3ER9B

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/rna
total genus 158
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
B PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
B PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er9B01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er9B03
3ER9B 3ERCC 3ER8C 3OWGA 2GA9D 2GAFD
chains in the Genus database with same CATH superfamily
5BOMA 4KLOA 4DO9A 4I2BA 4RWOA 9ICIA 2BBJA 2WINM 5E84A 3EJQA 4FHXA 3JYYA 9ICKA 3SYVA 4FM3A 5DECA 4E7XA 4HYBA 3OGUA 4TUQA 2O5AA 8ICIA 4JLCA 1OU5A 1TQSA 4I1QA 3NKUA 4AZHA 2N3KA 3ER8C 4I2JA 4XA5A 2BPGA 4UDYX 4AZCB 1PX5A 8ICZA 2O0I1 5J2FA 4OAIZ 4KB6A 1MQ3A 1TV9A 4P4OA 8ICRA 3G9GA 5TZVA 4EBKA 3OUYB 1ZQGA 4EZSA 1TQTA 5B3PA 3V72A 4WC0A 3BVTA 4IM3A 3D2EA 3CZSA 2PBEA 4ATMA 3MDCA 4EZPA 1R89A 1RZTA 4XJEA 9ICSA 7ICGA 2DR5A 3AUOA 2BCSA 2ZHBA 4NXTA 3DPOA 4KLUA 4JWNA 7ICKA 2PFQA 1V4AA 4YMMA 4NM1A 2GAFD 1E2UA 1RPLA 3AQNA 2PFOA 1HWWA 2F1BA 5J2KA 3BUIA 2Q66A 4F01A 1HUOA 4RPXA 2BCVA 5DEDA 2PFNA 9ICRA 3CK6A 7ICJA 4IWQA 3K7DA 4E80A 4P4MA 3JPSA 8ICTA 4YD1A 2BPFA 2HHPA 2P66A 3JZ0A 1MIYA 4BNEA 3WFSC 4RQ7A 4DCNC 1JAJA 3CVRA 2Q12A 2YI9A 1MIWA 8ICGA 4KLTA 3C2KA 9ICOA 2RFFA 4NXWA 2EFKA 4X4RA 4KLHA 4YMOA 4UD4A 2F1AA 3T48A 2YL6A 1R8BA 4EZNA 4Z6DA 3MGIA 3PHZA 4PH5A 1SUFA 3Q84A 4KLDA 4JWMA 2F18A 4UD5A 4RPYA 3I01A 5DBAA 3RJGA 5J0QA 2FMSA 4EZQA 1Y2OA 2YL9A 4ATBB 4PHEA 4K98A 4IQVA 5CFTA 3PNCA 1ZQKA 3RJIA 4OAHA 4WC3A 4PO2A 1JMSA 5DB8A 3C2LA 1O7DB 4X0AA 2PMRA 5HREA 4O69A 1Q78A 2BE3A 3SOGA 4UAWA 8ICCA 2RAIA 2F7RA 1ZQMA 7ICUA 1OAOA 3ER9B 1ZQWA 9ICFA 3T46A 1TQVA 3BUQA 2HN2A 3OVSA 2ZH3A 1DKZA 4OAGA 2W9MA 4S3NA 1ZQNA 2YKTA 4JWEA 5J2CA 2ZH1A 3QNIA 4JN4A 4NQIA 4JLZA 4RQ0A 2Z0VA 3DPPA 4PHDA 4UB5A 3NYBA 4EEBA 4I29A 9ICTA 1JQRA 4XQ8A 4AZGA 1ZWWA 