3ER9B

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 158
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
B PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
B PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er9B01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er9B03
2GA9D 2GAFD 3ERCC 3OWGA 3ER8C 3ER9B
chains in the Genus database with same CATH superfamily
4EZNA 2GA9D 1R8BA 3L3OM 2I9GA 1ZQFA 9ICMA 4O5CA 1MQ3A 1MIYA 3KAVA 9ICCA 4K4HA 4PGXA 5J2AA 3O3MB 4XQ7A 3D50A 4YMNA 2PXIA 3BVXA 4NKTA 1BPDA 4KM5A 4Z6EA 4F00A 4WC3A 4P4MA 3LVTA 4UB5A 2YI8A 5D63A 4M2YA 1TQUA 4FM3A 2YIVX 4K96A 4X4TA 1F5AA 1ZQCA 4EEDA 3EJTA 3V7JA 3K7DA 4H6IA 3MBYA 5J2FA 4QZCA 1ZQZA 4KLTA 2V0OA 5CHGA 4TURA 8ICHA 1MIVA 3G9GA 1X03A 5J0PA 4I2JA 9ICLA 2QKWA 4WC4A 1TVAA 9ICRA 4JN4A 1ZQMA 3UXOA 3JCFA 9ICXA 1ZYLA 2BPGA 3JPSA 4F5OA 3Q84A 1TFWA 5J0WA 4E7XA 4HX0A 4EEBA 4E80A 2HN1A 3CZSA 3QA8A 3UITA 4AT7B 2DVIA 5J0QA 4EZOA 3OVSA 3EF2A 4KLGA 2F1BA 1KDHA 3DX1A 7ICRA 5FIGA 1BPXA 3FD9A 3ERCC 1SU8A 4M0AA 3BVWA 8ICTA 8ICUA 3H37A 2OBMA 4AZ7A 5J2HA 3B0YA 3TFSA 4R5IA 1QWNA 3JPNA 4QZ8A 3OHXM 4D8JA 9ICBA 5HHIA 3NVOA 1ZQLA 4O6AA 4OAIZ 5BPCA 4KLLA 2NCZA 4QZ9A 2FICA 5J0SA 4KB6A 7ICKA 2ND1A 3DX2A 4EZXA 2M2UA 4IQUA 4IM3A 4WBZA 5J29A 4UAYA 4RWOA 1I4DA 4LT6A 2OW7A 1JMSA 3T4AG 1ZQYA 5CB1A 4EBKA 2F7RA 1JN3A 3C7NA 2B56A 3B0XA 4S3NA 8ICIA 5DB7A 5IINA 2ISPA 3K75D 3C2LA 4WOYA 2ND0A 5D4BA 4JLXA 8ICXA 8ICLA 4JLCA 5HRKA 5IIIA 4K4IA 9ICEA 8ICBA 4X4NA 2Q12A 4JWIA 4RWPA 3BUIA 2B4VA 2RAJA 4WBYA 1RZTA 2F7PA 4IQTA 4AT8A 9ICFA 4I0UA 1OA1A 3ISBA 4TUPA 7ICFA 3C5GA 8ICRA 3AQLA 7ICMA 1TFYA 5HRBA 4RWNA 3SYVA 1TV9A 2X3WA 4R5JA 3D2FA 4R64A 3CAZA 4XQ8A 3EJPA 3UPQA 3D51A 2DR5A 4MFCA 5TKYA 5D62A 3ER9B 2X5CA 3OK8A 4IQWA 2Z8YA 1Y2OA 5CJ7A 1YWMA 4HY9A 4AZCA 2ZH2A 4F01A 2BCUA 4WQLA 7ICLA 1XSNA 2BE3A 4I2AA 9ICUA 4WC7A 4YD1A 2M2WA 5CWRA 2F1AA 3B52X 1FA0A 5DBCA 4JNEA 3BVTA 4FHXA 4OAGA 1ZQIA 4XJEA 2M2VA 3MGIA 4LZGA 1R8AA 1ZQKA 9ICAA 1Q78A 4ATBB 3T47A 4QZDA 3SOGA 4RQ0A 4WPCA 2EFLA 3HWTA 3HW8A 4IM2A 3OV7A 3GDXA 3RJHA 4NLZA 5HRDA 2FMSA 7ICPA 2P66A 2ALWA 4LEWA 4M9JA 9ICGA 1NOMA 4DOCA 3MCRA 1KNYA 4PGYA 3DDFA 2F7OA 3D2EA 3LK9A 4ATMA 4O9MA 8ICSA 3PMNA 3RH4A 4NXVA 4P4OA 3DYTA 7ICSA 5CFUA 2YKTA 4RQ5A 4NM2A 4K99A 5JTGA 1ZJNA 9ICVA 1PX5A 5B3QA 3JPQA 1HXKA 3LLLA 4KLUA 4R66A 7ICGA 2EWFA 