3EPEA

Crystal structure of the glur4 ligand-binding domain in complex with glutamate
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
TVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKGTPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGEC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating AMPA receptor activation and cleft closure across subunits: crystal structures of the GluR4 ligand-binding domain in complex with full and partial agonists
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
molecule keywords Glutamate receptor 4,Glutamate receptor
total genus 80
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-09-29
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3epeA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3epeA02
1Y4TA 4GRKA 3CIJA 4R74A 3MQ9A 2O7UA 2X7PA 4F2OA 4EF1A 4HW8A 1HSJA 2G93A 1QUJA 4XKNA 1BIYA 2THIA 4O3AA 4UACA 3TYHA 4P11A 5AA4B 2QPQA 1N04A 4YICA 3Q26A 5I57B 4PP0A 1BTJA 1EZOA 4XKPA 5DT6A 3W9WA 4WEDA 2HFBA 4QFNA 4NF4A 4NWDA 1P1UA 2AL4A 1VSOA 1N7XA 2O68A 2VP1A 3BFTA 3I3VA 3O66A 3O9PA 4KHZE 3A3CA 4PFUA 3PMXA 5DTBA 5HBCA 5TPAA 1DTZA 4HCYA 3B6TA 1R9LA 3UN6A 4IO2A 3M8UA 5FHNA 2XHDA 5H8HA 3CG1A 3PD8A 2CMOA 3USDA 3FVKA 1B7UA 3ILUB 3GZGA 4Q0CA 4EQBA 1XS5A 2AYSA 1Z7ME 2DP8A 2DE2A 2XXRA 3MZ9A 4KD5A 3IORA 1AMFA 1DPEA 3P7IA 2HZLA 4POWA 2QSXA 3TTLA 3S9NC 3RQTA 3WAFA 4LZ5A 3VLVA 1H76A 2FA7A 4YAHX 1L5TA 1SI1A 3G3HA 3KSJA 4MBPA 4U4XA 1FTLA 1JW5A 1OLAA 1QKBA 4O3BA 3TAJA 1SBPA 2Q88A 2RKMA 1FTKA 2P1SA 2Y84A 4LZ7A 3K1NA 4Q30B 5I84A 3H6WA 5EYFA 1NNTA 3H7MA 3SEUA 1JNFA 4EXLA 1JW1A 1A8FA 4R2FA 4QFLA 2OLBA 3KOSA 1I6BA 3HN0A 1LAGE 1GVCA 3TCHA 3HCQA 3OENA 5A5XA 1S7YA 1N0TA 4QSEA 3WAEA 1MPBA 5CM6A 3MUQA 4F22A 1MM6A 3M3LA 3FJGA 1VFDA 2DXRA 4OEUA 4ZZEA 1NNFA 1PC3A 3QUJA 4JDFA 4ND9A 2Z22A 3KJ7A 3RGYA 3TQWA 3QSLA 1XHYA 2NWJA 1B7ZA 3ZKLA 2UVIA 1GTKA 1PB7A 1PB8A 3JV9A 5H8QB 5HPQA 3MPKA 2I3VA 2ONSA 2DVZA 5EHMA 2B3BA 4ECFA 1Q35A 2GRVA 2I3WA 4G77A 4G68A 4OVJA 1MH3A 2O6AA 4MLVA 4TQUQ 5AA1A 1LBCA 2XXYA 2P2AA 4U1ZA 1FTJA 1ZKBA 2BJJX 4XKRA 4ZECA 2HZKA 3PUVE 3MVXA 3MP1A 4NEDA 4QSCA 3KN3A 1QUKA 1OMPA 1WODA 2O51A 4EUOA 4YB6A 1FW0A 4AQ4A 2DXYA 2OWTA 3FVOA 4BDOA 1BLFA 4RXLA 3K00A 4TOZA 5FTHA 4PQJA 1D4NA 5CMKA 4GXSB 1ZLQA 4G2ZA 4F1YA 1HSEA 5I2NA 4IO4A 1SDXA 1URSA 3Q29A 1B0LA 2AIXA 4NF6B 4QF9A 1LB9A 1MPCA 3G3JA 3HSTA 1Q1KA 3KJTA 1FQAA 1UTBB 1PBPA 3MZBA 4IY5A 5AA2D 3EHSA 5DVIA 4K3FA 3H03A 4M4GA 3R6UA 3UK4A 2H4IA 4NWCA 1MDP1 3K0VA 3KGCA 3F11A 2M8CA 2GFEA 3U92A 3H3GA 3TEPA 3CI8A 3FXQA 2I4BA 3PPRA 5TPAB 3FXUA 4R6YA 5KDTA 3CFLA 3CVGA 4OQOA 2RCAA 4C0RA 3PUXE 4I62A 4F3GA 3MPLA 3T9XB 3TTMA 2FYIA 2OBGA 2WKYA 3GXAA 4F1UA 3TCGA 3ZKKA 3RT8A 3HHFA 2ZMBA 1SW4A 3CG3A 5I58A 4OETA 3ZS6A 1KWHA 2NOOA 2DWAA 4OERA 3H6UA 1XVYA 4ZDMA 4M1VA 4FATA 4DLDA 1Y3QA 4ELRA 2PMSA 2UVGA 4DZ1A 1EZ9A 5I57A 1O63A 1IXGA 1M5EA 3RTWB 3BFUA 4GOTA 2I0CA 4JXIA 1MY1A 1AOVA 4N6PA 4EF2A 3VFJA 1ZU0A 1N84A 1LFHA 3S9EA 3O29A 2DOJA 4BDNA 1A99A 1IEJA 3IB1A 4R9GA 1MY3A 1SW1A 1B9JA 3MW0A 4XXUA 4DE8A 5CBRA 2D5WA 4JBZA 4ZEIA 3VXBA 4ELPA 1NNPA 1I6QA 4GIZA 1VFEA 3PMVA 2XXXA 3PUZE 4KQPA 1D9YA 1B5IA 2ANJA 4EQ7A 5BUUA 3IO6A 4H5GA 1XT8A 4H65A 2F8DA 3BBRA 1M5BA 2ABHA 4C1TA 1ZIUA 1SQYA 1ZJLA 2HXWA 4NF5B 1FQFA 4E0XA 4Z7EA 4QHQA 5CMMA 2Z23A 2I48A 1NH8A 1I69A 3OO6A 2UYEA 4OFOA 3LUYA 4POXA 4ZEFA 1MXYA 1USYE 2F7BA 1QULA 3VDFA 4JSOA 1JEVA 2Y7PA 1S50A 4BLAA 1B52A 5CMBA 4RY1A 2Q89A 3JYRA 3FGSA 2REJA 2ZYMA 1QW0A 3PUWE 4G8HA 3TMGA 4RNSA 1N76A 1RYXA 3PGFA 3TKDA 3PUYE 5I2NB 4LUBA 2O7IA 2XXHA 4YMBA 2DS9A 3O97A 3HHGA 5H8NB 3T93B 2I58A 1LCFA 4LQ5A 3TODA 3ODBA 1Y9UA 5J1DA 1ELJA 1H45A 2R71A 2HQ0A 3N5LA 3PPNA 3FATA 1IXHA 1LLSA 5JTYB 3RNNA 2E0SA 1B3FA 1OQHA 2V3UA 2F34A 3N6TA 4LQ2A 4Q8RA 2DWIA 3FJMA 4H0WA 2Y7IA 3PPQA 1D9VA 5KDTB 1T0KA 3OXNA 1YAEA 3O2AA 1USYH 4KR5A 1M5CA 2PYYA 2QMXA 3FUZA 4KYEA 4QFOA 1MXUA 2F35A 1R9QA 3DM0A 5DEXB 3A3UA 1TFAA 3TELA 3VLWA 5FHMA 1NKXA 1Y20A 2UVJA 1B3LA 1GR2A 2X26A 3PD9A 5ITOA 3TTRA 3KBRA 4OESA 1XOCA 3SEWA 2VD3A 3H06B 3UA8A 1N3XA 2XXWA 1N3WA 3TDJA 3EN3A 3H4ZA 2XX9A 1OLCA 1RKMA 1MPDA 3MVWA 4G4PA 3OEMA 3OO8A 3MBPA 5A5XB 1OIBA 2A5SA 2F5XA 3Q28A 3QK6A 2R6GE 3U8QA 4LP2B 2QL3A 4BDRA 2V84A 1DSNA 4X48A 3MWBA 2XX8A 1A8EA 4GWOA 5FHOA 4ZE8A 3V5AA 3N94A 1N7WA 1Y3PA 2UVHA 4U21A 2OK2A 5ICQA 1P1WA 1MG1A 3GBBA 5DVFA 3G3IA 3IK6B 4IO3A 1MQDA 1MS7A 3IOWA 4YU0A 3O28A 5H8QA 3VE1B 1FQDA 2ZNSA 3B7DA 4H1XA 3DP8A 3LBSA 2XXTA 4YKPA 2XXPA 1MXWA 2VD2A 4YZZA 1GV8A 1LSTA 4IO7A 1A7LA 3HV1A 3K1PA 2I0BA 4F2QA 2GH9A 3M3KA 3VLUA 1WVJA 4FEDA 2H5YA 4R72A 4RJZA 5L9OA 1SVXB 1CE2A 1BP5A 4RK2A 3HO7A 3L6GA 3SDFA 1OQGA 3FXRA 3RY3A 4GXAA 1IXIA 1NMUA 1ZBMA 2B65A 2XD3A 1P1NA 3LR1A 1R6ZA 3OOAA 2H9BA 4KPTA 2PVUA 4PETA 5EHSA 1YPNA 4H8JA 2Y7KA 3I6VA 3PPPA 3DLNA 4QRZA 4LVQA 4R6HA 5DYHA 3ILTB 5CMCA 5TP9B 3TCFA 2CZLA 1UIUA 4C1UA 3QXMA 4MLQA 1H3DA 3EF7A 3LSLA 1FCKA 1M5FA 1M5DA 1O64A 4OENA 2OZZA 2Q8JA 3CSGA 1LFIA 4LZ8A 5FTIA 4BDMA 4Q5TA 4OZ9A 3VXCA 4GFRA 4TLMB 1LAFE 1TXFA 3MP6A 4UA8A 1AL3A 3U1OA 3C36A 2ALUA 3QUFA 5H8HB 3U94A 5I2KA 2H98A 4GLIA 3IJXB 2F7CA 1A55A 1MXVA 4MF3A 4GQOA 5H8FA 4PFTA 3DP6A 1AH5A 4L17A 3PMWA 2Y7RA 3TQLA 4U22A 5B7DA 3OO7A 3V89B 4F18A 3CFZA 1B4ZA 1ATGA 3FIRA 2DE4A 3K6UA 3K02A 3OSRA 1B1HA 2F97A 4FECA 2X7QA 4WEPA 4YB7A 3OO9A 3KEIA 5L9SA 1B51A 2RF1A 2UYFA 3DELB 1NNKA 4DCYA 1DOTA 3KSXA 1B5JA 1JVXA 4OFLA 2OCUA 1XVXA 4PE5B 2UXAA 4IGTA 3SEYA 3VVDA 5I59A 4F3BA 1JEUA 3L6HA 1Y1MA 4R9FA 4U23A 5K2YA 4JWYA 4N07A 1MRPA 2D21A 2VOZA 3O6IA 4ESXA 1MH4A 1DTGA 3N26A 4PFWA 5TU0A 2V93A 2I6EA 4I1DA 1TT1A 1LFGA 4AB6A 2HCAA 1NH7A 3CFXA 4G8MA 3RUMA 2F6GA 3T9HB 1B3GA 1SD3A 1Y1ZA 4R73A 3C31A 4ISUA 5CRYA 4R75A 2DYXA 4F3SA 4DXBA 2O84X 1MXXA 2F78A 5LOMA 2H99A 1UQWA 4E0WA 4LATA 1IUDA 1DPPA 2YJPA 2P0SA 3SKPA 1LAXA 4THIA 1B2HA 3FVGA 2QS3A 4MFIA 4LA9A 4NF6A 3KN7A 5ELVA 3VVFA 5AA4A 4ZE9A 3UP9A 1B4HA 4HCWA 5K2XA 4OYVA 1CB6A 4I9DA 3FD3A 4EQ9A 3QIMA 3DP4A 4H8IA 4IO5A 4U2RA 4XKQA 4RYAA 1US5A 4EDPA 3E3KA 3SETA 1PB9A 2DWJA 2QRYA 3MJNA 1B3HA 1PEBA 2Z8EA 3RT6B 1II5A 1FQCA 4MH5A 4Z0IA 3MAMA 3OSQA 3U93A 3RPWA 1LCTA 4XIGQ 4FAJA 2QS2A 3Q25A 4G68B 1B3EA 2DE3A 3T96B 3K6VA 1LB8A 2ZYOA 3FV1A 5ICTA 5KCJA 2ZNTA 3RTFB 2V3QA 2YLNA 4KCDA 1A40A 1NFTA 1XC1A 2RC9A 3CSBA 3UIFA 2ZYKA 3JZJA 4RPNA 2R9JA 2NXOA 2E1SA 2HAUA 2O1LA 3BKIB 3G3KA 3MVYA 3RN8A 4DCXA 2QS1A 2RC8A 4QFPA 4YKIA 4JSDA 5I2KB 3EHTA 2OJTA 4G68C 5BWJA 5I59B 1IIWA 3CR9A 3KN8A 3EHUA 3M3FA 3G7WA 4HTGA 5JEIA 3O6HA 1LBBA 1MQIA 2LAOA 4N13A 3S4UA 2REGA 3T66A 1B58A 1VR5A 3E4RA 3PPOA 1P99A 1MDQA 1SI0A 1A54A 4ZS9A 1OVBA 3R7XA 5I56B 1S9TA 1IZ1A 2A5TA 1SW5A 4NE4A 1QVSA 4OWDA 4ZEDA 4KI0E 5IAIA 5DVJA 3IJOB 3C34A 3GBAA 3EQ1A 3KFMA 3W9VA 1FTMA 2KLFA 2AL5A 4JWXA 1B5HA 4NF5A 5AA2B 4ZEKA 1JVYA 5AE4A 5B70A 3V8XB 4FJPA 2XXQA 4FE8A 2XX7A 1OVTA 5AA2A 4H67A 2QMWA 4HS7A 3D4GA 1UIVA 2F7AA 1H44A 4G8NA 4R2BA 3FASA 3PU5A 1MY0A 3KZGA 3V83A 1EZPA 3H6VA 3IAZA 2NUVA 4ELOA 2PBWA 3G3FA 3ONMA 1TFDA 4DDDA 2PX1A 2Y7WA 2ESNA 2FNCA 3D4CA 3LSWA 3CRBA 3Q27A 1EH3A 1ZTYA 2VHAA 2Q2AA 2YPNA 3C33A 2V25A 4IO6A 3UORA 4OHNA 3S9LC 5CI5A 3SERA 3IR1A 2G29A 1GGGA 4QSDA 3U72A 4NF4B 1MQJA 1R1NA 4WKMA 2F36A 3K6WA 2GHBA 1B6HA 3GLBA 1HSLA 1B1XA 1JQFA 1RYOA 1LAHE 1P1OA 3A09A 3FZVA 4H6DA 5F7VA 1IITA 5H8SA 5ITPA 4NMYA 4F3PA 1B46A 2A5TB 1Y3NA 2IA4A 3R26A 4U1OA 3W15C 2V3TA 5TP9A 3QYTA 4IB2A 3UGWA 4BDLA 5HM4B 5JK4A 2HEUA 3TFLA 1AIVA 2GHAA 4FEBA 5I58B 3E13X 1MQHA 2Q9TA 5KZTA 4KYDA 4P0IA 4OEVA 2F6PA 4IGRA 3IOUA 4X1BA 1J1NA 4GF8A 3IOVA 1URDA 3H6TA 4IY6A 4RK9A 3EPEA 3LC8A 3LSFB 5F1QA 2IEEA 4OTEA 3TZAA 2H25A 1YCJA 4NF8B 3FVNA 1YTVA 1Y4CA 2ZXTA 4P0GA 3K2DA 4R6KA 5M2VA 1Z7NE 3IB2A 1URGA 4WXJA 4EXKA 5ISUA 2B3FA 1FQEA 3B6WA 3VVEA 5CBSA 1SYHA 1MY4A 4O3CA 2XD2A 4JWOA 1TWYA 2Z8FA 3IOTA 5KCJB 4GVOA 1SW2A 1ZMGA 1B40A 1SYIA 2XXUA 2PT2A 2QS4A 1UTBA 3N6UA 3C4MA 3B6QA 1JW4A 4TLLB 3IB0A 4I8CA 3I5OA 2DQVA 3T22A 3TPAA 2PT1A 3IL1B 3TTNA 5CC2A 3IX1A 1EU8A 3IO4A 3K1MA 4U4SA 1B05A 4JB7A 4BDQA 3O6GA 3S9MC 5AA3A 1IQ7A 1F9BA 1PDAA 1I6AA 1QUIA 3OMBA 4DIGA 2I4CA 2RCBA 3KOTA 3KG2A 4YKJA 2ZNUA 3RLFE 3S2VA 5H8NA 2D3IA 5JTYA 4GL0A 1MY2A 2ZYNA 3MC2A 3SEXA 2O1MA 3THIA 3VV5A 1QJMA 2VGQA 4YB5A 1UTHA 3K6XA 1MXZA 4OFJA 1MM7A 4FORA 4XTCQ 1PBQA 1BKAA 4YKKA 3K4UA 3E9XA 3AXFA 2DSFA 2QJEA 3C9HA 3G3GA 3LSXA 4KYSA 4ONYA 3T9VA 4OMBA 1UTHB 2OWSA 2Q2CA 1LGBC 1US4A 4X1DA 2XXIA 2DVCA 4DXUA 1D3KA 3OELA 1POY1 3PV0E 4RPOA 5H8FB 1B32A 1POTA 3ZSFA 1IXCA 3OD7A 2Z8DA 5DEXA 3SESA 5IKBA 1FQBA 1ANFA 1FTOA 4QFKA 4ZZAA 3SEVA 1B7HA 3HPIA 3ECRA 3MVZA 4NTLA 4ELQA 4H5FA 4RA1A 4ZEBA 4OXVA 4GL8A 2RC7A 3QAXA 4LONB 2RINA 1O7TA 2DWHA 4YMAA 1NL5A 1H43A 5L8DA 4FIMA 2XXVA 2I49A 4GD5A 3FJ7A 4F31B 5I56A 4F29A 2HAVA 5L9MA 3C32A 4F39A 4ESWA 3TUSA 3K01A 3C35A 1WDNA 4F1VA 1MQGA 1B0HA 1QKAA 1DMBA 2ONKE 3MP8A 3MZ1A 3T9UA 4AB5A 3FV2A 1JETA 2O69A 1VE4A 3OEKA 4KFQA 4KCCA 4NF8A 4DXCA 4PFYA 2NVUB 4F19A 2W7YA 4X9TA 2ONRA 1P1QA 3TTKA