5DBCA 4RQ8A 5HHIA 2GWSA 2B56A 5J0OA 2B4VA 5HRHA 4MF2A 4KIKA 8ICMA 4KLIA 1I49A 2YIBA 3CZNA 5IIIA 2X3XA 4AT8A 1KDHA 4I2HA 4R5JA 1BPXA 1NOMA 5HRLA 4X4UA 3C7NA 1KNYA 3MCRA 4HY9A 9ICBA 1ZQPA 4NM2A 4NSWA 4I2EA 4PPXA 8ICQA 3L3PA 4XQ7A 7ICVA 3UQ0A 1ZQYA 5HR9A 3EF2A 3BVUA 4R5LA 3CV5A 4R5GA 4K9BA 3BUPA 1TFWA 4EZWA 1R8CA 4NLZA 4FO6A 4PGXA 3HJ1A 4NY8A 4LZDA 5JTGA 4F5OA 3HW8A 3NVOA 4E3CA 4EZTA 4RQ2A 3PMNA 5CR0A 4UB4A 1LQ7A 2ZH9A 2OBLA 4QZ9A 3AU6A 4K4HA 4KLEA 1PS3A 3UPSA 5J0PA 2OZNB 1ZQZA 4E8FA 2GA9D 1UEVA 2IHOA 4JL9A 3RJHA 4O6AA 3VEAA 3T47A 3VEBA 3HAJA 3RPMA 3D2FA 1U00A 1E9VA 3I04A 5J2JA 4Z6FA 1XSLA 3H39A 1ZQTA 8ICXA 4JWIA 1XSPA 4X4OA 8ICSA 4P2HA 9ICXA 3B53X 1BPEA 2D4CA 4TUPA 5IIMA 3H38A 5D4BA 3B51X 4LEYA 3LVTA 2X5CA 4AZBA 4I2AA 3C5GA 1TVAA 1DKXA 3A98A 4TUSA 2IHMA 1TQWA 8ICLA 3H3AA 4I2GA 3QE6A 4PGYA 3F7WA 2ZXQA 4WC1A 5HHHA 4B9QA 3BVWA 3DYTA 3LK9A 2F7QA 9ICWA 7ICLA 4RT2A 1YWMA 2YLAA 5HRFA 1ZQOA 5J2AA 9ICJA 3TFSA 9ICGA 2PFPA 4X4VA 3D52A 1ZQHA 1W9MA 5CHEA 2EX3B 3JPTA 2I9GA 3WFOA 4FHYA 4NKTA 8ICJA 4AT7A 3OK8A 4WQKA 2RAKA 5J2GA 3B0XA 2BCUA 3V7KA 4E81A 3T4AG 4PGQA 5HC9A 1R34A 4O5CA 4YCXA 4TURA 4WC2A 3I2WA 4KLMA 5J2EA 3K75D 4YMNA 3ISDA 4FHPA 4AZ5A 4M5DA 1MIVA 3RJFA 3DPQA 2YLLA 4I27A 2MI7A 2X3VA 4MFCA 4K4IA 3HWTA 1SU6A 3QNJA 4KIKB 2F7OA 2YIAA 4FO1A 4WBYA 1X04A 4H8SA 4F00A 7ICRA 4AT8B 1ZQXA 3RH5A 3EJRA 2QXLA 3UXOA 4F5QA 5J2DA 5DB6A 5DBBA 3ERCC 3TFRA 2ND1A 2JNKA 3D51A 4DOBA 1R8AA 3LQCB 4O68A 7ICQA 4M47A 4EEDA 4M9NA 2DR9A 5KBPA 2M2TA 4PHPA 3OVAA 3OHXM 2V0OA 3ZEDA 2LM0A 2BCQA 3DDFA 8ICFA 3KDRA 4YN4A 2GF4A 1ZQFA 3LMFA 2DRBA 7ICEA 5FLEX 3WFQE 4EZYA 4K9AA 4I2DA 4I2CA 2OBMA 5CP2A 4FHVA 3ABHA 4IQTA 4WC7A 3BVVA 5J2IA 7ICOA 4RQ4A 1MQ2A 2VANA 9ICHA 5HRGA 4O67A 4FZSA 4R65A 5J2HA 9ICVA 3AU2A 2ZH4A 2FMQA 2ALWA 3UPQA 2ZH5A 2BPCA 