3ER9B

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
468
structure length
445
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
molecule tags Transcription, transferase/rna
source organism Vaccinia virus wr
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
total genus 158
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
B PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
B PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er9B01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er9B03
3OWGA 3ERCC 2GA9D 2GAFD 3ER8C 3ER9B
chains in the Genus database with same CATH superfamily
2ZH4A 2FYVA 3BUPA 4IWQA 3CZNA 2EWRA 3DX1A 5D46A 4KIKB 2EWFA 3EF2A 1ZQJA 1ZQVA 4GXJA 7ICFA 1UEUA 1OU5A 4UD4A 4RPXA 3EJSA 3O3OB 2EFKA 3JPPA 4ATBA 3T48A 9ICEA 4WPEA 3VEAA 2OW7A 4YMNA 4MKPA 5BOMA 1OA1A 3JPNA 4N7RA 3TFSA 4AZCB 4JWNA 2Z0OA 1ZQMA 4B9QA 4EBKA 8ICYA 9ICJA 2FMSA 4WC1A 2OZNB 5HRGA 4RQ4A 4EZXA 2GWSA 4RPZA 4UAZA 4JNEA 9ICAA 2X5CA 3I2WA 3C5FA 3L9DA 3H37A 5HRBA 2DR7A 3MCRA 2P66A 2JNSA 4FO6A 8ICRA 3MGHA 4DOAA 5DKWA 3V7LA 8ICFA 5DBCA 1KDHA 4EZVA 4XRHA 4M9LA 1WOTA 3OGUA 5IIMA 2F18A 5J0OA 3V7JA 3D2EA 2YLAA 3HIYA 4LEWA 3JPTA 4S3NA 4LEYA 8ICTA 7ICUA 4I2FA 1JMSA 5J0PA 1UEVA 4HX0A 3D51A 5J0WA 2ZH6A 1ZQGA 5HRKA 1ZQBA 2B51A 4R63A 4UAYA 4E81A 4IQTA 1ZQYA 4QZGA 4RQ0A 4NLNA 2F7OA 4X4QA 1ZQTA 4MF8A 1ZJMA 2Z0NA 2BE3A 9ICKA 2YI9A 4XQ7A 4EP7A 4DO9A 8ICMA 4RQ8A 3DPQA 4I2HA 4Z6DA 4KLMA 2M2UA 2KHOA 4IM0A 4R64A 2IHOA 1ZQEA 3HWTA 4WBZA 1E2UA 1W9MA 4G6QA 4JWEA 1KEJA 2YLLA 3DYTA 2C08A 3CKDA 1BPYA 3MDAA 4E3CA 3GDXA 2ISOA 4O68A 4K97A 2ISPA 2HHPA 1ZQCA 1TV9A 5HRFA 5DBBA 3H3AA 3T47A 4NKTA 3QWEA 2B56A 4K4GA 2PFQA 2Q13A 4M47A 3DDGA 2EFLA 3GI7A 4XQ8A 3PMNA 4TUQA 4K9AA 2PFNA 2QXLA 2YL6A 4MFFA 4QZDA 4I2JA 3ERCC 2BBJA 3ISCA 3MDCA 3QA8A 5C5BA 4AT8A 1HWWA 2RFFA 4NLZA 4AZIA 8ICAA 4AT7A 3B53X 4QZBA 4X4TA 2WYIA 3FD9A 4M0MA 3H39A 5HRHA 2BPGA 3HAHA 5J0QA 2DVIA 9ICCA 5DDMA 4RWOA 1Q78A 4P4PA 3AQMA 2PXIA 4PHDA 4IM2A 3Q84A 1ZQPA 1R89A 4LEVA 3CK6A 4LZGA 1TQTA 3UQ2A 2N3KA 3RH4A 4R5JA 4NXZA 2O1PA 4TURA 1DKYA 3OUYA 4X4RA 4X4VA 7ICJA 4X0BA 8ICVA 7ICNA 4K9BA 4F5NA 5HRLA 4YD1A 2BCRA 3QNIA 4I2BA 2DR9A 5DEDA 4X4PA 3NWIA 5DDYA 5CFSA 2WYHA 4AZCA 4PGXA 7ICGA 3BUBA 4NSWA 1TVAA 3AU6A 4AZ7A 3PHZA 4JL9A 4EZWA 4K8VA 9ICWA 1XSPA 4RWQA 3AQLA 5FIGA 4Z6FA 5IIKA 5HREA 2BPFA 4JNFA 4WQKA 3JPOA 4RQ7A 