2WYIA 1TQSA 3QE6A 2F7QA 4AZHA 1I4TA 5J2KA 4B9QA 4X0AA 4FO6A 1ZQJA 2BPCA 4NKUA 2FMQA 7ICUA 4YN4A 1E2UA 4Z6CA 4MF8A 2ZH4A 4F5RA 3CV5A 2BPFA 7ICEA 3UQ0A 2PY6A 5CFSA 4YCXA 4FHVA 4UB2A 4QZGA 4QZAA 3DPOA 4DCNC 4P2HA 2O1PA 3I01A 1QX1A 4RPXA 2IUBA 1GNTA 2YL6A 8ICFA 3D4YA 5DB6A 3HIYA 4MKPA 4X0BA 8ICJA 3BUQA 4JWEA 2GWSA 4X4OA 3B51X 5DDMA 1URUA 3T48A 4F5PA 3AU2A 2ZH6A 8ICAA 3ISCA 1R5EA 4TUQA 3JPRA 3MDAA 9ICQA 1TQWA 2W9MA 3WFPA 3ABHA 4R5KA 5KBPA 2ZHAA 2ZH8A 8ICYA 2BCVA 4KLHA 5HHHA 4RQ8A 1MIWA 4PHDA 3B53X 4EZUA 7ICNA 3T49A 5J2GA 4EZSA 3L3PA 4FZSA 1OA0A 5J2JA 4UB3A 2PFQA 8ICVA 3OWGA 1R8CA 5E84A 4IQVA 2YLLA 4KLSA 1VFGA 2DR8A 3AQNA 5BOLA 4EZPA 4EZVA 4JWMA 1ZQRA 3BLBA 1GPJA 1VJ7A 1O7DB 3AQKA 4QZFA 2RAKA 2YI9A 3EJUA 4HR1B 1XSLA 4EZWA 5CHEA 2HN2A 2RAIA 3JPOA 4GXJA 4KLOA 2OBLA 1MJGA 3HAHA 4AZ5A 4FH3A 9ICJA 3C2MA 3V7LA 1BPYA 1NO5A 4WPEA 3JYYA 5DECA 4ATBA 2IHOA 3PLTA 4M9NA 4UDXX 4RPZA 3WFRE 4RT2A 2FMPA 3ACOA 1ZQNA 8ICMA 1JQRA 4K8VA 3MGHA 8ICGA 4M0MA 4UAWA 2YLAA 2QXLA 1U00A 2DR7A 8ICZA 3CKDA 5D49A 1OU5A 4NXUA 4RQ2A 4H8SA 1BPEA 3H39A 4AT9B 4I2IA 1ZJMA 4K9AA 2B51A 4K4GA 3D4ZA 4DOBA 4KIKA 2YIBA 1DKXA 3Q0KA 3NYBA 1R33A 4NPHA 3WFSC 2EX3B 3VEAA 4MFAA 1JAJA 2BBJA 3H38A 4AT8B 4IG8A 4GXIA 4KLIA 2Q13A 2HHPA 4R5GA 4PO2A 5J2DA 3V7KA 3GI7A 3V72A 4JL9A 2Z0VA 3CZNA 3RJIA 4G6QA 3RJGA 1ZQVA 9ICHA 4X4RA 3DPPA 9ICSA 4R65A 3DDGA 4E81A 1UPXA 3OUYA 4KLQA 1KEJA 4WCWA 1ZQTA 2FYVA 5C5BA 2EFKA 3BUPA 2F18A 2ZH1A 3MDCA 4KLFA 1DKYA 1SUFA 1R89A 5DB8A 3A98A 4M9HA 4F5QA 3L9DA 1E9VA 4FH5A 7ICVA 4WC1A 1SU7A 3RV0A 4IWPA 3I04A 7ICJA 1UEVA 4O68A 4JNFA 4NXTA 2YL8A 3C2KA 1RPLA 7ICIA 4NXWA 1XSPA 4PHEA 3AUOA 5DBAA 3EJQA 3QNIA 4LEYA 2ZHBA 4M9LA 4AVMA 3EJSA 5F2VO 2PFPA 2BBHA 4P4PA 4EZYA 2RFFA 1ZQPA 2WYHA 4UB1A 1ZQQA 4NLNA 1TQTA 4I2DA 4NXXA 2DRAA 8ICCA 4NSWA 1UEUA 4AT7A 4GXKA 4R5LA 4O5KA 3ISDA 4EZRA 4I2EA 4I27A 9ICIA 4AZIA 4F5NA 4KLEA 5J2BA 4IWQA 2ISOA 3KDRA 3QNJA 4RT3A 7ICTA 3BVUA 3VEBA 9ICWA 4AZCB 1ZQBA 4BNEA 5HREA 5DBBA 5DB9A 2YL9A 3DPQA 3DX4A 3AU6A 3OVBA 3LMFA 4X4VA 4YMOA 2GAFD 4KLDA 4X4QA 7ICHA 3OVAA 5HR9A 4FHWA 4QZHA 4I2GA 1GN9A 5CP2A 3DX0A 4DOAA 4RQ4A 3PHZA 5J0TA 1BPZA 1R34A 2ID1A 3UXNA 1TQVA 4OAHA 4WC6A 8ICOA 3ZEDA 4NXZA 5HRGA 2N3KA 1HWWA 2OZNB 1ZWWA 2O5AA 5EOZA 5J2IA 1ZQWA 2DR9A 4I29A 4IW0A 1ZQEA 5J2CA 4WC5A 3O3NB 4FHYA 3RJJA 3PNCA 4WQKA 3KAWA 3OUYB 3HJ4A 4FZOA 3UXPA 