3ER9B

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/rna
total genus 158
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
B PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
B PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er9B01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er9B03
3OWGA 3ER8C 2GA9D 3ERCC 3ER9B 2GAFD
chains in the Genus database with same CATH superfamily
3OVBA 4AKVA 4KLEA 4P2HA 9ICKA 3DPPA 4FHPA 3CK6A 3JCFA 3BUIA 5DDMA 5EOZA 1QWUA 3D52A 3BUQA 2Q66A 1I4TA 3F7WA 2FMQA 2F7RA 4UBCA 3D4YA 5HRBA 4X5VA 3B0XA 3JPQA 5BOMA 1XSNA 4RQ1A 3DPOA 3PNCA 5J2GA 1ZJNA 7ICRA 2EFKA 3C2LA 3LMFA 1HTYA 3DPQA 1TQUA 5HRGA 3ERCC 4KB6A 3LLLA 3PLTA 4X4UA 4RWOA 4I2DA 1RZTA 3T46A 3Q84A 5BOLA 3D51A 4NLNA 4B9QA 4YMMA 4AT7A 1QWNA 4WBYA 3EJSA 1UEUA 4JLXA 4F5OA 1BPDA 3UQ2A 2ZH6A 4IWOA 4AZHA 4JWIA 5F2VO 5J2EA 1HUOA 8ICNA 5C5BA 4UDYX 4AT8A 3C2MA 4RQ7A 3PMLA 3OGUA 4OAHA 1ZQRA 4NSWA 4EZSA 2X3VA 4M2YA 5J0TA 4Z6EA 1TV9A 1MIWA 4RQ8A 1I4DA 4IQUA 5IIKA 1GNTA 3H37A 1YWMA 4EBKA 2ZH5A 4KLLA 2FICA 4K4GA 3CZSA 4R5LA 4EZQA 1WDZA 4M9HA 1E9VA 5CP2A 3HAHA 4O69A 5CHGA 5TZVA 3FD9A 2ZH1A 4M0MA 4K4HA 2F7OA 4JWCA 4YD2A 4PHEA 2BE3A 5DBAA 7ICHA 4H6HA 5DB6A 2ZH3A 4ATBA 3QNJA 3SOGA 4I2EA 4EZYA 4M9LA 8ICIA 3BUDA 2BCVA 3BUBA 4S3NA 4I29A 4PHAA 1MIVA 4KLHA 4WPCA 5HRHA 3UITA 2Z0OA 3T49A 4JNEA 4IQTA 4QZFA 5J2IA 3JZ0A 3OV7A 1BPXA 4I28A 3K7DA 3RH6A 4PGYA 1I49A 4GXKA 4NXXA 3G9GA 5J2HA 3RJEA 3ZEDA 4JWNA 2M2VA 3UXNA 3PHZA 4KIKB 4O6AA 3OUYB 4X4RA 3DDFA 5JTGA 1ZQUA 7ICQA 1R33A 4E81A 3O3OB 4EZNA 1VFGA 1JQRA 3DYTA 5IIIA 4PHDA 8ICJA 1HWWA 7ICNA 2YLLA 9ICXA 1LQ7A 4NQIA 2Z0VA 4JNFA 3H3AA 2BCRA 3C66A 4JL9A 9ICAA 5J29A 4GXJA 4AT9B 4KLUA 5D62A 2D1LA 1U00A 4X0BA 1R89A 4M0AA 4HR1A 5TKYA 2F18A 2PFNA 1QX1A 3RJGA 4KLTA 4K97A 4XQ8A 1R34A 1ZQXA 4EZPA 1Q78A 3UPSA 5J0SA 4O9MA 2YLAA 9ICCA 2YIBA 3EJRA 2BCQA 4RWQA 9ICPA 4EEBA 1UETA 4UB4A 3NKUA 5HRIA 4TURA 4X4NA 4QZCA 8ICXA 4KLMA 5DB9A 1OA1A 4AZ6A 2F1AA 3ABHA 3OHXM 2B56A 2ND0A 1GN9A 4WC0A 4TUPA 1URUA 2EWFA 9ICQA 5HRKA 4R5JA 3UXOA 2LXYA 1XSPA 1ZQWA 1ZQNA 2PMRA 4I2CA 8ICCA 3AUOA 4NM2A 4HY9A 4UB2A 4MF2A 5DB7A 4P4PA 2GA9D 3MGHA 3HJ4A 4I0UA 2YL6A 2Z0NA 3BVVA 5J0RA 4DCNC 4NM1A 2F1BA 3JPSA 2X5CA 3HW8A 2EWRA 3OK8A 4R5KA 3I04A 4X4QA 4X0AA 4LEZA 8ICHA 3BVUA 2PFPA 8ICAA 4EZXA 1GPJA 4P4OA 1DKYA 5J0OA 3UXPA 4F5RA 1SUFA 