5J29A 3AQNA 4FHWA 4PH5A 3NYBA 4KLIA 2QKWA 3BLBA 5J2IA 2YL5A 5FLEX 1MQ3A 4EV6A 1E1DA 3CVRA 1SUFA 4R5KA 4KB6A 7ICTA 5DB6A 4UB5A 2Z0VA 5CHEA 4I2GA 4YMOA 8ICPA 4WC4A 4IQUA 4QZCA 7ICOA 3LLLA 2EX3B 9ICPA 2I9GA 3JCFA 5J2FA 4DCNC 4YN4A 5HC9A 2YL8A 8ICIA 5IIOA 4I1QA 1MIVA 2OBMA 4XJEA 4P4OA 2PFOA 2RAIA 2X3WA 3UXPA 1RZTA 4F5PA 3RJIA 4R5GA 3BUDA 3DX4A 3RJFA 3C18A 2F7PA 1RPLA 4EZQA 3HAIA 3Q0KA 4UDYX 3I01A 3K7DA 4FHVA 3WFPA 2X3XA 4QZ9A 4M9NA 4WPCA 8ICOA 1BPXA 4IWOA 5J2EA 4FO1A 4NXVA 2ZH2A 2ZH3A 4F5QA 4LEZA 4P2HA 1ZWWA 3BUIA 1BPEA 4OAGA 9ICXA 1QX1A 3OK8A 4NM1A 7ICEA 3WFQE 3EJPA 2BBHA 4E8FA 2WINM 3KDRA 3I39X 4UDXX 5J0SA 4JLXA 4X0AA 3RJEA 1TFYA 9ICGA 8ICJA 3SOGA 5BPCA 4PPXA 7ICQA 4JN4A 1ZQKA 2MI7A 4HR1A 5J2CA 5CA7A 4TUSA 3D2FA 3RV1A 3AUOA 2PFPA 5IIIA 2X3VA 3HX0A 3PMLA 4H8SA 7ICIA 4K4HA 5B3PA 1R34A 4EEDA 4UB3A 2ZH9A 7ICKA 5DB7A 3BVXA 8ICUA 4UB1A 4AT7B 4GXKA 1JN3A 4AT9A 4QZFA 4QZIA 4M9HA 3UXOA 1URUA 4X4UA 2M2TA 1ZQXA 1ZQLA 4O5KA 8ICWA 4RT2A 5CB1A 2NRKA 2DR5A 2ND1A 1YLQA 4K4IA 3C7NA 4YD2A 2JNKA 4JWCA 3UPSA 4KLSA 3M3WA 4AVMA 3UXNA 3ER8C 4MFAA 4JLZA 3WFOA 2ZH8A 4AKVA 4X4NA 1VFGA 3OV7A 1ZQWA 1HXKA 2GA9D 3RH6A 5J2GA 5HR9A 5J2JA 8ICHA 9ICQA 4I2IA 4R5IA 4K96A 5D4BA 4M0AA 7ICRA 2RT6A 1NOMA 3RJGA 1O7DC 4P4MA 4UBBA 3DX0A 1X04A 5D49A 2Q12A 9ICOA 3CAZA 4OAIZ 4XA5A 3V72A 5JTGA 4Z6CA 1U00A 4KLGA 2ZHAA 3F7WA 4O69A 3BVTA 1XSLA 3LK9A 3HAJA 4FH5A 4NKUA 2D4CA 1JQKA 3C2MA 1ZYLA 3RPMA 4FZOA 4WC6A 5IINA 2HN2A 3CV5A 3JPRA 7ICHA 4NY8A 1E9VA 2Z8YA 4KLUA 5DB8A 5HHHA 1JQRA 4KLOA 4WBYA 3BVUA 5CWRA 1TQSA 4FHYA 2BCQA 2YL9A 5D61A 1JAJA 4I2CA 3RJKA 4F01A 3PNCA 3UQ0A 3ISBA 9ICVA 4X4OA 3EJTA 5CFTA 3AU2A 1PX5A 3OVBA 3C66A 4QZAA 3I04A 4I28A 4AZBA 3OVSA 4M04A 2ZXQA 4EZSA 4E7XA 9ICTA 1SU7A 5DB9A 5HHIA 9ICHA 3BUQA 4M2YA 1BPBA 5TKYA 4QZEA 2FMQA 9ICLA 3DX2A 4IQVA 4RT3A 8ICXA 1GN9A 1MQ2A 5J0XA 1ZQQA 4M9GA 4O9MA 4PHPA 4JWMA 2PBEA 3QE6A 2D1LA 4LT6A 4KLJA 3KAWA 4YMMA 5J0YA 5CP2A 5J2HA 4KLLA 2M2WA 1QWNA 3OHXM 4WQLA 3ACOA 9ICUA 2BCSA 4R65A 2YI8A 2GF4A 2FMPA 4I27A 3UITA 4EZNA 4LZDA 3DPOA 3OUYB 2GAFD 1ZQDA 8ICLA 4ATMA 4RQ1A 3C2KA 7ICPA 4FZSA 4O5EA 4KLQA 3ZEDA 2OW6A 4E80A 1YWMA 5J2KA 2ID1A 4I0UA 8ICSA 3RJJA 3L3OM 4DYLA 5BOLA 4KLHA 3CZSA 1VJ7A 2ZH5A 4MFCA 4I29A 5DBAA 1ZQAA 2RAJA 4IW0A 1ZQZA 1MIWA 1ZQSA 1QWUA 4D8JA 4X5VA 4FM3A 1ZQHA 4RWNA 8ICNA 5CR0A 4RQ2A 3RJHA 3G9GA 4AT9B 1TQVA 2RAKA 3OVAA 1ZJNA 4UBCA 