5CR0A 4AZ6A 2PBEA 9ICKA 2PFOA 2PMRA 4M9GA 3RV1A 4NY8A 4UB4A 3BUDA 2RT6A 3CK6A 5J0OA 3EJRA 4O5EA 4I2CA 4YMMA 4K97A 4EGWA 3HAIA 4QZBA 2KHOA 3HJ1A 2YL5A 4PHAA 2Z0NA 4R63A 4XA5A 4RPYA 3JPPA 2WINM 3HAJA 4FZPA 4JWNA 5B3PA 2O0I1 2ZH7A 3DX3A 4HR1A 4OAFA 2X3VA 4E8FA 5IIMA 4KLMA 4MFFA 1HUOA 4NM1A 4NLKA 4EZQA 4I2FA 2ZXQA 2DRBA 4RWQA 4DO9A 4RQ7A 4AT9A 4UBCA 3LQCB 4N7RA 9ICNA 7ICQA 3RH5A 4O69A 1ZQGA 1HTYA 4K98A 4I28A 2JNKA 4UD4A 2D1LA 4UD5A 2OO2A 1I4LA 2JNSA 3I2WA 3RPMA 3HX0A 8ICNA 3M3WA 2OW6A 3I39X 4K9BA 5IIJA 1QWUA 4UAZA 1ZQXA 2IHMA 4EV6A 2VANA 1ZQDA 4IWOA 2Z0OA 4X4SA 2M2TA 3OGUA 3VKHA 4UBBA 4LEVA 3ER8C 4H6HA 1ZQAA 1X04A 1YLQA 4QZEA 1WOTA 5DKWA 2BCQA 3PMLA 2LXYA 1LQ7A 4FHPA 2BCSA 4WH5A 5J0XA 3RJKA 4HYBA 3C66A 5HRLA 8ICQA 2LM0A 2EWRA 4UDYX 8ICWA 4EBJA 1UETA 3AQMA 5IIOA 4XUSA 5CA7A 4PGQA 7ICOA 3JZ0A 5J2EA 5IILA 4JLZA 4X4UA 2C08A 4MF2A 2ELBA 4PH5A 4M04A 9ICPA 4QZIA 2ZH9A 3BVVA 1MQ2A 4WC0A 3O3OB 5J0RA 1ZQSA 2D4CA 3UQ2A 1WDZA 4AKVA 1ZQHA 4M47A 8ICPA 4PPXA 5D46A 1O7DC 2BCRA 1GNLA 4Z6FA 8ICKA 2X3XA 4I2HA 4EP7A 4E3CA 1DKZA 5C5BB 2GF4A 4LZDA 2YIAA 4O67A 2PFNA 3NWIA 1I49A 4LVSA 5IIKA 3QWEA 2MI7A 1E1DA 3UPSA 3C18A 1JQKA 4AZBA 5HC9A 3JPTA 4LEZA 3NKUA 4DYLA 4WC2A 1ZQOA 4NQIA 5D61A 5J0YA 3D52A 2ZH3A 3T46A 3WFOA 1Q79A 1W9MA 1SU6A 3RH6A 4FO1A 4KLJA 4AZGA 4RQ6A 1BPBA 1PS3A 4RQ3A 1OAOA 3RJFA 4JWCA 1ZQUA 4PHPA 1V4AA 5HRHA 5HRIA 5J0UA 4XRHA 3C5FA 4RQ1A 4M5DA 4I2BA 4YD2A 3H3AA 4JWDA 4EZZA 5FLEX 4TUSA 2ZH5A 3BUBA 8ICEA 4I1QA 2QFFA 9ICTA 3F7WA 4EZTA 2NRKA 1HUZA 3TFRA 5TZVA 4IM0A 2FCLA 3CVRA 2Q66A 5DDYA 9ICOA 3WFQE 5HRFA 4Z6DA 5BOMA 4KIKB 5CFTA 4X4PA 4X5VA 3RJEA 5DEDA
chains in the Genus database with same CATH topology
4EZNA 2GA9D 2WINM 3L3OM 5B3PA 4K9AA 2B51A 4HR1A 4OAFA 3KAVA 3B52X 4KIKA 2YIBA 4EZQA 1DKXA 4JNEA 4OAGA 4NPHA 3O3MB 4XJEA 2EX3B 3VEAA 4N7RA 4O69A 4K98A 4KM5A 4F00A 4R5GA 3T47A 4PO2A 3GI7A 4JL9A 2JNSA 4G6QA 2YI8A 4IM2A 5D63A 3I39X 4FM3A 4K9BA 2YIVX 4K96A 3DPPA 4E81A 1UPXA 4LEWA 3MCRA 3K7DA 4H6IA 3D2EA 4IWOA 4NXVA 1DKYA 1SUFA 3VKHA 3A98A 4LEVA 3ER8C 4H6HA 5CFUA 4K99A 1E9VA 5B3QA 1SU7A 2EWFA 3RV0A 4IWPA 3I04A 4JN4A 4B9QA 4O68A 4WH5A 1ZYLA 4JNFA 4NXTA 1E2UA 4HYBA 2LM0A 2EWRA 4UDYX 4NXWA 4HX0A 2PY6A 5CFSA 3QA8A 4LEYA 3UITA 4JLZA 3DPOA 4EZOA 3EF2A 3I01A 5FIGA 4EZYA 1GNTA 3FD9A 3ERCC 1SU8A 4MKPA 4JWEA 3O3OB 4NXXA 2OBMA 3B51X 4R5LA 