4WQLA 5B3QA 4LEZA 3UXPA 3RH6A 4JWDA 4JNEA 4NXZA 3UXNA 4NLNA 2ZH6A 3RJKA 4RQ1A 1QWUA 1QWNA 4AT9A 4LEWA 1ZQBA 5IILA 2FCLA 2YL5A 3DX0A 4EZRA 4WC5A 1ZJMA 1ZQUA 3M3WA 4AVMA 4QZBA 1YLQA 3QA8A 4FZOA 5C5BA 3FD9A 1QX1A 3PMLA 1WDZA 4O5KA 8ICYA 1SU7A 4M9LA 5J0UA 4UBCA 9ICAA 2DR8A 4RPZA 3KAWA 7ICNA 2M2WA 4QZAA 1ZQAA 3AQKA 4FH3A 1ZJNA 8ICUA 5D46A 4EGWA 1URUA 3OV7A 4XUSA 4M0AA 2YIVX 2ZH7A 1X03A 2OW6A 4RWQA 3MGHA 5IINA 3JPRA 4UDXX 4M9JA 1HTYA 2WYHA 1WOTA 5IIKA 4QZ8A 4FHWA 4EZOA 3H37A 3O3MB 2LXYA 2F7PA 5HRBA 5J0YA 4EV6A 3KAVA 5CA7A 3BVXA 4NKUA 1JN3A 1VFGA 5D61A 3UQ2A 8ICWA 3RJJA 4F5NA 4DOAA 5FIGA 5CB1A 4UBBA 4KLSA 2BCRA 3JCFA 4EP7A 3O3NB 5BPCA 4O5EA 4QZCA 2OW7A 3NWIA 5D49A 4I2FA 1ZYLA 3JPOA 5J29A 2B51A 1XSNA 4AKVA 4K8VA 3EJUA 1R5EA 4IWOA 7ICFA 4RQ3A 4RWPA 4IQWA 3DX3A 2O1PA 2ISPA 8ICBA 4MFAA 1TFYA 4RT3A 4XRHA 4R5IA 2D1LA 3O3OB 5D63A 4GXJA 2EFLA 3WFPA 3T49A 5DB7A 4WPCA 5HRIA 4GXKA 3RH4A 4KLGA 4I0UA 7ICPA 4WC6A 2BBHA 4KLFA 3RV0A 5DDYA 1KEJA 3I39X 2HN1A 3MBYA 2IUBA 5CFSA 3ISCA 4EBJA 3D50A 1I4TA 2PXIA 5DDMA 8ICEA 3DX1A 2M2VA 4PHAA 1UETA 4X4QA 1ZQQA 5CHGA 2QFFA 2M2UA 4H6IA 1VJ7A 4MKPA 1ZQSA 3JPPA 3BUDA 4K99A 5J0TA 5CJ7A 3EJPA 4AZIA 2Z8YA 5IIOA 4QZGA 3C5FA 4IG8A 5HRDA 4UB1A 1BPZA 1ZQCA 4P4PA 5IIJA 5J0RA 3EJTA 4MF8A 4AT9B 5DB9A 4YD2A 3ISBA 3V7JA 4EZXA 4QZDA 4UB2A 1ZQEA 3VKHA 8ICHA 4D8JA 4WBZA 4IM2A 5J0XA 1Q79A 2Q13A 4R66A 4HR1A 1MJGA 2DVIA 1GN9A 5C5BB 3AQMA 4O9MA 4WC4A 4X0BA 4M2YA 2C08A 4EZUA 4M9HA 1OA1A 2JNSA 3C66A 7ICIA 4DYLA 3C18A 5J0WA 4LVSA 9ICCA 1BPYA 9ICLA 1HUZA 3B0YA 4NXXA 2OO2A 2FMPA 5TKYA 2FICA 4RWNA 5CFUA 2ISOA 3AQLA 7ICHA 4KM5A 4NXUA 4FZPA 9ICUA 4UB3A 4JLXA 1ZQJA 1SU8A 7ICSA 4WH5A 4N7RA 2ID1A 2WYIA 4EZZA 4IQUA 3RV1A 4AZCA 4WOYA 4IM0A 4WCWA 4AZ6A 5BOLA 2ZH2A 2RT6A 9ICPA 3RJEA 4UAYA 3OUYA 3JPNA 5F2VO 2NRKA 3JPQA 