3EP3B

Human adometdc d174n mutant with no putrescine bound
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
63
structure length
54
Chain Sequence
HFFEGTEKLLEVWFSSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQEAYVLSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Putrescine Activation of Human S-Adenosylmethionine Decarboxylase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords S-adenosylmethionine decarboxylase beta chain
total genus 6
structure length 54
sequence length 63
ec nomenclature ec 4.1.1.50: Adenosylmethionine decarboxylase.
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.360.50 Alpha Beta 2-Layer Sandwich Dihydrodipicolinate Reductase; domain 2 S-adenosylmethionine decarboxylase 3ep3B01
1I7MB 3DZ5B 1I79B 3EP3B 3EP7B 1I7CB 3EP6B 3DZ6B 3EP8B 3H0WB 3DZ3B 3H0VB 3EP5B 1I7BB 5TVOB 1JENB 3DZ4B 3EPAB 3DZ7B 3EPBB 3EP4B 1I72B 1MHMB 3DZ2B 3EP9B
chains in the Genus database with same CATH superfamily
3Q1LA 3E5RA 3KSDO 3E1KA 4L9RA 1I7CB 1P1FA 2VYVD 1C3VA 3DR3A 5J9GA 3PYLA 3B20A 3EC7A 4LRSB 4R3WA 4R5MA 3V5NA 4LSMA 4XR4A 1QKIA 2YYYA 4R5HA 4NHEA 4XQCA 5JY6A 3TV1A 1FF9A 3TUTA 1JKFA 3GPDG 3OA0A 1GL3A 1GPDG 4ZICA 3DZ6B 1H6AA 2VYNA 2DUUA 3TUXA 1NQOA 5TVOB 1MB4A 3V1YA 4F3YA 1CERA 1BRMA 3QW2A 4XB2A 1Q7GA 3E82A 3EUWA 2B4RO 1YL7A 4MVJF 3QV1A 4XQGA 4DPLA 5GZ1A 4AK1A 2PKQO 1RM5A 3LC2O 4MVJM 3WGZA 3EP3B 3PZRA 1S7CA 2X5KO 3GFGA 4XQEA 3WGOA 1PS8A 2G82A 3C1AA 5A06A 3IDSA 3QVTA 1Q2XA 3DZ7B 3IWCB 1DRVA 3E18A 3LC1O 3Q2IA 1NX6A 3Q11A 5CEFA 1YDWA 1ML3A 4DPKA 3PYXA 4MVJI 2B4TO 3Q2KA 1I33A 3TW3A 3H0VB 3DMTC 1P1HA 3RC7A 3LC7O 1NWHA 3DZ4B 5JW6A 3EP4B 1I72B 4KOAA 2FPNA 2AXQA 4II7A 3QVXA 1RM0A 4XRGA 3ZCXA 1DC3A 1VC2A 1PU2A 4TVBA 3WGYA 1F06A 3NT4A 1DC4A 3PFWO 1TA4A 1VKOA 1YS4A 4MKXA 1TB4A 1TLTA 5JYFA 1I7BB 4XB1A 3BTSA 2I5PO 5GZ3A 2NVWA 1EBFA 3Q0EA 3CPSA 3B1KA 5A03A 1LA2A 1VM6A 2EP7A 2R00A 3F4LA 1H94A 3ZJXA 4MVJG 1EVJA 2CVOA 4GQAA 