3T48A 4R5IA 4EZRA 3OHXM 4D8JA 1GNLA 4O6AA 4IWQA 4R5KA 4OAIZ 4E3CA 1DKZA 3KDRA 2NCZA 2YIAA 3QNJA 4O67A 3VEBA 3B53X 4EZUA 3T49A 4KB6A 4EZSA 2ND1A 4EZXA 4IM3A 1OA0A 1E1DA 3T4AG 3OWGA 1JQKA 3DPQA 5E84A 4LEZA 3LMFA 3NKUA 3C7NA 2GAFD 2B56A 5D61A 4EZPA 4EZVA 3T46A 1GPJA 1GN9A 4WOYA 2ND0A 1W9MA 3PHZA 1SU6A 4JLXA 4JLCA 2YI9A 4HR1B 4EZWA 4OAHA 4FO1A 5CHEA 4JWIA 3ZEDA 2B4VA 2N3KA 2OBLA 1MJGA 1OAOA 4IW0A 4JWCA 3O3NB 1OA1A 4WQKA 3KAWA 2IHOA 4JWDA 4UDXX 4EZZA 5FLEX 4R5JA 2QFFA 3D2FA 3F7WA 4EZTA 4IM0A 3RV1A 5TKYA 2FCLA 3ER9B 4K8VA 2X5CA 5D62A 4M0MA 2Z8YA 2RT6A 2QXLA 1U00A 4HY9A 4F01A 4KIKB 4NXUA 5CFTA 4WQLA 4K97A 2KHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GA9 D;  2GAF D;  3ERC C;  3OWG A;  3ER8 C;  3ER9 B; 
#chains in the Genus database with same CATH topology
 4EZN A;  2GA9 D;  1R8B A;  3L3O M;  2I9G A;  1ZQF A;  9ICM A;  4O5C A;  1MQ3 A;  1MIY A;  3KAV A;  9ICC A;  4K4H A;  4PGX A;  5J2A A;  3O3M B;  4XQ7 A;  3D50 A;  4YMN A;  2PXI A;  3BVX A;  4NKT A;  1BPD A;  4KM5 A;  4Z6E A;  4F00 A;  4WC3 A;  4P4M A;  3LVT A;  4UB5 A;  2YI8 A;  5D63 A;  4M2Y A;  1TQU A;  4FM3 A;  2YIV X;  4K96 A;  4X4T A;  1F5A A;  1ZQC A;  4EED A;  3EJT A;  3V7J A;  3K7D A;  4H6I A;  3MBY A;  5J2F A;  4QZC A;  1ZQZ A;  4KLT A;  2V0O A;  5CHG A;  4TUR A;  8ICH A;  1MIV A;  3G9G A;  1X03 A;  5J0P A;  4I2J A;  9ICL A;  2QKW A;  4WC4 A;  1TVA A;  9ICR A;  4JN4 A;  1ZQM A;  3UXO A;  3JCF A;  9ICX A;  1ZYL A;  2BPG A;  3JPS A;  4F5O A;  3Q84 A;  1TFW A;  5J0W A;  4E7X A;  4HX0 A;  4EEB A;  4E80 A;  2HN1 A;  3CZS A;  3QA8 A;  3UIT A;  4AT7 B;  2DVI A;  5J0Q A;  4EZO A;  3OVS A;  3EF2 A;  4KLG A;  2F1B A;  1KDH A;  3DX1 A;  7ICR A;  5FIG A;  1BPX A;  3FD9 A;  3ERC C;  1SU8 A;  4M0A A;  3BVW A;  8ICT A;  8ICU A;  3H37 A;  2OBM A;  4AZ7 A;  5J2H A;  3B0Y A;  3TFS A;  4R5I A;  1QWN A;  3JPN A;  4QZ8 A;  3OHX M;  4D8J A;  9ICB A;  5HHI A;  3NVO A;  1ZQL A;  4O6A A;  4OAI Z;  5BPC A;  4KLL A;  2NCZ A;  4QZ9 A;  2FIC A;  5J0S A;  4KB6 A;  7ICK A;  2ND1 A;  3DX2 A;  4EZX A;  2M2U A;  4IQU A;  4IM3 A;  4WBZ A;  5J29 A;  4UAY A;  4RWO A;  1I4D A;  4LT6 A;  2OW7 A;  1JMS A;  3T4A G;  1ZQY A;  5CB1 A;  4EBK A;  2F7R A;  1JN3 A;  3C7N A;  2B56 A;  3B0X A;  4S3N A;  8ICI A;  5DB7 A;  5IIN A;  2ISP A;  3K75 D;  3C2L A;  4WOY A;  2ND0 A;  5D4B A;  4JLX A;  