4X5VA 3DDGA 4I2IA 2FYVA 3HX0A 1I4LA 1NO5A 4LEVA 4NPHA 3MDAA 3UITA 4F5RA 4JNFA 3BLBA 4R5KA 4Z6CA 3D4ZA 3PLTA 2ZH8A 4X4PA 3B52X 4QZIA 3DX4A 8ICVA 1I4DA 5EOZA 3ACOA 3Q0KA 4H6HA 2QKWA 3WFRE 3EJSA 1ZQIA 4I28A 4OAFA 3BUBA 1OA0A 3OWGA 2KHOA 3C2MA 1HXKA 8ICNA 7ICMA 4LZGA 4QZEA 2ND0A 1R33A 8ICKA 4X4NA 3HAHA 4NLKA 1O7DC 2NCZA 1ZQDA 2Z0OA 4JWCA 4NXVA 4M9GA 5D62A 3OVBA 3HIYA 3D4YA 4LT6A 4X4TA 2X3WA 1JQKA 2DRAA 1ZQVA 4HX0A 8ICAA 4RQ5A 2YI8A 3LLLA 2ZHAA 1GNTA 9ICNA 4UAZA 4AT7B 2EWFA 4EZVA 4K97A 1F5AA 8ICOA 8ICPA 3GDXA 4GXIA 5HRKA 4ATBA 1FA0A 5J2BA 4QZHA 4F5PA 3HJ4A 3V7LA 1E1DA 4M04A 4AZ7A 3HAIA 1ZQRA 3L3OM 4MFFA 2RAJA 4DOCA 5J0SA 1ZQLA 2ELBA 3CAZA 4KLLA 1UPXA 4KLJA 4G6QA 4Z6EA 4K96A 9ICQA 1GNLA 4X4SA 4RQ6A 3QWEA 1DKYA 2EWRA 2YL8A 3DX2A 4IWPA 5CWRA 4HR1B 4WPEA 5DKWA 3L9DA 4K4GA 1BPBA 7ICTA 1BPDA 2DR7A 4IW0A 3GI7A 1GPJA 4QZFA 1UEUA 4KLQA 2Z0NA 2PY6A 4R64A 9ICMA 9ICEA 1TQUA 4FH5A 4R63A 4M0MA 3CKDA
chains in the Genus database with same CATH topology
4EZYA 4HY9A 4EZXA 3MCRA 4K9AA 2OBMA 3VKHA 2WINM 5E84A 4D8JA 4IM2A 4FM3A 3EF2A 4HR1A 4HYBA 4O67A 1MJGA 1GN9A 4JLCA 4R5LA 3NKUA 2N3KA 4R5GA 4WQLA 4EZUA 3ER8C 1OA1A 2JNSA 5B3QA 4K9BA 4EZWA 4LEZA 4JWDA 4JNEA 4UDYX 4NXXA 4OAIZ 4KB6A 5TKYA 4E3CA 4LEWA 4EZTA 5CFUA 2FCLA 4EZRA 4EZSA 2OBLA 5B3PA 4KM5A 4NXUA 4IM3A 3D2EA 4EZPA 4JLXA 1SU8A 3QA8A 4XJEA 2GA9D 2IHOA 4N7RA 3FD9A 4WH5A 4EZZA 4JL9A 3RV1A 4O6AA 3VEAA 1SU7A 3T47A 3VEBA 3DPOA 4NXTA 4WOYA 4IM0A 3D2FA 1U00A 1E9VA 3I04A 2GAFD 1E2UA 3KAWA 4JWIA 4F01A 2RT6A 2YIVX 3B53X 4IWQA 3K7DA 4LEYA 3B51X 4UDXX 2X5CA 4LEVA 4NPHA 1DKXA 2YI9A 3A98A 3UITA 4EZOA 4JNFA 3F7WA 3O3MB 4R5KA 4B9QA 3KAVA 4NXWA 3B52X 5D61A 3T48A 4H6HA 5FIGA 4EZNA 3PHZA 1SUFA 4OAFA 3O3NB 1OA0A 3OWGA 2KHOA 3I01A 1W9MA 5CHEA 2EX3B 2ND0A 4EZQA 1ZYLA 2B51A 4K8VA 4K98A 5CFTA 