4RPZA 4I2FA 4EGWA 4NPHA 9ICJA 5IIMA 4I2HA 3LQCB 3CAZA 4WCWA 5HR9A 4UAWA 8ICPA 4O5KA 4WQLA 4FM3A 2M2TA 2HN2A 8ICGA 4WC7A 4K9AA 2IHOA 3DDGA 5D63A 4E7XA 1ZQBA 8ICOA 2QFFA 1DKZA 4YMNA 5DKWA 9ICSA 2MI7A 1O7DC 4UBBA 4YD1A 4E8FA 4TUQA 4AZ5A 4WBZA 3HAIA 5IINA 2FMSA 3HX0A 1JMSA 3B53X 2ZHBA 7ICGA 5IIJA 1TQTA 7ICVA 4WQKA 4QZ9A 2ISOA 2ELBA 3I01A 2O5AA 4RQ5A 2N3KA 3KAWA 4R63A 1BPBA 9ICBA 2OO2A 3HWTA 1TFWA 2BPCA 5HRFA 1JQKA 2VANA 2WINM 4KLOA 2D4CA 3BUPA 3RJJA 1MQ3A 1O7DB 1ZQLA 3QWEA 4X4TA 5DDYA 4I2AA 1ZQAA 2PFQA 1FA0A 2BCSA 4EZOA 4NXVA 4RT2A 3V7JA 2FYVA 1Q79A 3OUYA 4FHYA 3C7NA 4OAFA 4Z6DA 4RQ0A 4QZGA 4IW0A 3MCRA 4I2BA 9ICWA 4IQVA 1TQSA 3VEAA 7ICPA 1OAOA 2Z8YA 5J0XA 4QZDA 4EP7A 2F7QA 7ICIA 3QA8A 2ZH2A 4UB1A 9ICUA 7ICLA 5CFSA 7ICMA 8ICYA 4YMOA 4H8SA 2M2UA 4QZ8A 4UD4A 1OA0A 5D49A 4FO6A 2QXLA 4RQ2A 1UPXA 3WFOA 4EV6A 3NVOA 4JN4A 3RV1A 1X03A 1OU5A 4NY8A 2DR8A 3RJFA 4F5QA 4R65A 3UPQA 4PPXA 1ZQMA 5HRLA 2QKWA 2IUBA 4R64A 1ZQEA 4K96A 4FHVA 5HRDA 4EZTA 4WPEA 5CFUA 4IWPA 1R8BA 3MGIA 3ISCA 4M5DA 1X04A 1JN3A 1ZQDA 3RV0A 1YLQA 5J2JA 4UB3A 2PY6A 4F01A 2KHOA 2X3WA 1TQWA 2ISPA 2YI9A 4IQWA 4EEDA 1BPEA 5D46A 4MF8A 2O1PA 4WC4A 4KLJA 1JAJA 2JNSA 3CKDA 2FMPA 4AZIA 4AT8B 4DYLA 2EX3B 9ICHA 3T48A 3ER8C 3B52X 2RFFA 5IILA 3AU6A 1DKXA 4PGQA 4UAYA 4EZVA 1TVAA 7ICFA 5CWRA 3T4AG 4QZBA 1ZYLA 3QE6A 3JPNA 3ISDA 5HHIA 3GI7A 4EZRA 4XA5A 8ICQA 4LEYA 4NKTA 2YL9A 4G6QA 1ZQJA 3QNIA 4FZOA 1SU7A 4LEWA 1ZQIA 4MKPA 3HAJA 4UB5A 3CZNA 2DR9A 3GDXA 4DO9A 1GNLA 4YN4A 4K9BA 7ICSA 4R5GA 4O67A 4WC1A 3C5FA 3DX1A 3RJIA 4ATBB 2YIAA 4HYBA 1HXKA 4IM2A 2O0I1 1VJ7A 2DR5A 2RAJA 4P4MA 4LZGA 3DX4A 4LT6A 4LZDA 3D2FA 4AZ7A 3ISBA 3JPTA 5J0YA 1XSLA 5CJ7A 5FIGA 4EZZA 8ICBA 1TFYA 3A98A 5HREA 4TUSA 3LVTA 9ICTA 4WC3A 2YIVX 3MDCA 1KDHA 1MQ2A 9ICNA 3AQNA 4E80A 5IIOA 4AZCB 9ICLA 2RAIA 4NXWA 4I1QA 3D50A 1ZQVA 5E84A 2Q13A 4IM3A 4EZWA 2GWSA 1BPZA 4MFAA 4PHPA 2PXIA 2C08A 4IWQA 2RT6A 3EJPA 5DECA 4M47A 4K99A 4RPYA 1E2UA 9ICFA 4Z6CA 5J2BA 4Z6FA 3EJUA 4XRHA 2ALWA 3ACOA 1SU6A 5J2DA 1ZQTA 2BPGA 8ICKA 3V7KA 3CVRA 4RWNA 4QZEA 2BBJA 8ICSA 1NOMA 3D2EA 7ICOA 5CB1A 2BPFA 9ICOA 4RPXA 9ICGA 3HIYA 5HHHA 4R66A 8ICEA 3BVXA 2OW6A 4EZUA 4K98A 1HUZA 3JPOA 3AQMA 4GXIA 3JPRA 3RJKA 4WC2A 2JNKA 4QZIA 3WFRE 4XJEA 3M3WA 2LM0A 4NXZA 5CFTA 2ZH8A 4RQ4A 4QZAA 1ZJMA 3WFQE 4FZPA 4X4PA 1UEVA 4RT3A 3DX3A 4PGXA 3OVAA 3L9DA 4F00A 