1MC4A 3PWKA 1H9AA 2GLXA 3HJAA 2PKQP 1PR3A 3CEAA 4GMGA 4YWJA 3EP7B 1P1IA 3EP6B 1DIHA 3ZDFA 1H6DA 3QVSA 3K73O 4PG4A 2R00C 3ABIA 4JN6B 1EBUA 4MVJE 4O59O 4O89A 1QXSA 4EW6A 1RM4A 3PYMA 3M2TA 3U3XA 3OA2A 1NWCA 3H9EO 4MVJD 5C7IO 1I32A 3V2UA 4HADA 3HNPA 1P1JA 1U1IA 3NT2A 3PQVA 3EP8B 3H0WB 2GZ1A 2GZ3A 3OQBA 4R54A 2I3AA 1NPTO 3C8MA 1T4BA 3EPAB 3O9ZA 2Q22A 4R51A 1LC0A 4R41A 5AQ1A 4IQ8A 4XQ9A 1XYGA 3RVDA 1DC6A 4IQ0A 4H3VA 2PKRA 4MINA 2HO5A 3IJPA 2HJSA 2EJWA 2D2IA 3VAZA 3PWSA 1CRWG 2O4UX 1DSSG 2Q49A 4ZHSA 2X0NA 1XEAA 4DIBA 1TVEA 5T73A 2VYND 1JKIA 1A7KA 1P9LA 3CIFA 5A04A 1B7GO 3QVWA 2DBVO 1UYJA 1T4DA 1NQ5A 1J0XO 3MOIA 1DPGA 3IP3A 3KV3O 1ZH8A 3INGA 3KGDA 4MIOA 4MJLA 1PQUA 3KSZO 1SZJG 2VYVA 3EZYA 3K2BA 4MVJA 3FHLA 3BTUA 5C7OO 4MKZA 3IWBB 5M6DA 3RC9A 2DAPA 2EP5A 5KVQA 3LVFO 4R3NA 3BTVA 1H6CA 5JYAA 1NVMB 3KUXA 4R4JA 3E9MA 4WNIA 4PLPA 1DC5A 1RYDA 1NQAO 2NQTA 2DC1A 1H9BA 5KVSA 4MIYA 1E7MA 3CINA 3K9QO 3MZ0A 4MVJH 1JN0A 3EPBB 4GPD1 2GZ2A 2BHLA 4QX6A 1E77A 2Q4EA 3DZ5B 4O8JA 3OHSX 3GNQA 1RM3A 1I79B 3DMTA 1H2HA 1E5QA 5EIOA 1H6BA 3DO5A 3QY9A 4PG7A 4FB5A 4Z0HO 3E6AA 3MTJA 2QZ9A 3I23A 4BOYA 1ARZA 1QMHA 1H93A 4N54A 3JSAA 1J5PA 3DAPA 1IHYA 1OBFO 4WOJA 5AVOA 1ZNQO 3STHA 1VSUA 1YL6A 3NTRA 1GYPA 2DPGA 1GCUA 2H63A 3WBBA 3NTQA 4DPMA 3WYCA 4L8VA 3BIOA 4PG5A 1U8FO 1QMIA 2POQX 4WNCA 4HKTA 1GADO 5A05A 1E5LA 3DB2A 5C7LO 1JENB 3VOSA 2O48X 3UW3A 1RYEA 3DOCA 4PG8A 1GAEO 3GDOA 3WYBA 5EINA 1DRUA 4LGVA 3DZ2B 5EESA 4LRTB 5BNTA 1HDGO 2CZCA 3FD8A 3L4SO 3UUWA 4DBVO 1NBOA 5A02A 3PZBA 1GD1O 5DDIP 3RCBA 3L0DA 1LC3A 1OFGA 5GZ6A 1OZAA 2P2SA 4INAA 2I3GA 4PG6A 4YDRA 3HSKA 1DBVO 2G17A 3L6OO 3B1JA 3EVNA 3DTYA 1CF2O 1P1KA 4K9DA 1YL5A 5EERA 3RBVA 2BH9A 3RC1A 2HKIA 3NT5A 3TZ6A 3WBFA 3WB9A 1YWGO 3IWDB 1MHMB 2X5JO 2XF8A 4P8RA 1K3TA 3HXLA 5JYEA 3DBVO 1I7MB 2IXBA 1GYQA 4O63O 2IXAA 2OZPA 3NTOA 2GD1O 1DRWA 4GMFA 3DZ3B 3HQ4O 3EP5B 1DAPA 3CMCO 3RC2A 1IHXA 1VKNA 2YV3A 1PQPA 4RL6A 1E7YA 4MIEA 4CLQA 2PH5A 2GYYA 4MVJP 3WGQA 1VSVA 1GR0A 3EP9B