4IWOA 4WQKA 2NCZA 4JWCA 4NXVA 4E81A 3T4AG 5D62A 4OAHA 4PO2A 1JQKA 4R5IA 5D63A 3O3OB 4HX0A 3T49A 2YI8A 1GNTA 4O69A 3DPQA 2EWFA 4EZVA 4K97A 3RV0A 1SU6A 3QNJA 3I39X 1OAOA 2YIAA 4KIKB 3ER9B 4FO1A 3T46A 5CFSA 4F00A 1E1DA 3L3OM 1DKZA 4OAGA 2QXLA 4JWEA 1UPXA 4JN4A 4G6QA 3ERCC 4K96A 2ND1A 1GNLA 4JLZA 2QFFA 3DPPA 4H6IA 1DKYA 2EWRA 4O68A 4MKPA 4IWPA 4HR1B 4K99A 2Z8YA 2B56A 2B4VA 4KIKA 4IW0A 3GI7A 1GPJA 3OHXM 2LM0A 2YIBA 3ZEDA 2PY6A 3KDRA 4R5JA 3LMFA 4M0MA 5FLEX 3C7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER9 B;  3ERC C;  3ER8 C;  3OWG A;  2GA9 D;  2GAF D; 
#chains in the Genus database with same CATH topology
 5BOM A;  4KLO A;  4DO9 A;  4I2B A;  4RWO A;  9ICI A;  2BBJ A;  2WIN M;  5E84 A;  3EJQ A;  4FHX A;  3JYY A;  9ICK A;  3SYV A;  4FM3 A;  5DEC A;  4E7X A;  4HYB A;  3OGU A;  4TUQ A;  2O5A A;  8ICI A;  4JLC A;  1OU5 A;  1TQS A;  4I1Q A;  3NKU A;  4AZH A;  2N3K A;  3ER8 C;  4I2J A;  4XA5 A;  2BPG A;  4UDY X;  4AZC B;  1PX5 A;  8ICZ A;  2O0I 1;  5J2F A;  4OAI Z;  4KB6 A;  1MQ3 A;  1TV9 A;  4P4O A;  8ICR A;  3G9G A;  5TZV A;  4EBK A;  3OUY B;  1ZQG A;  4EZS A;  1TQT A;  5B3P A;  3V72 A;  4WC0 A;  3BVT A;  4IM3 A;  3D2E A;  3CZS A;  2PBE A;  4ATM A;  3MDC A;  4EZP A;  1R89 A;  1RZT A;  4XJE A;  9ICS A;  7ICG A;  2DR5 A;  3AUO A;  2BCS A;  2ZHB A;  4NXT A;  3DPO A;  4KLU A;  4JWN A;  7ICK A;  2PFQ A;  1V4A A;  4YMM A;  4NM1 A;  2GAF D;  1E2U A;  1RPL A;  3AQN A;  2PFO A;  1HWW A;  2F1B A;  5J2K A;  3BUI A;  2Q66 A;  4F01 A;  1HUO A;  4RPX A;  2BCV A;  5DED A;  2PFN A;  9ICR A;  3CK6 A;  7ICJ A;  4IWQ A;  3K7D A;  4E80 A;  4P4M A;  3JPS A;  8ICT A;  4YD1 A;  2BPF A;  2HHP A;  2P66 A;  3JZ0 A;  1MIY A;  4BNE A;  3WFS C;  4RQ7 A;  4DCN C;  1JAJ A;  3CVR A;  2Q12 A;  2YI9 A;  1MIW A;  8ICG A;  4KLT