9ICIA 3BVTA 8ICWA 4QZHA 1Y2OA 4I2IA 4O68A 4UD5A 4JWMA 2YI8A 2ZXQA 9ICVA 3KDRA 1R5EA 1TQVA 4WC6A 5B3QA 3TFRA 2DVIA 4IG8A 8ICTA 2B4VA 1SU8A 2BCUA 4M9JA 4RWPA 4M9NA 8ICLA 2YL5A 3SYVA 3C2KA 3JYYA 3L3OM 4M9GA 4KIKA 4JWDA 1E1DA 5CHEA 5CR0A 3DX0A 5DBCA 1ZQOA 5DB8A 3RPMA 3MBYA 2NRKA 4FHWA 4KLIA 1ZQFA 7ICUA 4E3CA 2B51A 4N7RA 1ZWWA 3B51X 4OAIZ 4AZGA 4DOAA 3BLBA 2OBLA 2RAKA 1R8CA 1ZQHA 4NLKA 8ICRA 4KLQA 4UDXX 3RH5A 1NO5A 2HHPA 4WOYA 4PH5A 2Q12A 3O3NB 5J0WA 3OVSA 4AT9A 1ZQGA 1R8AA 4KLFA 4MFFA 2X3XA 4DOCA 4EBJA 4ATMA 4YCXA 2DRAA 2V0OA 1WOTA 3TFSA 4K4IA 3K75D 4RQ3A 1KEJA 4FZSA 4D8JA 3VKHA 3KAVA 3H38A 5KBPA 4FH5A 5DEDA 3ER9B 4O5CA 5D61A 3WFSC 3HJ1A 4NXTA 3OWGA 3Q0KA 1KNYA 4F5PA 8ICVA 2NCZA 2YKTA 4WC5A 4AT7B 5J2KA 4IM0A 3NYBA 2GF4A 3EJQA 4PO2A 5DBBA 3V72A 2F7PA 4H6IA 1BPYA 2FCLA 4XUSA 4DOBA 3JPPA 3AQKA 2P66A 5C5BB 8ICZA 3UQ0A 3V7LA 3DX2A 3H39A 1MJGA 4F5NA 4JLZA 2EFLA 3I2WA 4AZCA 4HX0A 4XQ7A 4I27A 4BNEA 1PS3A 3RH4A 2PFOA 3C18A 5CA7A 4UAZA 5J0UA 3MDAA 5J2CA 7ICEA 3AQLA 5D4BA 2OW7A 4X4VA 7ICJA 4NKUA 4X4SA 5B3PA 4FO1A 1ZQSA 1ZQPA 4MFCA 9ICRA 2BBHA 3LK9A 2WYIA 1W9MA 4NLZA 3B0YA 4AVMA 4KLGA 4JLCA 2ND1A 4LVSA 4KLSA 2OZNB 1ZQYA 3I39X 4FH3A 3RJHA 9ICMA 1MIYA 4KM5A 3C5GA 5J2FA 3PMNA 4NXUA 2ZH4A 1ZQKA 8ICUA 2PBEA 3WFPA 3D4ZA 3NWIA 3VEBA 1ZQCA 2ZH7A 3BVWA 3L3PA 2I9GA 4WH5A 1F5AA 4I2JA 4FHXA 3EF2A 4K8VA 4X4OA 7ICKA 2M2WA 3T47A 4I2GA 4O5EA 4AZBA 2DR7A 2YL8A 9ICEA 2WYHA 4KLDA 5FLEX 2ID1A 5BPCA 2ZHAA 1ZQZA 4R5IA 4RQ6A 2DRBA 3CV5A 1V4AA 4JWEA 2W9MA 5J0PA 2OBMA 5J2AA 1ZQQA 1PX5A 2GAFD 5J0QA 2IHMA 7ICTA 8ICMA 4LEVA 5HC9A 4M04A 2HN1A 3O3MB 3AU2A 1RPLA 3EJTA 4HR1B 8ICFA 1I4LA 2ZH9A 4OAGA
chains in the Genus database with same CATH topology
4JWDA 1E1DA 2YIBA 3DPPA 3RV0A 2PY6A 4F01A 4E3CA 2B51A 3NKUA 2KHOA 4N7RA 3B51X 2YI9A 4OAIZ 2OBLA 3F7WA 1OA1A 2JNSA 4UDXX 3OHXM 2B56A 2ND0A 1GN9A 2EWFA 4WOYA 3O3NB 2EX3B 4R5JA 3DPOA 3T48A 3ER8C 3LMFA 3DPQA 3B52X 3ERCC 4KB6A 1DKXA 4HY9A 4EZVA 3T4AG 1ZYLA 3T46A 3VKHA 4D8JA 3KAVA 2GA9D 3GI7A 4EZRA 3ER9B 5D61A 4LEYA 4NXTA 4G6QA 4B9QA 3OWGA 4LEWA 1SU7A 4MKPA 2X5CA 2EWRA 2NCZA 4R5KA 3I04A 4IM0A 4JLXA 4LEZA 1GNLA 4K9BA 4EZXA 4R5GA 1GPJA 4O67A 1DKYA 4IWOA 1SUFA 4JWIA 4PO2A 4NPHA 2YIAA 4H6IA 4HYBA 4IM2A 4UDYX 2FCLA 4OAHA 4EZSA 3D2FA 4WQLA 4FM3A 1MJGA 4K9AA 5FIGA 4EZZA 4JLZA 1GNTA 3A98A 2IHOA 5D63A 5CHEA 2QFFA 1DKZA 4HX0A 