chains in the Genus database with same CATH superfamily
1BIYA 4O3AA 3FXBA 4GX4A 4NF4A 5H8HB 1Q9DA 4KHZE 3O9PA 3V89B 5H8HA 4NHBA 5I7IA 3FVKA 1B7UA 1YYZA 4KD5A 4P47A 1AMFA 3S9NC 2HPGA 2HZLA 2QSXA 3RQTA 4LZ5A 1KA1A 1IMCA 3KSJA 1FTLA 1OLAA 2RKMA 4PFIA 2P1SA 3H6WA 5EYFA 3SEUA 1A8FA 4R2FA 3KOSA 1GVCA 3OENA 5A5XA 1NNFA 3TQWA 2Z22A 5H8QB 3MPKA 2FBPA 1Q35A 4OVJA 4G77A 4TQUQ 2BJJX 2HZKA 3MP1A 4MNCA 1QUKA 4AQ4A 2DXYA 4TOZA 4G2ZA 1B0LA 4NF6B 3G3JA 1MPCA 3MZBA 4UABA 3R6UA 2H4IA 1MDP1 3H3GA 5KDTA 5TPAB 4R6YA 3CFLA 1FPKA 4OQOA 4I62A 3MPLA 2FYIA 3TCGA 4NGUA 2DWAA 4OERA 4P1LA 3D1RA 2UVGA 4DZ1A 5I57A 4GOTA 1FRPA 4JXIA 1ZU0A 4OVSA 4XFEA 3IB1A 1MY3A 1SW1A 1B9JA 4DE8A 5CBRA 4JBZA 4ZEIA 3VXBA 1NNPA 3PMVA 2XXXA 4EQ7A 3IO6A 1ZIUA 1ZJLA 4NF5B 4PAFA 4I3EA 4OFOA 3LUYA 4ZEFA 2F7BA 1USYE 1S50A 1B52A 5CMBA 3JYRA 2CEXA 2P3VA 3TKDA 2B4MA 5DW8A 5I2NB 3HHGA 4MCOA 2I58A 1LCFA 3ODBA 4MAGA 3PPNA 1OQHA 3FJMA 2Y7IA 1T0KA 4KR5A 3O2AA 2PYYA 2QMXA 3FUZA 2F35A 1R9QA 3VLWA 3TELA 2UVJA 1XOCA 3SEWA 3EN3A 2XX9A 1OLCA 1IMFA 4G4PA 3OEMA 2A5SA 3U8QA 1DSNA 4ZE8A 4O7MA 5DVFA 1MQDA 4YU0A 2Q74A 1LBXA 3B7DA 4H1XA 1MXWA 4P8BA 1LSTA 4IO7A 1A7LA 4F2QA 3VLUA 4R72A 2H5YA 4RK2A 4IR8A 3L6GA 3SDFA 1OQGA 1IXIA 1ZBMA 2B65A 4PETA 1P1NA 2OX3A 3OOAA 4KPTA 5EHSA 4GX6A 2Y7KA 1NI9A 4LVQA 5TP9B 3TCFA 3QXMA 4MLQA 4LZ8A 1LFIA 4OZ9A 4GFRA 3U94A 5I2KA 4GQOA 4JVCA 4PFTA 2R8TA 1FBFA 4U22A 3OO7A 3CFZA 1ATGA 2F97A 4AS5A 1B51A 2UYFA 3DELB 4DCYA 4OFLA 3VVDA 1JEUA 3L6HA 4PDHA 2CZHA 1Y1MA 4R9FA 3BIGA 1MH4A 4PFWA 5TU0A 2HCAA 4G8MA 4R73A 5CRYA 4R75A 4DXBA 1FPGA 1MXXA 2O84X 5ET8A 4E0WA 4LATA 2YJPA 2P0SA 1B2HA 5AA4A 4NF6A 3VVFA 3KN7A 4ZE9A 4HCWA 5K2XA 3QIMA 4H8IA 4OVQA 3E78A 3SETA 4I40A 1D9QA 5F24A 4MH5A 2QS2A 3Q25A 4G68B 4H45A 5KCJA 2ZYOA 3RTFB 2YLNA 4KCDA 3CSBA 2ZYKA 3MVYA 3RN8A 4QFPA 4YKIA 3EHTA 2OJTA 5BWJA 3CR9A 3O6HA 1LBBA 3T66A 3PPOA 4OVTA 1IZ1A 2A5TA 4OWDA 4ZEDA 4OVRA 4KI0E 3EQ1A 2AL5A 4ZEKA 1JVYA 2XX7A 4O94A 5AA2A 3D4GA 3PU5A 3V83A 1EZPA 2Y7WA 2FNCA 5IM2A 1EH3A 3S9LC 2Q2AA 2YPNA 4IO6A 2XWOA 1HSLA 5F7VA 5ITPA 2A5TB 3W15C 3QYTA 4IB2A 3TFLA 1MQHA 4KYDA 1J1NA 3H6TA 3EPEA 3LSFB 4PTKA 5F1QA 4OTEA 3TZAA 4PFBA 2H25A 1YCJA 4P0GA 1YTVA 2ZXTA 4R6KA 3K2DA 5M2VA 3B6WA 4FBPA 1SYHA 4O3CA 2XD2A 1TWYA 2Z8FA 5IGAA 2F3DA 1B40A 1ZMGA 4TLLB 5AA4B 3C4MA 2PFYA 4I8CA 5CC2A 2DQVA 2PT1A 3IL1B 4U4SA 2XWVA 2WYPA 4JB7A 4BDQA 1QUIA 1PDAA 3OMBA 2I4CA 2RCBA 3KOTA 2ZNUA 5H8NA 3SEXA 4FORA 1INPA 4XTCQ 1BKAA 4YKKA 4Q8RA 3C9HA 4ONYA 3G3GA 5ET7A 5IZ3A 1US4A 4X1DA 1POTA 1IXCA 5DEXA 2Z8DA 2WX9A 1FQBA 1FTOA 4ZZAA 3HPIA 3MVZA 4ZEBA 4OXVA 3QAXA 1NL5A 1NUYA 5L8DA 4FIMA 3FJ7A 4F31B 1NUWA 3C32A 4F39A 4ESWA 1FPDA 1EYKA 4F19A 2W7YA 4X9TA 2ONRA 1Y4TA 3CIJA 4R74A 2O7UA 2X7PA 4HW8A 2G93A 1NV6A 2CEYA 2THIA 2QPQA 1N04A 1BTJA 5DT6A 2HFBA 3BIHA 5EQ8A 4QFNA 4NWDA 1VSOA 3O66A 4PFUA 5DTBA 5TPAA 3RPLA 3B6TA 3UN6A 5FHNA 3ILUB 5EYGA 1Z7ME 2XXRA 2MKZA 3IORA 1DPEA 3P7IA 4PC9A 1H76A 2FA7A 4P1EA 4U4XA 1QKBA 2XXKA 3TAJA 2Y84A 4LZ7A 1NNTA 1JW1A 2OLBA 1I6BA 1QGXA 3WAEA 1MPBA 1MM6A 3FJGA 1VFDA 2DXRA 4OEUA 1PC3A 3QUJA 4JDFA 4BDMA 2UVIA 4KXPA 4PF6A 2ONSA 2DVZA 3T1BA 4HXVA 4G68A 4MLVA 1YXIA 1FTJA 1ZKBA 4NEDA 3KN3A 1OMPA 4YB6A 1FW0A 2OWTA 3FVOA 4BDOA 1BLFA 4N4UA 5HPQA 5I2NA 1SDXA 1FQAA 1UTBB 5DVIA 4M4GA 4GBWA 2I4BA 3FXUA 4C0RA 3MSTA 3PUXE 4F3GA 2OBGA 2WKYA 3ZKKA 3CG3A 2NOOA 2QVUA 1XVYA 1Y3QA 2HXRA 4ELRA 4PAIA 3BFUA 1AOVA 4N6PA 1A99A 3RPLB 2D5WA 4ELPA 1I6QA 4GIZA 4KQPA 1D9YA 5BUUA 4H5GA 4H65A 1FPIA 2ABHA 2HXWA 4Z7EA 1FQFA 2I48A 1NH8A 3OO6A 1MXYA 3VDFA 1JEVA 2Y7PA 4RY1A 1QW0A 3TMGA 4RNSA 1N76A 3E79A 2KR0A 2KQZA 2O7IA 4LQ5A 3TODA 1Y9UA 5J1DA 3FATA 1LLSA 4GWXA 1B3FA 2DWIA 5KDTB 1D9VA 3SESA 1YAEA 3TTLA 1USYH 3MYUA 4KYEA 3A3UA 1TFAA 5ITOA 1NKXA 1GR2A 4C1UA 3UA8A 3KBRA 4OESA 3H06B 3H4ZA 4HE2A 1RKMA 1MPDA 1FPFA 2F5XA 4MIJA 4LP2B 4BDRA 2V84A 4X48A 4DI4B 2XX8A 4GWOA 3V5AA 3N94A 2UVHA 3CHGA 5H8QA 2ZNSA 3DP8A 1DBZA 1FJ6A 4MNPA 4GWWA 3HV1A 3M3KA 1WVJA 5L9OA 4MMPA 3RY3A 5IZZA 2PVUA 5DYHA 5EQ7A 1FCKA 1LBVA 1M5DA 1O64A 3PTYA 3CSGA 5FTIA 3VXCA 5I5PA 4UA8A 3U1OA 2ALUA 3IJXB 4MF3A 1A55A 1FBPA 3DP6A 4L17A 1B4ZA 3FIRA 3OSRA 2DE4A 3K6UA 3K02A 2X7QA 4YB7A 3KEIA 1BK4A 3KC1A 1DOTA 1EYIA 3KSXA 4PE5B 4IGTA 2FIXA 4U23A 5K2YA 4N07A 4ESXA 1DTGA 1FBHA 2CZKA 2I6EA 4I1DA 4N6KA 1NH7A 5LDZA 2WBBA 3C31A 4F3SA 2DYXA 5LOMA 2H99A 1IUDA 1DPPA 4THIA 4H46A 2QS3A 1LBZA 1CB6A 3FD3A 2JJKA 4XKQA 1NUZA 2QRYA 3T0JA 3RT6B 1II5A 3U93A 3T96B 3K6VA 2ZNTA 2V3QA 1XC1A 4RPNA 3JZJA 3G3KA 2QS1A 2RC8A 5I3SA 3KN8A 3EHUA 5JEIA 2FIEA 1B58A 3E4RA 1A54A 4ZS9A 1OVBA 1S9TA 4OVPA 5DVJA 3GBAA 5AA2B 4FJPA 2XXQA 1OVTA 4PFRA 2QMWA 4HS7A 2F7AA 4G8NA 3H6VA 4ELOA 2PBWA 4JVIA 4DDDA 3LSWA 3C33A 5CI5A 4NF4B 1LBYA 1FPJA 2F36A 1IMBA 1P1OA 4H6DA 1IITA 4NMYA 1B46A 1Y3NA 5KZTA 4P0IA 2F6PA 4RK9A 4X8RA 1Y4CA 2V4CA 1Z7NE 4N91A 4WXJA 2QS4A 1UTBA 3B6QA 1JW4A 3TPAA 3IB0A 3I5OA 1NUXA 4PGPA 1FPEA 4QXDA 5ET6A 4GWUA 3S9MC 5AA3A 4DIGA 4MHFA 3RLFE 4YKJA 5EQ9A 3S2VA 4GL0A 2ZYNA 3MC2A 2O1MA 1QJMA 3K6XA 1MM7A 3AXFA 3T9VA 1UTHB 4MX6A 2DVCA 4N81A 1POY1 4RPOA 5H8FB 1B32A 2OWZA 1B7HA 4NTLA 3U65A 4H5FA 4RA1A 4N15A 4YMAA 1K9YA 4MJOA 1FBGA 4F1VA 3MZ1A 1JETA 2O69A 4NF8A 4GWSA 4GRKA 3MQ9A 4EF1A 1HSJA 1NV3A 1FJ9A 4UACA 4P11A 4YICA 5I57B 4PP0A 1EZOA 4XKPA 3W9WA 4WEDA 4PGNA 1P1UA 2AL4A 3BFTA 2VP1A 3LUZA 3I3VA 5ESYA 3A3CA 3PMXA 1DTZA 4HCYA 1R9LA 4IO2A 4LN5A 3CG1A 3USDA 4FATA 4Q0CA 4EQBA 2DP8A 3MZ9A 4PAKA 4POWA 3VLVA 1SI1A 3G3HA 4MBPA 1JW5A 4O3BA 2Q88A 3K1NA 5I84A 3H7MA 4EXLA 4QFLA 1LAGE 3TCHA 1S7YA 4QSEA 5IZ1A 5CM6A 3M3LA 4ZZEA 2QVVA 1XHYA 2NWJA 1B7ZA 5EQAA 1PB7A 3JV9A 4OANA 5EHMA 4P9KA 4JVDA 1MH3A 2VT5A 2VPNA 4U1ZA 3MVXA 4QSCA 1WODA 2O51A 4EUOA 4RXLA 3K00A 4P56A 4PQJA 1D4NA 1ZLQA 4IO4A 3Q29A 2AIXA 1LB9A 1JP4A 3KJTA 5IAIA 1Q1KA 2Y5KA 1PBPA 4IY5A 3EHSA 3H03A 3UK4A 4NWCA 3TEPA 3K0VA 2XWKA 2M8CA 3F11A 5EYHA 3RT8A 1SW4A 4OETA 4DLDA 1EZ9A 1O63A 1IXGA 1M5EA 2I0CA 2PCRA 4EF2A 3VFJA 3S9EA 2DOJA 4R9GA 3MW0A 4XXUA 1VFEA 3PUZE 2ANJA 1XT8A 3KBZA 1SQYA 5CMMA 2Z23A 1I69A 2UYEA 4POXA 3FBPA 4JSOA 1K9ZA 4BLAA 4OA4A 2Q89A 3FGSA 2REJA 2ZYMA 4MNIA 3PGFA 3PUYE 4LUBA 2XXHA 2DS9A 3O97A 3T93B 5ET5A 1H45A 3N5LA 4AS4A 1IXHA 3RNNA 4O7IA 2F34A 4LQ2A 3PPQA 4MEVA 1M5CA 4QFOA 1MXUA 5DEXB 3PD9A 3U72A 3TTRA 4NAPA 1N3XA 1N3WA 3TDJA 3MVWA 3OO8A 5A5XB 3Q28A 3QK6A 2R6GE 2QL3A 3B50A 3MWBA 5J16A 4U21A 2OK2A 5ICQA 1MG1A 3GBBA 3G3IA 3IK6B 1NV2A 4IO3A 1MS7A 3O28A 3VE1B 1FQDA 2XXTA 4YKPA 2VD2A 3GYYA 4YZZA 2PFZA 2GH9A 4RJZA 2XA5A 1SVXB 1CE2A 1BP5A 3HFUA 3HO7A 3FXRA 4GXAA 4WEPA 2XD3A 3PPPA 3ILTB 5CMCA 1UIUA 3EF7A 3LSLA 1M5FA 5A5LA 4OENA 2OZZA 3B8BA 4TLMB 1TXFA 1AL3A 4GLIA 2DDKA 1MXVA 5H8FA 3PMWA 2Y7RA 4FECA 5L9SA 1FPLA 1B5JA 2OCUA 5I59A 3IFCA 4JWYA 2VOZA 3N26A 1TT1A 3RUMA 3T9HB 2F6GA 1B3GA 1FSAA 1Y1ZA 4ISUA 1UQWA 3SKPA 2VPOA 4I3YA 3FVGA 4I9DA 4EQ9A 1KZ8A 3DP4A 4IO5A 4U2RA 4RYAA 3E3KA 1PB9A 1PEBA 2Z8EA 1FQCA 4Z0IA 3RPWA 4FAJA 4NQ8A 1B3EA 1SPIA 5ICTA 1NFTA 3UIFA 2NXOA 2O1LA 1LBWA 1IMEA 1RDZA 4JSDA 5I2KB 4N6DA 1IIWA 3M3FA 4HTGA 2LAOA 3S4UA 1MDQA 1SI0A 5I56B 3R7XA 4NE4A 3KFMA 3W9VA 1FTMA 4JWXA 4NF5A 5B70A 3V8XB 4FE8A 4H67A 3WAFA 2WYKA 1NV0A 3IAZA 1TFDA 2PX1A 2ESNA 3D4CA 2V25A 4OHNA 3SERA 4QSDA 4WKMA 3K6WA 2GHBA 1B6HA 1B1XA 3FZVA 5H8SA 4F3PA 2IA4A 2QVRA 4BDLA 5TP9A 2HEUA 2GHAA 4FEBA 4OEVA 3IOUA 4X1BA 4GF8A 3IOVA 1URDA 4EDPA 3LC8A 2IEEA 2HHMA 5IZ3B 4NF8B 3FVNA 5ISUA 3IB2A 4EXKA 5CBSA 1MY4A 3IOTA 1SYIA 4P3LA 2PT2A 3TTNA 4NG7A 3IX1A 1EU8A 3O6GA 1IQ7A 5JTYA 4N8YA 3THIA 4YB5A 1MXZA 4OFJA 1PBQA 3K4UA 3E9XA 4N17A 4GWYA 2OWSA 2WEFA 3OELA 3OD7A 1FTAA 5IKBA 1G0IA 2RC7A 4LONB 2DWHA 2I49A 4F29A 1KA0A 2HAVA 5L9MA 3K01A 1WDNA 1MQGA 1B0HA 3MP8A 3T9UA 4AB5A 3OEKA 4KFQA 4O8MA 1AWBA 4F2OA 4PF8A 1QUJA 4XKNA 3TYHA 3Q26A 3ROJA 3KC0A 1N7XA 2O68A 5HBCA 