3ER8A

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with two fragments of rna
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
297
structure length
288
Chain Sequence
MDVVSLDKPFMYFEEIDNELDYEPESKLPYQGQLKLLLGELFFLSKLQRHGILDGATVVYIGSAPGTHIRYLRDHFYNLGVIIKWMLIDGRHHDPILNGLRDVTLVTRFVDEEYLRSIKKQLHPSKIILISDVASGNEPSTADLLSNYALQNVMISILNPVASSLKWRCPFPDQWIKDFYIPHGNKMLQPFAPSYSAEMRLLSIYTGENMRLTRVTKSDAVNYEKKMYYLNKIVRNKVVVNFDYPNQEYDYFHMYFMLRTVYCNKTFPTTKAKVLFLQQSIFRFLNIP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 89
structure length 288
sequence length 297
chains with identical sequence B
ec nomenclature ec 2.1.1.57: Methyltransferase cap1.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01358 PARP_regulatory Poly A polymerase regulatory subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3er8A00
2FK7A 5HIIA 3A27A 3HCEA 3G8BA 5K0BA 3LKZA 4RWZA 5LQCA 4OA8A 1AQIA 3UJ8A 4GUAA 4P7JA 3O31A 1EAMA 3OZSA 3THSA 3V97A 4BLUA 1RJEA 1O9GA 4PWYA 3A25A 4ATNA 2O0LA 2VP3A 4RTOA 4RVFA 4IV0A 5DT2A 4PGHA 3TPZA 2ZVJA 3R6TA 2P40A 5CCBA 2QE6A 2ONZA 3H2BA 5K05A 3FUWA 3VC2A 3GIWA 2P7HA 3Q7EA 1X1BA 4RTMA 2XYQA 1P91A 5DM1A 1JG4A 1Z3CA 5BW4A 1G38A 3C3YA 4NECA 1P1CA 1YFLA 5LR6A 2EFJA 3QV2A 3K6RA 2GAFA 4HC4A 5DX1A 3P8ZA 3MERA 2BR4A 2ZSUA 2P3OA 2OO3A 4V0QA 1H1DA 2VS1A 3OE5A 1QANA 1SUIA 2NXNA 1D2HA 3DR5A 3GDHA 4R8SA 5K0LA 2FYTA 3HVKA 4HTFB 1M0EA 2JG3A 4FS8A 3ELYA 2AOUA 2JH8A 3GCZA 4U7TB 4E70A 3M33A 2YXEA 2PXCA 4HH4A 1I1NA 4OBWA 1TW3A 2BM9A 3ELUA 1UIRA 3KKZA 4QQKA 5DX8A 1JQEA 3FPGA 2C7QA 4E2YA 4GOLD 2P41A 2GS9A 2YTZA 5KS2A 4ZTBA 3WSTA 1N2XA 2JJQA 4GEKA 5EVJA 1XDZA 1NE2A 2XYRA 2JHCA 4RV9A 5K0NA 2IDKA 3T7TA 2WA2A 4KWCA 3UJCA 5K8VA 1U2ZA 1IM8A 2ZWVA 2AOWA 3A7EA 3EMDA 1SQGA 5EMKA 3SSMA 3KPJA 3G2MA 3PVCA 2UZ4A 1KPIA 2PX5A 3G8AA 4FR0A 1YZ3A 3DXXA 3KQYA 4GQBA 4QPNA 1B42A 5CM2Z 3E23A 1TPYA 3T7RA 2R6ZA 3C3PA 5EIFA 1XCLA 1R8YA 3K0BA 3EVEA 4PCLA 1RI5A 4KVZA 5LQNA 3IV6A 3FYDA 3M6XA 1EG2A 3AXSA 1R6AA 1ZGAA 2QY6A 4GOMD 4MQ4A 2NXEA 4CTKA 1YFJA 3HP7A 3KQOA 1YF3A 3FTDA 4AZTA 5E1MA 3FRIA 3NJRA 5LSAA 2LD4A 1KP9A 1NW3A 4FP9A 5CVVA 2PJDA 3IEIA 2H00A 5CD1A 1RJFA 2DPMA 4PONA 2GH1A 4C04A 1O54A 1AV6A 3EVZA 1YZHA 4HGZA 2ZBQA 4BLWA 5K09A 3UBTA 2XBMA 2BH2A 1KPGA 3DLIA 2NYUA 2XYVA 1JTEA 3CJRA 1VP9A 2WK1A 1WS6A 3NDIA 2IH5A 4C03A 4RVHA 3CCFA 2AN5A 1RI2A 1VPTA 3OU7A 3DXZA 3TM4A 1O9HA 2DULA 2ORED 5DSXA 5C9ZA 3B7PA 4P7GA 4M7RA 2UYCA 1FPQA 1RJGA 3FTCA 3TKAA 2ZZMA 2AR0A 5DTQA 4BLVA 4CTJA 2C7RA 4P7FA 1R8XA 3DXYA 3IYLW 5FA5A 3UWPA 3O7WA 2IP2A 1N7JA 4XUCA 1JG2A 5GINE 4C4AA 5F2KA 4PYLA 3C6KA 3OE4A 3CJTA 3EEYA 4AX8A 3B3GA 3C0KA 5C1IA 1NBIA 1P39A 3BKXA 3GRYA 1YB2A 4XCXA 3DMFA 3PFGA 2Z6UA 2HTEA 1XDSA 5DSTA 1VP3A 1BOOA 2QRVA 3MCZA 4ER7A 4R8RA 3JWIA 3DOUA 4WXHA 4YV2A 1ZG3A 5FWDA 4IKPA 3TMAA 1V39A 3GRRA 3EVDA 5EOVA 3I53A 2AOTB 3PB3A 1PRYA 2F8LA 4Y30A 5T67A 4V0RA 2O06A 5E9JA 3OCJA 3LECA 3KR9A 2CMGA 2I7CA 5GIPE 3MHTA 3CBGA 2XVMA 5M5BA 3HCBA 4PYMA 3X0DA 2YXLA 3OZTA 2AOUB 4QVKA 1VE3A 4LECA 1X1CA 3TLJA 5GWXA 4FZVA 4R6XA 5FTWA 2XVAA 1IY9A 3KQQA 3M6UA 5BW5A 2AOXA 5FWAA 1FBNA 3DTNA 3LBFA 3NWEA 3VSEA 4H0NA 1BC5A 5FADA 5HEKA 7MHTA 2HWKA 1IXKA 3CGGA 1F3LA 4B17A 4DA4A 4Y2HA 2VDVE 3TM5A 4YMHA 3MTEA 5CVJA 3HCCA 5ICGA 3UA4A 2AOTA 2OPBA 3BWBA 3G2QA 2NXCA 1INLA 5K0CA 4MIKA 2IH4A 2CL5A 3LBYA 2ZW9A 1L3BA 1OR8A 3G5TA 3KR2A 1R00A 3CC8A 1VL5A 2NP6A 5DPMA 1MJFA 4RTQA 3UA3A 4CXMA 1Q0TA 4RTRA 3SSNA 3MCTA 2Q41A 3JWHA 5U4XA 3BKWA 2PX4A 3OU2A 3E7PA 2HMYB 5DLYA 5E8RA 4E2XA 5D1NA 4LWOA 4RSRA 3CKKA 3BGDA 4C08A 4YV1A 1AQJA 3CJQA 2HR1A 2PSSA 2FCAA 4M37A 1NW7A 2GA9A 2VDUE 3GU3A 1QAOA 3ID6C 3PT9A 4ER0A 1UWVA 1NV8A 4HTFA 1Q0SA 3BWYA 5KVAA 4QQNA 3FPHA 3ER9A 1PJZA 3KPYA 3MTIA 1X19A 2B78A 2QRVB 3HNRA 4FT2A 4BY9E 3AWIA 3BWMA 1HMYA 3OFJA 4X41A 5KQSA 3T7SA 1AF7A 4E33A 5K0FA 1ZGJA 3NTVA 2QYOA 4BP1A 4C07A 3OPNA 1X1DA 2Y1XA 3HVJA 3I64A 3ANXA 1QAMA 4E31A 1JSZA 4QTTB 4X63A 1G60A 1WXWA 2G72A 2BM8A 3HEMA 2P8JA 1JTFA 1L3IA 3TR6A 5EEGA 4PGGA 5KYGA 1KR5A 3KQWA 3KPVA 3KPWA 3U81A 5HIKA 2P7IA 3KQSA 2CMHA 2JH9A 2PT9A 1EJ0A 1P1BA 1XTPA 5DTMA 3NMUF 4UOEA 4YUYA 4M36A 5EZQA 3B3FA 4JXJA 3SX0A 3TOSA 4OQEA 3DLCA 4EMSA 8MHTA 5K03A 4ER3A 2BR5A 2PXXA 1M6EX 2YX1A 2I62A 3HCAA 1G8SA 2A14A 3MQ2A 4FSDA 4X1OA 4F84A 5LQAA 1FP2A 4FSXA 4R05A 3RIEA 2B3TA 3VYWA 3FPJA 3G89A 5DM0A 4HSGA 3G7UA 5LQRA 3LCUA 3LL7A 3PS9A 3OFKA 4F86A 4PYQA 1QAQA 5E1BA 3SVZA 1DCTA 1JQ3A 5E2AA 4ER5A 3NVKI 4YUVA 2O07A 3SR4A 3C6MA 3FTEA 3BT7A 3TFWA 4RTJA 3ELDA 3A26A 2ZBPA 3EMBA 4DMGA 4GC9A 2ZZKA 4F85A 1RI1A 2B2CA 4IWNA 5EHGA 3IHTA 3KR1A 4PCAA 4RVGA 1QZZA 1TW2A 3BUSA 3OZRA 1SG9A 2AZTA 1FJXA 2BZGA 4PYOA 3GRZA 3UJ7A 3EGIA 5DWQA 1DL5A 1JQDA 2V74B 4RX1A 5T64A 2AVNA 4KRGA 3G88A 4KW7A 2OBFA 2OKCA 3KU1A 2CKDA 3PX2A 5IH3A 2PKWA 3F4KA 2EJTA 5E1DA 2Z6QA 4KIFA 1VLMA 1DUSA 3L8DA 3P71T 4PYKA 5F2OA 4C05A 1EJ6A 3EVBA 1L9KA 4AZVA 2C7PA 5E1OA 4X60A 1G8AA 3REOA 3S68A 2EJUA 4RYLA 1NT2A 4RTLA 4XUEA 5EEHA 3LCCA 1HNNA 2GB4A 4PINA 3G2PA 5GP1A 3EVGA 5EKXA 1ZKDA 4DZRA 3HCFA 1ORHA 3UJAA 5GM1A 4CWAA 3HTXA 3LSTA 3NVMB 2NP7A 4G56A 5EPEA 2PV0A 4AZWA 1R18A 3HVIA 