2YIVX 4R5LA 4EZQA 1E9VA 4O69A 3FD9A 4M0MA 4NXWA 4JWCA 5E84A 4IM3A 4EZWA 5B3PA 3B53X 4FO1A 4WQKA 4IWQA 2RT6A 3I01A 2N3KA 3KAWA 4H6HA 1W9MA 4K99A 3QNJA 1E2UA 4EZYA 4JLCA 2ND1A 1JQKA 1SU6A 3I39X 3UITA 2WINM 3T49A 4JNEA 4KM5A 3D2EA 4NXUA 3K7DA 4EZOA 4EZUA 3VEBA 4NXVA 4NXXA 4K98A 3ZEDA 3C7NA 4OAFA 3PHZA 4KIKB 4IW0A 3MCRA 4O6AA 4WH5A 4XJEA 3VEAA 4E81A 3O3OB 4EZNA 3EF2A 2LM0A 1OAOA 4K8VA 5CFTA 2Z8YA 3T47A 3QA8A 5CFSA 4F00A 4JNFA 5FLEX 1OA0A 2QXLA 4JL9A 1UPXA 4R5IA 4O68A 2YI8A 4JN4A 3RV1A 5D62A 4JWEA 3KDRA 2OBMA 2GAFD 1U00A 5B3QA 2B4VA 1SU8A 4LEVA 4HR1A 5TKYA 4K96A 3O3MB 4EZTA 5CFUA 4IWPA 4HR1B 4K97A 3L3OM 4EZPA 4OAGA 4KIKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ER8 C;  2GA9 D;  3ERC C;  3ER9 B;  2GAF D; 
#chains in the Genus database with same CATH topology
 3OVB A;  4AKV A;  4KLE A;  4P2H A;  9ICK A;  3DPP A;  4FHP A;  3CK6 A;  3JCF A;  3BUI A;  5DDM A;  5EOZ A;  1QWU A;  3D52 A;  3BUQ A;  2Q66 A;  1I4T A;  3F7W A;  2FMQ A;  2F7R A;  4UBC A;  3D4Y A;  5HRB A;  4X5V A;  3B0X A;  3JPQ A;  5BOM A;  1XSN A;  4RQ1 A;  3DPO A;  3PNC A;  5J2G A;  1ZJN A;  7ICR A;  2EFK A;  3C2L A;  3LMF A;  1HTY A;  3DPQ A;  1TQU A;  5HRG A;  3ERC C;  4KB6 A;  3LLL A;  3PLT A;  4X4U A;  4RWO A;  4I2D A;  1RZT A;  3T46 A;  3Q84 A;  5BOL A;  3D51 A;  4NLN A;  4B9Q A;  4YMM A;  4AT7 A;  1QWN A;  4WBY A;  3EJS A;  1UEU A;  4JLX A;  4F5O A;  1BPD A;  3UQ2 A;  2ZH6 A;  4IWO A;  4AZH A;  4JWI A;  5F2V O;  5J2E A;  1HUO A;  8ICN A;  5C5B A;  4UDY X;  4AT8 A;  3C2M A;  4RQ7 A;  3PML A;  3OGU A;  4OAH A;  1ZQR A;  4NSW A;  4EZS A;  2X3V A;  4M2Y A;  5J0T A;  4Z6E A;  1TV9 A;  1MIW A;  4RQ8 A;  1I4D A;  4IQU A;  5IIK A;  1GNT A;  3H37 A;  1YWM A;  4EBK A;  2ZH5 A;  4KLL A;  2FIC A;  4K4G A;  3CZS A;  4R5L A;  4EZQ A;  1WDZ A;  4M9H A;  1E9V A;  5CP2 A;  3HAH A;  4O69 A;  5CHG A;  5TZV A;  3FD9 A;  2ZH1 A;  4M0M A;  4K4H A;  2F7O A;  4JWC A;  4YD2 A;  4PHE A;  2BE3 A;  5DBA A;  7ICH A;  4H6H A;  5DB6 A;  2ZH3 A;  4ATB A;  3QNJ A;  3SOG A;  4I2E A;  4EZY A;  4M9L A;  8ICI A;  3BUD A;  2BCV A;  3BUB A;  4S3N A;  4I29 A;  4PHA A;  1MIV A;  4KLH A;  4WPC A;  5HRH A;  3UIT A;  2Z0O A;  3T49 A;  4JNE A;  4IQT A;  4QZF A;  5J2I A;  3JZ0 A;  3OV7 A;  1BPX A;  4I28 A;  3K7D A;  3RH6 A;  4PGY A;  1I49 A;  4GXK A;  4NXX A;  3G9G A;  5J2H A;  3RJE A;  