8ICX A;  8ICL A;  4JLC A;  5HRK A;  5III A;  4K4I A;  9ICE A;  8ICB A;  4X4N A;  2Q12 A;  4JWI A;  4RWP A;  3BUI A;  2B4V A;  2RAJ A;  4WBY A;  1RZT A;  2F7P A;  4IQT A;  4AT8 A;  9ICF A;  4I0U A;  1OA1 A;  3ISB A;  4TUP A;  7ICF A;  3C5G A;  8ICR A;  3AQL A;  7ICM A;  1TFY A;  5HRB A;  4RWN A;  3SYV A;  1TV9 A;  2X3W A;  4R5J A;  3D2F A;  4R64 A;  3CAZ A;  4XQ8 A;  3EJP A;  3UPQ A;  3D51 A;  2DR5 A;  4MFC A;  5TKY A;  5D62 A;  3ER9 B;  2X5C A;  3OK8 A;  4IQW A;  2Z8Y A;  1Y2O A;  5CJ7 A;  1YWM A;  4HY9 A;  4AZC A;  2ZH2 A;  4F01 A;  2BCU A;  4WQL A;  7ICL A;  1XSN A;  2BE3 A;  4I2A A;  9ICU A;  4WC7 A;  4YD1 A;  2M2W A;  5CWR A;  2F1A A;  3B52 X;  1FA0 A;  5DBC A;  4JNE A;  3BVT A;  4FHX A;  4OAG A;  1ZQI A;  4XJE A;  2M2V A;  3MGI A;  4LZG A;  1R8A A;  1ZQK A;  9ICA A;  1Q78 A;  4ATB B;  3T47 A;  4QZD A;  3SOG A;  4RQ0 A;  4WPC A;  2EFL A;  3HWT A;  3HW8 A;  4IM2 A;  3OV7 A;  3GDX A;  3RJH A;  4NLZ A;  5HRD A;  2FMS A;  7ICP A;  2P66 A;  2ALW A;  4LEW A;  4M9J A;  9ICG A;  1NOM A;  4DOC A;  3MCR A;  1KNY A;  4PGY A;  3DDF A;  2F7O A;  3D2E A;  3LK9 A;  4ATM A;  4O9M A;  8ICS A;  3PMN A;  3RH4 A;  4NXV A;  4P4O A;  3DYT A;  7ICS A;  5CFU A;  2YKT A;  4RQ5 A;  4NM2 A;  4K99 A;  5JTG A;  1ZJN A;  9ICV A;  1PX5 A;  5B3Q A;  3JPQ A;  1HXK A;  3LLL A;  4KLU A;  4R66 A;  7ICG A;  2EWF A;  2WYI A;  1TQS A;  3QE6 A;  2F7Q A;  4AZH A;  1I4T A;  5J2K A;  4B9Q A;  4X0A A;  4FO6 A;  1ZQJ A;  2BPC A;  4NKU A;  2FMQ A;  7ICU A;  4YN4 A;  1E2U A;  4Z6C A;  4MF8 A;  2ZH4 A;  4F5R A;  3CV5 A;  2BPF A;  7ICE A;  3UQ0 A;  2PY6 A;  5CFS A;  4YCX A;  4FHV A;  4UB2 A;  4QZG A;  4QZA A;  3DPO A;  4DCN C;  4P2H A;  2O1P A;  3I01 A;  1QX1 A;  4RPX A;  2IUB A;  1GNT A;  2YL6 A;  8ICF A;  3D4Y A;  5DB6 A;  3HIY A;  4MKP A;  4X0B A;  8ICJ A;  3BUQ A;  4JWE A;  2GWS A;  4X4O A;  3B51 X;  5DDM A;  1URU A;  3T48 A;  4F5P A;  3AU2 A;  2ZH6 A;  8ICA A;  3ISC A;  1R5E A;  4TUQ A;  3JPR A;  3MDA A;  9ICQ A;  1TQW A;  2W9M A;  3WFP A;  3ABH A;  4R5K A;  5KBP A;  2ZHA A;  2ZH8 A;  8ICY A;  2BCV A;  4KLH A;  5HHH A;  4RQ8 A;  1MIW A;  4PHD A;  3B53 X;  4EZU A;  7ICN A;  3T49 A;  5J2G A;  4EZS A;  3L3P A;  4FZS A;  1OA0 A;  5J2J A;  4UB3 A;  2PFQ A;  8ICV A;  3OWG A;  1R8C A;  5E84 A;  4IQV A;  2YLL A;  4KLS A;  1VFG A;  2DR8 A;  3AQN A;  5BOL A;  