2FK8A 3EVFA 5ICEA 2JHPA 3I9FA 5DRTA 4DCGA 5K0EA 3M6VA 3TQSA 4PIMA 3UJ6A 1VBFA 2AN4A 2P1DA 3HM2A 3ELWA 3I5UA 4GOOD 4EQZA 4RTKA 1RI3A 2ERCA 2ZFUA 3BXOA 2ZIFA 4OBXA 1VIDA 3TKYA 5G02A 3G5LA 3KPUA 3KQTA 4E2WA 3GO4A 1NW8A 2IDJA 2YQZA 4U7PB 4E2ZA 2UYHA 1NW5A 3GWZA 1SVUA 3I58A 3LDUA 5KQRA 2YUIA 3JWGA 1D2GA 3EEOA 1BHJA 2C7OA 4A6EA 5DM4A 3FRHA 4PIPA 5DX0A 2PVCA 4E30A 5LQJA 1R74A 1VQ1A 2AN3A 4KDRA 3MGGA 2OXTA 3FZGA 5CVUA 3SMQA 5ICFA 3MAGA 2YVLA 3LHDA 3FPEA 5HFJA 3HA7A 3P97A 4WVLA 5EKUA 4C06A 2QM3A 1KXZA 2H1RA 1L3CA 3FYCA 1I4WA 3BGVA 3LDFA 3MB5A 2G71A 4FT4A 5CVDA 1WG8A 5EZSA 5CVEA 5HOQA 5EIWA 1JSXA 4A6DA 3DMHA 5K0GA 2FRXA 1WY7A 4LWPA 3RW9A 4EKIA 4OQDA 3ER8A 4QPPA 3ORHA 2ZTHA 3R24A 3QOWA 2IBTA 5E9QA 1NKVA 4POOA 3E05A 3FUUA 2P3LA 2YXDA 5EMJA 4MHTA 3EGEA 2OY0A 1KPHA 3LDGA 3UZUA 4OX9Y 3KQPA 3LCVB 3RODA 3DULA 5EGSA 2PT6A 4X61A 2ZBRA 4M38A 3HA3A 5GOZA 4MTLA 5LQUA 1Y8CA 2AVDA 5FQNA 5HIMA 5GIOE 4GOND 4XUDA 3LX6A 3NDJA 2GLUA 4YUZA 3P9KA 2OB1A 1XJ5A 4LG1A 4RTSA 4L7VA 1WXXA 3OU6A 4QTUB 3KQVA 1D2CA 3UJBA 4YUXA 5EHIA 1SQFA 2G1PA 1FP1D 2HV9A 3FTFA 2UYOA 3SM3A 1YUBA 4ISCA 3B5IA 3LKDA 4HGYA 3E8SA 3UJDA 1XCJA 4P58A 4YV0A 5FQOA 5F2NA 1G55A 1G6Q1 10MHA 2Z6AA 2PXAA 4GBED 2G70A 2G8NA 2OZVA 3Q87B 1KIAA 2GPYA 3A7DA 3GRUA 1RI4A 4PYJA 4IV8A 3B89A 3M70A 3PFHA 5JUWA 2PWPA 4HRAA 2IIPA 1ZQ9A 5P8WA 1SUSA 3LPMA 4E32A 5K01A 3PLAE 2JHAA 2WA1A 3P9IA 3HA5A 3P2IA 4PYNA 1I9GA 4YMGA 1BKYA 1XVAA 5E2BA 5H02A 2PWYA 5HIJA 1KYWA 3PX3A 4FGZA 3B3JA 2VZ9A 3SXJA 3KR0A 4ER6A 2OYRA 3FUVA 3P2EA 5K0JA 5C0OE 3DMGA 3DUWA 4DKJA 4CKEA 2IFTA 2IH2A 3HCDA 4O29A 2O05A 4DM3A 5BXYA 1QYRA 3AY0A 3EVAA 2CWWA 2ONYA 1NV9A 1NW6A 3DH0A 3O4FA 3HVHA 4GF5A 3EVCA 4DF3A 4EK9A 1MHTA 2IGTA 4KDCA 3G2OA 5B1SA 2R3SA 4HG2A 3BWCA 3GNLA 4EKGA 3V8VA 2BR3A 1X1AA 3T0IA 3THRA 2PX8A 3EGVA 1UFKA 3R9XB 2HNKA 3BGIA 1F38A 3R3HA 1EQAA 5LQKA 5T6BA 5D1HA 2H11A 3UJ9A 3UFBA 2P35A 2VDWA 2ADMA 4PYIA 3LGAA 2FPOA 1XXLA 4GC5A 4RTNA 1WZNA 2IPXA 3KHKA 1JG1A 2EG5A 1ORIA 3NWBA 3GGDA 1NBHA 1KHHA 4PNEA 1JG3A 5DXJA 5EMLA 3R0QA 5FHRA 2B25A 1SKMA 2UYQA 4QDKA 3PTAA 3BZBA 5EG5A 2ZLBA 2K4MA 2B9EA 2NNWB 5DXAA 5DRYA 2OB2A 5BP7A 3M4XA 2AOVA 5ERGB 5IKMA 2YR0A 3GRVA 5JR3A 4RTPA 2PGXA 3P9CA 3M6WA 5E8JA 4BP3A 4K6MA 5FCDA 2ZIGA 5FUBA 5FHQA 2FHPA 1ZHFA 5DM2A 1L1EA 5CUQA 2I6GA 3DP7A 3SGLA 2KW5A 3FUXA 3CVOA 4P7KA 4CKBA 4Z2YA 2PY6A 4DCMA 3P9NA 3QOXA 4YUWA 2V7EA 2NXJA 5CIYA 9MHTA 2ZWAA 2E5WA 3KQMA 3NW9A 5DTRA 3GXOA 5ICCA 3AXTA 1XDUA 2PX2A 4CKCA 3ME5A 2ESRA 2Y1WA 3FUTA 4EVIA 1T43A 1EIZA 2P3QA 1JR4A 2ZIEA 4OA5A 4QDJA 2IBSA 5EMMA 1N7IA 3A4TA 2N47A 2I9KA 2ZCJA 3GJYA 5MHTA 2ZULA 3AJDA 1RJDA 3D2LA 5E9WA 5EC8A 3VC1A 2EX4A 2O57A 3P2KA 5FULA 5HZMA 3FPFA 2PLWA 3EPPA 4R6WA 4KIGA 2AS0A 4DQ0A 3TRKA 3ERCA 5CCXA 4AUKA 5HILA 4MWZA 4RVDA 5EQJB 4AZSA 3SSOA 2PBFA 5FA8A 4QVGA 2ZZNA 1KYZA 5GM2A 1M6YA 3JWJA
chains in the Genus database with same CATH superfamily
2BFCA 2MSNA 3HEBA 2VEDA 1UXHA 3EJ6A 3OQVA 4FNOA 4FZ5A 2QTCA 4PGAA 4XVQA 5IP5A 1LPMA 2VF4X 3HGQA 4HWGA 4WNCA 3COPA 5IBQA 2QRJA 4JCCA 5BMVF 4BBPA 1NWCA 4BWFB 1FF9A 2QLTA 2X86A 1RAHA 2JGAA 2D1YA 4IIYA 3V97A 1TADA 1M8KA 4ZAWA 3IIJA 4F3CA 4IGKA 3V8QA 2W6QA 2PL5A 3OQIA 1ESMA 1M2OA 4GWGA 5TQVA 2IVZA 7REQB 1OTYA 4IV0A 3R4VA 3HJTA 1C3XA 3OZVA 2QMYA 3EUAA 4LXIA 4L9AA 1QHSA 4AJ1A 1JEJA 3ROXA 2XB9A 1L5SA 3LRTA 3QOFA 2DAPA 3JD2A 3W1WA 4EYKA 1QQ5A 2DPXA 2OXEA 3EXHB 1Z63A 3ETGA 4YC7A 4MPTA 4BECA 1M2WA 1P2FA 2I6QA 2R60A 1PZNA 1RQNA 1J0DA 1FFAA 2HIMA 1UKAA 2ZTLA 4GVLA 4KRXA 1K92A 4DEVA 1V2HE 2PR7A 3HZOA 3NWOA 4PSVA 1QRDA 3RS9A 2H85A 4R2JA 1BAPA 3Q9LA 4MPPA 4BC1A 2HMAA 4FC7A 3JQAA 4RAQA 2IYZA 4EGAA 2YICA 3N0WA 1ZEJA 2D1QA 2NT3A 1JDBB 3HVKA 2YJ4A 5B2ZA 3ZKWB 5JJLA 1XKTA 4UCXA 2JIZD 1BROA 2C97A 3IT3A 5EHXA 4K1XA 2GCEA 3DO5A 4HH4A 3OAAA 2IYTA 5EJGA 3RSGA 3TLEA 2IOHA 4BX9A 1SPBS 3N2NA 2H2FA 4PLHA 1RWVA 3VPAA 3OSZA 1SCQA 3U1BA 4OXKA 1Z8FA 3SF8A 3KQHA 2BUBA 4EY8A 5F7OA 2AXPA 1NVEA 1X1QA 3LT2A 5EVJA 4WE3A 5K4GA 2JRCA 4BQEA 3RQSA 4ENVA 3UJPA 5IT0A 1IPFA 5K0NA 3HV2A 3UJCA 2FE4A 3DDOA 5FA6A 3QLTA 1F8FA 1PWYE 1UMCA 2O2CA 3VQTA 3SSMA 4RY2A 5ICMA 4CODB 3I8OA 4ZZIA 4Q4JA 2AK3A 1O6CA 3TQHA 2R6ZA 1FU4A 3OZAA 3UUWA 3JQ7B 5IC6A 5LZ5A 2E4UA 1S5PA 1PEAA 1FYEA 1U7XA 4IYJA 3SCZA 4Z9YA 2ATEA 1BDIA 3LVQE 3FKQA 3LKVA 4C0LA 3N8DA 3IULA 1OASA 3M6XA 1TFUA 4W8HA 4CM8A 1GUAA 2V7QA 1A2KC 1I3CA 3MYRA 3PKIA 2UV8A 2NXEA 3Q1KA 4EWLA 5A06A 3OCVA 1RBQA 5B1YA 2PVSA 2MR6A 3GRPA 1RRPA 5AKZA 4MHSA 4XJSA 2A94A 4CF6A 2GPAA 1E3QA 3K5PA 3PYMA 4EHDA 2IYAA 1U04A 2VRBA 4H3SA 3VZCA 5CD1A 3S8MA 2JBAA 2B61A 5LQMA 1CUSA 2GDZA 2VJOA 3TO5A 4B4KA 2QGFA 5L4NA 1J97A 4UAJA 1Y4DE 1SQSA 2F9FA 1NM5A 3AL3A 1U9IC 2IOYA 3K30A 4DTIA 4KWEA 3RSFA 2COEA 1R1DA 4EB3A 2C2WA 3B1XA 3C1OA 3CCFA 1GGFA 4MRVA 3K5WA 3KFLA 5KIAA 3DLBA 2QRKA 1YQDA 2VF7A 2WE7A 3NTUA 4IIGA 5DSXA 1QS0A 4P7GA 1W6UA 5IBCA 1UBCA 1U02A 2BJHA 3K16A 5DTQA 5HQ3A 4P7FA 2Q2OA 3WVNA 2Z0MA 1FRZA 4PQRA 3VGJA 4BYMA 4IX9A 3DAFA 2J6HA 1E3IA 4WKGA 2WQ6A 4L2IB 4R5MA 3V4VB 1J49A 2VF5X 1N7JA 3SEFA 2VFAA 4YR7A 1ZONA 2OG1A 4PYLA 3U7IA 5KPJA 2OR3A 5BV0A 2EJWA 2LGJA 3BDIA 4OQNA 4W5JA 4JLMA 1WUHS 