3M8UA 2XHDA 3PD8A 2CMOA 3GZGA 1XS5A 2AYSA 2DE2A 4YAHX 1L5TA 3IFAA 1SBPA 3LV0A 1FBDA 1FTKA 4Q30B 1JNFA 3HN0A 3HCQA 1N0TA 3MUQA 4F22A 4ND9A 3RGYA 3KJ7A 3ZKLA 3QSLA 1GTKA 1PB8A 2I3VA 2B3BA 4ECFA 2GRVA 2I3WA 3ISPA 2O6AA 5AA1A 4XEQA 1LBCA 2P3NA 2XXYA 2P2AA 4XKRA 4ZECA 3PUVE 5LTCA 5FTHA 2BJIA 5CMKA 4GXSB 4F1YA 1HSEA 2F3BA 1URSA 4QF9A 3HSTA 3QMFA 5AA2D 4K3FA 3KGCA 2GFEA 3U92A 3CI8A 3FXQA 3PPRA 3CVGA 2RCAA 3T9XB 3TTMA 3GXAA 4F1UA 3HHFA 2ZMBA 5I58A 3ZS6A 1KWHA 2FHYA 3H6UA 4PDDA 4ZDMA 4M1VA 2PMSA 4X04A 3RTWB 1MY1A 4NN3A 1N84A 1LFHA 3O29A 4BDNA 1IEJA 4PBHA 1DCUA 1XI6A 1B5IA 2F8DA 3BBRA 1M5BA 4C1TA 4E0XA 4QHQA 1EYJA 4GBVA 2WBDA 1QULA 3NOHA 1NV5A 3PUWE 4G8HA 1RYXA 4GX3A 4YMBA 5H8NB 1ELJA 1G0HA 2R71A 2HQ0A 5JTYB 2E0SA 2V3UA 3N6TA 4H0WA 3OXNA 4N8GA 3DM0A 3EKIA 5FHMA 1Y20A 1IMAA 1B3LA 2X26A 2VD3A 1CNQA 2XXWA 4PBQA 3MBPA 1OIBA 1A8EA 5FHOA 1N7WA 1Y3PA 1FBEA 1P1WA 3IOWA 3LBSA 2XXPA 1IMDA 1GV8A 5T3JA 3K1PA 2I0BA 1VDWA 4FEDA 2FVZA 4G61A 1NMUA 3LR1A 1R6ZA 2H9BA 1YPNA 4H8JA 3I6VA 4QRZA 3DLNA 4R6HA 2CZLA 3RYDA 1H3DA 2Q8JA 4Q5TA 1LAFE 3MP6A 3C36A 3QUFA 2H98A 2F7CA 2Q8MA 1RDXA 2XWIA 1AH5A 3TQLA 5B7DA 4F18A 5I56A 1B1HA 3OO9A 2RF1A 2QFLA 1NNKA 1JVXA 1XVXA 3SEYA 2UXAA 4F3BA 1MRPA 2D21A 3O6IA 2V93A 4AB6A 1LFGA 3CFXA 1SD3A 2F78A 2ZZXA 1LAXA 1FBCA 5ELVA 4MFIA 4LA9A 3UP9A 1B4HA 4OYVA 1NV7A 4DI3D 4PCDA 1DK4A 1US5A 2DWJA 4NX1A 3MJNA 1B3HA 3MAMA 3OSQA 1LEVA 1LCTA 4XIGQ 2DE3A 2ZZWA 1LB8A 3FV1A 1A40A 2RC9A 2R9JA 2E1SA 2HAUA 3BKIB 4DCXA 4G68C 3G7WA 4N13A 1MQIA 4NF0A 2REGA 1VR5A 1P99A 1SW5A 1QVSA 3IJOB 3C34A 2KLFA 1B5HA 5AE4A 1YZ0A 1UIVA 4R2BA 1H44A 3FASA 1MY0A 3KZGA 2NUVA 2Y5LA 3G3FA 3ONMA 3CRBA 3Q27A 2VHAA 1ZTYA 3UORA 3IR1A 2G29A 1GGGA 1MQJA 1R1NA 3GLBA 1JQFA 1RYOA 1LAHE 3A09A 2GQ1A 3R26A 4U1OA 2V3TA 3UGWA 5HM4B 5JK4A 1AIVA 5I58B 3E13X 2Q9TA 4IGRA 4IY6A 3SZPA 1FPBA 1URGA 2B3FA 1FQEA 3VVEA 4JWOA 4QBAA 5KCJB 4GVOA 1SW2A 2ZZVA 2XXUA 3N6UA 3A29A 3TTKA 3T22A 3K1MA 3IO4A 1B05A 4HE1A 1F9BA 1I6AA 2CZIA 5FBPA 3KG2A 4XF5A 2D3IA 1MY2A 3VV5A 2VGQA 1UTHA 1NV1A 5I59B 2DSFA 2QJEA 4KYSA 3LSXA 4OMBA 2Q2CA 1LGBC 4DXUA 2XXIA 1D3KA 3PV0E 3ZSFA 4GWZA 4PE3A 1ANFA 4QFKA 3SEVA 3ECRA 4ELQA 4GL8A 2RINA 1O7TA 1H43A 1NV4A 2L5VA 2XXVA 4GD5A 3TUSA 4HE0A 3C35A 1QKAA 2ONKE 1DMBA 3FV2A 1VE4A 4KCCA 4DXCA 4PFYA 1RDYA 2NVUB 2B4LA 1P1QA
chains in the Genus database with same CATH topology
1Y4TA 4GRKA 3CIJA 4R74A 3MQ9A 2O7UA 2X7PA 4F2OA 4EF1A 4HW8A 1HSJA 2G93A 1QUJA 4XKNA 1BIYA 2THIA 4O3AA 4UACA 3TYHA 4P11A 5AA4B 2QPQA 1N04A 4YICA 3Q26A 5I57B 4PP0A 1BTJA 1EZOA 4XKPA 5DT6A 3W9WA 4WEDA 2HFBA 4QFNA 4NF4A 4NWDA 1P1UA 2AL4A 1VSOA 1N7XA 2O68A 2VP1A 3BFTA 3I3VA 3O66A 3O9PA 4KHZE 3A3CA 4PFUA 3PMXA 5DTBA 5HBCA 5TPAA 1DTZA 4HCYA 3B6TA 1R9LA 3UN6A 4IO2A 3M8UA 5FHNA 2XHDA 5H8HA 3CG1A 3PD8A 2CMOA 3USDA 3FVKA 1B7UA 3ILUB 3GZGA 4Q0CA 4EQBA 1XS5A 2AYSA 1Z7ME 2DP8A 2DE2A 2XXRA 3MZ9A 4KD5A 3IORA 1AMFA 1DPEA 3P7IA 2HZLA 4POWA 2QSXA 3TTLA 3S9NC 3RQTA 3WAFA 4LZ5A 3VLVA 1H76A 2FA7A 4YAHX 1L5TA 1SI1A 3G3HA 3KSJA 4MBPA 4U4XA 1FTLA 1JW5A 1OLAA 1QKBA 4O3BA 3TAJA 1SBPA 2Q88A 2RKMA 1FTKA 2P1SA 2Y84A 4LZ7A 3K1NA 4Q30B 5I84A 3H6WA 5EYFA 1NNTA 3H7MA 3SEUA 1JNFA 4EXLA 1JW1A 1A8FA 4R2FA 4QFLA 2OLBA 3KOSA 1I6BA 3HN0A 1LAGE 1GVCA 3TCHA 3HCQA 3OENA 5A5XA 1S7YA 1N0TA 4QSEA 3WAEA 1MPBA 5CM6A 3MUQA 4F22A 1MM6A 3M3LA 3FJGA 1VFDA 2DXRA 4OEUA 4ZZEA 1NNFA 1PC3A 3QUJA 4JDFA 4ND9A 2Z22A 3KJ7A 3RGYA 3TQWA 3QSLA 1XHYA 2NWJA 1B7ZA 3ZKLA 2UVIA 1GTKA 1PB7A 1PB8A 3JV9A 5H8QB 5HPQA 3MPKA 2I3VA 2ONSA 2DVZA 5EHMA 2B3BA 4ECFA 1Q35A 2GRVA 2I3WA 4G77A 4G68A 4OVJA 1MH3A 2O6AA 4MLVA 4TQUQ 5AA1A 1LBCA 2XXYA 2P2AA 4U1ZA 1FTJA 1ZKBA 2BJJX 4XKRA 4ZECA 2HZKA 3PUVE 3MVXA 3MP1A 4NEDA 4QSCA 3KN3A 1QUKA 1OMPA 1WODA 2O51A 4EUOA 4YB6A 1FW0A 4AQ4A 2DXYA 2OWTA 3FVOA 4BDOA 1BLFA 4RXLA 3K00A 4TOZA 5FTHA 4PQJA 1D4NA 5CMKA 4GXSB 1ZLQA 4G2ZA 4F1YA 1HSEA 5I2NA 4IO4A 1SDXA 1URSA 3Q29A 1B0LA 2AIXA 4NF6B 4QF9A 1LB9A 1MPCA 3G3JA 3HSTA 1Q1KA 3KJTA 1FQAA 1UTBB 1PBPA 3MZBA 4IY5A 5AA2D 3EHSA 5DVIA 4K3FA 3H03A 4M4GA 3R6UA 3UK4A 2H4IA 4NWCA 1MDP1 3K0VA 3KGCA 3F11A 2M8CA 2GFEA 3U92A 3H3GA 3TEPA 3CI8A 3FXQA 2I4BA 3PPRA 5TPAB 3FXUA 4R6YA 5KDTA 3CFLA 3CVGA 4OQOA 2RCAA 4C0RA 3PUXE 4I62A 4F3GA 3MPLA 3T9XB 3TTMA 2FYIA 2OBGA 2WKYA 3GXAA 4F1UA 3TCGA 3ZKKA 3RT8A 3HHFA 2ZMBA 1SW4A 3CG3A 5I58A 4OETA 3ZS6A 1KWHA 2NOOA 2DWAA 4OERA 3H6UA 1XVYA 4ZDMA 4M1VA 4FATA 4DLDA 1Y3QA 4ELRA 2PMSA 2UVGA 4DZ1A 1EZ9A 5I57A 1O63A 1IXGA 1M5EA 3RTWB 3BFUA 4GOTA 2I0CA 4JXIA 1MY1A 1AOVA 4N6PA 4EF2A 3VFJA 1ZU0A 1N84A 1LFHA 3S9EA 3O29A 2DOJA 4BDNA 1A99A 1IEJA 3IB1A 4R9GA 1MY3A 1SW1A 1B9JA 3MW0A 4XXUA 4DE8A 5CBRA 2D5WA 4JBZA 4ZEIA 3VXBA 4ELPA 1NNPA 1I6QA 4GIZA 1VFEA 3PMVA 2XXXA 3PUZE 4KQPA 1D9YA 1B5IA 2ANJA 4EQ7A 5BUUA 3IO6A 4H5GA 1XT8A 4H65A 2F8DA 3BBRA 1M5BA 2ABHA 4C1TA 1ZIUA 1SQYA 1ZJLA 2HXWA 4NF5B 1FQFA 4E0XA 4Z7EA 4QHQA 5CMMA 2Z23A 2I48A 1NH8A 1I69A 3OO6A 2UYEA 4OFOA 3LUYA 4POXA 4ZEFA 1MXYA 1USYE 2F7BA 1QULA 3VDFA 4JSOA 1JEVA 2Y7PA 1S50A 4BLAA 1B52A 5CMBA 4RY1A 2Q89A 3JYRA 3FGSA 2REJA 2ZYMA 1QW0A 3PUWE 4G8HA 3TMGA 4RNSA 1N76A 1RYXA 3PGFA 3TKDA 3PUYE 5I2NB 4LUBA 2O7IA 2XXHA 4YMBA 2DS9A 3O97A 3HHGA 5H8NB 3T93B 2I58A 1LCFA 4LQ5A 3TODA 3ODBA 1Y9UA 5J1DA 1ELJA 1H45A 2R71A 2HQ0A 3N5LA 3PPNA 3FATA 1IXHA 1LLSA 5JTYB 3RNNA 2E0SA 1B3FA 1OQHA 2V3UA 2F34A 3N6TA 4LQ2A 4Q8RA 2DWIA 3FJMA 4H0WA 2Y7IA 3PPQA 1D9VA 5KDTB 1T0KA 3OXNA 1YAEA 3O2AA 1USYH 4KR5A 1M5CA 2PYYA 2QMXA 3FUZA 4KYEA 4QFOA 1MXUA 2F35A 1R9QA 3DM0A 5DEXB 3A3UA 1TFAA 3TELA 3VLWA 5FHMA 1NKXA 1Y20A 2UVJA 1B3LA 1GR2A 2X26A 3PD9A 5ITOA 3TTRA 3KBRA 4OESA 1XOCA 3SEWA 2VD3A 3H06B 3UA8A 1N3XA 2XXWA 1N3WA 3TDJA 3EN3A 3H4ZA 2XX9A 1OLCA 1RKMA 1MPDA 3MVWA 4G4PA 3OEMA 3OO8A 3MBPA 5A5XB 1OIBA 2A5SA 2F5XA 3Q28A 3QK6A 2R6GE 3U8QA 4LP2B 2QL3A 4BDRA 2V84A 1DSNA 4X48A 3MWBA 2XX8A 1A8EA 4GWOA 5FHOA 4ZE8A 3V5AA 3N94A 1N7WA 1Y3PA 2UVHA 4U21A 2OK2A 5ICQA 1P1WA 1MG1A 3GBBA 5DVFA 3G3IA 3IK6B 4IO3A 1MQDA 1MS7A 3IOWA 4YU0A 3O28A 5H8QA 3VE1B 1FQDA 2ZNSA 3B7DA 4H1XA 3DP8A 3LBSA 2XXTA 4YKPA 2XXPA 1MXWA 2VD2A 4YZZA 1GV8A 1LSTA 4IO7A 1A7LA 3HV1A 3K1PA 2I0BA 4F2QA 2GH9A 3M3KA 3VLUA 1WVJA 4FEDA 2H5YA 4R72A 4RJZA 5L9OA 1SVXB 1CE2A 1BP5A 4RK2A 3HO7A 3L6GA 3SDFA 1OQGA 3FXRA 3RY3A 4GXAA 1IXIA 1NMUA 1ZBMA 2B65A 2XD3A 1P1NA 3LR1A 1R6ZA 3OOAA 2H9BA 4KPTA 2PVUA 4PETA 5EHSA 1YPNA 4H8JA 2Y7KA 3I6VA 3PPPA 3DLNA 4QRZA 4LVQA 4R6HA 5DYHA 3ILTB 5CMCA 5TP9B 3TCFA 2CZLA 1UIUA 4C1UA 3QXMA 4MLQA 1H3DA 3EF7A 3LSLA 1FCKA 1M5FA 1M5DA 1O64A 4OENA 2OZZA 2Q8JA 3CSGA 1LFIA 4LZ8A 5FTIA 4BDMA 4Q5TA 4OZ9A 3VXCA 4GFRA 4TLMB 1LAFE 1TXFA 3MP6A 4UA8A 1AL3A 3U1OA 3C36A 2ALUA 3QUFA 5H8HB 3U94A 5I2KA 2H98A 4GLIA 3IJXB 2F7CA 1A55A 1MXVA 4MF3A 4GQOA 5H8FA 4PFTA 3DP6A 1AH5A 4L17A 3PMWA 2Y7RA 3TQLA 4U22A 5B7DA 3OO7A 3V89B 4F18A 3CFZA 1B4ZA 1ATGA 3FIRA 2DE4A 3K6UA 3K02A 3OSRA 1B1HA 2F97A 4FECA 2X7QA 4WEPA 4YB7A 3OO9A 3KEIA 5L9SA 1B51A 2RF1A 2UYFA 3DELB 1NNKA 4DCYA 1DOTA 3KSXA 1B5JA 1JVXA 4OFLA 2OCUA 1XVXA 4PE5B 2UXAA 4IGTA 3SEYA 3VVDA 5I59A 4F3BA 1JEUA 3L6HA 1Y1MA 4R9FA 4U23A 5K2YA 4JWYA 4N07A 1MRPA 2D21A 2VOZA 3O6IA 4ESXA 1MH4A 1DTGA 3N26A 4PFWA 5TU0A 2V93A 2I6EA 4I1DA 1TT1A 1LFGA 4AB6A 2HCAA 1NH7A 3CFXA 4G8MA 3RUMA 2F6GA 3T9HB 1B3GA 1SD3A 1Y1ZA 4R73A 3C31A 4ISUA 5CRYA 4R75A 2DYXA 4F3SA 4DXBA 2O84X 1MXXA 2F78A 5LOMA 2H99A 1UQWA 4E0WA 4LATA 1IUDA 1DPPA 2YJPA 2P0SA 3SKPA 1LAXA 4THIA 1B2HA 3FVGA 2QS3A 4MFIA 4LA9A 4NF6A 3KN7A 5ELVA 3VVFA 5AA4A 4ZE9A 3UP9A 1B4HA 4HCWA 5K2XA 4OYVA 1CB6A 4I9DA 3FD3A 4EQ9A 3QIMA 3DP4A 4H8IA 4IO5A 4U2RA 4XKQA 4RYAA 1US5A 4EDPA 3E3KA 3SETA 1PB9A 2DWJA 2QRYA 3MJNA 1B3HA 1PEBA 2Z8EA 3RT6B 1II5A 1FQCA 4MH5A 4Z0IA 3MAMA 3OSQA 3U93A 3RPWA 1LCTA 4XIGQ 4FAJA 2QS2A 3Q25A 4G68B 1B3EA 2DE3A 3T96B 3K6VA 1LB8A 2ZYOA 3FV1A 5ICTA 5KCJA 2ZNTA 3RTFB 2V3QA 2YLNA 4KCDA 1A40A 1NFTA 1XC1A 2RC9A 3CSBA 3UIFA 2ZYKA 3JZJA 4RPNA 2R9JA 2NXOA 2E1SA 2HAUA 2O1LA 3BKIB 3G3KA 3MVYA 3RN8A 4DCXA 2QS1A 2RC8A 4QFPA 4YKIA 4JSDA 5I2KB 3EHTA 2OJTA 4G68C 5BWJA 5I59B 1IIWA 3CR9A 3KN8A 3EHUA 3M3FA 3G7WA 4HTGA 5JEIA 3O6HA 1LBBA 1MQIA 2LAOA 4N13A 3S4UA 2REGA 3T66A 1B58A 1VR5A 3E4RA 3PPOA 1P99A 1MDQA 1SI0A 1A54A 4ZS9A 1OVBA 3R7XA 5I56B 1S9TA 1IZ1A 2A5TA 1SW5A 4NE4A 1QVSA 4OWDA 4ZEDA 4KI0E 5IAIA 5DVJA 3IJOB 3C34A 3GBAA 3EQ1A 3KFMA 3W9VA 1FTMA 2KLFA 2AL5A 4JWXA 1B5HA 4NF5A 5AA2B 4ZEKA 1JVYA 5AE4A 5B70A 3V8XB 