1XSNA 4RQ5A 5J0UA 8ICKA 3B0YA 4KLDA 4KLEA 4K98A 1BPZA 3B52X 1SU8A 2OBLA 4JLCA 4F5OA 2IHMA 1SU6A 1DKXA 2ELBA 2YIBA 4EBJA 3B0XA 3LQCB 4LVSA 4JWDA 5EOZA 3O3MB 3KAVA 4AZGA 2O5AA 8ICQA 4EZPA 3EJQA 4Z6EA 2YKTA 4EGWA 2F1AA 3B51X 3OWGA 2ZH7A 1ZQFA 4WC5A 1UETA 1MJGA 9ICMA 5B3QA 4WCWA 1NO5A 4RQ3A 4RWPA 3MBYA 1WDZA 3D52A 4FHPA 1GNTA 2PMRA 4R5LA 3RV0A 2F7QA 4WC7A 2OO2A 1BPDA 4M5DA 4UD5A 4QZ8A 9ICRA 4OAHA 5D63A 2YIVX 1GNLA 4K99A 3BVWA 1R8AA 2B4VA 4NXWA 3LVTA 4WC0A 3HW8A 1ZQUA 3JZ0A 3ER9B 5CHGA 8ICGA 2FCLA 3MGIA 3T4AG 3DX3A 3QNJA 4NLKA 4NXXA 4NQIA 1I4TA 4KIKA 5J2AA 4KLTA 4EZOA 4F5RA 1LQ7A 5F2VO 5HRDA 1X03A 5E84A 8ICCA 4KM5A 4JWIA 4ATBB 4I2EA 1PS3A 2QFFA 4HYBA 4HR1B 5TZVA 9ICIA 3BVVA 1ZQRA 4WC2A 8ICEA 4O67A 4AZHA 4BNEA 4RQ6A 7ICLA 2W9MA 9ICFA 2M2VA 2LM0A 4EEBA 4PGYA 5CFUA 5IIJA 4EZRA 4EZTA 2DR8A 4IM3A 4DOBA 4O5CA 3L3PA 5C5BB 1ZQIA 4AZ6A 3JPSA 2F7RA 4WOYA 5J0TA 4PHEA 9ICSA 3O3NB 5CJ7A 2DRBA 4UAWA 4I2DA 5HRIA 2ZH1A 4KLFA 4PGQA 3DPPA 4H6IA 4PO2A 1I4LA 5KBPA 4IG8A 4FHXA 3TFRA 7ICMA 4QZHA 1Q79A 1HUOA 2HN1A 3UPQA 1Y2OA 3SYVA 4NPHA 1GPJA 3EJRA 3T46A 3V7KA 3NKUA 3RH5A 1F5AA 1I49A 2F1BA 4PHAA 5J0RA 5D62A 4H6HA 4GXIA 4FH3A 2ND0A 4OAFA 3NVOA 1TFWA 5DECA 5J2DA 4M9JA 4RPYA 4HY9A 4X4SA 2BCVA 9ICNA 4NXTA 3DDFA 4EZZA 3VKHA 3VEBA 1OA0A 1I4DA 4YCXA 3ISDA 4IWPA 1UPXA 1OAOA 3AQKA 4EZYA 2NCZA 4F00A 1ZQOA 4DOCA 4WH5A 3EJUA 3PLTA 2IUBA 2BCUA 4UB2A 4AZ5A 2BPCA 2YIAA 3A98A 1HUZA 9ICBA 3H38A 8ICBA 3HJ1A 2Q66A 2ZHBA 5IILA 7ICSA 3JPQA 1R8BA 4TUPA 3WFSC 1O7DB 1ZQNA 1R8CA 1R5EA 4UB4A 1FA0A 3D50A 3LMFA 8ICZA 5J2BA 4FZPA 2O0I1 1TQWA 3HJ4A 3C2LA 4R66A 4IQWA 2ALWA 2LXYA 3C5GA 2FICA 7ICVA 3D4YA 1DKZA 1HTYA 3JYYA 4I2AA 3ABHA 3K75D 1R33A 4EZUA 4O6AA 1KNYA 4AT8B 2PY6A 1V4AA 4MF2A 2VANA 3D4ZA 4WC3A 3WFRE 2V0OA 4NM2A 2DRAA 1MIYA 4XUSA 4NXUA 1TQUA 3T49A
chains in the Genus database with same CATH topology
4OAHA 4IWQA 2RT6A 2EWRA 5D63A 2YIVX 1GNLA 4K9BA 4K99A 4KIKB 2B4VA 4NXWA 2EWFA 3EF2A 3ER9B 2FCLA 3T4AG 3QNJA 3O3OB 5CFSA 4OAIZ 4NXXA 3T48A 1U00A 4KIKA 3PHZA 4JL9A 3F7WA 4EZWA 3VEAA 4K8VA 4O69A 4EZOA 4MKPA 1OA1A 5FIGA 1JQKA 1ZYLA 4N7RA 5E84A 4KM5A 4JNFA 4JWIA 4B9QA 4WQKA 1E9VA 2Z8YA 2QFFA 4HYBA 4EZXA 4HR1B 4JNEA 5D61A 2X5CA 5FLEX 4F01A 3MCRA 4O67A 1E1DA 1SUFA 4R5KA 4KB6A 2JNSA 2LM0A 5CFTA 5CFUA 5CHEA 4EZRA 4EZTA 4IM3A 3I04A 4EZVA 4EZSA 1SU7A 2EX3B 4WOYA 3D2EA 4LEWA 5TKYA 4LEYA 3O3NB 1GN9A 