A;  3C2K A;  9ICO A;  2RFF A;  4NXW A;  2EFK A;  4X4R A;  4KLH A;  4YMO A;  4UD4 A;  2F1A A;  3T48 A;  2YL6 A;  1R8B A;  4EZN A;  4Z6D A;  3MGI A;  3PHZ A;  4PH5 A;  1SUF A;  3Q84 A;  4KLD A;  4JWM A;  2F18 A;  4UD5 A;  4RPY A;  3I01 A;  5DBA A;  3RJG A;  5J0Q A;  2FMS A;  4EZQ A;  1Y2O A;  2YL9 A;  4ATB B;  4PHE A;  4K98 A;  4IQV A;  5CFT A;  3PNC A;  1ZQK A;  3RJI A;  4OAH A;  4WC3 A;  4PO2 A;  1JMS A;  5DB8 A;  3C2L A;  1O7D B;  4X0A A;  2PMR A;  5HRE A;  4O69 A;  1Q78 A;  2BE3 A;  3SOG A;  4UAW A;  8ICC A;  2RAI A;  2F7R A;  1ZQM A;  7ICU A;  1OAO A;  3ER9 B;  1ZQW A;  9ICF A;  3T46 A;  1TQV A;  3BUQ A;  2HN2 A;  3OVS A;  2ZH3 A;  1DKZ A;  4OAG A;  2W9M A;  4S3N A;  1ZQN A;  2YKT A;  4JWE A;  5J2C A;  2ZH1 A;  3QNI A;  4JN4 A;  4NQI A;  4JLZ A;  4RQ0 A;  2Z0V A;  3DPP A;  4PHD A;  4UB5 A;  3NYB A;  4EEB A;  4I29 A;  9ICT A;  1JQR A;  4XQ8 A;  4AZG A;  1ZWW A;  5DBC A;  4RQ8 A;  5HHI A;  2GWS A;  2B56 A;  5J0O A;  2B4V A;  5HRH A;  4MF2 A;  4KIK A;  8ICM A;  4KLI A;  1I49 A;  2YIB A;  3CZN A;  5III A;  2X3X A;  4AT8 A;  1KDH A;  4I2H A;  4R5J A;  1BPX A;  1NOM A;  5HRL A;  4X4U A;  3C7N A;  1KNY A;  3MCR A;  4HY9 A;  9ICB A;  1ZQP A;  4NM2 A;  4NSW A;  4I2E A;  4PPX A;  8ICQ A;  3L3P A;  4XQ7 A;  7ICV A;  3UQ0 A;  1ZQY A;  5HR9 A;  3EF2 A;  3BVU A;  4R5L A;  3CV5 A;  4R5G A;  4K9B A;  3BUP A;  1TFW A;  4EZW A;  1R8C A;  4NLZ A;  4FO6 A;  4PGX A;  3HJ1 A;  4NY8 A;  4LZD A;  5JTG A;  4F5O A;  3HW8 A;  3NVO A;  4E3C A;  4EZT A;  4RQ2 A;  3PMN A;  5CR0 A;  4UB4 A;  1LQ7 A;  2ZH9 A;  2OBL A;  4QZ9 A;  3AU6 A;  4K4H A;  4KLE A;  1PS3 A;  3UPS A;  5J0P A;  2OZN B;  1ZQZ A;  4E8F A;  2GA9 D;  1UEV A;  2IHO A;  4JL9 A;  3RJH A;  4O6A A;  3VEA A;  3T47 A;  3VEB A;  3HAJ A;  3RPM A;  3D2F A;  1U00 A;  1E9V