4FJPA 2XXQA 4FE8A 2XX7A 1OVTA 5AA2A 4H67A 2QMWA 4HS7A 3D4GA 1UIVA 2F7AA 1H44A 4G8NA 4R2BA 3FASA 3PU5A 1MY0A 3KZGA 3V83A 1EZPA 3H6VA 3IAZA 2NUVA 4ELOA 2PBWA 3G3FA 3ONMA 1TFDA 4DDDA 2PX1A 2Y7WA 2ESNA 2FNCA 3D4CA 3LSWA 3CRBA 3Q27A 1EH3A 1ZTYA 2VHAA 2Q2AA 2YPNA 3C33A 2V25A 4IO6A 3UORA 4OHNA 3S9LC 5CI5A 3SERA 3IR1A 2G29A 1GGGA 4QSDA 3U72A 4NF4B 1MQJA 1R1NA 4WKMA 2F36A 3K6WA 2GHBA 1B6HA 3GLBA 1HSLA 1B1XA 1JQFA 1RYOA 1LAHE 1P1OA 3A09A 3FZVA 4H6DA 5F7VA 1IITA 5H8SA 5ITPA 4NMYA 4F3PA 1B46A 2A5TB 1Y3NA 2IA4A 3R26A 4U1OA 3W15C 2V3TA 5TP9A 3QYTA 4IB2A 3UGWA 4BDLA 5HM4B 5JK4A 2HEUA 3TFLA 1AIVA 2GHAA 4FEBA 5I58B 3E13X 1MQHA 2Q9TA 5KZTA 4KYDA 4P0IA 4OEVA 2F6PA 4IGRA 3IOUA 4X1BA 1J1NA 4GF8A 3IOVA 1URDA 3H6TA 4IY6A 4RK9A 3EPEA 3LC8A 3LSFB 5F1QA 2IEEA 4OTEA 3TZAA 2H25A 1YCJA 4NF8B 3FVNA 1YTVA 1Y4CA 2ZXTA 4P0GA 3K2DA 4R6KA 5M2VA 1Z7NE 3IB2A 1URGA 4WXJA 4EXKA 5ISUA 2B3FA 1FQEA 3B6WA 3VVEA 5CBSA 1SYHA 1MY4A 4O3CA 2XD2A 4JWOA 1TWYA 2Z8FA 3IOTA 5KCJB 4GVOA 1SW2A 1ZMGA 1B40A 1SYIA 2XXUA 2PT2A 2QS4A 1UTBA 3N6UA 3C4MA 3B6QA 1JW4A 4TLLB 3IB0A 4I8CA 3I5OA 2DQVA 3T22A 3TPAA 2PT1A 3IL1B 3TTNA 5CC2A 3IX1A 1EU8A 3IO4A 3K1MA 4U4SA 1B05A 4JB7A 4BDQA 3O6GA 3S9MC 5AA3A 1IQ7A 1F9BA 1PDAA 1I6AA 1QUIA 3OMBA 4DIGA 2I4CA 2RCBA 3KOTA 3KG2A 4YKJA 2ZNUA 3RLFE 3S2VA 5H8NA 2D3IA 5JTYA 4GL0A 1MY2A 2ZYNA 3MC2A 3SEXA 2O1MA 3THIA 3VV5A 1QJMA 2VGQA 4YB5A 1UTHA 3K6XA 1MXZA 4OFJA 1MM7A 4FORA 4XTCQ 1PBQA 1BKAA 4YKKA 3K4UA 3E9XA 3AXFA 2DSFA 2QJEA 3C9HA 3G3GA 3LSXA 4KYSA 4ONYA 3T9VA 4OMBA 1UTHB 2OWSA 2Q2CA 1LGBC 1US4A 4X1DA 2XXIA 2DVCA 4DXUA 1D3KA 3OELA 1POY1 3PV0E 4RPOA 5H8FB 1B32A 1POTA 3ZSFA 1IXCA 3OD7A 2Z8DA 5DEXA 3SESA 5IKBA 1FQBA 1ANFA 1FTOA 4QFKA 4ZZAA 3SEVA 1B7HA 3HPIA 3ECRA 3MVZA 4NTLA 4ELQA 4H5FA 4RA1A 4ZEBA 4OXVA 4GL8A 2RC7A 3QAXA 4LONB 2RINA 1O7TA 2DWHA 4YMAA 1NL5A 1H43A 5L8DA 4FIMA 2XXVA 2I49A 4GD5A 3FJ7A 4F31B 5I56A 4F29A 2HAVA 5L9MA 3C32A 4F39A 4ESWA 3TUSA 3K01A 3C35A 1WDNA 4F1VA 1MQGA 1B0HA 1QKAA 1DMBA 2ONKE 3MP8A 3MZ1A 3T9UA 4AB5A 3FV2A 1JETA 2O69A 1VE4A 3OEKA 4KFQA 4KCCA 4NF8A 4DXCA 4PFYA 2NVUB 4F19A 2W7YA 4X9TA 2ONRA 1P1QA 3TTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Y4T A;  4GRK A;  3CIJ A;  4R74 A;  3MQ9 A;  2O7U A;  2X7P A;  4F2O A;  4EF1 A;  4HW8 A;  1HSJ A;  2G93 A;  1QUJ A;  4XKN A;  1BIY A;  2THI A;  4O3A A;  4UAC A;  3TYH A;  4P11 A;  5AA4 B;  2QPQ A;  1N04 A;  4YIC A;  3Q26 A;  5I57 B;  4PP0 A;  1BTJ A;  1EZO A;  4XKP A;  5DT6 A;  3W9W A;  4WED A;  2HFB A;  4QFN A;  4NF4 A;  4NWD A;  1P1U A;  2AL4 A;  1VSO A;  1N7X A;  2O68 A;  2VP1 A;  3BFT A;  3I3V A;  3O66 A;  3O9P A;  4KHZ E;  3A3C A;  4PFU A;  3PMX A;  5DTB A;  5HBC A;  5TPA A;  1DTZ A;  4HCY A;  3B6T A;  1R9L A;  3UN6 A;  4IO2 A;  3M8U A;  5FHN A;  2XHD A;  5H8H A;  3CG1 A;  3PD8 A;  2CMO A;  3USD A;  3FVK A;  1B7U A;  3ILU B;  3GZG A;  4Q0C A;  4EQB A;  1XS5 A;  2AYS A;  1Z7M E;  2DP8 A;  2DE2 A;  2XXR A;  3MZ9 A;  4KD5 A;  3IOR A;  1AMF A;  1DPE A;  3P7I A;  2HZL A;  4POW A;  2QSX A;  3TTL A;  3S9N C;  3RQT A;  3WAF A;  4LZ5 A;  3VLV A;  1H76 A;  2FA7 A;  4YAH X;  1L5T A;  1SI1 A;  3G3H A;  3KSJ A;  4MBP A;  4U4X A;  1FTL A;  1JW5 A;  1OLA A;  1QKB A;  4O3B A;  3TAJ A;  1SBP A;  2Q88 A;  2RKM A;  1FTK A;  2P1S A;  2Y84 A;  4LZ7 A;  3K1N A;  4Q30 B;  5I84 A;  3H6W A;  5EYF A;  1NNT A;  3H7M A;  3SEU A;  1JNF A;  4EXL A;  1JW1 A;  1A8F A;  4R2F A;  4QFL A;  2OLB A;  3KOS A;  1I6B A;  3HN0 A;  1LAG E;  1GVC A;  3TCH A;  3HCQ A;  3OEN A;  5A5X A;  1S7Y A;  1N0T A;  4QSE A;  3WAE A;  1MPB A;  5CM6 A;  3MUQ A;  4F22 A;  1MM6 A;  3M3L A;  3FJG A;  1VFD A;  2DXR A;  4OEU A;  4ZZE A;  1NNF A;  1PC3 A;  3QUJ A;  4JDF A;  4ND9 A;  2Z22 A;  3KJ7 A;  3RGY A;  3TQW A;  3QSL A;  1XHY A;  2NWJ A;  1B7Z A;  3ZKL A;  2UVI A;  1GTK A;  1PB7 A;  1PB8 A;  3JV9 A;  5H8Q B;  5HPQ A;  3MPK A;  2I3V A;  2ONS A;  2DVZ A;  5EHM A;  2B3B A;  4ECF A;  1Q35 A;  2GRV A;  2I3W A;  4G77 A;  4G68 A;  4OVJ A;  1MH3 A;  2O6A A;  4MLV A;  4TQU Q;  5AA1 A;  1LBC A;  2XXY A;  2P2A A;  4U1Z A;  1FTJ A;  1ZKB A;  2BJJ X;  4XKR A;  4ZEC A;  2HZK A;  3PUV E;  3MVX A;  3MP1 A;  4NED A;  4QSC A;  3KN3 A;  1QUK A;  1OMP A;  1WOD A;  2O51 A;  4EUO A;  4YB6 A;  1FW0 A;  4AQ4 A;  2DXY A;  2OWT A;  3FVO A;  4BDO A;  1BLF A;  4RXL A;  3K00 A;  4TOZ A;  5FTH A;  4PQJ A;  1D4N A;  5CMK A;  4GXS B;  1ZLQ A;  4G2Z A;  4F1Y A;  1HSE A;  5I2N A;  4IO4 A;  1SDX A;  1URS A;  3Q29 A;  1B0L A;  2AIX A;  4NF6 B;  4QF9 A;  1LB9 A;  1MPC A;  3G3J A;  3HST A;  1Q1K A;  3KJT A;  1FQA A;  1UTB B;  1PBP A;  3MZB A;  4IY5 A;  5AA2 D;  3EHS A;  5DVI A;  4K3F A;  3H03 A;  4M4G A;  3R6U A;  3UK4 A;  2H4I A;  4NWC A;  1MDP 1;  3K0V A;  3KGC A;  3F11 A;  2M8C A;  2GFE A;  3U92 A;  3H3G A;  3TEP A;  3CI8 A;  3FXQ A;  2I4B A;  3PPR A;  5TPA B;  3FXU A;  4R6Y A;  5KDT A;  3CFL A;  3CVG A;  4OQO A;  2RCA A;  4C0R A;  3PUX E;  4I62 A;  4F3G A;  3MPL A;  3T9X B;  3TTM A;  2FYI A;  2OBG A;  2WKY A;  3GXA A;  4F1U A;  3TCG A;  3ZKK A;  3RT8 A;  3HHF A;  2ZMB A;  1SW4 A;  3CG3 A;  5I58 A;  4OET A;  3ZS6 A;  1KWH A;  2NOO A;  2DWA A;  4OER A;  3H6U A;  1XVY A;  4ZDM A;  4M1V A;  4FAT A;  4DLD A;  1Y3Q A;  4ELR A;  2PMS A;  2UVG A;  4DZ1 A;  1EZ9 A;  5I57 A;  1O63 A;  1IXG A;  1M5E A;  3RTW B;  3BFU A;  4GOT A;  2I0C A;  4JXI A;  1MY1 A;  1AOV A;  4N6P A;  4EF2 A;  3VFJ A;  1ZU0 A;  1N84 A;  1LFH A;  3S9E A;  3O29 A;  2DOJ A;  4BDN A;  1A99 A;  1IEJ A;  3IB1 A;  4R9G A;  1MY3 A;  1SW1 A;  1B9J A;  3MW0 A;  4XXU A;  4DE8 A;  5CBR A;  2D5W A;  4JBZ A;  4ZEI A;  3VXB A;  4ELP A;  1NNP A;  1I6Q A;  4GIZ A;  1VFE A;  3PMV A;  2XXX A;  3PUZ E;  4KQP A;  1D9Y A;  1B5I A;  2ANJ A;  4EQ7 A;  5BUU A;  3IO6 A;  4H5G A;  1XT8 A;  4H65 A;  2F8D A;  3BBR A;  1M5B A;  2ABH A;  4C1T A;  1ZIU A;  1SQY A;  1ZJL A;  2HXW A;  4NF5 B;  1FQF A;  4E0X A;  4Z7E A;  4QHQ A;  5CMM A;  2Z23 A;  2I48 A;  1NH8 A;  1I69 A;  3OO6 A;  2UYE A;  4OFO A;  3LUY A;  4POX A;  4ZEF A;  1MXY A;  1USY E;  2F7B A;  1QUL A;  3VDF A;  4JSO A;  1JEV A;  2Y7P A;  1S50 A;  4BLA A;  1B52 A;  5CMB A;  4RY1 A;  2Q89 A;  3JYR A;  3FGS A;  2REJ A;  2ZYM A;  1QW0 A;  3PUW E;  4G8H A;  3TMG A;  4RNS A;  1N76 A;  1RYX A;  3PGF A;  3TKD A;  3PUY E;  5I2N B;  4LUB A;  2O7I A;  2XXH A;  4YMB A;  2DS9 A;  3O97 A;  3HHG A;  5H8N B;  3T93 B;  2I58 A;  1LCF A;  4LQ5 A;  3TOD A;  3ODB A;  1Y9U A;  5J1D A;  1ELJ A;  1H45 A;  2R71 A;  2HQ0 A;  3N5L A;  3PPN A;  3FAT A;  1IXH A;  1LLS A;  5JTY B;  3RNN A;  2E0S A;  1B3F A;  1OQH A;  2V3U A;  2F34 A;  3N6T A;  4LQ2 A;  4Q8R A;  2DWI A;  3FJM A;  4H0W A;  2Y7I A;  3PPQ A;  1D9V A;  5KDT B;  1T0K A;  3OXN A;  1YAE A;  3O2A A;  1USY H;  4KR5 A;  1M5C A;  2PYY A;  2QMX A;  3FUZ A;  4KYE A;  4QFO A;  1MXU A;  2F35 A;  1R9Q A;  3DM0 A;  5DEX B;  3A3U A;  1TFA A;  3TEL A;  3VLW A;  5FHM A;  1NKX A;  1Y20 A;  2UVJ A;  1B3L A;  1GR2 A;  2X26 A;  3PD9 A;  5ITO A;  3TTR A;  3KBR A;  4OES A;  1XOC A;  3SEW A;  2VD3 A;  3H06 B;  3UA8 A;  1N3X A;  2XXW A;  1N3W A;  3TDJ A;  3EN3 A;  3H4Z A;  2XX9 A;  1OLC A;  1RKM A;  1MPD A;  3MVW A;  4G4P A;  3OEM A;  3OO8 A;  3MBP A;  5A5X B;  1OIB A;  2A5S A;  2F5X A;  3Q28 A;  3QK6 A;  2R6G E;  3U8Q A;  4LP2 B;  2QL3 A;  4BDR A;  2V84 A;  1DSN A;  4X48 A;  3MWB A;  2XX8 A;  1A8E A;  4GWO A;  5FHO A;  4ZE8 A;  3V5A A;  3N94 A;  1N7W A;  1Y3P A;  2UVH A;  4U21 A;  2OK2 A;  5ICQ A;  1P1W A;  1MG1 A;  3GBB A;  5DVF A;  3G3I A;  3IK6 B;  4IO3 A;  1MQD A;  1MS7 A;  3IOW A;  4YU0 A;  3O28 A;  5H8Q A;  3VE1 B;  1FQD A;  2ZNS A;  3B7D A;  4H1X A;  3DP8 A;  3LBS A;  2XXT A;  4YKP A;  2XXP A;  1MXW A;  2VD2 A;  4YZZ A;  1GV8 A;  1LST A;  4IO7 A;  1A7L A;  3HV1 A;  3K1P A;  2I0B A;  4F2Q A;  2GH9 A;  3M3K A;  3VLU A;  1WVJ A;  4FED A;  2H5Y A;  4R72 A;  4RJZ A;  5L9O A;  1SVX B;  1CE2 A;  1BP5 A;  4RK2 A;  3HO7 A;  3L6G A;  3SDF A;  1OQG A;  3FXR A;  3RY3 A;  4GXA A;  1IXI A;  1NMU A;  1ZBM A;  2B65 A;  2XD3 A;  1P1N A;  3LR1 A;  1R6Z A;  3OOA A;  2H9B A;  4KPT A;  2PVU A;  4PET A;  5EHS A;  1YPN A;  4H8J A;  2Y7K A;  3I6V A;  3PPP A;  3DLN A;  4QRZ A;  4LVQ A;  4R6H A;  5DYH A;  3ILT B;  5CMC A;  5TP9 B;  3TCF A;  2CZL A;  1UIU A;  4C1U A;  3QXM A;  4MLQ A;  1H3D A;  3EF7 A;  3LSL A;  1FCK A;  1M5F A;  1M5D