4EZP A;  4EZV A;  4JWM A;  1ZQR A;  3BLB A;  1GPJ A;  1VJ7 A;  1O7D B;  3AQK A;  4QZF A;  2RAK A;  2YI9 A;  3EJU A;  4HR1 B;  1XSL A;  4EZW A;  5CHE A;  2HN2 A;  2RAI A;  3JPO A;  4GXJ A;  4KLO A;  2OBL A;  1MJG A;  3HAH A;  4AZ5 A;  4FH3 A;  9ICJ A;  3C2M A;  3V7L A;  1BPY A;  1NO5 A;  4WPE A;  3JYY A;  5DEC A;  4ATB A;  2IHO A;  3PLT A;  4M9N A;  4UDX X;  4RPZ A;  3WFR E;  4RT2 A;  2FMP A;  3ACO A;  1ZQN A;  8ICM A;  1JQR A;  4K8V A;  3MGH A;  8ICG A;  4M0M A;  4UAW A;  2YLA A;  2QXL A;  1U00 A;  2DR7 A;  8ICZ A;  3CKD A;  5D49 A;  1OU5 A;  4NXU A;  4RQ2 A;  4H8S A;  1BPE A;  3H39 A;  4AT9 B;  4I2I A;  1ZJM A;  4K9A A;  2B51 A;  4K4G A;  3D4Z A;  4DOB A;  4KIK A;  2YIB A;  1DKX A;  3Q0K A;  3NYB A;  1R33 A;  4NPH A;  3WFS C;  2EX3 B;  3VEA A;  4MFA A;  1JAJ A;  2BBJ A;  3H38 A;  4AT8 B;  4IG8 A;  4GXI A;  4KLI A;  2Q13 A;  2HHP A;  4R5G A;  4PO2 A;  5J2D A;  3V7K A;  3GI7 A;  3V72 A;  4JL9 A;  2Z0V A;  3CZN A;  3RJI A;  4G6Q A;  3RJG A;  1ZQV A;  9ICH A;  4X4R A;  3DPP A;  9ICS A;  4R65 A;  3DDG A;  4E81 A;  1UPX A;  3OUY A;  4KLQ A;  1KEJ A;  4WCW A;  1ZQT A;  2FYV A;  5C5B A;  2EFK A;  3BUP A;  2F18 A;  2ZH1 A;  3MDC A;  4KLF A;  1DKY A;  1SUF A;  1R89 A;  5DB8 A;  3A98 A;  4M9H A;  4F5Q A;  3L9D A;  1E9V A;  4FH5 A;  7ICV A;  4WC1 A;  1SU7 A;  3RV0 A;  4IWP A;  3I04 A;  7ICJ A;  1UEV A;  4O68 A;  4JNF A;  4NXT A;  2YL8 A;  3C2K A;  1RPL A;  7ICI A;  4NXW A;  1XSP A;  4PHE A;  3AUO A;  5DBA A;  3EJQ A;  3QNI A;  4LEY A;  2ZHB A;  4M9L A;  4AVM A;  3EJS A;  5F2V O;  2PFP A;  2BBH A;  4P4P A;  4EZY A;  2RFF A;  1ZQP A;  2WYH A;  4UB1 A;  1ZQQ A;  4NLN A;  1TQT A;  4I2D A;  4NXX A;  2DRA A;  8ICC A;  4NSW A;  1UEU A;  4AT7 A;  4GXK A;  4R5L A;  4O5K A;  3ISD A;  4EZR A;  4I2E A;  4I27 A;  9ICI A;  4AZI A;  4F5N A;  4KLE A;  5J2B A;  4IWQ A;  2ISO A;  3KDR A;  3QNJ A;  4RT3 A;  7ICT A;  3BVU A;  3VEB A;  9ICW A;  4AZC B;  1ZQB A;  4BNE A;  5HRE A;  5DBB A;  5DB9 A;  2YL9 A;  3DPQ A;  3DX4 A;  3AU6 A;  3OVB A;  3LMF A;  4X4V A;  4YMO A;  2GAF D;  4KLD A;  4X4Q A;  7ICH A;  3OVA A;  5HR9 A;  4FHW A;  4QZH A;  4I2G A;  1GN9 A;  5CP2 A;  3DX0 A;  4DOA A;  4RQ4 A;  3PHZ A;  5J0T A;  1BPZ A;  1R34 A;  2ID1 A;  3UXN A;  1TQV A;  4OAH A;  4WC6 A;  8ICO A;  3ZED A;  4NXZ A;  5HRG A;  2N3K A;  1HWW A;  2OZN B;  1ZWW