4HX0A 4XJEA 2OBMA 3DPPA 4H6IA 4PO2A 2B51A 4E81A 4R5GA 3KAWA 4NPHA 1GPJA 3T46A 3NKUA 4EZQA 3OHXM 4WQLA 2YI9A 4UDYX 3I01A 3K7DA 2YI8A 5D62A 4H6HA 3UITA 4EZNA 2ND0A 3DPOA 3DPQA 2GAFD 4OAFA 2KHOA 4IM0A 4HY9A 2IHOA 4IWOA 3ZEDA 4FO1A 4NXVA 4NXTA 4LEZA 4EZZA 3VKHA 1E2UA 1W9MA 4OAGA 4G6QA 1OA0A 3VEBA 4JWEA 1UPXA 1OAOA 4IWPA 3L3OM 2NCZA 2WINM 3KDRA 3I39X 4UDXX 4E3CA 4EZYA 4F00A 4JLXA 4WH5A 4O68A 4K97A 4R5IA 2YIAA 3A98A 4JN4A 4IW0A 4HR1A 4D8JA 3D2FA 3RV1A 4FM3A 3T47A 2B56A 5B3PA 3GI7A 4K98A 3B52X 3LMFA 1SU8A 2OBLA 4JLCA 4K9AA 2QXLA 1SU6A 1DKXA 2YIBA 3ERCC 4JWDA 3QA8A 3O3MB 3KAVA 4EZPA 2ND1A 1DKZA 3B51X 3B53X 3C7NA 3OWGA 3FD9A 4M0MA 4JWCA 4EZUA 1MJGA 4O6AA 5B3QA 3ER8C 4IM2A 4JLZA 2PY6A 4LEVA 1GNTA 4R5LA 3RV0A 2N3KA 2GA9D 4R5JA 4NXUA 1DKYA 4K96A 3T49A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ERC C;  2GA9 D;  2GAF D;  3ER8 C;  3ER9 B; 
#chains in the Genus database with same CATH topology
 2ZH4 A;  2FYV A;  3BUP A;  4IWQ A;  3CZN A;  2EWR A;  3DX1 A;  5D46 A;  4KIK B;  2EWF A;  3EF2 A;  1ZQJ A;  1ZQV A;  4GXJ A;  7ICF A;  1UEU A;  1OU5 A;  4UD4 A;  4RPX A;  3EJS A;  3O3O B;  2EFK A;  3JPP A;  4ATB A;  3T48 A;  9ICE A;  4WPE A;  3VEA A;  2OW7 A;  4YMN A;  4MKP A;  5BOM A;  1OA1 A;  3JPN A;  4N7R A;  3TFS A;  4AZC B;  4JWN A;  2Z0O A;  1ZQM A;  4B9Q A;  4EBK A;  8ICY A;  9ICJ A;  2FMS A;  4WC1 A;  2OZN B;  5HRG A;  4RQ4 A;  4EZX A;  2GWS A;  4RPZ A;  4UAZ A;  4JNE A;  9ICA A;  2X5C A;  3I2W A;  3C5F A;  3L9D A;  3H37 A;  5HRB A;  2DR7 A;  3MCR A;  2P66 A;  2JNS A;  4FO6 A;  8ICR A;  3MGH A;  4DOA A;  5DKW A;  3V7L A;  8ICF A;  5DBC A;  1KDH A;  4EZV A;  4XRH A;  4M9L A;  1WOT A;  3OGU A;  5IIM A;  2F18 A;  5J0O A;  3V7J A;  3D2E A;  2YLA A;  3HIY A;  4LEW A;  3JPT A;  4S3N A;  4LEY A;  8ICT A;  7ICU A;  4I2F A;  1JMS A;  5J0P A;  1UEV A;  4HX0 A;  3D51 A;  5J0W A;  2ZH6 A;  1ZQG A;  5HRK A;  1ZQB A;  2B51 A;  4R63 A;  4UAY A;  4E81 A;  4IQT A;  1ZQY A;  4QZG A;  4RQ0 A;  4NLN A;  2F7O A;  4X4Q A;  1ZQT A;  4MF8 A;  1ZJM A;  2Z0N A;  2BE3 A;  9ICK A;  2YI9 A;  4XQ7 A;  4EP7 A;  4DO9 A;  8ICM A;  4RQ8 A;  3DPQ A;  4I2H A;  4Z6D A;  4KLM A;  2M2U A;  2KHO A;  4IM0 A;  4R64 A;  2IHO A;  1ZQE A;  3HWT A;  4WBZ A;  1E2U A;  1W9M A;  4G6Q A;  4JWE A;  1KEJ A;  2YLL A;  3DYT A;  2C08 A;  3CKD A;  1BPY A;  3MDA A;  4E3C A;  3GDX A;  2ISO A;  4O68 