A;  1O64 A;  4OEN A;  2OZZ A;  2Q8J A;  3CSG A;  1LFI A;  4LZ8 A;  5FTI A;  4BDM A;  4Q5T A;  4OZ9 A;  3VXC A;  4GFR A;  4TLM B;  1LAF E;  1TXF A;  3MP6 A;  4UA8 A;  1AL3 A;  3U1O A;  3C36 A;  2ALU A;  3QUF A;  5H8H B;  3U94 A;  5I2K A;  2H98 A;  4GLI A;  3IJX B;  2F7C A;  1A55 A;  1MXV A;  4MF3 A;  4GQO A;  5H8F A;  4PFT A;  3DP6 A;  1AH5 A;  4L17 A;  3PMW A;  2Y7R A;  3TQL A;  4U22 A;  5B7D A;  3OO7 A;  3V89 B;  4F18 A;  3CFZ A;  1B4Z A;  1ATG A;  3FIR A;  2DE4 A;  3K6U A;  3K02 A;  3OSR A;  1B1H A;  2F97 A;  4FEC A;  2X7Q A;  4WEP A;  4YB7 A;  3OO9 A;  3KEI A;  5L9S A;  1B51 A;  2RF1 A;  2UYF A;  3DEL B;  1NNK A;  4DCY A;  1DOT A;  3KSX A;  1B5J A;  1JVX A;  4OFL A;  2OCU A;  1XVX A;  4PE5 B;  2UXA A;  4IGT A;  3SEY A;  3VVD A;  5I59 A;  4F3B A;  1JEU A;  3L6H A;  1Y1M A;  4R9F A;  4U23 A;  5K2Y A;  4JWY A;  4N07 A;  1MRP A;  2D21 A;  2VOZ A;  3O6I A;  4ESX A;  1MH4 A;  1DTG A;  3N26 A;  4PFW A;  5TU0 A;  2V93 A;  2I6E A;  4I1D A;  1TT1 A;  1LFG A;  4AB6 A;  2HCA A;  1NH7 A;  3CFX A;  4G8M A;  3RUM A;  2F6G A;  3T9H B;  1B3G A;  1SD3 A;  1Y1Z A;  4R73 A;  3C31 A;  4ISU A;  5CRY A;  4R75 A;  2DYX A;  4F3S A;  4DXB A;  2O84 X;  1MXX A;  2F78 A;  5LOM A;  2H99 A;  1UQW A;  4E0W A;  4LAT A;  1IUD A;  1DPP A;  2YJP A;  2P0S A;  3SKP A;  1LAX A;  4THI A;  1B2H A;  3FVG A;  2QS3 A;  4MFI A;  4LA9 A;  4NF6 A;  3KN7 A;  5ELV A;  3VVF A;  5AA4 A;  4ZE9 A;  3UP9 A;  1B4H A;  4HCW A;  5K2X A;  4OYV A;  1CB6 A;  4I9D A;  3FD3 A;  4EQ9 A;  3QIM A;  3DP4 A;  4H8I A;  4IO5 A;  4U2R A;  4XKQ A;  4RYA A;  1US5 A;  4EDP A;  3E3K A;  3SET A;  1PB9 A;  2DWJ A;  2QRY A;  3MJN A;  1B3H A;  1PEB A;  2Z8E A;  3RT6 B;  1II5 A;  1FQC A;  4MH5 A;  4Z0I A;  3MAM A;  3OSQ A;  3U93 A;  3RPW A;  1LCT A;  4XIG Q;  4FAJ A;  2QS2 A;  3Q25 A;  4G68 B;  1B3E A;  2DE3 A;  3T96 B;  3K6V A;  1LB8 A;  2ZYO A;  3FV1 A;  5ICT A;  5KCJ A;  2ZNT A;  3RTF B;  2V3Q A;  2YLN A;  4KCD A;  1A40 A;  1NFT A;  1XC1 A;  2RC9 A;  3CSB A;  3UIF A;  2ZYK A;  3JZJ A;  4RPN A;  2R9J A;  2NXO A;  2E1S A;  2HAU A;  2O1L A;  3BKI B;  3G3K A;  3MVY A;  3RN8 A;  4DCX A;  2QS1 A;  2RC8 A;  4QFP A;  4YKI A;  4JSD A;  5I2K B;  3EHT A;  2OJT A;  4G68 C;  5BWJ A;  5I59 B;  1IIW A;  3CR9 A;  3KN8 A;  3EHU A;  3M3F A;  3G7W A;  4HTG A;  5JEI A;  3O6H A;  1LBB A;  1MQI A;  2LAO A;  4N13 A;  3S4U A;  2REG A;  3T66 A;  1B58 A;  1VR5 A;  3E4R A;  3PPO A;  1P99 A;  1MDQ A;  1SI0 A;  1A54 A;  4ZS9 A;  1OVB A;  3R7X A;  5I56 B;  1S9T A;  1IZ1 A;  2A5T A;  1SW5 A;  4NE4 A;  1QVS A;  4OWD A;  4ZED A;  4KI0 E;  5IAI A;  5DVJ A;  3IJO B;  3C34 A;  3GBA A;  3EQ1 A;  3KFM A;  3W9V A;  1FTM A;  2KLF A;  2AL5 A;  4JWX A;  1B5H A;  4NF5 A;  5AA2 B;  4ZEK A;  1JVY A;  5AE4 A;  5B70 A;  3V8X B;  4FJP A;  2XXQ A;  4FE8 A;  2XX7 A;  1OVT A;  5AA2 A;  4H67 A;  2QMW A;  4HS7 A;  3D4G A;  1UIV A;  2F7A A;  1H44 A;  4G8N A;  4R2B A;  3FAS A;  3PU5 A;  1MY0 A;  3KZG A;  3V83 A;  1EZP A;  3H6V A;  3IAZ A;  2NUV A;  4ELO A;  2PBW A;  3G3F A;  3ONM A;  1TFD A;  4DDD A;  2PX1 A;  2Y7W A;  2ESN A;  2FNC A;  3D4C A;  3LSW A;  3CRB A;  3Q27 A;  1EH3 A;  1ZTY A;  2VHA A;  2Q2A A;  2YPN A;  3C33 A;  2V25 A;  4IO6 A;  3UOR A;  4OHN A;  3S9L C;  5CI5 A;  3SER A;  3IR1 A;  2G29 A;  1GGG A;  4QSD A;  3U72 A;  4NF4 B;  1MQJ A;  1R1N A;  4WKM A;  2F36 A;  3K6W A;  2GHB A;  1B6H A;  3GLB A;  1HSL A;  1B1X A;  1JQF A;  1RYO A;  1LAH E;  1P1O A;  3A09 A;  3FZV A;  4H6D A;  5F7V A;  1IIT A;  5H8S A;  5ITP A;  4NMY A;  4F3P A;  1B46 A;  2A5T B;  1Y3N A;  2IA4 A;  3R26 A;  4U1O A;  3W15 C;  2V3T A;  5TP9 A;  3QYT A;  4IB2 A;  3UGW A;  4BDL A;  5HM4 B;  5JK4 A;  2HEU A;  3TFL A;  1AIV A;  2GHA A;  4FEB A;  5I58 B;  3E13 X;  1MQH A;  2Q9T A;  5KZT A;  4KYD A;  4P0I A;  4OEV A;  2F6P A;  4IGR A;  3IOU A;  4X1B A;  1J1N A;  4GF8 A;  3IOV A;  1URD A;  3H6T A;  4IY6 A;  4RK9 A;  3EPE A;  3LC8 A;  3LSF B;  5F1Q A;  2IEE A;  4OTE A;  3TZA A;  2H25 A;  1YCJ A;  4NF8 B;  3FVN A;  1YTV A;  1Y4C A;  2ZXT A;  4P0G A;  3K2D A;  4R6K A;  5M2V A;  1Z7N E;  3IB2 A;  1URG A;  4WXJ A;  4EXK A;  5ISU A;  2B3F A;  1FQE A;  3B6W A;  3VVE A;  5CBS A;  1SYH A;  1MY4 A;  4O3C A;  2XD2 A;  4JWO A;  1TWY A;  2Z8F A;  3IOT A;  5KCJ B;  4GVO A;  1SW2 A;  1ZMG A;  1B40 A;  1SYI A;  2XXU A;  2PT2 A;  2QS4 A;  1UTB A;  3N6U A;  3C4M A;  3B6Q A;  1JW4 A;  4TLL B;  3IB0 A;  4I8C A;  3I5O A;  2DQV A;  3T22 A;  3TPA A;  2PT1 A;  3IL1 B;  3TTN A;  5CC2 A;  3IX1 A;  1EU8 A;  3IO4 A;  3K1M A;  4U4S A;  1B05 A;  4JB7 A;  4BDQ A;  3O6G A;  3S9M C;  5AA3 A;  1IQ7 A;  1F9B A;  1PDA A;  1I6A A;  1QUI A;  3OMB A;  4DIG A;  2I4C A;  2RCB A;  3KOT A;  3KG2 A;  4YKJ A;  2ZNU A;  3RLF E;  3S2V A;  5H8N A;  2D3I A;  5JTY A;  4GL0 A;  1MY2 A;  2ZYN A;  3MC2 A;  3SEX A;  2O1M A;  3THI A;  3VV5 A;  1QJM A;  2VGQ A;  4YB5 A;  1UTH A;  3K6X A;  1MXZ A;  4OFJ A;  1MM7 A;  4FOR A;  4XTC Q;  1PBQ A;  1BKA A;  4YKK A;  3K4U A;  3E9X A;  3AXF A;  2DSF A;  2QJE A;  3C9H A;  3G3G A;  3LSX A;  4KYS A;  4ONY A;  3T9V A;  4OMB A;  1UTH B;  2OWS A;  2Q2C A;  1LGB C;  1US4 A;  4X1D A;  2XXI A;  2DVC A;  4DXU A;  1D3K A;  3OEL A;  1POY 1;  3PV0 E;  4RPO A;  5H8F B;  1B32 A;  1POT A;  3ZSF A;  1IXC A;  3OD7 A;  2Z8D A;  5DEX A;  3SES A;  5IKB A;  1FQB A;  1ANF A;  1FTO A;  4QFK A;  4ZZA A;  3SEV A;  1B7H A;  3HPI A;  3ECR A;  3MVZ A;  4NTL A;  4ELQ A;  4H5F A;  4RA1 A;  4ZEB A;  4OXV A;  4GL8 A;  2RC7 A;  3QAX A;  4LON B;  2RIN A;  1O7T A;  2DWH A;  4YMA A;  1NL5 A;  1H43 A;  5L8D A;  4FIM A;  2XXV A;  2I49 A;  4GD5 A;  3FJ7 A;  4F31 B;  5I56 A;  4F29 A;  2HAV A;  5L9M A;  3C32 A;  4F39 A;  4ESW A;  3TUS A;  3K01 A;  3C35 A;  1WDN A;  4F1V A;  1MQG A;  1B0H A;  1QKA A;  1DMB A;  2ONK E;  3MP8 A;  3MZ1 A;  3T9U A;  4AB5 A;  3FV2 A;  1JET A;  2O69 A;  1VE4 A;  3OEK A;  4KFQ A;  4KCC A;  4NF8 A;  4DXC A;  4PFY A;  2NVU B;  4F19 A;  2W7Y A;  4X9T A;  2ONR A;  1P1Q A;  3TTK A; 
#chains in the Genus database with same CATH topology
 1BIY A;  4O3A A;  3FXB A;  4GX4 A;  4NF4 A;  5H8H B;  1Q9D A;  4KHZ E;  3O9P A;  3V89 B;  5H8H A;  4NHB A;  5I7I A;  3FVK A;  1B7U A;  1YYZ A;  4KD5 A;  4P47 A;  1AMF A;  3S9N C;  2HPG A;  2HZL A;  2QSX A;  3RQT A;  4LZ5 A;  1KA1 A;  1IMC A;  3KSJ A;  1FTL A;  1OLA A;  2RKM A;  4PFI A;  2P1S A;  3H6W A;  5EYF A;  3SEU A;  1A8F A;  4R2F A;  3KOS A;  1GVC A;  3OEN A;  5A5X A;  1NNF A;  3TQW A;  2Z22 A;  5H8Q B;  3MPK A;  2FBP A;  1Q35 A;  4OVJ A;  4G77 A;  4TQU Q;  2BJJ X;  2HZK A;  3MP1 A;  4MNC A;  1QUK A;  4AQ4 A;  2DXY A;  4TOZ A;  4G2Z A;  1B0L A;  4NF6 B;  3G3J A;  1MPC A;  3MZB A;  4UAB A;  3R6U A;  2H4I A;  1MDP 1;  3H3G A;  5KDT A;  5TPA B;  4R6Y A;  3CFL A;  1FPK A;  4OQO A;  4I62 A;  3MPL A;  2FYI A;  3TCG A;  4NGU A;  2DWA A;  4OER A;  4P1L A;  3D1R A;  2UVG A;  4DZ1 A;  5I57 A;  4GOT A;  1FRP A;  4JXI A;  1ZU0 A;  4OVS A;  4XFE A;  3IB1 A;  1MY3 A;  1SW1 A;  1B9J A;  4DE8 A;  5CBR A;  4JBZ A;  4ZEI A;  3VXB A;  1NNP A;  3PMV A;  2XXX A;  4EQ7 A;  3IO6 A;  1ZIU A;  1ZJL A;  4NF5 B;  4PAF A;  4I3E A;  4OFO A;  3LUY A;  4ZEF A;  2F7B A;  1USY E;  1S50 A;  1B52 A;  5CMB A;  3JYR A;  2CEX A;  2P3V A;  3TKD A;  2B4M A;  5DW8 A;  5I2N B;  3HHG A;  4MCO A;  2I58 A;  1LCF A;  3ODB A;  4MAG A;  3PPN A;  1OQH A;  3FJM A;  2Y7I A;  1T0K A;  4KR5 A;  3O2A A;  2PYY A;  2QMX A;  3FUZ A;  2F35 A;  1R9Q A;  3VLW A;  3TEL A;  2UVJ A;  1XOC A;  3SEW A;  3EN3 A;  2XX9 A;  1OLC A;  1IMF A;  4G4P A;  3OEM A;  2A5S A;  3U8Q A;  1DSN A;  4ZE8 A;  4O7M A;  5DVF A;  1MQD A;  4YU0 A;  2Q74 A;  1LBX A;  3B7D A;  4H1X A;  1MXW A;  4P8B A;  1LST A;  4IO7 A;  1A7L A;  4F2Q A;  3VLU A;  4R72 A;  2H5Y A;  4RK2 A;  4IR8 A;  3L6G A;  3SDF A;  1OQG A;  1IXI A;  1ZBM A;  2B65 A;  4PET A;  1P1N A;  2OX3 A;  3OOA A;  4KPT A;  5EHS A;  4GX6 A;  2Y7K A;  1NI9 A;  4LVQ A;  5TP9 B;  3TCF A;  3QXM A;  4MLQ A;  4LZ8 A;  1LFI A;  4OZ9 A;  4GFR A;  3U94 A;  5I2K A;  4GQO A;  4JVC A;  4PFT A;  2R8T A;  1FBF A;  4U22 A;  3OO7 A;  3CFZ A;  1ATG A;  2F97 A;  4AS5 A;  1B51 A;  2UYF A;  3DEL B;  4DCY A;  4OFL A;  3VVD A;  1JEU A;  3L6H A;  4PDH A;  2CZH A;  1Y1M A;  4R9F A;  3BIG A;  1MH4 A;  4PFW A;  5TU0 A;  2HCA A;  4G8M A;  4R73 A;  5CRY A;  4R75 A;  4DXB A;  