3ZED A;  4JWN A;  2M2V A;  3UXN A;  3PHZ A;  4KIK B;  4O6A A;  3OUY B;  4X4R A;  3DDF A;  5JTG A;  1ZQU A;  7ICQ A;  1R33 A;  4E81 A;  3O3O B;  4EZN A;  1VFG A;  1JQR A;  3DYT A;  5III A;  4PHD A;  8ICJ A;  1HWW A;  7ICN A;  2YLL A;  9ICX A;  1LQ7 A;  4NQI A;  2Z0V A;  4JNF A;  3H3A A;  2BCR A;  3C66 A;  4JL9 A;  9ICA A;  5J29 A;  4GXJ A;  4AT9 B;  4KLU A;  5D62 A;  2D1L A;  1U00 A;  4X0B A;  1R89 A;  4M0A A;  4HR1 A;  5TKY A;  2F18 A;  2PFN A;  1QX1 A;  3RJG A;  4KLT A;  4K97 A;  4XQ8 A;  1R34 A;  1ZQX A;  4EZP A;  1Q78 A;  3UPS A;  5J0S A;  4O9M A;  2YLA A;  9ICC A;  2YIB A;  3EJR A;  2BCQ A;  4RWQ A;  9ICP A;  4EEB A;  1UET A;  4UB4 A;  3NKU A;  5HRI A;  4TUR A;  4X4N A;  4QZC A;  8ICX A;  4KLM A;  5DB9 A;  1OA1 A;  4AZ6 A;  2F1A A;  3ABH A;  3OHX M;  2B56 A;  2ND0 A;  1GN9 A;  4WC0 A;  4TUP A;  1URU A;  2EWF A;  9ICQ A;  5HRK A;  4R5J A;  3UXO A;  2LXY A;  1XSP A;  1ZQW A;  1ZQN A;  2PMR A;  4I2C A;  8ICC A;  3AUO A;  4NM2 A;  4HY9 A;  4UB2 A;  4MF2 A;  5DB7 A;  4P4P A;  2GA9 D;  3MGH A;  3HJ4 A;  4I0U A;  2YL6 A;  2Z0N A;  3BVV A;  5J0R A;  4DCN C;  4NM1 A;  2F1B A;  3JPS A;  2X5C A;  3HW8 A;  2EWR A;  3OK8 A;  4R5K A;  3I04 A;  4X4Q A;  4X0A A;  4LEZ A;  8ICH A;  3BVU A;  2PFP A;  8ICA A;  4EZX A;  1GPJ A;  4P4O A;  1DKY A;  5J0O A;  3UXP A;  4F5R A;  1SUF A;  4RPZ A;  4I2F A;  4EGW A;  4NPH A;  9ICJ A;  5IIM A;  4I2H A;  3LQC B;  3CAZ A;  4WCW A;  5HR9 A;  4UAW A;  8ICP A;  4O5K A;  4WQL A;  4FM3 A;  2M2T A;  2HN2 A;  8ICG A;  4WC7 A;  4K9A A;  2IHO A;  3DDG A;  5D63 A;  4E7X A;  1ZQB A;  8ICO A;  2QFF A;  1DKZ A;  4YMN A;  5DKW A;  9ICS A;  2MI7 A;  1O7D C;  4UBB A;  4YD1 A;  4E8F A;  4TUQ A;  4AZ5 A;  4WBZ A;  3HAI A;  5IIN A;  2FMS A;  3HX0 A;  1JMS A;  3B53 X;  2ZHB A;  7ICG A;  5IIJ A;  1TQT A;  7ICV A;  4WQK A;  4QZ9 A;  2ISO A;  2ELB A;  3I01 A;  2O5A A;  4RQ5 A;  2N3K A;  3KAW A;  4R63 A;  1BPB A;  9ICB A;  2OO2 A;  3HWT A;  1TFW A;  2BPC A;  5HRF A;  1JQK A;  2VAN A;  2WIN M;  4KLO A;  2D4C A;  3BUP A;  3RJJ A;  1MQ3 A;  1O7D B;  1ZQL A;  3QWE A;  4X4T A;  5DDY A;  4I2A A;  1ZQA A;  2PFQ A;  1FA0 A;  2BCS A;  4EZO A;  4NXV A;  4RT2 A;  3V7J A;  2FYV A;  1Q79 A;  3OUY A;  4FHY A;  3C7N A;  4OAF A;  4Z6D A;  4RQ0 A;  4QZG A;  4IW0 A;  3MCR A;  4I2B A;  9ICW A;  4IQV A;  1TQS A;  3VEA A;  7ICP