A;  4K97 A;  2ISP A;  2HHP A;  1ZQC A;  1TV9 A;  5HRF A;  5DBB A;  3H3A A;  3T47 A;  4NKT A;  3QWE A;  2B56 A;  4K4G A;  2PFQ A;  2Q13 A;  4M47 A;  3DDG A;  2EFL A;  3GI7 A;  4XQ8 A;  3PMN A;  4TUQ A;  4K9A A;  2PFN A;  2QXL A;  2YL6 A;  4MFF A;  4QZD A;  4I2J A;  3ERC C;  2BBJ A;  3ISC A;  3MDC A;  3QA8 A;  5C5B A;  4AT8 A;  1HWW A;  2RFF A;  4NLZ A;  4AZI A;  8ICA A;  4AT7 A;  3B53 X;  4QZB A;  4X4T A;  2WYI A;  3FD9 A;  4M0M A;  3H39 A;  5HRH A;  2BPG A;  3HAH A;  5J0Q A;  2DVI A;  9ICC A;  5DDM A;  4RWO A;  1Q78 A;  4P4P A;  3AQM A;  2PXI A;  4PHD A;  4IM2 A;  3Q84 A;  1ZQP A;  1R89 A;  4LEV A;  3CK6 A;  4LZG A;  1TQT A;  3UQ2 A;  2N3K A;  3RH4 A;  4R5J A;  4NXZ A;  2O1P A;  4TUR A;  1DKY A;  3OUY A;  4X4R A;  4X4V A;  7ICJ A;  4X0B A;  8ICV A;  7ICN A;  4K9B A;  4F5N A;  5HRL A;  4YD1 A;  2BCR A;  3QNI A;  4I2B A;  2DR9 A;  5DED A;  4X4P A;  3NWI A;  5DDY A;  5CFS A;  2WYH A;  4AZC A;  4PGX A;  7ICG A;  3BUB A;  4NSW A;  1TVA A;  3AU6 A;  4AZ7 A;  3PHZ A;  4JL9 A;  4EZW A;  4K8V A;  9ICW A;  1XSP A;  4RWQ A;  3AQL A;  5FIG A;  4Z6F A;  5IIK A;  5HRE A;  2BPF A;  4JNF A;  4WQK A;  3JPO A;  4RQ7 A;  5J29 A;  3AQN A;  4FHW A;  4PH5 A;  3NYB A;  4KLI A;  2QKW A;  3BLB A;  5J2I A;  2YL5 A;  5FLE X;  1MQ3 A;  4EV6 A;  1E1D A;  3CVR A;  1SUF A;  4R5K A;  4KB6 A;  7ICT A;  5DB6 A;  4UB5 A;  2Z0V A;  5CHE A;  4I2G A;  4YMO A;  8ICP A;  4WC4 A;  4IQU A;  4QZC A;  7ICO A;  3LLL A;  2EX3 B;  9ICP A;  2I9G A;  3JCF A;  5J2F A;  4DCN C;  4YN4 A;  5HC9 A;  2YL8 A;  8ICI A;  5IIO A;  4I1Q A;  1MIV A;  2OBM A;  4XJE A;  4P4O A;  2PFO A;  2RAI A;  2X3W A;  3UXP A;  1RZT A;  4F5P A;  3RJI A;  4R5G A;  3BUD A;  3DX4 A;  3RJF A;  3C18 A;  2F7P A;  1RPL A;  4EZQ A;  3HAI A;  3Q0K A;  4UDY X;  3I01 A;  3K7D A;  4FHV A;  3WFP A;  2X3X A;  4QZ9 A;  4M9N A;  4WPC A;  8ICO A;  1BPX A;  4IWO A;  5J2E A;  4FO1 A;  4NXV A;  2ZH2 A;  2ZH3 A;  4F5Q A;  4LEZ A;  4P2H A;  1ZWW A;  3BUI A;  1BPE A;  4OAG A;  9ICX A;  1QX1 A;  3OK8 A;  4NM1 A;  7ICE A;  3WFQ E;  3EJP A;  2BBH A;  4E8F A;  2WIN M;  3KDR A;  3I39 X;  4UDX X;  5J0S A;  4JLX A;  4X0A A;  3RJE A;  1TFY A;  9ICG A;  8ICJ A;  3SOG A;  5BPC A;  4PPX A;  7ICQ A;  4JN4 A;  1ZQK A;  2MI7 A;  4HR1 A;  5J2C A;  5CA7 A;  4TUS A;  3D2F A;  3RV1 A;  3AUO A;  2PFP A;  5III A;  2X3V A;  3HX0 A;  3PML A;  4H8S A;  