A;  2O5A A;  5EOZ A;  5J2I A;  1ZQW A;  2DR9 A;  4I29 A;  4IW0 A;  1ZQE A;  5J2C A;  4WC5 A;  3O3N B;  4FHY A;  3RJJ A;  3PNC A;  4WQK A;  3KAW A;  3OUY B;  3HJ4 A;  4FZO A;  3UXP A;  5CR0 A;  4AZ6 A;  2PBE A;  9ICK A;  2PFO A;  2PMR A;  4M9G A;  3RV1 A;  4NY8 A;  4UB4 A;  3BUD A;  2RT6 A;  3CK6 A;  5J0O A;  3EJR A;  4O5E A;  4I2C A;  4YMM A;  4K97 A;  4EGW A;  3HAI A;  4QZB A;  2KHO A;  3HJ1 A;  2YL5 A;  4PHA A;  2Z0N A;  4R63 A;  4XA5 A;  4RPY A;  3JPP A;  2WIN M;  3HAJ A;  4FZP A;  4JWN A;  5B3P A;  2O0I 1;  2ZH7 A;  3DX3 A;  4HR1 A;  4OAF A;  2X3V A;  4E8F A;  5IIM A;  4KLM A;  4MFF A;  1HUO A;  4NM1 A;  4NLK A;  4EZQ A;  4I2F A;  2ZXQ A;  2DRB A;  4RWQ A;  4DO9 A;  4RQ7 A;  4AT9 A;  4UBC A;  3LQC B;  4N7R A;  9ICN A;  7ICQ A;  3RH5 A;  4O69 A;  1ZQG A;  1HTY A;  4K98 A;  4I28 A;  2JNK A;  4UD4 A;  2D1L A;  4UD5 A;  2OO2 A;  1I4L A;  2JNS A;  3I2W A;  3RPM A;  3HX0 A;  8ICN A;  3M3W A;  2OW6 A;  3I39 X;  4K9B A;  5IIJ A;  1QWU A;  4UAZ A;  1ZQX A;  2IHM A;  4EV6 A;  2VAN A;  1ZQD A;  4IWO A;  2Z0O A;  4X4S A;  2M2T A;  3OGU A;  3VKH A;  4UBB A;  4LEV A;  3ER8 C;  4H6H A;  1ZQA A;  1X04 A;  1YLQ A;  4QZE A;  1WOT A;  5DKW A;  2BCQ A;  3PML A;  2LXY A;  1LQ7 A;  4FHP A;  2BCS A;  4WH5 A;  5J0X A;  3RJK A;  4HYB A;  3C66 A;  5HRL A;  8ICQ A;  2LM0 A;  2EWR A;  4UDY X;  8ICW A;  4EBJ A;  1UET A;  3AQM A;  5IIO A;  4XUS A;  5CA7 A;  4PGQ A;  7ICO A;  3JZ0 A;  5J2E A;  5IIL A;  4JLZ A;  4X4U A;  2C08 A;  4MF2 A;  2ELB A;  4PH5 A;  4M04 A;  9ICP A;  4QZI A;  2ZH9 A;  3BVV A;  1MQ2 A;  4WC0 A;  3O3O B;  5J0R A;  1ZQS A;  2D4C A;  3UQ2 A;  1WDZ A;  4AKV A;  1ZQH A;  4M47 A;  8ICP A;  4PPX A;  5D46 A;  1O7D C;  2BCR A;  1GNL A;  4Z6F A;  8ICK A;  2X3X A;  4I2H A;  4EP7 A;  4E3C A;  1DKZ A;  5C5B B;  2GF4 A;  4LZD A;  2YIA A;  4O67 A;  2PFN A;  3NWI A;  1I49 A;  4LVS A;  5IIK A;  3QWE A;  2MI7 A;  1E1D A;  3UPS A;  3C18 A;  1JQK A;  4AZB A;  5HC9 A;  3JPT A;  4LEZ A;  3NKU A;  4DYL A;  4WC2 A;  1ZQO A;  4NQI A;  5D61 A;  5J0Y A;  3D52 A;  2ZH3 A;  3T46 A;  3WFO A;  1Q79 A;  1W9M A;  1SU6 A;  3RH6 A;  4FO1 A;  4KLJ A;  4AZG A;  4RQ6 A;  1BPB A;  1PS3 A;  4RQ3 A;  1OAO A;  3RJF A;  4JWC A;  1ZQU A;  4PHP A;  1V4A A;  5HRH A;  5HRI A;  5J0U A;  4XRH A;  3C5F A;  4RQ1 A;  4M5D A;  4I2B A;  4YD2 A;  3H3A A;  4JWD A;  4EZZ A;  5FLE X;  4TUS A;  2ZH5 A;  3BUB A;  8ICE A;  4I1Q A;  2QFF A;  9ICT A;  3F7W A;  4EZT A;  2NRK A;  1HUZ A;  3TFR A;  5TZV A;  4IM0 A;  2FCL A;  3CVR A;  2Q66 A;  5DDY A;  9ICO A;  3WFQ E;  5HRF A;  4Z6D A;  5BOM A;  4KIK B;  5CFT A;  4X4P A;  4X5V A;  3RJE A;  5DED A; 