1JFTA 2QRVA 4RIGA 3VM6A 1FL9A 1RYYA 4JP3A 2WHRA 4CM9D 2R65A 4RMGA 5CFZA 3ADBA 4AMYA 3KSAC 3Q1LA 3KLOA 1MX3A 1KRWA 3CLVA 3S0JA 4ZYZA 3KKLA 3LO8A 4LSWA 1LA2A 1BEZA 3STTA 3ZVMA 4IYRA 4D44A 1W35A 4R83A 2H7CA 2O7SA 3AG5A 1AUVA 1U65A 3FTPA 2YXNA 3AM4A 4WIAA 3R8CA 1LB1B 3NIWA 2I6XA 3JQFA 4S12A 5JTTA 2B6NA 2YVQA 2VK8A 1LXCA 1AKVA 1V6CA 1S2LA 2HK8A 4FZVA 3AINA 1S3GA 5JH7F 1U3FA 1NR5A 3PWSA 3FY4A 3WL4A 1FDRA 2AOXA 4F06A 2VTDA 4L85A 5KTSA 2WM8A 1NFQA 2C83A 1GEEA 3DW3X 1NVVQ 4R1MA 3L04A 4DA4A 2V9ZA 5JJIA 4ZDWA 5CVJA 5HF6A 1ZK3A 3IILA 2D8AA 4AFNA 4CGYA 3SQOA 3STYA 2IHKA 3UA4A 4N82A 2OPBA 1CEEA 3GEDA 4G0OA 1E1QD 5DBIA 1ECFA 2Q5OA 3OIWA 4FMCB 1M0TA 5EPOA 1R10A 5K6RA 3SKYA 2SICE 3JATB 3NAMA 4P3OA 3I1JA 1AQLA 3DE2X 2NP6A 4TYQA 2B83A 2OSBA 4ZODA 1PT9A 2NU6B 1YIDA 2YHSA 5IBRA 4P86A 2KMLA 4WUVA 3VMMA 5KX5B 1P17A 1WZIA 2O2DA 4QBGB 4EW3A 1XEWY 1X0VA 2J87A 4EGSA 4KPUA 3WX0A 4GGPA 2I2WA 4Q9AA 4KNYA 1SC4A 1E9EA 2OBNA 3AY6A 4H59A 2VPQA 4U7FA 3SHTA 4JR1A 2JGLA 5L3VA 4WQMA 3F3KA 3FPHA 5CXUA 5BN5B 3SOPA 4DIOA 4X7MA 1XD9A 4HNGA 2R6JA 4QATA 1IY8A 4CLXA 2A84A 1TU0A 2DUNA 4EA9A 2E4XA 2SNIE 2JFOA 5IKOA 3WLEA 2ZSEA 2F62A 3A1DA 4OQYA 4F8YA 1P4GA 4MS3A 4OK3A 4YMVA 1UXIA 5JY6A 4S35A 1J07A 1NMSA 2Y1XA 3F6SA 2IHZA 2BSXA 3L79A 2VP6A 3QTBA 3GJZA 2EFCB 5JROA 4TZ0A 3WLAA 1G1AA 2C5BA 2QVLA 4XVCA 1L3IA 3NKFA 1CEYA 1T5OA 2WJAA 2NO6A 3DAGA 3QKSB 2Q3HA 3FZYA 1XMPA 2AI1A 3NHLA 4I3GA 2NO5A 4AD8A 4CI9A 3NDRA 1XPJA 5H3LA 2J5QA 4IJ6A 1C3LA 4KRYA 2A92A 3DBRB 1ZD9A 5JPCA 3OEHD 5AK5A 1G5QA 3NETA 5JSYA 3W2IA 2J46A 2GNAA 3FLBA 3HCAA 1QBKC 2ZIZA 2RCYA 1ZCJA 4R05A 3QSGA 3NORA 3EE6A 1JYEA 2L2QA 4GP6A 4RIHA 3H0CA 2EBUA 4HFMA 5DHRA 2QR3A 1A9XB 5A9SA 2C54A 4I50B 4RD6A 4N3AA 4PRZA 2RKWA 5KTKA 3BMNA 2H51A 3MFYA 4OAQA 4YUVA 3RVKA 1JJIA 1R0XA 4MA4A 1ZVVA 5A0VA 3EMBA 1XRLA 5HGXA 4ALJA 2WFLA 3PUWA 3M6IA 1BWSA 4DIDA 2V7BA 4LV6A 4X1KA 2WYWA 4R68A 1YR7A 3QMPA 5HE8A 1U4NA 2WMYA 3CX7A 3WYFA 4DNOA 3DL7A 4PX2A 4BZQA 1MT0A 2AZTA 4JQZA 5ESXA 1T8SA 5F35A 5KQPA 1V5WA 3RBZA 1K0FA 1NMXA 5JZVA 2JLVA 1CC1S 1JZSA 4KRGA 5GY7A 2R87A 3HRKA 2J3EA 2WPDD 2XT6A 1OA1A 3QTLA 1RNLA 3RBXA 4DA6A 3U4GA 1SBQA 1I3LA 1TM5E 1BVUA 1JNXX 1WABA 1QP8A 5JNUA 5BSEA 3QI7A 5I51A 4B73A 1SUCA 1RXUA 3CZ5A 2FW1A 1HT0A 3C7TA 4TZKA 2P2CA 3UJHA 5FPYA 3HN7A 2XZDA 2GLXA 3U6KA 1M54A 4KQJA 1XAIA 5K0TA 2PUEA 3R3VA 1TTQB 3WGIA 4H6VA 2WYIA 4FYWA 2FVXA 2I3GA 1JWLA 4UVEA 1XRRA 2A5DA 4QTXA 1HDYA 1PQUA 1VA5A 2V58A 1TK3A 3WDLA 4JVLA 1N77A 1K6XA 4FZ3A 4EG6A 5DNYB 1BCRA 2QBYA 2PTHA 1EYZA 3RYFA 1RI3A 1KO7A 3DMTA 5CK4A 1P7VA 3P2JA 3T35A 2GUWA 4OO3A 3D4NA 4FN4A 3WWDA 3KPUA 1T0BA 3KQTA 5ILGA 1OWOA 2MSCB 3BFJA 1NW8A 3EAFA 4IXTA 2A9JA 1N2CB 4K28A 3TRIA 4MKFA 4FKBA 5G2OA 3MA0A 3E3MA 4IDPA 1JHZA 1I2DA 1MIOA 4Y2JA 3RH0A 4BU0A 4DPMA 5B3JC 3BSSA 4PIPA 5DX0A 3RTGA 3ZI4A 2BFBA 1FFEA 1U7UA 2ZYSA 4UFPA 1ESZA 5HG0A 1R6BX 3FVVA 4JJKA 1CUVA 2QTRA 4WVLA 5EKUA 3LCJA 4FT4A 4IWYA 2R5NA 1Z29A 4ZQHA 1W5BA 4BAGA 1JHQA 3PHCA 4LVUA 3LT1A 3ZV3A 5BPFA 5ECGC 3O0DA 3ZJ5A 2GNOA 3LUBA 4QUHA 1ZR4A 4J43A 3PQEA 3L1KA 4UMFA 1Q44A 1VKRA 3D7LA 5KDDA 3U7GA 1QP0A 3O83A 4MOWA 3K8ZA 5CNMA 3V6MA 1MO3A 4FOLA 1SD5A 1APBA 3VZBA 1I33A 1MRZA 3CINA 5G41A 3UATA 5BVHB 2IS2A 1RXYA 4TV9A 4OHWA 4QRDA 5JLAA 2ZRKA 3EDMA 2Z83A 4OX9Y 1D4ZA 3PDCA 2ADOA 2CUTA 1GSAA 5DGDA 1N6KA 1OFHA 4RLQA 5HMLA 1A71A 1E2QA 1VKNA 1NC1A 2IXGA 3WMWA 4AJHA 1GGEA 3A2LA 1Z2OX 3GDFA 4LGVA 4BEVA 2NTVA 2WHEA 3D6MA 1SUWA 1XTIA 1EQUA 2Z1NA 3I2IA 2FDCA 4YLYA 1YE3A 4OATA 1S7GA 2CD9A 2MIIA 2CFSA 4E5NA 1T13A 3P2YA 5F2NA 3R9XB 1YS7A 4LXHA 2WWFA 1FW8A 2PXAA 3W34A 4NMLA 1P31A 2D2FA 1NPDA 1VE1A 2XMZA 4OHRA 1PBTA 1XN4A 4WOCA 3WBKA 2RB4A 4Q4CA 2OHOA 4DIMA 5CX1B 1DBVO 1GVHA 1W75A 1P0CA 3EBLA 2AFIE 2AD5A 2XOKD 4FX2A 4DPLA 4O4IF 2DR0A 3C4JA 3KOYA 4E32A 3U5ZB 4XI9A 2QVBA 3SAJA 2QZ9A 3HGTA 4KUEA 4BV3A 2ZJ6A 3CKLA 3RV4A 3E48A 3E58A 3HXOA 3IAM6 3SBOA 1SZCA 3CXRA 5SYNA 3WNDA 4D5GA 2CJYA 3PD7A 1RIFA 3HCDA 4G1VA 3Q3JB 2DT8A 2PGAA 1HDGO 1KOJA 3F5MA 4XWKA 5IEJA 1TLTA 5FO1A 5A5FA 1USVA 4HFNA 5IZCC 3FSEA 4I55B 1VSVA 3T06B 1P7PA 1IWPB 1QU3A 3FFAA 4EVRA 1GIAA 3O03A 3EZ2A 2JLBA 4AXBA 1DJQA 3T94A 2C2XA 2CVZA 1LK0A 3O47A 5LL6P 1JHRA 1P33A 1IOZA 1IMJA 2WIBA 1HGXA 4K8OA 2H52A 1IQPA 2H5IA 1CT9A 3GMTA 3IKLA 4RH0A 2OV6A 4P92A 1PUXA 2R8RA 2W11A 3R5KA 4P84A 4X1IA 3VR6H 3OQHA 2KB0A 5E7JA 1KK2A 1R8JA 2A0UA 3TZQA 3SZGA 4M9QA 5JAHA 2W8ZA 3HUEA 5K3CA 1SULA 4GI7A 1JAZA 4J0CA 1YU6A 1TMKA 2PRJA 4UM8B 1K86A 4AMZA 5BRAA 3H4VA 3ZQJA 4K9OA 1QMGA 3AF6A 2P2DA 5CGQB 1MTOA 4B87A 4MUHA 5LUAA 1EUQA 3HUDA 4KAJA 1CR0A 2Q28A 3I5AA 3OMLA 1T2UA 4KCGA 1PZXA 4BZPA 5MGBA 4FI3C 3SDBA 2NNWB 3M0EA 3CZAA 3USCS 1P1HA 4ND1A 5ERGB 4ZWNA 1DBQA 4D46A 4DAOA 4F6RA 5IKMA 3EXAA 3G6KA 5HJ2A 5I8ZA 4EDHA 3QVLA 5I7AA 3WL3A 3QPWA 3WB9A 3BWEA 1MMFB 2I8LA 2WZCA 3CIOA 3FDXA 1SQ0A 1IN1A 4XGRA 3ICVA 3IUEA 4YIHA 2VZEA 1SCNE 1HYBA 2G83A 1C4OA 4J0GA 5DHSA 2WJ6A 2QL7A 5AW4A 4N7MA 2QMEA 5I7EA 2ANBA 2NVBA 3JD4A 5C1DA 3TG2A 5AKIA 3LRPA 2VP0A 1SELA 2FLWA 2VIIA 3HKCA 3NAQA 3PLRA 1E9AA 2ZBDA 1Z4PX 1ZC3A 2Z2JA 5ETJA 4N0EA 3A9RA 1FSPA 2VA8A 1DAKA 1E2PA 1KYIA 2I87A 4PY2A 