7ICI A;  4K4H A;  5B3P A;  1R34 A;  4EED A;  4UB3 A;  2ZH9 A;  7ICK A;  5DB7 A;  3BVX A;  8ICU A;  4UB1 A;  4AT7 B;  4GXK A;  1JN3 A;  4AT9 A;  4QZF A;  4QZI A;  4M9H A;  3UXO A;  1URU A;  4X4U A;  2M2T A;  1ZQX A;  1ZQL A;  4O5K A;  8ICW A;  4RT2 A;  5CB1 A;  2NRK A;  2DR5 A;  2ND1 A;  1YLQ A;  4K4I A;  3C7N A;  4YD2 A;  2JNK A;  4JWC A;  3UPS A;  4KLS A;  3M3W A;  4AVM A;  3UXN A;  3ER8 C;  4MFA A;  4JLZ A;  3WFO A;  2ZH8 A;  4AKV A;  4X4N A;  1VFG A;  3OV7 A;  1ZQW A;  1HXK A;  2GA9 D;  3RH6 A;  5J2G A;  5HR9 A;  5J2J A;  8ICH A;  9ICQ A;  4I2I A;  4R5I A;  4K96 A;  5D4B A;  4M0A A;  7ICR A;  2RT6 A;  1NOM A;  3RJG A;  1O7D C;  4P4M A;  4UBB A;  3DX0 A;  1X04 A;  5D49 A;  2Q12 A;  9ICO A;  3CAZ A;  4OAI Z;  4XA5 A;  3V72 A;  5JTG A;  4Z6C A;  1U00 A;  4KLG A;  2ZHA A;  3F7W A;  4O69 A;  3BVT A;  1XSL A;  3LK9 A;  3HAJ A;  4FH5 A;  4NKU A;  2D4C A;  1JQK A;  3C2M A;  1ZYL A;  3RPM A;  4FZO A;  4WC6 A;  5IIN A;  2HN2 A;  3CV5 A;  3JPR A;  7ICH A;  4NY8 A;  1E9V A;  2Z8Y A;  4KLU A;  5DB8 A;  5HHH A;  1JQR A;  4KLO A;  4WBY A;  3BVU A;  5CWR A;  1TQS A;  4FHY A;  2BCQ A;  2YL9 A;  5D61 A;  1JAJ A;  4I2C A;  3RJK A;  4F01 A;  3PNC A;  3UQ0 A;  3ISB A;  9ICV A;  4X4O A;  3EJT A;  5CFT A;  3AU2 A;  1PX5 A;  3OVB A;  3C66 A;  4QZA A;  3I04 A;  4I28 A;  4AZB A;  3OVS A;  4M04 A;  2ZXQ A;  4EZS A;  4E7X A;  9ICT A;  1SU7 A;  5DB9 A;  5HHI A;  9ICH A;  3BUQ A;  4M2Y A;  1BPB A;  5TKY A;  4QZE A;  2FMQ A;  9ICL A;  3DX2 A;  4IQV A;  4RT3 A;  8ICX A;  1GN9 A;  1MQ2 A;  5J0X A;  1ZQQ A;  4M9G A;  4O9M A;  4PHP A;  4JWM A;  2PBE A;  3QE6 A;  2D1L A;  4LT6 A;  4KLJ A;  3KAW A;  4YMM A;  5J0Y A;  5CP2 A;  5J2H A;  4KLL A;  2M2W A;  1QWN A;  3OHX M;  4WQL A;  3ACO A;  9ICU A;  2BCS A;  4R65 A;  2YI8 A;  2GF4 A;  2FMP A;  4I27 A;  3UIT A;  4EZN A;  4LZD A;  3DPO A;  3OUY B;  2GAF D;  1ZQD A;  8ICL A;  4ATM A;  4RQ1 A;  3C2K A;  7ICP A;  4FZS A;  4O5E A;  4KLQ A;  3ZED A;  2OW6 A;  4E80 A;  1YWM A;  5J2K A;  2ID1 A;  4I0U A;  8ICS A;  3RJJ A;  3L3O M;  4DYL A;  5BOL A;  4KLH A;  3CZS A;  1VJ7 A;  2ZH5 A;  4MFC A;  4I29 A;  5DBA A;  1ZQA A;  2RAJ A;  4IW0 A;  1ZQZ A;  1MIW A;  1ZQS A;  1QWU A;  4D8J A;  4X5V A;  4FM3 A;  1ZQH A;  4RWN A;  8ICN A;  5CR0 A;  4RQ2 A;  3RJH A;  3G9G A;  4AT9 B;  1TQV A;  2RAK A;  3OVA A;  1ZJN A;  4UBC A;  1XSN A;  4RQ5 