1FPG A;  1MXX A;  2O84 X;  5ET8 A;  4E0W A;  4LAT A;  2YJP A;  2P0S A;  1B2H A;  5AA4 A;  4NF6 A;  3VVF A;  3KN7 A;  4ZE9 A;  4HCW A;  5K2X A;  3QIM A;  4H8I A;  4OVQ A;  3E78 A;  3SET A;  4I40 A;  1D9Q A;  5F24 A;  4MH5 A;  2QS2 A;  3Q25 A;  4G68 B;  4H45 A;  5KCJ A;  2ZYO A;  3RTF B;  2YLN A;  4KCD A;  3CSB A;  2ZYK A;  3MVY A;  3RN8 A;  4QFP A;  4YKI A;  3EHT A;  2OJT A;  5BWJ A;  3CR9 A;  3O6H A;  1LBB A;  3T66 A;  3PPO A;  4OVT A;  1IZ1 A;  2A5T A;  4OWD A;  4ZED A;  4OVR A;  4KI0 E;  3EQ1 A;  2AL5 A;  4ZEK A;  1JVY A;  2XX7 A;  4O94 A;  5AA2 A;  3D4G A;  3PU5 A;  3V83 A;  1EZP A;  2Y7W A;  2FNC A;  5IM2 A;  1EH3 A;  3S9L C;  2Q2A A;  2YPN A;  4IO6 A;  2XWO A;  1HSL A;  5F7V A;  5ITP A;  2A5T B;  3W15 C;  3QYT A;  4IB2 A;  3TFL A;  1MQH A;  4KYD A;  1J1N A;  3H6T A;  3EPE A;  3LSF B;  4PTK A;  5F1Q A;  4OTE A;  3TZA A;  4PFB A;  2H25 A;  1YCJ A;  4P0G A;  1YTV A;  2ZXT A;  4R6K A;  3K2D A;  5M2V A;  3B6W A;  4FBP A;  1SYH A;  4O3C A;  2XD2 A;  1TWY A;  2Z8F A;  5IGA A;  2F3D A;  1B40 A;  1ZMG A;  4TLL B;  5AA4 B;  3C4M A;  2PFY A;  4I8C A;  5CC2 A;  2DQV A;  2PT1 A;  3IL1 B;  4U4S A;  2XWV A;  2WYP A;  4JB7 A;  4BDQ A;  1QUI A;  1PDA A;  3OMB A;  2I4C A;  2RCB A;  3KOT A;  2ZNU A;  5H8N A;  3SEX A;  4FOR A;  1INP A;  4XTC Q;  1BKA A;  4YKK A;  4Q8R A;  3C9H A;  4ONY A;  3G3G A;  5ET7 A;  5IZ3 A;  1US4 A;  4X1D A;  1POT A;  1IXC A;  5DEX A;  2Z8D A;  2WX9 A;  1FQB A;  1FTO A;  4ZZA A;  3HPI A;  3MVZ A;  4ZEB A;  4OXV A;  3QAX A;  1NL5 A;  1NUY A;  5L8D A;  4FIM A;  3FJ7 A;  4F31 B;  1NUW A;  3C32 A;  4F39 A;  4ESW A;  1FPD A;  1EYK A;  4F19 A;  2W7Y A;  4X9T A;  2ONR A;  1Y4T A;  3CIJ A;  4R74 A;  2O7U A;  2X7P A;  4HW8 A;  2G93 A;  1NV6 A;  2CEY A;  2THI A;  2QPQ A;  1N04 A;  1BTJ A;  5DT6 A;  2HFB A;  3BIH A;  5EQ8 A;  4QFN A;  4NWD A;  1VSO A;  3O66 A;  4PFU A;  5DTB A;  5TPA A;  3RPL A;  3B6T A;  3UN6 A;  5FHN A;  3ILU B;  5EYG A;  1Z7M E;  2XXR A;  2MKZ A;  3IOR A;  1DPE A;  3P7I A;  4PC9 A;  1H76 A;  2FA7 A;  4P1E A;  4U4X A;  1QKB A;  2XXK A;  3TAJ A;  2Y84 A;  4LZ7 A;  1NNT A;  1JW1 A;  2OLB A;  1I6B A;  1QGX A;  3WAE A;  1MPB A;  1MM6 A;  3FJG A;  1VFD A;  2DXR A;  4OEU A;  1PC3 A;  3QUJ A;  4JDF A;  4BDM A;  2UVI A;  4KXP A;  4PF6 A;  2ONS A;  2DVZ A;  3T1B A;  4HXV A;  4G68 A;  4MLV A;  1YXI A;  1FTJ A;  1ZKB A;  4NED A;  3KN3 A;  1OMP A;  4YB6 A;  1FW0 A;  2OWT A;  3FVO A;  4BDO A;  1BLF A;  4N4U A;  5HPQ A;  5I2N A;  1SDX A;  1FQA A;  1UTB B;  5DVI A;  4M4G A;  4GBW A;  2I4B A;  3FXU A;  4C0R A;  3MST A;  3PUX E;  4F3G A;  2OBG A;  2WKY A;  3ZKK A;  3CG3 A;  2NOO A;  2QVU A;  1XVY A;  1Y3Q A;  2HXR A;  4ELR A;  4PAI A;  3BFU A;  1AOV A;  4N6P A;  1A99 A;  3RPL B;  2D5W A;  4ELP A;  1I6Q A;  4GIZ A;  4KQP A;  1D9Y A;  5BUU A;  4H5G A;  4H65 A;  1FPI A;  2ABH A;  2HXW A;  4Z7E A;  1FQF A;  2I48 A;  1NH8 A;  3OO6 A;  1MXY A;  3VDF A;  1JEV A;  2Y7P A;  4RY1 A;  1QW0 A;  3TMG A;  4RNS A;  1N76 A;  3E79 A;  2KR0 A;  2KQZ A;  2O7I A;  4LQ5 A;  3TOD A;  1Y9U A;  5J1D A;  3FAT A;  1LLS A;  4GWX A;  1B3F A;  2DWI A;  5KDT B;  1D9V A;  3SES A;  1YAE A;  3TTL A;  1USY H;  3MYU A;  4KYE A;  3A3U A;  1TFA A;  5ITO A;  1NKX A;  1GR2 A;  4C1U A;  3UA8 A;  3KBR A;  4OES A;  3H06 B;  3H4Z A;  4HE2 A;  1RKM A;  1MPD A;  1FPF A;  2F5X A;  4MIJ A;  4LP2 B;  4BDR A;  2V84 A;  4X48 A;  4DI4 B;  2XX8 A;  4GWO A;  3V5A A;  3N94 A;  2UVH A;  3CHG A;  5H8Q A;  2ZNS A;  3DP8 A;  1DBZ A;  1FJ6 A;  4MNP A;  4GWW A;  3HV1 A;  3M3K A;  1WVJ A;  5L9O A;  4MMP A;  3RY3 A;  5IZZ A;  2PVU A;  5DYH A;  5EQ7 A;  1FCK A;  1LBV A;  1M5D A;  1O64 A;  3PTY A;  3CSG A;  5FTI A;  3VXC A;  5I5P A;  4UA8 A;  3U1O A;  2ALU A;  3IJX B;  4MF3 A;  1A55 A;  1FBP A;  3DP6 A;  4L17 A;  1B4Z A;  3FIR A;  3OSR A;  2DE4 A;  3K6U A;  3K02 A;  2X7Q A;  4YB7 A;  3KEI A;  1BK4 A;  3KC1 A;  1DOT A;  1EYI A;  3KSX A;  4PE5 B;  4IGT A;  2FIX A;  4U23 A;  5K2Y A;  4N07 A;  4ESX A;  1DTG A;  1FBH A;  2CZK A;  2I6E A;  4I1D A;  4N6K A;  1NH7 A;  5LDZ A;  2WBB A;  3C31 A;  4F3S A;  2DYX A;  5LOM A;  2H99 A;  1IUD A;  1DPP A;  4THI A;  4H46 A;  2QS3 A;  1LBZ A;  1CB6 A;  3FD3 A;  2JJK A;  4XKQ A;  1NUZ A;  2QRY A;  3T0J A;  3RT6 B;  1II5 A;  3U93 A;  3T96 B;  3K6V A;  2ZNT A;  2V3Q A;  1XC1 A;  4RPN A;  3JZJ A;  3G3K A;  2QS1 A;  2RC8 A;  5I3S A;  3KN8 A;  3EHU A;  5JEI A;  2FIE A;  1B58 A;  3E4R A;  1A54 A;  4ZS9 A;  1OVB A;  1S9T A;  4OVP A;  5DVJ A;  3GBA A;  5AA2 B;  4FJP A;  2XXQ A;  1OVT A;  4PFR A;  2QMW A;  4HS7 A;  2F7A A;  4G8N A;  3H6V A;  4ELO A;  2PBW A;  4JVI A;  4DDD A;  3LSW A;  3C33 A;  5CI5 A;  4NF4 B;  1LBY A;  1FPJ A;  2F36 A;  1IMB A;  1P1O A;  4H6D A;  1IIT A;  4NMY A;  1B46 A;  1Y3N A;  5KZT A;  4P0I A;  2F6P A;  4RK9 A;  4X8R A;  1Y4C A;  2V4C A;  1Z7N E;  4N91 A;  4WXJ A;  2QS4 A;  1UTB A;  3B6Q A;  1JW4 A;  3TPA A;  3IB0 A;  3I5O A;  1NUX A;  4PGP A;  1FPE A;  4QXD A;  5ET6 A;  4GWU A;  3S9M C;  5AA3 A;  4DIG A;  4MHF A;  3RLF E;  4YKJ A;  5EQ9 A;  3S2V A;  4GL0 A;  2ZYN A;  3MC2 A;  2O1M A;  1QJM A;  3K6X A;  1MM7 A;  3AXF A;  3T9V A;  1UTH B;  4MX6 A;  2DVC A;  4N81 A;  1POY 1;  4RPO A;  5H8F B;  1B32 A;  2OWZ A;  1B7H A;  4NTL A;  3U65 A;  4H5F A;  4RA1 A;  4N15 A;  4YMA A;  1K9Y A;  4MJO A;  1FBG A;  4F1V A;  3MZ1 A;  1JET A;  2O69 A;  4NF8 A;  4GWS A;  4GRK A;  3MQ9 A;  4EF1 A;  1HSJ A;  1NV3 A;  1FJ9 A;  4UAC A;  4P11 A;  4YIC A;  5I57 B;  4PP0 A;  1EZO A;  4XKP A;  3W9W A;  4WED A;  4PGN A;  1P1U A;  2AL4 A;  3BFT A;  2VP1 A;  3LUZ A;  3I3V A;  5ESY A;  3A3C A;  3PMX A;  1DTZ A;  4HCY A;  1R9L A;  4IO2 A;  4LN5 A;  3CG1 A;  3USD A;  4FAT A;  4Q0C A;  4EQB A;  2DP8 A;  3MZ9 A;  4PAK A;  4POW A;  3VLV A;  1SI1 A;  3G3H A;  4MBP A;  1JW5 A;  4O3B A;  2Q88 A;  3K1N A;  5I84 A;  3H7M A;  4EXL A;  4QFL A;  1LAG E;  3TCH A;  1S7Y A;  4QSE A;  5IZ1 A;  5CM6 A;  3M3L A;  4ZZE A;  2QVV A;  1XHY A;  2NWJ A;  1B7Z A;  5EQA A;  1PB7 A;  3JV9 A;  4OAN A;  5EHM A;  4P9K A;  4JVD A;  1MH3 A;  2VT5 A;  2VPN A;  4U1Z A;  3MVX A;  4QSC A;  1WOD A;  2O51 A;  4EUO A;  4RXL A;  3K00 A;  4P56 A;  4PQJ A;  1D4N A;  1ZLQ A;  4IO4 A;  3Q29 A;  2AIX A;  1LB9 A;  1JP4 A;  3KJT A;  5IAI A;  1Q1K A;  2Y5K A;  1PBP A;  4IY5 A;  3EHS A;  3H03 A;  3UK4 A;  4NWC A;  3TEP A;  3K0V A;  2XWK A;  2M8C A;  3F11 A;  5EYH A;  3RT8 A;  1SW4 A;  4OET A;  4DLD A;  1EZ9 A;  1O63 A;  1IXG A;  1M5E A;  2I0C A;  2PCR A;  4EF2 A;  3VFJ A;  3S9E A;  2DOJ A;  4R9G A;  3MW0 A;  4XXU A;  1VFE A;  3PUZ E;  2ANJ A;  1XT8 A;  3KBZ A;  1SQY A;  5CMM A;  2Z23 A;  1I69 A;  2UYE A;  4POX A;  3FBP A;  4JSO A;  1K9Z A;  4BLA A;  4OA4 A;  2Q89 A;  3FGS A;  2REJ A;  2ZYM A;  4MNI A;  3PGF A;  3PUY E;  4LUB A;  2XXH A;  2DS9 A;  3O97 A;  3T93 B;  5ET5 A;  1H45 A;  3N5L A;  4AS4 A;  1IXH A;  3RNN A;  4O7I A;  2F34 A;  4LQ2 A;  3PPQ A;  4MEV A;  1M5C A;  4QFO A;  1MXU A;  5DEX B;  3PD9 A;  3U72 A;  3TTR A;  4NAP A;  1N3X A;  1N3W A;  3TDJ A;  3MVW A;  3OO8 A;  5A5X B;  3Q28 A;  3QK6 A;  2R6G E;  2QL3 A;  3B50 A;  3MWB A;  5J16 A;  4U21 A;  2OK2 A;  5ICQ A;  1MG1 A;  3GBB A;  3G3I A;  3IK6 B;  1NV2 A;  4IO3 A;  1MS7 A;  3O28 A;  3VE1 B;  1FQD A;  2XXT A;  4YKP A;  2VD2 A;  3GYY A;  4YZZ A;  2PFZ A;  2GH9 A;  4RJZ A;  2XA5 A;  1SVX B;  1CE2 A;  1BP5 A;  3HFU A;  3HO7 A;  3FXR A;  4GXA A;  4WEP A;  2XD3 A;  3PPP A;  3ILT B;  5CMC A;  1UIU A;  3EF7 A;  3LSL A;  1M5F A;  5A5L A;  4OEN A;  2OZZ A;  3B8B A;  4TLM B;  1TXF A;  1AL3 A;  4GLI A;  2DDK A;  1MXV A;  5H8F A;  3PMW A;  2Y7R A;  4FEC A;  5L9S A;  1FPL A;  1B5J A;  2OCU A;  5I59 A;  3IFC A;  4JWY A;  2VOZ A;  3N26 A;  1TT1 A;  3RUM A;  3T9H B;  2F6G A;  1B3G A;  1FSA A;  1Y1Z A;  4ISU A;  1UQW A;  3SKP A;  2VPO A;  4I3Y A;  3FVG A;  4I9D A;  4EQ9 A;  1KZ8 A;  3DP4 A;  4IO5 A;  4U2R A;  4RYA A;  3E3K A;  1PB9 A;  1PEB A;  2Z8E A;  1FQC A;  4Z0I A;  3RPW A;  4FAJ A;  4NQ8 A;  1B3E A;  1SPI A;  5ICT A;  1NFT A;  3UIF A;  2NXO A;  2O1L A;  1LBW A;  1IME A;  1RDZ A;  4JSD A;  5I2K B;  4N6D A;  1IIW A;  3M3F A;  4HTG A;  2LAO A;  3S4U A;  1MDQ A;  1SI0 A;  5I56 B;  3R7X A;  4NE4 A;  3KFM A;  3W9V A;  1FTM A;  4JWX A;  4NF5 A;  5B70 A;  3V8X B;  4FE8 A;  4H67 A;  3WAF A;  2WYK A;  1NV0 A;  3IAZ A;  1TFD