4U8GA 4QECA 5B3AA 4R6WA 4UREA 5AXAA 1F0NA 3ERCA 2A1TR 4WD3A 1C80A 5DO9A 1TZBA 5CCXA 4I8DA 2OECA 4MUKA 5UKDA 5BORA 3A6HA 3OP1A 1C7EA 3UANA 2FN4A 4J16C 1NQAO 1R4NB 4DIKA 3DM9B 1ZH2A 4JVNA 4FU0A 4ZALA 5JWRA 3BQMB 4Q01A 5KTOA 3NUZA 5EE5B 3UJ8A 1RJWA 3K1YA 1EVQA 4CHTA 3ADPA 3F7OA 3ZLVA 2C1ZA 4NKRA 4Z1MD 2FPRA 1BMTA 1XEXB 2JJMA 3TXYA 5H3HA 1LLFA 2OBMA 3NHSA 3OLYA 3ZOKA 1DAIA 1ZCFA 4I4CA 3OT4A 1G8HA 4QJ3A 3DOEA 2PUBA 4OSEA 4YLEA 5T41A 1FA9A 2VHXA 1YRBA 1T5HX 2BZ1A 4JVSB 2QE6A 2QQ5A 4MVJI 4C30A 1XROA 1O5IA 2H92A 5DTJA 3S1SA 2H8GA 1OIXA 1WPQA 1B23P 3EOBI 5F5LA 4BWYA 1JG4A 1ZCZA 2OFWA 4P98A 4BKMA 4DLPA 5JZMA 1HFJA 2HJRA 3QE9Y 2OHGA 3DYVA 3LPLA 2QRHA 1C0PA 3I01A 3O94A 3VOAA 3R9XA 1QGAA 3BMCA 2HCJB 2YVUA 3EWNA 3OT1A 3O4GA 4EEKA 4CEJB 4YMWA 5D01A 4CDRA 5JDCA 2DY0A 2VP5A 3G2NA 4YWHA 4NOMA 4EBBA 1Q16A 2J0EA 2H1IA 2WTAA 4N48A 2ZSUA 3N8IA 6ABPA 3O93A 1ETUA 2P3OA 3ICPA 4P80A 5DI3B 1SUIA 1BWPA 3DNMA 13PKA 3H19A 5JQGA 4R8SA 1XPRA 1LH0A 1GPNA 2PIAA 2XNJA 4PZLA 2FEXA 2JG3A 2LPMA 1WF3A 2EKQA 2AOUA 1P61B 2V7TA 2W0MA 3RHZA 1K08A 2XEXA 1MQSA 5ES4B 4F2GA 1I1NA 1FTNA 3LCMA 3HM9A 5A2GA 5TIIA 3DTVB 1NTRA 4QQKA 4CR8A 3LQYA 2AFIB 2WHQA 4LZWA 1IZZA 3DG9A 1GGVA 4EH1A 3JAMA 1F14A 2J8ZA 2AYYA 4NZZA 1TVKB 4OMUA 4GEKA 4TWRA 3WJ1A 4EJ2A 1YL6A 1Y7TA 1VSTA 1SVSA 4I1UA 1G7CA 1UDRA 3WLIA 3TSZA 3IV7A 2WA2A 2WJ4A 3CX4A 5HRUA 1ILWA 1V2GA 1VHQA 3KPJA 4HDKB 4E3ZA 2UZ4A 1Z74A 2WT4A 4N18A 5IM4F 1YZ3A 1XDBA 1W4ZA 4EEZA 4TMYA 1FJ2A 3WJ2A 1NNEA 1VPVA 1E7YA 4OV6B 4MI1A 1A9OA 1KSHA 3P27A 4PZYA 3AKYA 2JLAA 3BMNB 4N40A 2FSVA 1JSRA 2FDXA 4A03A 1VI6A 2NV0A 4K40A 4UD2A 4EP1A 3RJ5A 4AY2A 4JELA 3C3KA 1CR1A 2H2GA 3R5HA 2HA7A 5JC1A 5JBQA 5IRCD 5FTJA 1JU4A 3BXFA 1AV6A 4DSNA 2XI4A 1NLZA 1RE1A 3GJQA 5JQGF 2JIDA 1YNSA 3F96A 3ESQA 1JHVA 4ENQA 2VNAA 3L0OA 4JBLA 3F47A 1L8XA 1N2OA 3ACBA 5NLLA 3W2EA 3MPUA 1NBOA 3HFRA 3MWDB 3MG9A 1OQAA 3A1SA 3E9MA 3O82A 4R2MA 4M7RA 2PGJA 3NBKA 2XOXA 5JFGA 3S8EA 3DZKA 4WLOA 1ZVKA 2Y6UA 2A1IA 1B1AA 4OUDB 1HH4A 1UC5B 3SJAA 2BEKA 4TL8A 4TS9A 3UJNA 1J22A 1KBQA 3H99A 3NV9A 4WECA 3DE5X 2NU6A 4MGEA 1Z7EA 4JENA 2J4FA 2YZGA 4RDXA 5D7NA 5HKAA 2C7GA 2W6JA 4HDKA 2Q0XA 4YRSA 5IHXA 1KZHA 4OHUA 4TTRA 5C5DA 3VSBA 1GFWA 2VDLB 4PG8A 2VAWA 4F92B 3LUAA 1U3WA 3QXSA 3RTEA 1SBIA 3CE9A 3DOCA 4DXAA 1U3UA 1K8YB 2HWUA 4C5CA 1H2BA 1S8AA 4RF3A 5TPZA 1DELA 4A8TA 3MWEB 3R0ZA 4MH0R 4L5BA 2NU8A 4TLDA 2RH4A 3N5CA 4DT1A 3ADOA 4YJ2F 4DYDA 3GUUA 1F3OA 1MG5A 5AIBA 2YXLA 2LIVA 3U4HA 5AI8A 4ARZA 2Q29A 4A0RA 1U3DA 2OO5C 2AUMA 2HQSA 2I7VA 2QZ4A 2VYND 5ALXA 5HUJA 1FMFA 2Z08A 2HDWA 2IE0A 1Q2XA 2HTFA 4RD0A 4YRKA 1ZNZA 2XSZD 1YULA 4D3SA 3G8CA 4H0NA 2I1LA 4MP8A 2VL7A 3KD2A 2HWKA 3WHKA 1W0KD 2QDKA 3F9CA 4DY4A 1MVOA 3ILVA 3TL6A 2I71A 5AUOB 2GN6A 2WHYA 3PXCX 3THYB 3CNBA 4IW3B 3KDSE 1A8SA 2FSPA 4M9SA 3CN9A 2UZ1A 2NLOA 3G2QA 1U7ZA 3FOZA 2FRDA 2PIDA 3I9V1 4LZNA 4EB6B 4IO1A 4KN5A 3E9NA 4FNAA 1PJQA 1Q3KA 5ADHA 5L9AA 3DDZX 1BU5A 3AJEA 3TL2A 4LFBB 1ZVQA 1ZM9A 4X00A 1YZTA 2O2HA 1EB8A 2OXRA 2GXSA 2IEAA 2NO0A 2Y9MB 1R4MA 3PEVA 4RM2A 5JLJA 1Z33A 4RJIA 1SOUA 3OZXA 3OC0A 4EKYA 5B7NA 4NV1A 2PKQO 1E5TA 2QMOA 4NI5A 1J70A 3JD0A 3HYSA 5LB4A 2XPCA 4YVFA 4PX3A 5FBRB 1MU0A 1QE0A 2GERA 2CXQA 4A9AA 4AIIA 1KHTA 2YJZA 2BTEA 3CF2A 3J7AC 4C7OA 3Q7QA 3T52A 4Z4GA 4EGCB 3B3AA 3GU3A 4Y6RA 1ZINA 1H05A 3F98A 4QQNA 1XMSA 2IYRA 1KWKA 2FPMA 2QTTA 1R12A 2BTOA 3DZHA 3LUKA 5COBA 2PUAA 4AP6A 3TMYA 3E2PA 3PGMA 4WERA 1U3GA 1YBHA 3O2QB 5HS6A 2CNLA 4QU0A 2CDRA 2QYOA 2QR5A 2W6ZA 1NRXA 2PUFA 1HLGA 2RGAA 1C8BA 4DFDA 4F4DA 1OC4A 3HEMA 3RWOA 5BWOA 3K2BA 1QH0A 2G5PA 3I4FA 5KNBD 4YPFA 3CCBA 2FOIA 5EEGA 3EZNA 2BMVA 2IYFA 4UQPA 3H2ZA 1COWD 3EXEA 3H5LA 3BERA 4XGQA 4YLGA 1N1EA 4BJ6A 3HV0A 4D99A 1QX4A 3LC0A 1DRVA 1RRGA 1Z8HA 4FM9A 5FWYA 1CDEA 3WC4A 3GPLA 3ZWMA 4V3BA 2WZQA 4O6VA 2OENG 3HU5A 4XSHA 4CG2A 1GSOA 4EMSA 5BQ5A 1VYUA 1PJAA 1RR6A 3ITKA 3O84A 3SS7X 3U4AA 3ZD8A 3WB1A 4YRLA 3GV0A 2IUYA 4ER3A 1QYXA 1G0NA 3UFXB 1ZI8A 1M74A 1GNPA 3AFGA 3V8NA 4URFA 3ZG6A 1SOWA 1ECCA 4MB6A 1YDHA 1EDBA 4UXIA 5KVQA 2DBRA 3WK9A 4MEJA 5E6RB 1NQUA 4RFSB 3VHXA 4YCDA 4YMIA 2P11A 1DIAA 4JLKA 1II8A 2JLCA 4FYYA 3PJGA 4RENA 5E2IA 1RTKA 1J06A 4M1QA 5LBIA 5A5VA 3HSKA 4ZRMA 3TJZA 3C6YA 2ZP1A 2RHRA 1LS1A 2ZUSA 4KO3S 1CRPA 4HZIA 1A8QA 3URKA 1BHO1 1AKYA 1YBVA 1WJGA 4JYBA 1RI1A 4KXMA 4GXQA 4PR0A 4WNAA 5U4QA 2AC7A 1UDBA 4NBNA 3PC2A 1PQYA 1T29A 3IKVA 3NHUA 4EVSA 2F2TA 2QHXA 2OAP1 3P0FA 1H1TA 3EXG2 3QKTA 1C9KA 2WSYB 4G1CA 2EJCA 3CUKA 1RKQA 2PH3A 2WMDA 3BREA 3KU1A 3VOBA 4C7BA 4ZPXA 1M7GA 3HYTA 4F96A 2WD9A 2I7DA 5DNDA 3LWNA 4Z4EA 1BU8A 1PR0A 1GG2A 2ZIVB 2PLRA 5IAKA 1G3UA 4TV9F 5FF9A 1YHZA 1SN7A 3E9YA 1V9LA 2Z2KA 1WKBA 5C4MA 4KFTA 5BQPA 1FTQA 1QHXA 2CXSA 1GPMA 3EVGA 1KZ1A 1PV2A 4BPRA 1OYOA 4N7BA 3K53A 1CF2O 3PWKA 5AVJA 5BN1A 2D1RA 4YT8A 2X4IA 4MA0A 2AFHE 1PYDA 3DZGA 2I4RA 3VC7A 3ZWXA 5B7GA 3I9FA 1QIGA 2FA9A 3JQ9C 1WVMA 2VDRB 1ESNA 3JVUA 1AS2A 2ECOA 3M6VA 4JT8A 5AXCA 4ZVSA 4M0KA 4HF7A 4OG2A 3S7ZA 4BO2A 3WQSB 3E22A 4N6GA 3NT2A 4EY6A 3UBTA 2XE7A 4ARIA 5BYAA 2EP8A 3RUHA 3RVOA 1PLLA 5JVDB 5DNVA 5HZGA 4U7PB 4M8IA 3WK4A 3GWZA 3N76A 4R8KA 2C7OA 4YUAA 