A;  5J0U A;  8ICK A;  3B0Y A;  4KLD A;  4KLE A;  4K98 A;  1BPZ A;  3B52 X;  1SU8 A;  2OBL A;  4JLC A;  4F5O A;  2IHM A;  1SU6 A;  1DKX A;  2ELB A;  2YIB A;  4EBJ A;  3B0X A;  3LQC B;  4LVS A;  4JWD A;  5EOZ A;  3O3M B;  3KAV A;  4AZG A;  2O5A A;  8ICQ A;  4EZP A;  3EJQ A;  4Z6E A;  2YKT A;  4EGW A;  2F1A A;  3B51 X;  3OWG A;  2ZH7 A;  1ZQF A;  4WC5 A;  1UET A;  1MJG A;  9ICM A;  5B3Q A;  4WCW A;  1NO5 A;  4RQ3 A;  4RWP A;  3MBY A;  1WDZ A;  3D52 A;  4FHP A;  1GNT A;  2PMR A;  4R5L A;  3RV0 A;  2F7Q A;  4WC7 A;  2OO2 A;  1BPD A;  4M5D A;  4UD5 A;  4QZ8 A;  9ICR A;  4OAH A;  5D63 A;  2YIV X;  1GNL A;  4K99 A;  3BVW A;  1R8A A;  2B4V A;  4NXW A;  3LVT A;  4WC0 A;  3HW8 A;  1ZQU A;  3JZ0 A;  3ER9 B;  5CHG A;  8ICG A;  2FCL A;  3MGI A;  3T4A G;  3DX3 A;  3QNJ A;  4NLK A;  4NXX A;  4NQI A;  1I4T A;  4KIK A;  5J2A A;  4KLT A;  4EZO A;  4F5R A;  1LQ7 A;  5F2V O;  5HRD A;  1X03 A;  5E84 A;  8ICC A;  4KM5 A;  4JWI A;  4ATB B;  4I2E A;  1PS3 A;  2QFF A;  4HYB A;  4HR1 B;  5TZV A;  9ICI A;  3BVV A;  1ZQR A;  4WC2 A;  8ICE A;  4O67 A;  4AZH A;  4BNE A;  4RQ6 A;  7ICL A;  2W9M A;  9ICF A;  2M2V A;  2LM0 A;  4EEB A;  4PGY A;  5CFU A;  5IIJ A;  4EZR A;  4EZT A;  2DR8 A;  4IM3 A;  4DOB A;  4O5C A;  3L3P A;  5C5B B;  1ZQI A;  4AZ6 A;  3JPS A;  2F7R A;  4WOY A;  5J0T A;  4PHE A;  9ICS A;  3O3N B;  5CJ7 A;  2DRB A;  4UAW A;  4I2D A;  5HRI A;  2ZH1 A;  4KLF A;  4PGQ A;  3DPP A;  4H6I A;  4PO2 A;  1I4L A;  5KBP A;  4IG8 A;  4FHX A;  3TFR A;  7ICM A;  4QZH A;  1Q79 A;  1HUO A;  2HN1 A;  3UPQ A;  1Y2O A;  3SYV A;  4NPH A;  1GPJ A;  3EJR A;  3T46 A;  3V7K A;  3NKU A;  3RH5 A;  1F5A A;  1I49 A;  2F1B A;  4PHA A;  5J0R A;  5D62 A;  4H6H A;  4GXI A;  4FH3 A;  2ND0 A;  4OAF A;  3NVO A;  1TFW A;  5DEC A;  5J2D A;  4M9J A;  4RPY A;  4HY9 A;  4X4S A;  2BCV A;  9ICN A;  4NXT A;  3DDF A;  4EZZ A;  3VKH A;  3VEB A;  1OA0 A;  1I4D A;  4YCX A;  3ISD A;  4IWP A;  1UPX A;  1OAO A;  3AQK A;  4EZY A;  2NCZ A;  4F00 A;  1ZQO A;  4DOC A;  4WH5 A;  3EJU A;  3PLT A;  2IUB A;  2BCU A;  4UB2 A;  4AZ5 A;  2BPC A;  2YIA A;  3A98 A;  1HUZ A;  9ICB A;  3H38 A;  8ICB A;  3HJ1 A;  2Q66 A;  2ZHB A;  5IIL A;  7ICS A;  3JPQ A;  1R8B A;  4TUP A;  3WFS C;  1O7D B;  1ZQN A;  1R8C A;  1R5E A;  4UB4 A;  1FA0 A;  3D50 A;  3LMF A;  8ICZ A;  5J2B A;  4FZP A;  2O0I 1;  1TQW A;  3HJ4 A;  3C2L A;  4R66 A;  4IQW A;  2ALW A;  2LXY A;  3C5G A;  2FIC A;  7ICV A;  3D4Y A;  1DKZ A;  1HTY A;  3JYY A;  4I2A A;  3ABH A;  3K75 D;  1R33 A;  4EZU A;  4O6A A;  1KNY A;  4AT8 B;  2PY6 A;  1V4A A;  4MF2 A;  2VAN A;  3D4Z A;  4WC3 A;  3WFR E;  2V0O A;  4NM2 A;  2DRA A;  1MIY A;  4XUS A;  4NXU A;  1TQU A;  3T49 A; 