A;  1OAO A;  2Z8Y A;  5J0X A;  4QZD A;  4EP7 A;  2F7Q A;  7ICI A;  3QA8 A;  2ZH2 A;  4UB1 A;  9ICU A;  7ICL A;  5CFS A;  7ICM A;  8ICY A;  4YMO A;  4H8S A;  2M2U A;  4QZ8 A;  4UD4 A;  1OA0 A;  5D49 A;  4FO6 A;  2QXL A;  4RQ2 A;  1UPX A;  3WFO A;  4EV6 A;  3NVO A;  4JN4 A;  3RV1 A;  1X03 A;  1OU5 A;  4NY8 A;  2DR8 A;  3RJF A;  4F5Q A;  4R65 A;  3UPQ A;  4PPX A;  1ZQM A;  5HRL A;  2QKW A;  2IUB A;  4R64 A;  1ZQE A;  4K96 A;  4FHV A;  5HRD A;  4EZT A;  4WPE A;  5CFU A;  4IWP A;  1R8B A;  3MGI A;  3ISC A;  4M5D A;  1X04 A;  1JN3 A;  1ZQD A;  3RV0 A;  1YLQ A;  5J2J A;  4UB3 A;  2PY6 A;  4F01 A;  2KHO A;  2X3W A;  1TQW A;  2ISP A;  2YI9 A;  4IQW A;  4EED A;  1BPE A;  5D46 A;  4MF8 A;  2O1P A;  4WC4 A;  4KLJ A;  1JAJ A;  2JNS A;  3CKD A;  2FMP A;  4AZI A;  4AT8 B;  4DYL A;  2EX3 B;  9ICH A;  3T48 A;  3ER8 C;  3B52 X;  2RFF A;  5IIL A;  3AU6 A;  1DKX A;  4PGQ A;  4UAY A;  4EZV A;  1TVA A;  7ICF A;  5CWR A;  3T4A G;  4QZB A;  1ZYL A;  3QE6 A;  3JPN A;  3ISD A;  5HHI A;  3GI7 A;  4EZR A;  4XA5 A;  8ICQ A;  4LEY A;  4NKT A;  2YL9 A;  4G6Q A;  1ZQJ A;  3QNI A;  4FZO A;  1SU7 A;  4LEW A;  1ZQI A;  4MKP A;  3HAJ A;  4UB5 A;  3CZN A;  2DR9 A;  3GDX A;  4DO9 A;  1GNL A;  4YN4 A;  4K9B A;  7ICS A;  4R5G A;  4O67 A;  4WC1 A;  3C5F A;  3DX1 A;  3RJI A;  4ATB B;  2YIA A;  4HYB A;  1HXK A;  4IM2 A;  2O0I 1;  1VJ7 A;  2DR5 A;  2RAJ A;  4P4M A;  4LZG A;  3DX4 A;  4LT6 A;  4LZD A;  3D2F A;  4AZ7 A;  3ISB A;  3JPT A;  5J0Y A;  1XSL A;  5CJ7 A;  5FIG A;  4EZZ A;  8ICB A;  1TFY A;  3A98 A;  5HRE A;  4TUS A;  3LVT A;  9ICT A;  4WC3 A;  2YIV X;  3MDC A;  1KDH A;  1MQ2 A;  9ICN A;  3AQN A;  4E80 A;  5IIO A;  4AZC B;  9ICL A;  2RAI A;  4NXW A;  4I1Q A;  3D50 A;  1ZQV A;  5E84 A;  2Q13 A;  4IM3 A;  4EZW A;  2GWS A;  1BPZ A;  4MFA A;  4PHP A;  2PXI A;  2C08 A;  4IWQ A;  2RT6 A;  3EJP A;  5DEC A;  4M47 A;  4K99 A;  4RPY A;  1E2U A;  9ICF A;  4Z6C A;  5J2B A;  4Z6F A;  3EJU A;  4XRH A;  2ALW A;  3ACO A;  1SU6 A;  5J2D A;  1ZQT A;  2BPG A;  8ICK A;  3V7K A;  3CVR A;  4RWN A;  4QZE A;  2BBJ A;  8ICS A;  1NOM A;  3D2E A;  7ICO A;  5CB1 A;  2BPF A;  9ICO A;  4RPX A;  9ICG A;  3HIY A;  5HHH A;  4R66 A;  8ICE A;  3BVX A;  2OW6 A;  4EZU A;  4K98 A;  1HUZ A;  3JPO A;  3AQM A;  4GXI A;  3JPR A;  3RJK A;  4WC2 A;  2JNK A;  4QZI A;  3WFR E;  4XJE A;  3M3W