1YC2A 2C96A 2GVDC 2ZSFA 4TRNA 4W5WA 1BA3A 3EUEA 2HSEA 1CG6A 2DWOA 3SMQA 3VDMA 4DXDA 5CVUA 1SZDA 2Z56A 4HLCA 5G3ZA 3UG7A 4N5DA 4B6GA 4C6TA 2GO7A 2QD4A 2EKDA 2OD9A 3C4VA 3QYAA 4QJ4A 2Q6TA 3TIFA 4KLZA 4MS1A 5I7HA 3QIAA 1FVOA 1ZA1A 3BGVA 1E7QA 2VF2A 4DAEA 1AM4D 3T4XA 1JDJA 4KKXB 1ELOA 2ECKA 2ZUFA 4RLHA 4UBMA 3R7LA 2A57A 3PDIA 2FMXA 1H1LA 2NADA 3JAWB 1H2WA 2B4KA 3QFRA 1R0RE 1D8AA 2IYOA 1HEIA 1P45A 1I0LA 3FF1A 4UAUA 1DNPA 1TO1E 2CNKA 2C2OA 3IVRA 4H7IA 4LJ9A 3ULKA 3EFEA 3UZUA 3ZDXB 5JALA 4AY6A 1KU6A 4RZSA 4E13A 1LI7A 1I2MA 5KQGA 4H1WA 2EQ5A 2GZDA 1FP7A 2ODPA 1PFVA 1E6WA 3ZOZA 1FNBA 3EEFA 4JLBA 4V39A 2JLQA 1QQAA 1Y8CA 3RGGA 1JKJA 4NU5A 4ITRC 2ZIXA 3CT4A 4DBVO 4X6UA 2PYDA 4R1LA 1SXJC 2PT7A 4R2XA 3SIWA 3HKBB 4YUXA 1N4DA 2HCRA 3H4IA 4OEHA 1UMBA 2HV9A 3F8TA 3VO9A 5EE1A 3KXIA 3OKCA 2D00A 3DF7A 1YS1X 4WFIA 2Z6AA 1I3KA 3PHJA 3WGGA 4UMEA 3PC8C 1X6VA 1FMTA 4QXOA 1YZNA 1JLSA 3FLAA 3U4IA 1U0NA 4JBNA 3AEKA 3RYFB 3J80A 4LRQA 4YYEA 4EUSA 3U09A 4ND3A 3AC0A 3ECSA 3K9LA 2NAPA 2JHAA 4IQFA 5LVAA 2RC5A 2DQYA 2BFAA 1CJTC 5H02A 3UUEA 4ACAA 5HIJA 2CZCA 1NQWA 3R3SA 1QFZA 4YP1A 1YAJA 4EYGA 3FVRA 2OYRA 3P2EA 2X0DA 2WFAA 3VPSA 1SG0A 2TMDA 4W5TA 1OZAA 1G5IA 2ZRMA 3EASA 4DR4B 5CITA 2O05A 2PMCA 3L4SO 2IP4A 4N0MA 2IE8A 4LUCA 4YRMA 2PKRA 1ZVJA 1ST2A 2BFCB 3E3LA 3HABA 1NP6A 4KI0A 1LBTA 2AR9A 1ZK1A 2AH5A 1D5CA 3RWBA 3IHLA 1RLOA 4CUJA 4JFAA 1M34B 5TSDA 1ZJZA 1L4GA 1K75A 1P1FA 1IN5A 3T15A 4LXUA 5K3OA 3DLHA 3K31A 3IR7A 3N0VA 2X1MA 4M8LA 4PLCA 4UTXA 3SX2A 1AHIA 1N9KA 4Y9DA 1UFKA 3T0FA 3W6OA 4NXMB 3JQRA 3IO5A 2QRLA 4HQFA 3AIMA 2CEKA 3KU4A 5DIZA 3OE7D 3OZUA 4K81B 1LD3A 1QRRA 3DCYA 3ABSB 3G1UA 3QHPA 5C52B 5A6VA 3P5BA 3OECA 4HCJA 4LZPA 5D1HA 1DBPA 2VDOB 2D5CA 3S3TA 3DQQA 4FOTA 4KXUA 1E3SA 2QG4A 1ZD1A 5IMBA 3H5WA 2C2YA 1FQOA 1WPXA 3LXXA 2BV3A 1T1RA 4RE5A 3KZCA 5LZ2A 4F04A 3LY9A 4FFVA 2VLIA 3WBFA 4C7MA 1ZUHA 4ARBA 3SI7A 4I1SA 5BP7A 2Q3BA 2G9QA 2XGGA 4TLCA 2RKBA 5D5PA 3HKEA 2FQ1A 3AEQB 1H0RA 3MD0A 4Z9AA 1ZOSA 1A0OA 3C3BA 4K6MA 2Q07A 1LNZA 4MV9A 2Q2QA 2ZIGA 3JSXA 5FCDA 1LU9A 3HEAA 2FFJA 5K3AA 4PRKA 1LLQA 4QQ8A 1XD8A 4X9XA 1H2AS 2ISQA 4PPYA 2VDPB 1PK8A 3I1YA 1SVOA 4MVWA 4R9NA 4DQUA 1XI2A 5CLGA 2DLNA 1TRKA 4O4LA 3NJ4A 2HMTA 1O89A 1Z73A 2PTGA 2X0KA 4JROA 1EX7A 2B94A 3FROA 5I7UA 3G9QA 1YA6A 4CM3A 5JMPA 2JCVA 4HYYA 2JAXA 4QUBA 3UCEA 5EMMA 1CW2B 4WA8A 4MGYR 4B2IA 3H13A 2I3DA 1S9HA 2K87A 2QSJA 1N5MA 1DMRA 1B0UA 3BD9A 2EX4A 3P2KA 4HRYA 3KZXA 1IIBA 3COYA 1MV5A 3N2EA 3T3EA 5AW0A 4MS3B 621PA 5LLDA 1FU8A 3EZXA 4UVHA 3KFXA 4DN6A 1J0AA 3OJ0A 1XLTA 1SCDA 1F0PA 2GZ1A 3M6FA 3AL0C 4JB2A 1NU8A 2AHOA 4IHKA 3M34A 3PDIB 1MHPA 1XJQA 2JC3A 4ZO9A 5E6RA 2FK7A 3A27A 5CBPA 3LKZA 4P36A 5CH5A 1HFKA 3IUQA 4RMNA 5GVSA 1TUBB 1UMDB 4MVJF 5BNWA 4Q3OA 3BULA 5AH0A 4EABA 1EP2B 1C3VA 4WPGA 4D9FA 4UEOA 4HO1X 5K4AA 4HH3C 3DAYA 2P6OA 2W2MA 1OLUA 3PVZA 3IE1A 3AOEA 2B7LA 3OQ1A 3HSYA 1QDUA 5IKEA 1WBDA 1H8HA 2H1LA 3O8NA 3AQIA 1JLLB 3GA0A 4XYLA 4JP1A 3KYCB 1JBKA 3LBIA 4B45A 4TMZA 2ZTSA 3IQEA 5AHOA 3HCNA 1TCCA 3PJEA 2HNBA 4Z54A 5B6PA 3GT7A 2W6IA 3DZFA 2PBLA 3OX3A 4H6WA 3AK4A 3PCTA 2DG2A 2XCTB 3PXAA 2EFJA 2XOEA 3F7MA 1CQJB 3KZKA 3MUOA 3GXBA 4KBFA 1FP6A 4PQGA 3W8EA 4BNIA 4LTNA 4GGOA 5G4KA 1WBJB 2HNAA 5SYMA 1O94A 1M2VB 4TXHA 2FF7A 5CK5A 1NYQA 1KFBB 1L1FA 4ZA2A 2FWPA 2ODTX 4M3NA 1XTVA 4DRXB 1HT1E 1XF1A 1M73E 1N75A 2JGMA 3G5UA 4G2TA 3RHTA 1T8TA 4L3VA 4NDAA 4MKIA 1ABBA 1KMNA 1P80A 1L7DA 1WNFA 1XA4A 5F12A 3OPYB 5JSHA 2KWIA 4JLVA 1MO6A 2W37A 2ZR0A 1T5BA 3AVPA 4XB1A 5KOJA 3OE7A 4AUNA 1EWQA 2EJVA 4FPXA 1KZ9A 4LRUA 2CV1A 5EKTA 4IXMA 4LMRA 3DFMA 4MRNA 3WLRA 4ZMBA 3GHHA 5EJ4A 3HSSA 5JHHB 3Q8WA 1U1CA 2PX0A 2D2EA 4MS4A 1IXRC 2OLKA 5CT9A 5EMKA 3JVVA 2AOWA 4RJTA 2Q45A 3UFXA 1YUNA 2JFXA 1S01A 3UM9A 4EF5A 2XYHA 3T7RA 1PD0A 3DLTA 4QSHA 4KK3A 4Q3AA 4XH9B 2SECE 1H2HA 4Z4FA 3RRYA 3FDZB 4KVZA 2J5RA 3SZMA 3ZWVA 2D74A 4ACBA 4AN0A 2RGGA 3HUTA 4O4LF 3RKRA 1WUJS 1NVTA 1GPLA 2E4VA 2CUKA 3KLPX 3TQOA 3ZE7A 1V3VA 2FDRA 3CLUD 4E21A 3KJGA 2WSMA 2ZJBA 3IOYA 1YZHA 5EXPA 2GHQA 3TLKA 5K09A 4EG0A 3C14C 1LDMA 2V65A 2IXEA 1YR2A 1QH8A 3H11A 1W85A 1RC1A 1O94C 3L1UA 4C4YA 4QUGA 4C3UA 3PP8A 2KLHA 3L84A 4A8HA 2A0XA 3WG9A 3TM4A 3OU7A 1O97C 2TMGA 4FW9A 4Y1EA 1V11B 2HN9A 5IF3A 4JXXA 1WB6A 2H9AA 2Q7OE 1NJ1A 1FFBA 1Y7HA 3NHMA 1VSQA 4CMGA 4JI0B 5H4HA 3FHOA 3VR4H 3VR5H 1EWTA 3BEOA 2I65A 5EINA 1OI3A 4EZEA 5IVDA 2HIGA 1H0SA 5CD9A 3L9WA 4XGNA 3SFVA 1VZ2A 3BE4A 2WR8A 1CQZA 1L5MA 1SOMA 1U1DA 4NU8X 3ZV7A 3C6KA 3C16C 3DDCA 2WHXA 1WU7A 5KC9A 4B40A 3MRVA 2Q3EA 4K2HA 2HBQA 4HNTA 4LF7B 4G5RA 4X8HA 5AQEA 1XZGA 3EHDA 4TMKA 4LYFA 4LDPA 4E12A 4YALA 2AOTB 2PM8A 4U7DA 4NYMR 5E6SA 4OQPA 5AWFC 2HMWA 1PIWA 6LDHA 4D9IA 2RHMA 1ZA2A 1PZEA 2FX5A 2XVMA 1QYVA 1M1YA 2GJSA 2I2XB 2JLXA 2GK4A 1JEYA 1PGPA 1JEEA 3CLTC 4YP6A 3TLJA 1AA9A 5AW7A 1T3TA 4L5AA 3DOJA 3M6UA 4M0PA 4UXHA 2OHXA 1E0KA 2PGNA 3Q3HA 4O59O 2C03A 4EMBA 4ENWA 1GGMA 2H17A 2V6BA 4MUIA 4HDNB 1BC5A 3T5BA 4I4IA 3WLQA 3EBOA 2CJPA 3CGGA 2B2XA 1PSDA 1YRHA 2VT2A 2XA2A 2JJYA 3M8KA 4J4TA 4LPKA 3DT6A 5EQFA 1DXOA 4JI4B 2QX4A 5AKGA 3FGPA 1U90A 2CMDA 2OD2A 1H4VB 3C98A 3Q88A 2CCGA 5HXAA 2OCLA 2VBFA 