A;  2PX1 A;  2ESN A;  3D4C A;  2V25 A;  4OHN A;  3SER A;  4QSD A;  4WKM A;  3K6W A;  2GHB A;  1B6H A;  1B1X A;  3FZV A;  5H8S A;  4F3P A;  2IA4 A;  2QVR A;  4BDL A;  5TP9 A;  2HEU A;  2GHA A;  4FEB A;  4OEV A;  3IOU A;  4X1B A;  4GF8 A;  3IOV A;  1URD A;  4EDP A;  3LC8 A;  2IEE A;  2HHM A;  5IZ3 B;  4NF8 B;  3FVN A;  5ISU A;  3IB2 A;  4EXK A;  5CBS A;  1MY4 A;  3IOT A;  1SYI A;  4P3L A;  2PT2 A;  3TTN A;  4NG7 A;  3IX1 A;  1EU8 A;  3O6G A;  1IQ7 A;  5JTY A;  4N8Y A;  3THI A;  4YB5 A;  1MXZ A;  4OFJ A;  1PBQ A;  3K4U A;  3E9X A;  4N17 A;  4GWY A;  2OWS A;  2WEF A;  3OEL A;  3OD7 A;  1FTA A;  5IKB A;  1G0I A;  2RC7 A;  4LON B;  2DWH A;  2I49 A;  4F29 A;  1KA0 A;  2HAV A;  5L9M A;  3K01 A;  1WDN A;  1MQG A;  1B0H A;  3MP8 A;  3T9U A;  4AB5 A;  3OEK A;  4KFQ A;  4O8M A;  1AWB A;  4F2O A;  4PF8 A;  1QUJ A;  4XKN A;  3TYH A;  3Q26 A;  3ROJ A;  3KC0 A;  1N7X A;  2O68 A;  5HBC A;  3M8U A;  2XHD A;  3PD8 A;  2CMO A;  3GZG A;  1XS5 A;  2AYS A;  2DE2 A;  4YAH X;  1L5T A;  3IFA A;  1SBP A;  3LV0 A;  1FBD A;  1FTK A;  4Q30 B;  1JNF A;  3HN0 A;  3HCQ A;  1N0T A;  3MUQ A;  4F22 A;  4ND9 A;  3RGY A;  3KJ7 A;  3ZKL A;  3QSL A;  1GTK A;  1PB8 A;  2I3V A;  2B3B A;  4ECF A;  2GRV A;  2I3W A;  3ISP A;  2O6A A;  5AA1 A;  4XEQ A;  1LBC A;  2P3N A;  2XXY A;  2P2A A;  4XKR A;  4ZEC A;  3PUV E;  5LTC A;  5FTH A;  2BJI A;  5CMK A;  4GXS B;  4F1Y A;  1HSE A;  2F3B A;  1URS A;  4QF9 A;  3HST A;  3QMF A;  5AA2 D;  4K3F A;  3KGC A;  2GFE A;  3U92 A;  3CI8 A;  3FXQ A;  3PPR A;  3CVG A;  2RCA A;  3T9X B;  3TTM A;  3GXA A;  4F1U A;  3HHF A;  2ZMB A;  5I58 A;  3ZS6 A;  1KWH A;  2FHY A;  3H6U A;  4PDD A;  4ZDM A;  4M1V A;  2PMS A;  4X04 A;  3RTW B;  1MY1 A;  4NN3 A;  1N84 A;  1LFH A;  3O29 A;  4BDN A;  1IEJ A;  4PBH A;  1DCU A;  1XI6 A;  1B5I A;  2F8D A;  3BBR A;  1M5B A;  4C1T A;  4E0X A;  4QHQ A;  1EYJ A;  4GBV A;  2WBD A;  1QUL A;  3NOH A;  1NV5 A;  3PUW E;  4G8H A;  1RYX A;  4GX3 A;  4YMB A;  5H8N B;  1ELJ A;  1G0H A;  2R71 A;  2HQ0 A;  5JTY B;  2E0S A;  2V3U A;  3N6T A;  4H0W A;  3OXN A;  4N8G A;  3DM0 A;  3EKI A;  5FHM A;  1Y20 A;  1IMA A;  1B3L A;  2X26 A;  2VD3 A;  1CNQ A;  2XXW A;  4PBQ A;  3MBP A;  1OIB A;  1A8E A;  5FHO A;  1N7W A;  1Y3P A;  1FBE A;  1P1W A;  3IOW A;  3LBS A;  2XXP A;  1IMD A;  1GV8 A;  5T3J A;  3K1P A;  2I0B A;  1VDW A;  4FED A;  2FVZ A;  4G61 A;  1NMU A;  3LR1 A;  1R6Z A;  2H9B A;  1YPN A;  4H8J A;  3I6V A;  4QRZ A;  3DLN A;  4R6H A;  2CZL A;  3RYD A;  1H3D A;  2Q8J A;  4Q5T A;  1LAF E;  3MP6 A;  3C36 A;  3QUF A;  2H98 A;  2F7C A;  2Q8M A;  1RDX A;  2XWI A;  1AH5 A;  3TQL A;  5B7D A;  4F18 A;  5I56 A;  1B1H A;  3OO9 A;  2RF1 A;  2QFL A;  1NNK A;  1JVX A;  1XVX A;  3SEY A;  2UXA A;  4F3B A;  1MRP A;  2D21 A;  3O6I A;  2V93 A;  4AB6 A;  1LFG A;  3CFX A;  1SD3 A;  2F78 A;  2ZZX A;  1LAX A;  1FBC A;  5ELV A;  4MFI A;  4LA9 A;  3UP9 A;  1B4H A;  4OYV A;  1NV7 A;  4DI3 D;  4PCD A;  1DK4 A;  1US5 A;  2DWJ A;  4NX1 A;  3MJN A;  1B3H A;  3MAM A;  3OSQ A;  1LEV A;  1LCT A;  4XIG Q;  2DE3 A;  2ZZW A;  1LB8 A;  3FV1 A;  1A40 A;  2RC9 A;  2R9J A;  2E1S A;  2HAU A;  3BKI B;  4DCX A;  4G68 C;  3G7W A;  4N13 A;  1MQI A;  4NF0 A;  2REG A;  1VR5 A;  1P99 A;  1SW5 A;  1QVS A;  3IJO B;  3C34 A;  2KLF A;  1B5H A;  5AE4 A;  1YZ0 A;  1UIV A;  4R2B A;  1H44 A;  3FAS A;  1MY0 A;  3KZG A;  2NUV A;  2Y5L A;  3G3F A;  3ONM A;  3CRB A;  3Q27 A;  2VHA A;  1ZTY A;  3UOR A;  3IR1 A;  2G29 A;  1GGG A;  1MQJ A;  1R1N A;  3GLB A;  1JQF A;  1RYO A;  1LAH E;  3A09 A;  2GQ1 A;  3R26 A;  4U1O A;  2V3T A;  3UGW A;  5HM4 B;  5JK4 A;  1AIV A;  5I58 B;  3E13 X;  2Q9T A;  4IGR A;  4IY6 A;  3SZP A;  1FPB A;  1URG A;  2B3F A;  1FQE A;  3VVE A;  4JWO A;  4QBA A;  5KCJ B;  4GVO A;  1SW2 A;  2ZZV A;  2XXU A;  3N6U A;  3A29 A;  3TTK A;  3T22 A;  3K1M A;  3IO4 A;  1B05 A;  4HE1 A;  1F9B A;  1I6A A;  2CZI A;  5FBP A;  3KG2 A;  4XF5 A;  2D3I A;  1MY2 A;  3VV5 A;  2VGQ A;  1UTH A;  1NV1 A;  5I59 B;  2DSF A;  2QJE A;  4KYS A;  3LSX A;  4OMB A;  2Q2C A;  1LGB C;  4DXU A;  2XXI A;  1D3K A;  3PV0 E;  3ZSF A;  4GWZ A;  4PE3 A;  1ANF A;  4QFK A;  3SEV A;  3ECR A;  4ELQ A;  4GL8 A;  2RIN A;  1O7T A;  1H43 A;  1NV4 A;  2L5V A;  2XXV A;  4GD5 A;  3TUS A;  4HE0 A;  3C35 A;  1QKA A;  2ONK E;  1DMB A;  3FV2 A;  1VE4 A;  4KCC A;  4DXC A;  4PFY A;  1RDY A;  2NVU B;  2B4L A;  1P1Q A; 
#chains in the Genus database with same CATH homology
 1Y4T A;  4GRK A;  3CIJ A;  4R74 A;  3MQ9 A;  2O7U A;  2X7P A;  4F2O A;  4EF1 A;  4HW8 A;  1HSJ A;  2G93 A;  1QUJ A;  4XKN A;  1BIY A;  2THI A;  4O3A A;  4UAC A;  3TYH A;  4P11 A;  5AA4 B;  2QPQ A;  1N04 A;  4YIC A;  3Q26 A;  5I57 B;  4PP0 A;  1BTJ A;  1EZO A;  4XKP A;  5DT6 A;  3W9W A;  4WED A;  2HFB A;  4QFN A;  4NF4 A;  4NWD A;  1P1U A;  2AL4 A;  1VSO A;  1N7X A;  2O68 A;  2VP1 A;  3BFT A;  3I3V A;  3O66 A;  3O9P A;  4KHZ E;  3A3C A;  4PFU A;  3PMX A;  5DTB A;  5HBC A;  5TPA A;  1DTZ A;  4HCY A;  3B6T A;  1R9L A;  3UN6 A;  4IO2 A;  3M8U A;  5FHN A;  2XHD A;  5H8H A;  3CG1 A;  3PD8 A;  2CMO A;  3USD A;  3FVK A;  1B7U A;  3ILU B;  3GZG A;  4Q0C A;  4EQB A;  1XS5 A;  2AYS A;  1Z7M E;  2DP8 A;  2DE2 A;  2XXR A;  3MZ9 A;  4KD5 A;  3IOR A;  1AMF A;  1DPE A;  3P7I A;  2HZL A;  4POW A;  2QSX A;  3TTL A;  3S9N C;  3RQT A;  3WAF A;  4LZ5 A;  3VLV A;  1H76 A;  2FA7 A;  4YAH X;  1L5T A;  1SI1 A;  3G3H A;  3KSJ A;  4MBP A;  4U4X A;  1FTL A;  1JW5 A;  1OLA A;  1QKB A;  4O3B A;  3TAJ A;  1SBP A;  2Q88 A;  2RKM A;  1FTK A;  2P1S A;  2Y84 A;  4LZ7 A;  3K1N A;  4Q30 B;  5I84 A;  3H6W A;  5EYF A;  1NNT A;  3H7M A;  3SEU A;  1JNF A;  4EXL A;  1JW1 A;  1A8F A;  4R2F A;  4QFL A;  2OLB A;  3KOS A;  1I6B A;  3HN0 A;  1LAG E;  1GVC A;  3TCH A;  3HCQ A;  3OEN A;  5A5X A;  1S7Y A;  1N0T A;  4QSE A;  3WAE A;  1MPB A;  5CM6 A;  3MUQ A;  4F22 A;  1MM6 A;  3M3L A;  3FJG A;  1VFD A;  2DXR A;  4OEU A;  4ZZE A;  1NNF A;  1PC3 A;  3QUJ A;  4JDF A;  4ND9 A;  2Z22 A;  3KJ7 A;  3RGY A;  3TQW A;  3QSL A;  1XHY A;  2NWJ A;  1B7Z A;  3ZKL A;  2UVI A;  1GTK A;  1PB7 A;  1PB8 A;  3JV9 A;  5H8Q B;  5HPQ A;  3MPK A;  2I3V A;  2ONS A;  2DVZ A;  5EHM A;  2B3B A;  4ECF A;  1Q35 A;  2GRV A;  2I3W A;  4G77 A;  4G68 A;  4OVJ A;  1MH3 A;  2O6A A;  4MLV A;  4TQU Q;  5AA1 A;  1LBC A;  2XXY A;  2P2A A;  4U1Z A;  1FTJ A;  1ZKB A;  2BJJ X;  4XKR A;  4ZEC A;  2HZK A;  3PUV E;  3MVX A;  3MP1 A;  4NED A;  4QSC A;  3KN3 A;  1QUK A;  1OMP A;  1WOD A;  2O51 A;  4EUO A;  4YB6 A;  1FW0 A;  4AQ4 A;  2DXY A;  2OWT A;  3FVO A;  4BDO A;  1BLF A;  4RXL A;  3K00 A;  4TOZ A;  5FTH A;  4PQJ A;  1D4N A;  5CMK A;  4GXS B;  1ZLQ A;  4G2Z A;  4F1Y A;  1HSE A;  5I2N A;  4IO4 A;  1SDX A;  1URS A;  3Q29 A;  1B0L A;  2AIX A;  4NF6 B;  4QF9 A;  1LB9 A;  1MPC A;  3G3J A;  3HST A;  1Q1K A;  3KJT A;  1FQA A;  1UTB B;  1PBP A;  3MZB A;  4IY5 A;  5AA2 D;  3EHS A;  5DVI A;  4K3F A;  3H03 A;  4M4G A;  3R6U A;  3UK4 A;  2H4I A;  4NWC A;  1MDP 1;  3K0V A;  3KGC A;  3F11 A;  2M8C A;  2GFE A;  3U92 A;  3H3G A;  3TEP A;  3CI8 A;  3FXQ A;  2I4B A;  3PPR A;  5TPA B;  3FXU A;  4R6Y A;  5KDT A;  3CFL A;  3CVG A;  4OQO A;  2RCA A;  4C0R A;  3PUX E;  4I62 A;  4F3G A;  3MPL A;  3T9X B;  3TTM A;  2FYI A;  2OBG A;  2WKY A;  3GXA A;  4F1U A;  3TCG A;  3ZKK A;  3RT8 A;  3HHF A;  2ZMB A;  1SW4 A;  3CG3 A;  5I58 A;  4OET A;  3ZS6 A;  1KWH A;  2NOO A;  2DWA A;  4OER A;  3H6U A;  1XVY A;  4ZDM A;  4M1V A;  4FAT A;  4DLD A;  1Y3Q A;  4ELR A;  2PMS A;  2UVG A;  4DZ1 A;  1EZ9 A;  5I57 A;  1O63 A;  1IXG A;  1M5E A;  3RTW B;  3BFU A;  4GOT A;  2I0C A;  4JXI A;  1MY1 A;  1AOV A;  4N6P A;  4EF2 A;  3VFJ A;  1ZU0 A;  1N84 A;  1LFH A;  3S9E A;  3O29 A;  2DOJ A;  4BDN A;  1A99 A;  1IEJ A;  3IB1 A;  4R9G A;  1MY3 A;  1SW1 A;  1B9J A;  3MW0 A;  4XXU A;  4DE8 A;  5CBR A;  2D5W A;  4JBZ A;  4ZEI A;  3VXB A;  4ELP A;  1NNP A;  1I6Q A;  4GIZ A;  1VFE A;  3PMV A;  2XXX A;  3PUZ E;  4KQP A;  1D9Y A;  1B5I A;  2ANJ A;  4EQ7 A;  5BUU A;  3IO6 A;  4H5G A;  1XT8 A;  4H65 A;  2F8D A;  3BBR A;  1M5B A;  2ABH A;  4C1T A;  1ZIU A;  1SQY A;  1ZJL A;  2HXW A;  4NF5 B;  1FQF A;  4E0X A;  4Z7E A;  4QHQ A;  5CMM A;  2Z23 A;  2I48 A;  1NH8 A;  1I69 A;  3OO6 A;  2UYE A;  4OFO A;  3LUY A;  4POX A;  4ZEF A;  1MXY A;  1USY E;  2F7B A;  1QUL A;  