A;  2LM0 A;  4NXZ A;  5CFT A;  2ZH8 A;  4RQ4 A;  4QZA A;  1ZJM A;  3WFQ E;  4FZP A;  4X4P A;  1UEV A;  4RT3 A;  3DX3 A;  4PGX A;  3OVA A;  3L9D A;  4F00 A;  9ICI A;  3BVT A;  8ICW A;  4QZH A;  1Y2O A;  4I2I A;  4O68 A;  4UD5 A;  4JWM A;  2YI8 A;  2ZXQ A;  9ICV A;  3KDR A;  1R5E A;  1TQV A;  4WC6 A;  5B3Q A;  3TFR A;  2DVI A;  4IG8 A;  8ICT A;  2B4V A;  1SU8 A;  2BCU A;  4M9J A;  4RWP A;  4M9N A;  8ICL A;  2YL5 A;  3SYV A;  3C2K A;  3JYY A;  3L3O M;  4M9G A;  4KIK A;  4JWD A;  1E1D A;  5CHE A;  5CR0 A;  3DX0 A;  5DBC A;  1ZQO A;  5DB8 A;  3RPM A;  3MBY A;  2NRK A;  4FHW A;  4KLI A;  1ZQF A;  7ICU A;  4E3C A;  2B51 A;  4N7R A;  1ZWW A;  3B51 X;  4OAI Z;  4AZG A;  4DOA A;  3BLB A;  2OBL A;  2RAK A;  1R8C A;  1ZQH A;  4NLK A;  8ICR A;  4KLQ A;  4UDX X;  3RH5 A;  1NO5 A;  2HHP A;  4WOY A;  4PH5 A;  2Q12 A;  3O3N B;  5J0W A;  3OVS A;  4AT9 A;  1ZQG A;  1R8A A;  4KLF A;  4MFF A;  2X3X A;  4DOC A;  4EBJ A;  4ATM A;  4YCX A;  2DRA A;  2V0O A;  1WOT A;  3TFS A;  4K4I A;  3K75 D;  4RQ3 A;  1KEJ A;  4FZS A;  4D8J A;  3VKH A;  3KAV A;  3H38 A;  5KBP A;  4FH5 A;  5DED A;  3ER9 B;  4O5C A;  5D61 A;  3WFS C;  3HJ1 A;  4NXT A;  3OWG A;  3Q0K A;  1KNY A;  4F5P A;  8ICV A;  2NCZ A;  2YKT A;  4WC5 A;  4AT7 B;  5J2K A;  4IM0 A;  3NYB A;  2GF4 A;  3EJQ A;  4PO2 A;  5DBB A;  3V72 A;  2F7P A;  4H6I A;  1BPY A;  2FCL A;  4XUS A;  4DOB A;  3JPP A;  3AQK A;  2P66 A;  5C5B B;  8ICZ A;  3UQ0 A;  3V7L A;  3DX2 A;  3H39 A;  1MJG A;  4F5N A;  4JLZ A;  2EFL A;  3I2W A;  4AZC A;  4HX0 A;  4XQ7 A;  4I27 A;  4BNE A;  1PS3 A;  3RH4 A;  2PFO A;  3C18 A;  5CA7 A;  4UAZ A;  5J0U A;  3MDA A;  5J2C A;  7ICE A;  3AQL A;  5D4B A;  2OW7 A;  4X4V A;  7ICJ A;  4NKU A;  4X4S A;  5B3P A;  4FO1 A;  1ZQS A;  1ZQP A;  4MFC A;  9ICR A;  2BBH A;  3LK9 A;  2WYI A;  1W9M A;  4NLZ A;  3B0Y A;  4AVM A;  4KLG A;  4JLC A;  2ND1 A;  4LVS A;  4KLS A;  2OZN B;  1ZQY A;  3I39 X;  4FH3 A;  3RJH A;  9ICM A;  1MIY A;  4KM5 A;  3C5G A;  5J2F A;  3PMN A;  4NXU A;  2ZH4 A;  1ZQK A;  8ICU A;  2PBE A;  3WFP A;  3D4Z A;  3NWI A;  3VEB A;  1ZQC A;  2ZH7 A;  3BVW A;  3L3P A;  2I9G A;  4WH5 A;  1F5A A;  4I2J A;  4FHX A;  3EF2 A;  4K8V A;  4X4O A;  7ICK A;  2M2W A;  3T47 A;  4I2G A;  4O5E A;  4AZB A;  2DR7 A;  2YL8 A;  9ICE A;  2WYH A;  4KLD A;  5FLE X;  2ID1 A;  5BPC A;  2ZHA A;  1ZQZ A;  4R5I A;  4RQ6 A;  2DRB A;  3CV5 A;  1V4A A;  4JWE A;  2W9M A;  5J0P A;  2OBM A;  5J2A A;  1ZQQ A;  1PX5 A;  2GAF D;  5J0Q A;  2IHM A;  7ICT A;  8ICM A;  4LEV A;  5HC9 A;  4M04 A;  2HN1 A;  3O3M B;  3AU2 A;  1RPL A;  3EJT A;  4HR1 B;  8ICF A;  1I4L A;  2ZH9 A;  4OAG A; 