#chains in the Genus database with same CATH homology
 4EZN A;  2GA9 D;  2WIN M;  3L3O M;  5B3P A;  4K9A A;  2B51 A;  4HR1 A;  4OAF A;  3KAV A;  3B52 X;  4KIK A;  2YIB A;  4EZQ A;  1DKX A;  4JNE A;  4OAG A;  4NPH A;  3O3M B;  4XJE A;  2EX3 B;  3VEA A;  4N7R A;  4O69 A;  4K98 A;  4KM5 A;  4F00 A;  4R5G A;  3T47 A;  4PO2 A;  3GI7 A;  4JL9 A;  2JNS A;  4G6Q A;  2YI8 A;  4IM2 A;  5D63 A;  3I39 X;  4FM3 A;  4K9B A;  2YIV X;  4K96 A;  3DPP A;  4E81 A;  1UPX A;  4LEW A;  3MCR A;  3K7D A;  4H6I A;  3D2E A;  4IWO A;  4NXV A;  1DKY A;  1SUF A;  3VKH A;  3A98 A;  4LEV A;  3ER8 C;  4H6H A;  5CFU A;  4K99 A;  1E9V A;  5B3Q A;  1SU7 A;  2EWF A;  3RV0 A;  4IWP A;  3I04 A;  4JN4 A;  4B9Q A;  4O68 A;  4WH5 A;  1ZYL A;  4JNF A;  4NXT A;  1E2U A;  4HYB A;  2LM0 A;  2EWR A;  4UDY X;  4NXW A;  4HX0 A;  2PY6 A;  5CFS A;  3QA8 A;  4LEY A;  3UIT A;  4JLZ A;  3DPO A;  4EZO A;  3EF2 A;  3I01 A;  5FIG A;  4EZY A;  1GNT A;  3FD9 A;  3ERC C;  1SU8 A;  4MKP A;  4JWE A;  3O3O B;  4NXX A;  2OBM A;  3B51 X;  4R5L A;  3T48 A;  4R5I A;  4EZR A;  3OHX M;  4D8J A;  1GNL A;  4O6A A;  4IWQ A;  4R5K A;  4OAI Z;  4E3C A;  1DKZ A;  3KDR A;  2NCZ A;  2YIA A;  3QNJ A;  4O67 A;  3VEB A;  3B53 X;  4EZU A;  3T49 A;  4KB6 A;  4EZS A;  2ND1 A;  4EZX A;  4IM3 A;  1OA0 A;  1E1D A;  3T4A G;  3OWG A;  1JQK A;  3DPQ A;  5E84 A;  4LEZ A;  3LMF A;  3NKU A;  3C7N A;  2GAF D;  2B56 A;  5D61 A;  4EZP A;  4EZV A;  3T46 A;  1GPJ A;  1GN9 A;  4WOY A;  2ND0 A;  1W9M A;  3PHZ A;  1SU6 A;  4JLX A;  4JLC A;  2YI9 A;  4HR1 B;  4EZW A;  4OAH A;  4FO1 A;  5CHE A;  4JWI A;  3ZED A;  2B4V A;  2N3K A;  2OBL A;  1MJG A;  1OAO A;  4IW0 A;  4JWC A;  3O3N B;  1OA1 A;  4WQK A;  3KAW A;  2IHO A;  4JWD A;  4UDX X;  4EZZ A;  5FLE X;  4R5J A;  2QFF A;  3D2F A;  3F7W A;  4EZT A;  4IM0 A;  3RV1 A;  5TKY A;  2FCL A;  3ER9 B;  4K8V A;  2X5C A;  5D62 A;  4M0M A;  2Z8Y A;  2RT6 A;  2QXL A;  1U00 A;  4HY9 A;  4F01 A;  4KIK B;  4NXU A;  5CFT A;  4WQL A;  4K97 A;  2KHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...