chains in the Genus database with same CATH topology
1I7MB 3DZ5B 1VR7A 3DZ3A 3H0VA 2IIIA 1TLUA 1JL0A 3DZ2A 1I79B 3EP3B 3EP5A 3EP6A 3EP7B 1MSVA 1I7CB 3H0WA 3EP6B 1JENA 3DZ5A 3DZ6B 5TVOA 3EP8B 3H0WB 1TMIA 3DZ3B 3H0VB 3DZ7A 3EP5B 3EP3A 3DZ4A 3EP7A 1I7BB 1MHMA 5TVOB 3EP4A 1JENB 3DZ4B 3EPAB 1I7CA 3DZ7B 1I7MA 3EPAA 1I7BA 3EP9A 3EPBB 3EP4B 1I72B 1I79A 3EPBA 1I72A 1MHMB 3DZ6A 3DZ2B 3EP9B 3EP8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I7M B;  3DZ5 B;  1I79 B;  3EP3 B;  3EP7 B;  1I7C B;  3EP6 B;  3DZ6 B;  3EP8 B;  3H0W B;  3DZ3 B;  3H0V B;  3EP5 B;  1I7B B;  5TVO B;  1JEN B;  3DZ4 B;  3EPA B;  3DZ7 B;  3EPB B;  3EP4 B;  1I72 B;  1MHM B;  3DZ2 B;  3EP9 B; 
#chains in the Genus database with same CATH topology
 3Q1L A;  3E5R A;  3KSD O;  3E1K A;  4L9R A;  1I7C B;  1P1F A;  2VYV D;  1C3V A;  3DR3 A;  5J9G A;  3PYL A;  3B20 A;  3EC7 A;  4LRS B;  4R3W A;  4R5M A;  3V5N A;  4LSM A;  4XR4 A;  1QKI A;  2YYY A;  4R5H A;  4NHE A;  4XQC A;  5JY6 A;  3TV1 A;  1FF9 A;  3TUT A;  1JKF A;  3GPD G;  3OA0 A;  1GL3 A;  1GPD G;  4ZIC A;  3DZ6 B;  1H6A A;  2VYN A;  2DUU A;  3TUX A;  1NQO A;  5TVO B;  1MB4 A;  3V1Y A;  4F3Y A;  1CER A;  1BRM A;  3QW2 A;  4XB2 A;  1Q7G A;  3E82 A;  3EUW A;  2B4R O;  1YL7 A;  4MVJ F;  3QV1 A;  4XQG A;  4DPL A;  5GZ1 A;  4AK1 A;  2PKQ O;  1RM5 A;  3LC2 O;  4MVJ M;  3WGZ A;  3EP3 B;  3PZR A;  1S7C A;  2X5K O;  3GFG A;  4XQE A;  3WGO A;  1PS8 A;  2G82 A;  3C1A A;  5A06 A;  3IDS A;  3QVT A;  1Q2X A;  3DZ7 B;  3IWC B;  1DRV A;  3E18 A;  3LC1 O;  3Q2I A;  1NX6 A;  3Q11 A;  5CEF A;  1YDW A;  1ML3 A;  4DPK A;  3PYX A;  4MVJ I;  2B4T O;  3Q2K A;  1I33 A;  3TW3 A;  3H0V B;  3DMT C;  1P1H A;  3RC7 A;  3LC7 O;  1NWH A;  3DZ4 B;  5JW6 A;  3EP4 B;  1I72 B;  4KOA A;  2FPN A;  2AXQ A;  4II7 A;  3QVX A;  1RM0 A;  4XRG A;  3ZCX A;  1DC3 A;  1VC2 A;  1PU2 A;  4TVB A;  3WGY A;  1F06 A;  3NT4 A;  1DC4 A;  3PFW