#chains in the Genus database with same CATH homology
 4JWD A;  1E1D A;  2YIB A;  3DPP A;  3RV0 A;  2PY6 A;  4F01 A;  4E3C A;  2B51 A;  3NKU A;  2KHO A;  4N7R A;  3B51 X;  2YI9 A;  4OAI Z;  2OBL A;  3F7W A;  1OA1 A;  2JNS A;  4UDX X;  3OHX M;  2B56 A;  2ND0 A;  1GN9 A;  2EWF A;  4WOY A;  3O3N B;  2EX3 B;  4R5J A;  3DPO A;  3T48 A;  3ER8 C;  3LMF A;  3DPQ A;  3B52 X;  3ERC C;  4KB6 A;  1DKX A;  4HY9 A;  4EZV A;  3T4A G;  1ZYL A;  3T46 A;  3VKH A;  4D8J A;  3KAV A;  2GA9 D;  3GI7 A;  4EZR A;  3ER9 B;  5D61 A;  4LEY A;  4NXT A;  4G6Q A;  4B9Q A;  3OWG A;  4LEW A;  1SU7 A;  4MKP A;  2X5C A;  2EWR A;  2NCZ A;  4R5K A;  3I04 A;  4IM0 A;  4JLX A;  4LEZ A;  1GNL A;  4K9B A;  4EZX A;  4R5G A;  1GPJ A;  4O67 A;  1DKY A;  4IWO A;  1SUF A;  4JWI A;  4PO2 A;  4NPH A;  2YIA A;  4H6I A;  4HYB A;  4IM2 A;  4UDY X;  2FCL A;  4OAH A;  4EZS A;  3D2F A;  4WQL A;  4FM3 A;  1MJG A;  4K9A A;  5FIG A;  4EZZ A;  4JLZ A;  1GNT A;  3A98 A;  2IHO A;  5D63 A;  5CHE A;  2QFF A;  1DKZ A;  4HX0 A;  2YIV X;  4R5L A;  4EZQ A;  1E9V A;  4O69 A;  3FD9 A;  4M0M A;  4NXW A;  4JWC A;  5E84 A;  4IM3 A;  4EZW A;  5B3P A;  3B53 X;  4FO1 A;  4WQK A;  4IWQ A;  2RT6 A;  3I01 A;  2N3K A;  3KAW A;  4H6H A;  1W9M A;  4K99 A;  3QNJ A;  1E2U A;  4EZY A;  4JLC A;  2ND1 A;  1JQK A;  1SU6 A;  3I39 X;  3UIT A;  2WIN M;  3T49 A;  4JNE A;  4KM5 A;  3D2E A;  4NXU A;  3K7D A;  4EZO A;  4EZU A;  3VEB A;  4NXV A;  4NXX A;  4K98 A;  3ZED A;  3C7N A;  4OAF A;  3PHZ A;  4KIK B;  4IW0 A;  3MCR A;  4O6A A;  4WH5 A;  4XJE A;  3VEA A;  4E81 A;  3O3O B;  4EZN A;  3EF2 A;  2LM0 A;  1OAO A;  4K8V A;  5CFT A;  2Z8Y A;  3T47 A;  3QA8 A;  5CFS A;  4F00 A;  4JNF A;  5FLE X;  1OA0 A;  2QXL A;  4JL9 A;  1UPX A;  4R5I A;  4O68 A;  2YI8 A;  4JN4 A;  3RV1 A;  5D62 A;  4JWE A;  3KDR A;  2OBM A;  2GAF D;  1U00 A;  5B3Q A;  2B4V A;  1SU8 A;  4LEV A;  4HR1 A;  5TKY A;  4K96 A;  3O3M B;  4EZT A;  5CFU A;  4IWP A;  4HR1 B;  4K97 A;  3L3O M;  4EZP A;  4OAG A;  4KIK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...