#chains in the Genus database with same CATH homology
 4OAH A;  4IWQ A;  2RT6 A;  2EWR A;  5D63 A;  2YIV X;  1GNL A;  4K9B A;  4K99 A;  4KIK B;  2B4V A;  4NXW A;  2EWF A;  3EF2 A;  3ER9 B;  2FCL A;  3T4A G;  3QNJ A;  3O3O B;  5CFS A;  4OAI Z;  4NXX A;  3T48 A;  1U00 A;  4KIK A;  3PHZ A;  4JL9 A;  3F7W A;  4EZW A;  3VEA A;  4K8V A;  4O69 A;  4EZO A;  4MKP A;  1OA1 A;  5FIG A;  1JQK A;  1ZYL A;  4N7R A;  5E84 A;  4KM5 A;  4JNF A;  4JWI A;  4B9Q A;  4WQK A;  1E9V A;  2Z8Y A;  2QFF A;  4HYB A;  4EZX A;  4HR1 B;  4JNE A;  5D61 A;  2X5C A;  5FLE X;  4F01 A;  3MCR A;  4O67 A;  1E1D A;  1SUF A;  4R5K A;  4KB6 A;  2JNS A;  2LM0 A;  5CFT A;  5CFU A;  5CHE A;  4EZR A;  4EZT A;  4IM3 A;  3I04 A;  4EZV A;  4EZS A;  1SU7 A;  2EX3 B;  4WOY A;  3D2E A;  4LEW A;  5TKY A;  4LEY A;  3O3N B;  1GN9 A;  4HX0 A;  4XJE A;  2OBM A;  3DPP A;  4H6I A;  4PO2 A;  2B51 A;  4E81 A;  4R5G A;  3KAW A;  4NPH A;  1GPJ A;  3T46 A;  3NKU A;  4EZQ A;  3OHX M;  4WQL A;  2YI9 A;  4UDY X;  3I01 A;  3K7D A;  2YI8 A;  5D62 A;  4H6H A;  3UIT A;  4EZN A;  2ND0 A;  3DPO A;  3DPQ A;  2GAF D;  4OAF A;  2KHO A;  4IM0 A;  4HY9 A;  2IHO A;  4IWO A;  3ZED A;  4FO1 A;  4NXV A;  4NXT A;  4LEZ A;  4EZZ A;  3VKH A;  1E2U A;  1W9M A;  4OAG A;  4G6Q A;  1OA0 A;  3VEB A;  4JWE A;  1UPX A;  1OAO A;  4IWP A;  3L3O M;  2NCZ A;  2WIN M;  3KDR A;  3I39 X;  4UDX X;  4E3C A;  4EZY A;  4F00 A;  4JLX A;  4WH5 A;  4O68 A;  4K97 A;  4R5I A;  2YIA A;  3A98 A;  4JN4 A;  4IW0 A;  4HR1 A;  4D8J A;  3D2F A;  3RV1 A;  4FM3 A;  3T47 A;  2B56 A;  5B3P A;  3GI7 A;  4K98 A;  3B52 X;  3LMF A;  1SU8 A;  2OBL A;  4JLC A;  4K9A A;  2QXL A;  1SU6 A;  1DKX A;  2YIB A;  3ERC C;  4JWD A;  3QA8 A;  3O3M B;  3KAV A;  4EZP A;  2ND1 A;  1DKZ A;  3B51 X;  3B53 X;  3C7N A;  3OWG A;  3FD9 A;  4M0M A;  4JWC A;  4EZU A;  1MJG A;  4O6A A;  5B3Q A;  3ER8 C;  4IM2 A;  4JLZ A;  2PY6 A;  4LEV A;  1GNT A;  4R5L A;  3RV0 A;  2N3K A;  2GA9 D;  4R5J A;  4NXU A;  1DKY A;  4K96 A;  3T49 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...