O;  1TA4 A;  1VKO A;  1YS4 A;  4MKX A;  1TB4 A;  1TLT A;  5JYF A;  1I7B B;  4XB1 A;  3BTS A;  2I5P O;  5GZ3 A;  2NVW A;  1EBF A;  3Q0E A;  3CPS A;  3B1K A;  5A03 A;  1LA2 A;  1VM6 A;  2EP7 A;  2R00 A;  3F4L A;  1H94 A;  3ZJX A;  4MVJ G;  1EVJ A;  2CVO A;  4GQA A;  1MC4 A;  3PWK A;  1H9A A;  2GLX A;  3HJA A;  2PKQ P;  1PR3 A;  3CEA A;  4GMG A;  4YWJ A;  3EP7 B;  1P1I A;  3EP6 B;  1DIH A;  3ZDF A;  1H6D A;  3QVS A;  3K73 O;  4PG4 A;  2R00 C;  3ABI A;  4JN6 B;  1EBU A;  4MVJ E;  4O59 O;  4O89 A;  1QXS A;  4EW6 A;  1RM4 A;  3PYM A;  3M2T A;  3U3X A;  3OA2 A;  1NWC A;  3H9E O;  4MVJ D;  5C7I O;  1I32 A;  3V2U A;  4HAD A;  3HNP A;  1P1J A;  1U1I A;  3NT2 A;  3PQV A;  3EP8 B;  3H0W B;  2GZ1 A;  2GZ3 A;  3OQB A;  4R54 A;  2I3A A;  1NPT O;  3C8M A;  1T4B A;  3EPA B;  3O9Z A;  2Q22 A;  4R51 A;  1LC0 A;  4R41 A;  5AQ1 A;  4IQ8 A;  4XQ9 A;  1XYG A;  3RVD A;  1DC6 A;  4IQ0 A;  4H3V A;  2PKR A;  4MIN A;  2HO5 A;  3IJP A;  2HJS A;  2EJW A;  2D2I A;  3VAZ A;  3PWS A;  1CRW G;  2O4U X;  1DSS G;  2Q49 A;  4ZHS A;  2X0N A;  1XEA A;  4DIB A;  1TVE A;  5T73 A;  2VYN D;  1JKI A;  1A7K A;  1P9L A;  3CIF A;  5A04 A;  1B7G O;  3QVW A;  2DBV O;  1UYJ A;  1T4D A;  1NQ5 A;  1J0X O;  3MOI A;  1DPG A;  3IP3 A;  3KV3 O;  1ZH8 A;  3ING A;  3KGD A;  4MIO A;  4MJL A;  1PQU A;  3KSZ O;  1SZJ G;  2VYV A;  3EZY A;  3K2B A;  4MVJ A;  3FHL A;  3BTU A;  5C7O O;  4MKZ A;  3IWB B;  5M6D A;  3RC9 A;  2DAP A;  2EP5 A;  5KVQ A;  3LVF O;  4R3N A;  3BTV A;  1H6C A;  5JYA A;  1NVM B;  3KUX A;  4R4J A;  3E9M A;  4WNI A;  4PLP A;  1DC5 A;  1RYD A;  1NQA O;  2NQT A;  2DC1 A;  1H9B A;  5KVS A;  4MIY A;  1E7M A;  3CIN A;  3K9Q O;  3MZ0 A;  4MVJ H;  1JN0 A;  3EPB B;  4GPD 1;  2GZ2 A;  2BHL A;  4QX6 A;  1E77 A;  2Q4E A;  3DZ5 B;  4O8J A;  3OHS X;  3GNQ A;  1RM3 A;  1I79 B;  3DMT A;  1H2H A;  1E5Q A;  5EIO A;  1H6B A;  3DO5 A;  3QY9 A;  4PG7 A;  4FB5 A;  4Z0H O;  3E6A A;  3MTJ A;  2QZ9 