3UAWA 3UYKA 3Q6IA 1N6LA 1U9JA 1LZKA 2EEZA 4IXWA 4W7HA 2ZB2A 4M1OA 2WIGA 3NIDB 4BLRA 5F64A 2NVUB 3EXIB 5A4MS 5K99A 1JIQA 3WFZA 5KSPA 5DPMA 4JX8A 2HYDA 2QLMA 3C1TA 2QUIA 3HO1A 1V8PA 4A2PA 2FEOA 1GITA 3ZWKA 4EAAA 4PGMA 2WVAA 4G0ZA 3PQ3A 3J81A 1N8NA 5K6AC 4JLPA 2QN6A 4NE7A 4C7JA 5C2JB 4QX6A 1NAIA 4D57A 1P2VA 4M8SA 4NNOA 3KLBA 4UM9B 2A4MA 3LAWA 2B30A 3MSXA 1NV8A 3OIYA 4HTFA 4M1ZA 4NIMA 4DYHA 5C1OA 2CLCX 1PJZA 4UTVA 1GPKA 2IS1A 1X19A 2HU2A 3VSAA 2RHLA 1SCUA 4URXR 1K7FB 2P27A 1KOLA 4W5OA 4EBFA 3M83A 4F9GA 4TL7A 4Q4AB 1FS4A 2HBRA 2VQ6A 1RRFA 3BORA 4IILA 2VDMB 4K05A 4O1HA 3OJCA 3R3YA 3RNLA 1WKVA 2HQRA 5SYAA 4FYVA 1M83A 1PJ4A 1WLYA 2ZRDA 4ANFA 4EIWA 2CCKA 2G72A 5KPDA 2GBCA 4RHEA 3ZZTA 4MHOA 4RVNA 1LSOA 2PXHA 5CAEB 1Q84A 4I3FA 3HP1A 1MDFA 3MD9A 3NCHA 1GUDA 1M6WA 1E6CA 1L4HA 2PPVA 2P7IA 3GBSA 4KACA 4YECA 4L75A 4KR6A 2V03A 2JH9A 2GD0A 2YN2A 3EOAI 3G2KA 3M9LA 4TRMA 1UWKA 3VVCA 1RWWA 1Z5NA 2J41A 4RVCA 3V7WA 2XVZA 2ZG6A 1G9SA 4C9BA 1H4QA 1C3JA 2AG5A 4JYAB 3QPCA 1M6HA 7ABPA 1SXJD 4AC9A 2GZAA 5IJWA 1XEXA 2PGIA 1M6EX 2PXXA 4X1OA 3K70C 3G5MA 4XPIA 1SOVA 2HPAA 1YBFA 1DC4A 4FYXA 4X3CA 1KSFX 3BA6A 3WNQA 1P9LA 1YOBA 4RCVA 3LYUA 4YXWD 1H9AA 3ZV4A 3EWSA 4I1OA 2FFQA 3IP8A 4W9NC 3TQQA 2C94A 1HFWA 2O3JA 2ZWPA 3HJAA 1LK7A 2E87A 3K94A 4NK4A 4XSGA 3CPEA 4JJFA 4CCYB 1R3DA 3A26A 1CJSA 3VH3A 1JR6A 4H3KB 1UKBA 1FFSA 3CMMA 3BHNA 3CXUA 4IZOA 2OM6A 5LU9A 2W71A 3UW1A 4B6QA 3KRTA 1Z0JA 1OH5A 3DZJA 4FX5A 3SYLA 4LTMA 2HU8A 1KP3A 2H5LA 1PFGA 3TOXA 1YHNA 1P3DA 1J39A 3M1IA 2IV7A 2VATA 4F9TA 4ZGGA 3PG5A 4A0SA 3NRBA 1U0BB 5LKRA 4DTCA 2EJTA 3GZ4A 3FE2A 1BGVA 1DG9A 3INNA 1EZ1A 5ESRA 4DRZA 2XNDD 3H5VA 5F2OA 1JXMA 4P7BA 4PTYA 2JLYA 2RONA 4LNUB 2ZRGA 1A4IA 1HNNA 2HHLA 4FEAA 2V97A 1TZMA 3FWZA 3G2PA 3PNKA 5K6AA 1ORHA 1UQUA 3UJAA 1XQ1A 1DAEA 3SR0A 5FWXB 2B7BA 2JJ2D 3HHPA 1K4MA 3TCKA 5J1SB 3BCUA 2GBPA 1UC9A 2HPZA 1U2DA 2D62A 2P68A 3COSA 4MCJA 4ZI5A 5FBQB 3TTUA 1O96B 3FHCB 2M1XA 1N2BA 3WXMA 4IY1A 4TTJA 5ICEA 2A0KA 5IUJC 2R11A 3BRCA 1FLNA 3OPYA 1UH5A 4ZJYA 3JQAD 4LHXA 2UXCB 4OJKA 3VAZA 4A1FA 1G0OA 4RTKA 2D13A 3TDMA 4YJ3F 2IPLA 3OIGA 2WT8A 2Y1DA 3B2QA 3M81A 5B2EA 4YCNA 2V3VA 5JH7B 1T4CB 3BE5A 2JFFA 3ZN2A 2V54A 4ALLA 1V1JA 5C5IA 3EZFA 4D9EA 3P0HA 5DWDA 5LCXA 3QYJA 2D4HA 2YUIA 5D51S 4CL8A 5HUHA 1L4LA 1VLZA 1DHTA 3AG6A 4QOGA 3FFWA 3UGJA 3KYBA 3DO8A 3NHRA 3LOUA 2YNMC 2RGYA 3QEKA 1KI9A 3ZJ4A 4IRXA 2D54A 4TSFD 5DGXA 3FCEA 4TRJA 2W2KA 2VRCD 4Q7EA 4QLOA 2H1RA 1CV2A 1P0QA 1TI7A 4M53A 5AKHA 5B4VA 5CVDA 3CLRD 3WOVA 3DV9A 3ZGXA 4DV2B 1LRKA 1Z47A 1F48A 2V59A 3H8JA 4MPDA 3NU1A 1N92A 4J91A 1BHSA 2WWWA 3L1HA 2HHHB 1TNDA 2C4WA 1G3MA 4DV6B 2ZTHA 3LSYA 2NUPA 4QL3A 2IBTA 2AXQA 2IHNA 5G1NA 3VDNB 2CSUA 3V4SA 3Q11A 4MHTA 3U62A 1YOVA 2OY0A 1ONPA 1QH8B 4ZTZB 2X6RA 4ZZ1A 1Q6ZA 2VPPA 3PTLA 3WGKA 2V6FA 2ZYIA 3X1ZA 3H1PA 4Q34A 5THKA 1KA9H 3GEGA 1XTJA 4OYHA 1Y89A 3H65A 1PJTA 2L17A 2FW8A 3BTUA 1GZ4A 1QK4A 1ZH0A 4WDRA 4JLUA 4RK5A 4TYYA 5HIMA 3GCGA 3EX7C 4GKKB 1TGVA 3R7NA 4F91B 4MUYA 3RS4A 3PEWA 5LUBA 4Y0NA 1WXXA 3Q5EA 4J94A 4Q4DA 3UAXA 1Q1NA 4G8BA 2ZUUA 3D8BA 4Z3KA 1XAGA 4UEWA 1DRUA 5T8KA 1ZM3A 4GM4A 4BVGA 1WE2A 1QJ4A 4JR2A 2VCHA 3TK1A 1JQKA 1DX9A 2QTHA 3CLSD 3PU6A 4HQNA 1IJFA 1XZLA 2XVYA 1CVLA 4UUBA 1WNTA 1KGSA 5DV9A 2O8BA 4EUEA 4DMLA 2HMSA 1J7JA 4UU1A 2XQJA 1JEAA 1SIUA 3TLMA 2V7PA 3RYHA 1JAHA 4OI4A 4FDTA 4CHGA 1W36B 3GRFA 1AS3A 2GCOB 1DEXA 2QZZA 4MQLA 1TKRA 3ZCSA 4GM1A 3M1AA 3EUFA 4QYSA 5AICA 4OQMA 4QTYA 4UQOA 2QPLA 1JJ7A 4C4SA 3KKKA 2O50A 2WPNA 1C30A 3ENVA 3BGSA 1C7IA 2X0NA 5AK0A 3U3OA 1UJMA 4JBYA 1CIJA 1SQ5A 3KSZO 5BUSA 5I47A 1PJ8A 5AJUA 4DABA 1XGKA 1XXHE 3L92A 2B92A 1KDTA 1MABB 4IJVA 1N8SA 5EWLA 5JWHA 3DLAA 3DZIA 4EFNA 3ISTA 1G9XA 4PC6A 1Y9DA 3H04A 1PP4A 3DNFA 1XYVA 4JB3A 2H9YA 1G7TA 2Y77A 1EFVA 1NLMA 3EXFB 3FG9A 4ENUA 2REOA 3EGVA 2C3MA 2O4UX 1EP3B 5CDFA 4WXPA 4O2RA 3DHVA 1CK4A 1I7LA 3VO2A 2J45A 3K2EA 4CDGA 3EGOA 3ZIUA 3T3OA 4ZVLA 2ZJ4A 2RGWA 1IY0A 2BGTA 1AB6A 2H11A 3EQZA 3B5JA 3OA2A 4L73A 3PV0A 1K0UA 1UJNA 4PS1A 1XOIA 5CHYA 3TOZA 2FPOA 2JCYA 2OXFA 1M2FA 5KREA 1JLKA 2PSDA 3BD8A 1QYIA 4EAQA 2P2SA 4V38A 1PNOA 4NMMA 5B55A 1AMOA 1E1QA 1PU2A 2OFFA 4EZBA 3B60A 5FL7A 2WTEA 4EW2A 5FBWB 1TKCA 5C32A 3RVPA 4TTVA 1VC2A 3K9BA 3D54D 2BKLA 4J0IA 4LC1A 1IIRA 5FV4A 4GX2A 3T5CA 3X44A 3JYLA 3U5TA 1WEHA 4KYVA 1NDQA 2VTVA 5F9FA 3CRQA 3D8UA 4B3TB 2A7QA 3Q41A 5T57A 1V5EA 2RK3A 3BN3A 3IAFA 4QYIB 2B8TA 4GD3Q 4C4ZA 1F6WA 5F5XA 2Q4TA 1W1IA 2BOVA 2Q8NA 3ANSA 4H1VA 3UICA 1JIKA 1OI2A 2VXCA 3BMOB 4QBFA 1JMYA 1P44A 3IIIA 1TTPB 4IZ6A 2YASA 3NW9A 2C1XA 3HMKA 1LFDB 2HD4A 1EFAA 5EAIA 2ZEJA 5ICCA 1PL6A 2J4CA 3QBTA 1XFAA 2WJIA 2IEYA 3FUTA 2HWWA 5JSKA 4WCDA 3V7UA 4HDMB 4D0NA 1M66A 2OBXA 4ARCA 2P2LA 3KZ1E 3BTVA 4RMHA 5DLEA 5K3EA 1A88A 1V3TA 2QTVA 1WB4A 1W96A 4B8ZA 3BFPA 3NR2A 5JCOC 1W4CA 1K7SN 4CKXA 1EG7A 1NXSA 1H65A 3AF3A 1XO1A 3D3QA 4QOFA 1NU6A 1THZA 3E61A 2AJCA 4ZZ0A 2G4LA 3TW8A 1S4QA 3SYTA 1A2BA 2QX7A 3AUSA 1E3WA 4E5PA 2GHIA 2AZXA 1LBSA 3HCEA 5K0BA 5LQCA 3FI0A 2Z2XA 1VPDA 3DE4X 4WXRA 3UUFA 5KEIA 1NW9B 3EWAA 2XTNA 3I62A 4TSFA 4A5SA 4OJNA 4HRXA 3ROKA 4ZGWA 4N6NA 3WYAA 3I09A 3LUCA 