3VDF A;  4JSO A;  1JEV A;  2Y7P A;  1S50 A;  4BLA A;  1B52 A;  5CMB A;  4RY1 A;  2Q89 A;  3JYR A;  3FGS A;  2REJ A;  2ZYM A;  1QW0 A;  3PUW E;  4G8H A;  3TMG A;  4RNS A;  1N76 A;  1RYX A;  3PGF A;  3TKD A;  3PUY E;  5I2N B;  4LUB A;  2O7I A;  2XXH A;  4YMB A;  2DS9 A;  3O97 A;  3HHG A;  5H8N B;  3T93 B;  2I58 A;  1LCF A;  4LQ5 A;  3TOD A;  3ODB A;  1Y9U A;  5J1D A;  1ELJ A;  1H45 A;  2R71 A;  2HQ0 A;  3N5L A;  3PPN A;  3FAT A;  1IXH A;  1LLS A;  5JTY B;  3RNN A;  2E0S A;  1B3F A;  1OQH A;  2V3U A;  2F34 A;  3N6T A;  4LQ2 A;  4Q8R A;  2DWI A;  3FJM A;  4H0W A;  2Y7I A;  3PPQ A;  1D9V A;  5KDT B;  1T0K A;  3OXN A;  1YAE A;  3O2A A;  1USY H;  4KR5 A;  1M5C A;  2PYY A;  2QMX A;  3FUZ A;  4KYE A;  4QFO A;  1MXU A;  2F35 A;  1R9Q A;  3DM0 A;  5DEX B;  3A3U A;  1TFA A;  3TEL A;  3VLW A;  5FHM A;  1NKX A;  1Y20 A;  2UVJ A;  1B3L A;  1GR2 A;  2X26 A;  3PD9 A;  5ITO A;  3TTR A;  3KBR A;  4OES A;  1XOC A;  3SEW A;  2VD3 A;  3H06 B;  3UA8 A;  1N3X A;  2XXW A;  1N3W A;  3TDJ A;  3EN3 A;  3H4Z A;  2XX9 A;  1OLC A;  1RKM A;  1MPD A;  3MVW A;  4G4P A;  3OEM A;  3OO8 A;  3MBP A;  5A5X B;  1OIB A;  2A5S A;  2F5X A;  3Q28 A;  3QK6 A;  2R6G E;  3U8Q A;  4LP2 B;  2QL3 A;  4BDR A;  2V84 A;  1DSN A;  4X48 A;  3MWB A;  2XX8 A;  1A8E A;  4GWO A;  5FHO A;  4ZE8 A;  3V5A A;  3N94 A;  1N7W A;  1Y3P A;  2UVH A;  4U21 A;  2OK2 A;  5ICQ A;  1P1W A;  1MG1 A;  3GBB A;  5DVF A;  3G3I A;  3IK6 B;  4IO3 A;  1MQD A;  1MS7 A;  3IOW A;  4YU0 A;  3O28 A;  5H8Q A;  3VE1 B;  1FQD A;  2ZNS A;  3B7D A;  4H1X A;  3DP8 A;  3LBS A;  2XXT A;  4YKP A;  2XXP A;  1MXW A;  2VD2 A;  4YZZ A;  1GV8 A;  1LST A;  4IO7 A;  1A7L A;  3HV1 A;  3K1P A;  2I0B A;  4F2Q A;  2GH9 A;  3M3K A;  3VLU A;  1WVJ A;  4FED A;  2H5Y A;  4R72 A;  4RJZ A;  5L9O A;  1SVX B;  1CE2 A;  1BP5 A;  4RK2 A;  3HO7 A;  3L6G A;  3SDF A;  1OQG A;  3FXR A;  3RY3 A;  4GXA A;  1IXI A;  1NMU A;  1ZBM A;  2B65 A;  2XD3 A;  1P1N A;  3LR1 A;  1R6Z A;  3OOA A;  2H9B A;  4KPT A;  2PVU A;  4PET A;  5EHS A;  1YPN A;  4H8J A;  2Y7K A;  3I6V A;  3PPP A;  3DLN A;  4QRZ A;  4LVQ A;  4R6H A;  5DYH A;  3ILT B;  5CMC A;  5TP9 B;  3TCF A;  2CZL A;  1UIU A;  4C1U A;  3QXM A;  4MLQ A;  1H3D A;  3EF7 A;  3LSL A;  1FCK A;  1M5F A;  1M5D A;  1O64 A;  4OEN A;  2OZZ A;  2Q8J A;  3CSG A;  1LFI A;  4LZ8 A;  5FTI A;  4BDM A;  4Q5T A;  4OZ9 A;  3VXC A;  4GFR A;  4TLM B;  1LAF E;  1TXF A;  3MP6 A;  4UA8 A;  1AL3 A;  3U1O A;  3C36 A;  2ALU A;  3QUF A;  5H8H B;  3U94 A;  5I2K A;  2H98 A;  4GLI A;  3IJX B;  2F7C A;  1A55 A;  1MXV A;  4MF3 A;  4GQO A;  5H8F A;  4PFT A;  3DP6 A;  1AH5 A;  4L17 A;  3PMW A;  2Y7R A;  3TQL A;  4U22 A;  5B7D A;  3OO7 A;  3V89 B;  4F18 A;  3CFZ A;  1B4Z A;  1ATG A;  3FIR A;  2DE4 A;  3K6U A;  3K02 A;  3OSR A;  1B1H A;  2F97 A;  4FEC A;  2X7Q A;  4WEP A;  4YB7 A;  3OO9 A;  3KEI A;  5L9S A;  1B51 A;  2RF1 A;  2UYF A;  3DEL B;  1NNK A;  4DCY A;  1DOT A;  3KSX A;  1B5J A;  1JVX A;  4OFL A;  2OCU A;  1XVX A;  4PE5 B;  2UXA A;  4IGT A;  3SEY A;  3VVD A;  5I59 A;  4F3B A;  1JEU A;  3L6H A;  1Y1M A;  4R9F A;  4U23 A;  5K2Y A;  4JWY A;  4N07 A;  1MRP A;  2D21 A;  2VOZ A;  3O6I A;  4ESX A;  1MH4 A;  1DTG A;  3N26 A;  4PFW A;  5TU0 A;  2V93 A;  2I6E A;  4I1D A;  1TT1 A;  1LFG A;  4AB6 A;  2HCA A;  1NH7 A;  3CFX A;  4G8M A;  3RUM A;  2F6G A;  3T9H B;  1B3G A;  1SD3 A;  1Y1Z A;  4R73 A;  3C31 A;  4ISU A;  5CRY A;  4R75 A;  2DYX A;  4F3S A;  4DXB A;  2O84 X;  1MXX A;  2F78 A;  5LOM A;  2H99 A;  1UQW A;  4E0W A;  4LAT A;  1IUD A;  1DPP A;  2YJP A;  2P0S A;  3SKP A;  1LAX A;  4THI A;  1B2H A;  3FVG A;  2QS3 A;  4MFI A;  4LA9 A;  4NF6 A;  3KN7 A;  5ELV A;  3VVF A;  5AA4 A;  4ZE9 A;  3UP9 A;  1B4H A;  4HCW A;  5K2X A;  4OYV A;  1CB6 A;  4I9D A;  3FD3 A;  4EQ9 A;  3QIM A;  3DP4 A;  4H8I A;  4IO5 A;  4U2R A;  4XKQ A;  4RYA A;  1US5 A;  4EDP A;  3E3K A;  3SET A;  1PB9 A;  2DWJ A;  2QRY A;  3MJN A;  1B3H A;  1PEB A;  2Z8E A;  3RT6 B;  1II5 A;  1FQC A;  4MH5 A;  4Z0I A;  3MAM A;  3OSQ A;  3U93 A;  3RPW A;  1LCT A;  4XIG Q;  4FAJ A;  2QS2 A;  3Q25 A;  4G68 B;  1B3E A;  2DE3 A;  3T96 B;  3K6V A;  1LB8 A;  2ZYO A;  3FV1 A;  5ICT A;  5KCJ A;  2ZNT A;  3RTF B;  2V3Q A;  2YLN A;  4KCD A;  1A40 A;  1NFT A;  1XC1 A;  2RC9 A;  3CSB A;  3UIF A;  2ZYK A;  3JZJ A;  4RPN A;  2R9J A;  2NXO A;  2E1S A;  2HAU A;  2O1L A;  3BKI B;  3G3K A;  3MVY A;  3RN8 A;  4DCX A;  2QS1 A;  2RC8 A;  4QFP A;  4YKI A;  4JSD A;  5I2K B;  3EHT A;  2OJT A;  4G68 C;  5BWJ A;  5I59 B;  1IIW A;  3CR9 A;  3KN8 A;  3EHU A;  3M3F A;  3G7W A;  4HTG A;  5JEI A;  3O6H A;  1LBB A;  1MQI A;  2LAO A;  4N13 A;  3S4U A;  2REG A;  3T66 A;  1B58 A;  1VR5 A;  3E4R A;  3PPO A;  1P99 A;  1MDQ A;  1SI0 A;  1A54 A;  4ZS9 A;  1OVB A;  3R7X A;  5I56 B;  1S9T A;  1IZ1 A;  2A5T A;  1SW5 A;  4NE4 A;  1QVS A;  4OWD A;  4ZED A;  4KI0 E;  5IAI A;  5DVJ A;  3IJO B;  3C34 A;  3GBA A;  3EQ1 A;  3KFM A;  3W9V A;  1FTM A;  2KLF A;  2AL5 A;  4JWX A;  1B5H A;  4NF5 A;  5AA2 B;  4ZEK A;  1JVY A;  5AE4 A;  5B70 A;  3V8X B;  4FJP A;  2XXQ A;  4FE8 A;  2XX7 A;  1OVT A;  5AA2 A;  4H67 A;  2QMW A;  4HS7 A;  3D4G A;  1UIV A;  2F7A A;  1H44 A;  4G8N A;  4R2B A;  3FAS A;  3PU5 A;  1MY0 A;  3KZG A;  3V83 A;  1EZP A;  3H6V A;  3IAZ A;  2NUV A;  4ELO A;  2PBW A;  3G3F A;  3ONM A;  1TFD A;  4DDD A;  2PX1 A;  2Y7W A;  2ESN A;  2FNC A;  3D4C A;  3LSW A;  3CRB A;  3Q27 A;  1EH3 A;  1ZTY A;  2VHA A;  2Q2A A;  2YPN A;  3C33 A;  2V25 A;  4IO6 A;  3UOR A;  4OHN A;  3S9L C;  5CI5 A;  3SER A;  3IR1 A;  2G29 A;  1GGG A;  4QSD A;  3U72 A;  4NF4 B;  1MQJ A;  1R1N A;  4WKM A;  2F36 A;  3K6W A;  2GHB A;  1B6H A;  3GLB A;  1HSL A;  1B1X A;  1JQF A;  1RYO A;  1LAH E;  1P1O A;  3A09 A;  3FZV A;  4H6D A;  5F7V A;  1IIT A;  5H8S A;  5ITP A;  4NMY A;  4F3P A;  1B46 A;  2A5T B;  1Y3N A;  2IA4 A;  3R26 A;  4U1O A;  3W15 C;  2V3T A;  5TP9 A;  3QYT A;  4IB2 A;  3UGW A;  4BDL A;  5HM4 B;  5JK4 A;  2HEU A;  3TFL A;  1AIV A;  2GHA A;  4FEB A;  5I58 B;  3E13 X;  1MQH A;  2Q9T A;  5KZT A;  4KYD A;  4P0I A;  4OEV A;  2F6P A;  4IGR A;  3IOU A;  4X1B A;  1J1N A;  4GF8 A;  3IOV A;  1URD A;  3H6T A;  4IY6 A;  4RK9 A;  3EPE A;  3LC8 A;  3LSF B;  5F1Q A;  2IEE A;  4OTE A;  3TZA A;  2H25 A;  1YCJ A;  4NF8 B;  3FVN A;  1YTV A;  1Y4C A;  2ZXT A;  4P0G A;  3K2D A;  4R6K A;  5M2V A;  1Z7N E;  3IB2 A;  1URG A;  4WXJ A;  4EXK A;  5ISU A;  2B3F A;  1FQE A;  3B6W A;  3VVE A;  5CBS A;  1SYH A;  1MY4 A;  4O3C A;  2XD2 A;  4JWO A;  1TWY A;  2Z8F A;  3IOT A;  5KCJ B;  4GVO A;  1SW2 A;  1ZMG A;  1B40 A;  1SYI A;  2XXU A;  2PT2 A;  2QS4 A;  1UTB A;  3N6U A;  3C4M A;  3B6Q A;  1JW4 A;  4TLL B;  3IB0 A;  4I8C A;  3I5O A;  2DQV A;  3T22 A;  3TPA A;  2PT1 A;  3IL1 B;  3TTN A;  5CC2 A;  3IX1 A;  1EU8 A;  3IO4 A;  3K1M A;  4U4S A;  1B05 A;  4JB7 A;  4BDQ A;  3O6G A;  3S9M C;  5AA3 A;  1IQ7 A;  1F9B A;  1PDA A;  1I6A A;  1QUI A;  3OMB A;  4DIG A;  2I4C A;  2RCB A;  3KOT A;  3KG2 A;  4YKJ A;  2ZNU A;  3RLF E;  3S2V A;  5H8N A;  2D3I A;  5JTY A;  4GL0 A;  1MY2 A;  2ZYN A;  3MC2 A;  3SEX A;  2O1M A;  3THI A;  3VV5 A;  1QJM A;  2VGQ A;  4YB5 A;  1UTH A;  3K6X A;  1MXZ A;  4OFJ A;  1MM7 A;  4FOR A;  4XTC Q;  1PBQ A;  1BKA A;  4YKK A;  3K4U A;  3E9X A;  3AXF A;  2DSF A;  2QJE A;  3C9H A;  3G3G A;  3LSX A;  4KYS A;  4ONY A;  3T9V A;  4OMB A;  1UTH B;  2OWS A;  2Q2C A;  1LGB C;  1US4 A;  4X1D A;  2XXI A;  2DVC A;  4DXU A;  1D3K A;  3OEL A;  1POY 1;  3PV0 E;  4RPO A;  5H8F B;  1B32 A;  1POT A;  3ZSF A;  1IXC A;  3OD7 A;  2Z8D A;  5DEX A;  3SES A;  5IKB A;  1FQB A;  1ANF A;  1FTO A;  4QFK A;  4ZZA A;  3SEV A;  1B7H A;  3HPI A;  3ECR A;  3MVZ A;  4NTL A;  4ELQ A;  4H5F A;  4RA1 A;  4ZEB A;  4OXV A;  4GL8 A;  2RC7 A;  3QAX A;  4LON B;  2RIN A;  1O7T A;  2DWH A;  4YMA A;  1NL5 A;  1H43 A;  5L8D A;  4FIM A;  2XXV A;  2I49 A;  4GD5 A;  3FJ7 A;  4F31 B;  5I56 A;  4F29 A;  2HAV A;  5L9M A;  3C32 A;  4F39 A;  4ESW A;  3TUS A;  3K01 A;  3C35 A;  1WDN A;  4F1V A;  1MQG A;  1B0H A;  1QKA A;  1DMB A;  2ONK E;  3MP8 A;  3MZ1 A;  3T9U A;  4AB5 A;  3FV2 A;  1JET A;  2O69 A;  1VE4 A;  3OEK A;  4KFQ A;  4KCC A;  4NF8 A;  4DXC A;  4PFY A;  2NVU B;  4F19 A;  2W7Y A;  4X9T A;  2ONR A;  1P1Q A;  3TTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...