A;  3I23 A;  4BOY A;  1ARZ A;  1QMH A;  1H93 A;  4N54 A;  3JSA A;  1J5P A;  3DAP A;  1IHY A;  1OBF O;  4WOJ A;  5AVO A;  1ZNQ O;  3STH A;  1VSU A;  1YL6 A;  3NTR A;  1GYP A;  2DPG A;  1GCU A;  2H63 A;  3WBB A;  3NTQ A;  4DPM A;  3WYC A;  4L8V A;  3BIO A;  4PG5 A;  1U8F O;  1QMI A;  2POQ X;  4WNC A;  4HKT A;  1GAD O;  5A05 A;  1E5L A;  3DB2 A;  5C7L O;  1JEN B;  3VOS A;  2O48 X;  3UW3 A;  1RYE A;  3DOC A;  4PG8 A;  1GAE O;  3GDO A;  3WYB A;  5EIN A;  1DRU A;  4LGV A;  3DZ2 B;  5EES A;  4LRT B;  5BNT A;  1HDG O;  2CZC A;  3FD8 A;  3L4S O;  3UUW A;  4DBV O;  1NBO A;  5A02 A;  3PZB A;  1GD1 O;  5DDI P;  3RCB A;  3L0D A;  1LC3 A;  1OFG A;  5GZ6 A;  1OZA A;  2P2S A;  4INA A;  2I3G A;  4PG6 A;  4YDR A;  3HSK A;  1DBV O;  2G17 A;  3L6O O;  3B1J A;  3EVN A;  3DTY A;  1CF2 O;  1P1K A;  4K9D A;  1YL5 A;  5EER A;  3RBV A;  2BH9 A;  3RC1 A;  2HKI A;  3NT5 A;  3TZ6 A;  3WBF A;  3WB9 A;  1YWG O;  3IWD B;  1MHM B;  2X5J O;  2XF8 A;  4P8R A;  1K3T A;  3HXL A;  5JYE A;  3DBV O;  1I7M B;  2IXB A;  1GYQ A;  4O63 O;  2IXA A;  2OZP A;  3NTO A;  2GD1 O;  1DRW A;  4GMF A;  3DZ3 B;  3HQ4 O;  3EP5 B;  1DAP A;  3CMC O;  3RC2 A;  1IHX A;  1VKN A;  2YV3 A;  1PQP A;  4RL6 A;  1E7Y A;  4MIE A;  4CLQ A;  2PH5 A;  2GYY A;  4MVJ P;  3WGQ A;  1VSV A;  1GR0 A;  3EP9 B; 
#chains in the Genus database with same CATH homology
 1I7M B;  3DZ5 B;  1VR7 A;  3DZ3 A;  3H0V A;  2III A;  1TLU A;  1JL0 A;  3DZ2 A;  1I79 B;  3EP3 B;  3EP5 A;  3EP6 A;  3EP7 B;  1MSV A;  1I7C B;  3H0W A;  3EP6 B;  1JEN A;  3DZ5 A;  3DZ6 B;  5TVO A;  3EP8 B;  3H0W B;  1TMI A;  3DZ3 B;  3H0V B;  3DZ7 A;  3EP5 B;  3EP3 A;  3DZ4 A;  3EP7 A;  1I7B B;  1MHM A;  5TVO B;  3EP4 A;  1JEN B;  3DZ4 B;  3EPA B;  1I7C A;  3DZ7 B;  1I7M A;  3EPA A;  1I7B A;  3EP9 A;  3EPB B;  3EP4 B;  1I72 B;  1I79 A;  3EPB A;  1I72 A;  1MHM B;  3DZ6 A;  3DZ2 B;  3EP9 B;  3EP8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...