3P9RA 1DIHA 2YIDA 4QRHA 4XIGS 3S70A 1DJPA 1QO0A 3Q3IA 2NNLD 4H3HB 4PGHA 2NW6A 4RV4A 5BXQC 2OFXA 1IYZA 3VHRA 4XR4A 4IVNA 4RZIA 1OXVA 5K05A 1QFJA 1AN0A 2FQQA 3KKEA 5I7SA 5IT9A 4GZLA 3IT0A 2RD2A 5LXTA 2ZWOA 3AI7A 2F00A 1D2MA 1Z7BA 3H6GA 4I5DA 4GPD1 2C4HA 2NUTB 4HXYA 4KGXA 2IHJA 2BSAA 3NLLA 4NECA 1L7BA 2ZAIA 4FI3F 4V2UA 4XJTA 1QO7A 4GT1A 4HX5A 3GNQA 5DJ5A 4EX6A 1G4AE 2XUOA 3AV0B 5B1IA 5TF4A 1WVGA 1C7QA 5F7XA 2CLIB 4OX9B 1TM2A 1RFGE 3IBFA 3NWJA 2W2VA 1DZ3A 4MDHA 2IL1A 3HE3A 2NPIA 1A77A 1AXGA 5TJ9A 1WCIA 5JVDA 4ABTA 2FYTA 3GPDG 4AWAA 4QLAA 5KNBA 1T5LA 1H42A 1YJXA 2BGJA 5FYQA 5F1PA 5A9TA 1T5IA 2Q2WA 2PU7A 5TB5A 3GFQA 1FQKA 1L5VA 3ELBA 1HDEA 1Y3FE 1YKGA 2IX9A 2OL4A 2YTZA 3PHIA 4EHBA 1JEOA 4U2CA 3N74A 4GMKA 3WSTA 1QIKA 3FSGD 3Q5DA 4BO4A 1SXPA 2NO1A 3EA0A 4KO1S 4BMNA 5GJWC 1HG1A 1VL6A 2J9FA 1ULHA 1U2ZA 4JJEA 3HU1A 3COZA 3DE7X 1NUPA 1H2RS 1MC4A 2HSWA 1TMYA 2QYSA 3BF7A 5GV7A 3QEMB 4LKOA 5AW9A 3G8AA 2P9FA 3L4KA 1LLCA 3TLZA 3EVTA 4DLZA 2Q5QA 2LKCA 5EIFA 3L6RA 1GPBA 4HQKA 5LQNA 3OBBA 1GKKA 2F3TA 5F1OA 4R5HA 2Y92A 3JZDA 4JSTA 4KLAA 5JMOA 1QGZA 4DGSA 3G2JA 3R20A 3GL9A 2LD4A 5KKAA 3F49S 3WAJA 2XA1A 5BO5A 2RHOA 1G5TA 1RJFA 1DQZA 2JAQA 4OHVA 3NPAA 3UT0A 3WWCA 4C04A 1GT91 1WM1A 3L02A 2OCPA 4HAVA 4JK3A 4WNAB 1UDAA 4KX3A 1H0KA 1KPGA 2GWHA 1HFEL 2CJWA 4MW9A 4P82A 2O59A 3E1GA 5IANA 1U2PA 3DJYA 2E6KA 2DFTA 1W25A 1KZ7B 1JAYA 2XOKA 4CV1A 3ICCA 3NDIA 3SHOA 3GLIB 1DT3A 3VNAA 4RVHA 1COWA 3O2NA 2QN2A 1RI2A 1L7MA 1M76A 1WEKA 3DC7A 4IMPA 3ES9A 3ZU4A 2DULA 2DBQA 3IALA 4UFNA 5C9ZA 3NUGA 3PGA1 3HU2A 4JBHA 4PSDA 2JFQA 1MRNA 3OM8A 2XWSA 1BGXT 4J1SA 3OP4A 3JALB 3S2IA 2VWPA 3H5IA 4TOIA 4N5LA 3KJIA 3SBEA 3UIEA 1LDBA 4YREA 2NTEA 5EYPB 4U9HS 1U0OC 4JC8A 1A9TA 2QX6A 1T9GS 3DOHA 3MGBA 4JD5A 2YV1A 1YXMA 3H1TA 2HADA 2HT6A 1SPXA 1M1ZA 4HJXA 3A4VA 4C0QC 1LTHR 2BFFA 4N8SA 5AOAA 1P2DA 3UG6A 4YIKA 2IXFA 2Z5VA 4FTWA 1FP4B 1ZBDA 4X7PA 1FYDA 1UBSB 4QOJA 3IJPA 4HXGA 1A9YA 1BDMA 1XB2A 1QO0D 2QU8A 5DKFA 2Z09A 4KXNA 3B6KA 3ZQ4A 5A02A 1H9CA 1EX1A 3HCBA 4PYMA 3HRHA 5KTRA 3KQLA 3D43A 3UNXA 4DJAA 2X5NA 5AKEA 5JPDA 3QLEA 1DTSA 1TU3A 4MVJH 4M0FA 1MDBA 2DYKA 2QS9A 3JATA 1M2EA 4KYTA 4ONEA 5KHAA 4HVAA 3U17A 5BW5A 4N65A 3LBFA 1I4DD 3VSEA 3VYRB 4ETNA 2TYSB 4OLHA 2J9YB 5F7JA 2AWOA 4GP9A 5AIAA 4CM8B 3CNEA 5A5DA 1IXKA 3PFIA 5CDHA 2AMYA 4Y2HA 4DPKA 1GA4A 3G2LA 3MTEA 5EJAA 5L3QB 1KVSA 3CEHA 4BTEA 3U13A 2ZRNA 3BRWA 3BWBA 3LUDA 3PE4A 4TLLB 1GQ2A 2HK6A 3H7AA 2YFQA 3VX3A 3ZUGA 3M89A 3BSYA 1JLRA 4AS2A 2XAAA 4D9NA 1P1KA 3K9HA 4C7OB 4MIEA 1XG5A 1KEVA 1IBRA 2QW1A 5HUQA 4EB6A 1OR8A 1VB5A 5AK6A 1T5DX 3VYVA 1VL5A 3JQGA 3QVUA 4BBZA 4DNFA 3W5CA 4MVJE 1MJFA 2FR8A 2R96A 2LXNA 4UHJA 1U1GA 4RTRA 2BI8A 1JWAB 3R41A 1OYWA 2G7ZA 4ES6A 1IM2A 2R8XA 2YN0A 1OWLA 1R88A 2PX4A 4J0KA 1JHDA 3BWVA 5C46F 4PAMA 4W5RA 4AT1A 3MBOA 4NFYA 3C5HA 3TG8A 2PSSA 4JYPA 2JGFA 1O95C 1POXA 1X7ZB 1J5PA 2ZYDA 3BCSA 4GQAA 1F2DA 2GWRA 4A15A 4QO7A 4N03A 3R7WB 4CL3A 2QRVB 3HNRA 1TXGA 3R5XA 2E5FA 4REQA 4PQFA 2HO4A 3W2HA 4F3YA 3SLRA 4YCCA 5IH7A 4BXOB 2HKIA 3V7FA 1Y7LA 2NU8B 4A92A 3EH2A 1N33B 2P91A 2Z2YA 4A0FA 2O2GA 2Q46A 3AH8A 1SVWA 1T3SA 1HYGA 3HVJA 2XUJA 3STHA 3SVTA 4Q1VA 2ST1A 5BN3A 1VMKA 3AMVA 4E6EA 2P8JA 1L4YA 1ACMA 4IOJA 5FI0B 4ECEA 5G40A 4YQYA 4EHFA 1CUBA 3VR2D 1XIVA 3QY9A 2XRFA 3W78A 1T8PA 1G59A 1U7HA 4H1UA 3U81A 3KUCA 4FCWA 3U3RA 1E1KA 4BE4A 5L95A 3KQSA 3PUIA 1SJ9A 2PT9A 3FBTA 1J00A 4Q37A 3LU1A 4AURA 2OQIA 4AO7A 2X15A 4W9RA 3GGPA 5EZQA 3SX0A 1HXHA 4H3VA 5CB6A 3A9SA 4DDKA 4CMCA 2GFIA 1D2AA 7AT1A 5L53A 1T9KA 1QLHA 4IHJB 1QCYA 5C81A 3MQ2A 4FSDA 4PR3A 2QTZA 4MWSA 4TKUA 4NU6A 1KEZA 4PN7A 2ZWIA 1KO5A 3BOSA 4BGVA 3VO1A 5AM3A 4PS0A 1EDEA 3O4IA 5FBVB 4GPEA 5DM0A 1I13A 3ENWA 3MQ4A 4QDOA 3SEQA 5B6JA 4L4ZA 4NG5A 1QYCA 4MLDA 4PZ9A 3LY7A 2J48A 1X74A 4DARA 1RRCA 1JQ3A 4D56A 2IYUA 3H8SA 3LF1A 4X85A 1R6DA 4ZIRA 4WNIA 1OWNA 2HB6A 3I9NA 9LDTA 2BFDA 5DYTA 4FGJA 1Y7PA 4R7TA 3C43A 5LNK1 2NAFA 4ZAZA 2RJOA 2CFIA 3A70A 3WIBA 2PL3A 2I5PO 3IHTA 2ECQA 3AONB 3IVGA 2NUTA 3LPAA 4WDQA 1SG9A 2VSOA 4WLUA 1S2NA 5AKLA 1PNRA 3SEZA 4FCTA 1DL5A 4N3NA 4ZCQA 2BEWA 4Z1MA 2BY4A 3W77A 1PYOA 4GR9A 3C3EA 1IOLA 2D06A 2CKDA 2I6SA 4LI0A 4MITA 4C0BA 4V1CB 4JHXA 1GG9A 3I9KA 5ALZA 3TIGA 1P6XA 4RL4A 1I3MA 1SCAA 2JZOA 3PWTA 3VKWA 4WZBA 3L6UA 5JCPA 721PA 2FN9A 3M2PA 4J7CA 1JGTA 1KAEA 3QI2A 4NMXB 4MKZA 4BQRA 3OIUA 1J25A 5DOZA 1P74A 5JS1A 4D81A 4IDNA 1PR3A 3Q0EA 1DWQA 2PDAA 2LDXA 3IOMA 4Y6LA 3MAJA 3ROPA 3LSTA 4WN3A 1XLTC 5JV5A 3G7NA 1E8DA 3RS5A 1XMOB 4CEIB 2X5KO 4Q39A 5LDDC 3HB1A 4AUEA 3MM4A 2CFOA 4BKUA 4C88A 4IOKA 4J49A 4I7EA 3PQ8A 1EUDA 4NBWA 3LT0A 4DT1B 1PL8A 3GT0A 5HRCA 1U2TA 4PIMA 1DS6A 3I5UA 3FMIA 3HM2A 4FOOA 4L02A 5H9VA 2CV0A 5J3JA 3BXOA 1MH9A 4KQWA 4UW9A 3RRZA 5A3JA 1Y5RA 3RFXA 1B6TA 3WI7A 3WL5A 1R0KA 4HWRA 4IQ4A 3F9IA 3SHWA 1G20B 1ADJA 3R40A 4BO3A 3EGXB 1SBHA 2FMHA 5KAMA 1GPYA 2H1HA 1L5OA 1TT5B 2ZJOA 3B2EA 3BL6A 2ZQYA 3FCYA 4MEBA 2CHUA 1QIEA 2FETA 5J63A 3F6BX 4PXYA 4NZNA 1IOVA 3T0GA 4A6EA 3UJ3X 3FUCA 1RPJA 3HCWA 3OLQA 4RV5A 1ORDA 3R3UA 4RLFA 1SBNE 3MGGA 3IPXA 3V7YA 4CEJA 1LI5A 1GQFA 4HYTA 2HZBA 3RQIA 2YVLA 5HFJA 2PZJA 1EFUA 2X8JA 2DLDA 3P97A 4O4IB 4W8GA 4ZVVA 4YP0A 3MB5A 5AKYA 5YASA 2G71A 4BX2A 5HOQA 4WK0B 5CVEA 5ABPA 4YJFB 1Z5VA 4C4PA 4YGYA 4RHXA 4IDCA 4Y9RA 3C8DA 4D9CA 4NBKA 1F8YA 1CQWA 1NVFA 2OCIA 4LWPA 4XD7A 4UCWA 4GFDA 4CDMA 5I4CA 3M4YA 2FTKE 4HQLA 1LPNA 2CUZA 3AFIA 3P2OA 3WGQA 1ZN9A 1I4EB 1CD5A 2ZR8A 2P0AA 1NBEA 4EUFA 2Y99A 3OM9A 4QOEA 3UCXA 4JEIA 4UUMA 5FOXA 4MVJA 4X71A 2VNJA 4BVHA 1U8EA 3I0ZA 4FKMA 5J2UF 1L8LA 1YQGA 2R1VB 4QAQA 4DUPA 3DYBA 4OFXA 5AHRA 4MKXA 5LQUA 1DXHA 4H16A 1IBCA 4HXEB 4XUDA 3RWMB 2X7XA 1Y4SA 2GLUA 3A4IA 3AV3A 5C34B 5IFKA 5L40A 3MBKA 4GL2A 4Q3DA 3CHYA 3PQDA 5K2MA 2QN8A 2YQ5A 4QTUB 3L43A 3EPJA 3ZD6A 1D2CA 2EGGA 1F60A 1NMZA 2EJBA 3WWPA 2BSQA 2LBPA 1G18A 1MXFA 2H1VA 1YUBA 1XRNA 2MINA 3B5IA 2R8YA 4P58A 3KVOA 1BKDR 1ISPA 1RCFA 4LE0A 1ZYUA 10MHA 1UQTA 2FF5A 1QIDA 3JQ8B 2EERA 3HKCB 4WL0A 2COKA 2R68A 2HY7A 3KSBC 1K3TA 3M70A 2ETXA 3FPLA 3B9RA 3NGLA 1OX4B 2BWJA 2HV8A 3FAZA 1DVRA 4KAAA 2NO9A 2C78A 4FE7A 3OPYI 3AHHA 1G2IA 3WYEA 1M1YE 4FWTA 5BRNA 4J1TA 4GPTA 3KBBA 4TVOA 3GH1A 3DXFA 5C8VA 1FSGA 3T1NA 1ZRHA 2I3AA 4JYCA 1YC5A 4R7ZA 5I9BA 3VNRA 2CBZA 3U7RA 4EUKA 1KKLA 2FSGA 4F3RA 3OOWA 4K26A 1BN7A 1N3LA 4E7OA 3HCRA 2AW3A 3ZJVA 1PW5A 1FX1A 4EKEA 1ECPA 1Y1TA 4QJIA 4X20A 4ENSA 3LG2A 3N2IA 2A33A 1BRTA 1V47A 1GYPA 1DCKA 2ATXA 1EK6A 1DPGA 1RQXA 3S2EA 3GPCA 5IM4A 2GHTA 4IF6A 5FTMA 4EGFA 4IIJB 5HR5A 4JGGA 3QTTA 3QX3A 5KYYA 4MV6A 4BU1A 2ACEA 3IMGA 2FUG6 3IDAA 3E2IA 7YASA 4TKMA 3ICQB 2ID7A 3LMKA 3SBDA 2XSZA 4J9UE 1SFRA 3VR3A 5E4YA 4R0VA 1G4HA 1PX0A 2IOQA 1KAOA 2VI5A 5ELLA 2FSUA 3S4YA 1X1TA 4Q48A 3IPYA 1ORRA 4RTNA 3WAKA 1OBOA 4PPGA 3RABA 1C1YA 4DLTA 5JNTA 1KHHA 3PBKA 1JG3A 1VL0A 2MJLA 2VWQA 1UT6A 2PRYA 3H3XA 1FXUA 2I4MA 5JO0A 3ROZA 3CT6A 5DHUA 3E7FA 3K9QO 4EHNA 5C4IA 4NJEA 1POWA 2PGXA 2QXYA 1Q12A 3Q4GA 3TTXA 4BFVA 3M6WA 2W2TA 1IZ9A 3VH4A 5FUBA 5LU8A 2O3SA 1RFLA 5CUQA 4LDZA 1H3NA 3ILHA 5F5NA 1LWNA 2FFAA 2R62A 4KO4S 1MIHA 2VHWA 4UBKA 1OZFA 1V8DA 2ASVA 3PDJA 1Z2PX 2BMEA 4E1VA 4OTZA 4JP5A 4GHWA 1TZ2A 3KQMA 3GLHA 1XDUA 1Z3IX 2Q5EA 4B3RB 1GFSA 5CEFA 4MNTA 1KVQA 4OQQA 1DDOA 4WH0A 4K9LA 2F59A 4EKNB 1E77A 2HRQA 4B7XA 3LX5A 4JEMA 3NBYC 3SG0A 3FA2A 3KSUA 2OA0A 1YR1A 3FLMA 4M9CA 4Y1GA 4DADA 1LVGA 3R23A 2QPTA 4M8NE 2OCGA 5FULA 1PUJA 4RU1A 1ZJ4A 2IC5A 2YQ4A 1VRWA 3W5IA 5K5EA 2YMPA 2JVIA 3C8ZA 5K3FA 2XUKA 1GXSB 5HFNA 4E88A 4XQ0A 1LBQA 3MJEA 4P0TA 3TIXB 4R98A 3L8CA 1Q5PA 1N2EA 2PZBA 5HIIA 3RK0A 1FDTA 3ONVA 5AI4A 1Z8NA 3UWDA 2R751 1LCIA 3P19A 1KGDA 1DAOA 4HNAB 3ZVLA 4ZOLF 3LT4A 1U6KA 1LF0A 5CIWA 4GG1A 3EIFA 3N8GA 2Q0SA 2HJSA 3KB1A 4F71A 5TVGA 1RJEA 1Y6RA 1G5FA 4AY3A 1SKAA 2PZLA 4L3OA 4MYRA 1U4OA 2I2DA 4MRPA 2V4UA 1HZZC 3SWWA 4PAWA 2WQ7A 3AUJB 1KQPA 2KHZA 3UMCA 5DM1A 1VMDA 2WVJA 3TDNA 1QHGA 2QJTA 4LRSB 4QVIA 2EAUA 1AXEA 4F1KA 1DBSA 1FJHA 4KG7A 1Y81A 3WYNA 1T6ZA 1U2RA 2BH9A 2E37A 3L40A 3NC4A 4UMVA 1ZM2A 3P9QA 1JQ5A 1SCIA 2HDNB 4HC4A 4LQLA 4QNMA 1Z17A 4CCYA 3CN7A 4FEEA 3KYDB 4ZAVA 3AF0A 3BQNB 3MERA 4LYAA 3O3CA 4W1RA 4V0QA 3ZU6A 5K0LA 3SS8A 1QG2A 2YY5A 1N2GA 3HXLA 1BD4A 4TMWA 1D7OA 3EIUA 3DKKA 4MRSA 1J42A 3HXKA 4PO9A 4OBWA 3FNEA 4HVTA 4TWIA 1ZSNA 4OHBA 2C5GA 2VSYA 4XTRA 3FPGA 3BGWA 5IDWA 2FGJA 1WV1A 2B99A 1DTEA 2P41A 3UMMA 1ZOPA 3DUFB 3QVWA 1C5KA 3E9CA 3IAAA 4IJMA 2HCBA 2XYRA 2ZT8A 3IVCA 4HPXB 4TXJA 4BNVA 1L5HA 4OJMX 4M9ZA 4BNMA 1O95D 2GKSA 3ZDZB 1NF3A 1T4BA 3BQ9A 4AJ4A 3IJRA 1CR2A 2CVQA 4DIUA 4NZOA 2Q27A 3W7AA 1XZBA 2WI8A 4RK4A 3NP9A 2AMFA 3L7IA 3T7AA 1QGUA 3T5DA 4QUEA 3AFMA 3LC7O 3CVUA 2JAWA 1VECA 4BUZA 2BCGY 1KU0A 4LYHA 4Q47A 3TZLA 1S8FA 1N6IA 3QF4A 1QXSA 3CZ4A 2QUZA 4I1PA 2Q0HA 2VXBA 3B36A 3VZPA 2C4NA 3KQOA 3B78A 2VAXA 3FTDA 3L1IA 3PC3A 2O8EB 4PTLA 3CR7A 3LDHA 3N9IA 2BMJA 4F3TA 2ZE8A 4ZEMA 5DEOA 1MVNA 4B2LA 2VYVD 3QZUA 3N2KA 4CIBA 1WUKS 1E18A 4AG5A 3MT8A 4G89A 1DADA 2J3HA 3ZH9B 2RHDA 3UGQA 1SHJA 4WOBA 4WUTA 3ONNA 3JVDA 1Q83A 2QE7A 2WK1A 2Q7XA 2WICA 2XNKA 4W5QA 4B4DA 1R64A 1N5LA 1GWNA 3K9CA 1P5FA 1VPTA 1ZW1A 2O2YA 1KNQA 2OG2A 2QRMA 3L8MA 4PX5A 1R8SA 5IMSA 4U6NA 2Q4BA 3L7OA 1P7WA 2AE2A 3K0EA 4JU9A 5CURA 2FQYA 4CTJA 1JIIA 4KH0A 4V24A 1Z6TA 5MFZA 1G19A 1KJZA 3ZY2A 4UCFA 3H5RA 2OMEA 3NXKA 2QUHA 3IVAA 4HQOA 1IFXA 4WZBB 4OHCA 4Y1RB 4D96A 2DQZA 1MV8A 4KUGA 5KYVA 4DQKA 2ZRIA 4AX8A 3CJTA 2VJBA 3TX6A 4BE9A 3BKXA 4HQ6A 3Q5GA 1QVAA 3MTGA 4I1RA 3VNQA 1GAWA 1MJGM 1XDSA 4AG3A 1H8HD 4WA7A 5AD1A 3CVJA 1WOYA 4DNQA 4WXHA 1CUIA 1NZDA 3WLKX 1ODJA 3TMAA 2QRNA 5DM60 1UEJA 5KHLB 4V02A 4FYKA 1WCV1 1WF6A 4LDJA 5IVIA 3VX4A 3GLHE 3K09A 2YRFA 4J2HA 1UKYA 1JKIA 4CT0A 3LECA 2FWIA 3V55A 3SJUA 2YIVX 3CBGA 1EWVA 2J08A 1BJRE 4P08A 5D3MA 5G0UA 3SKXA 4RJKA 4CM4A 4BWGA 5FOSA 2E21A 5AW3A 4GLFA 2ZJAA 4JEUA 5ALMA 4UOZA 5LMZA 3CNNA 4NZMA 4P31A 4ZT4A 2ZITA 4A6XA 1Q0ZA 3LTNC 1T34A 1HE4A 3WK6A 1BJKA 2NOAA 1Z4LA 2YCBA 4UNQA 1XNRB 2IEDA 1ICIA 1ZJ5A 3PXDA 3DZBA 4G4JA 4LOAA 4NVRA 4TKUB 3WKEA 1NJGA 1A2OA 2O3RA 3NYRA 3TNFA 5LYJF 4OLAA 3VNVA 4XVHA 3R8FA 3KV3O 4HUJA 3FHLA 2ZJZA 1N3IA 2E4ZA 4LJ7A 5F7ZA 3R7DA 5ICSA 5CB4B 5KJFA 3S29A 1HDIA 1Y5IA 3DGFC 4JP8A 2C0PA 3HA2A 1A4RA 1Z5UA 5KDLA 3STWA 2ZYTX 2B35A 3IEPA 4DA8A 1X8LA 2G5CA 3OEED 4HNHA 3G85A 4MIKA 3PXBA