A;  3I04 A;  5J2J A;  4Z6F A;  1XSL A;  3H39 A;  1ZQT A;  8ICX A;  4JWI A;  1XSP A;  4X4O A;  8ICS A;  4P2H A;  9ICX A;  3B53 X;  1BPE A;  2D4C A;  4TUP A;  5IIM A;  3H38 A;  5D4B A;  3B51 X;  4LEY A;  3LVT A;  2X5C A;  4AZB A;  4I2A A;  3C5G A;  1TVA A;  1DKX A;  3A98 A;  4TUS A;  2IHM A;  1TQW A;  8ICL A;  3H3A A;  4I2G A;  3QE6 A;  4PGY A;  3F7W A;  2ZXQ A;  4WC1 A;  5HHH A;  4B9Q A;  3BVW A;  3DYT A;  3LK9 A;  2F7Q A;  9ICW A;  7ICL A;  4RT2 A;  1YWM A;  2YLA A;  5HRF A;  1ZQO A;  5J2A A;  9ICJ A;  3TFS A;  9ICG A;  2PFP A;  4X4V A;  3D52 A;  1ZQH A;  1W9M A;  5CHE A;  2EX3 B;  3JPT A;  2I9G A;  3WFO A;  4FHY A;  4NKT A;  8ICJ A;  4AT7 A;  3OK8 A;  4WQK A;  2RAK A;  5J2G A;  3B0X A;  2BCU A;  3V7K A;  4E81 A;  3T4A G;  4PGQ A;  5HC9 A;  1R34 A;  4O5C A;  4YCX A;  4TUR A;  4WC2 A;  3I2W A;  4KLM A;  5J2E A;  3K75 D;  4YMN A;  3ISD A;  4FHP A;  4AZ5 A;  4M5D A;  1MIV A;  3RJF A;  3DPQ A;  2YLL A;  4I27 A;  2MI7 A;  2X3V A;  4MFC A;  4K4I A;  3HWT A;  1SU6 A;  3QNJ A;  4KIK B;  2F7O A;  2YIA A;  4FO1 A;  4WBY A;  1X04 A;  4H8S A;  4F00 A;  7ICR A;  4AT8 B;  1ZQX A;  3RH5 A;  3EJR A;  2QXL A;  3UXO A;  4F5Q A;  5J2D A;  5DB6 A;  5DBB A;  3ERC C;  3TFR A;  2ND1 A;  2JNK A;  3D51 A;  4DOB A;  1R8A A;  3LQC B;  4O68 A;  7ICQ A;  4M47 A;  4EED A;  4M9N A;  2DR9 A;  5KBP A;  2M2T A;  4PHP A;  3OVA A;  3OHX M;  2V0O A;  3ZED A;  2LM0 A;  2BCQ A;  3DDF A;  8ICF A;  3KDR A;  4YN4 A;  2GF4 A;  1ZQF A;  3LMF A;  2DRB A;  7ICE A;  5FLE X;  3WFQ E;  4EZY A;  4K9A A;  4I2D A;  4I2C A;  2OBM A;  5CP2 A;  4FHV A;  3ABH A;  4IQT A;  4WC7 A;  3BVV A;  5J2I A;  7ICO A;  4RQ4 A;  1MQ2 A;  2VAN A;  9ICH A;  5HRG A;  4O67 A;  4FZS A;  4R65 A;  5J2H A;  9ICV A;  3AU2 A;  2ZH4 A;  2FMQ A;  2ALW A;  3UPQ A;  2ZH5 A;  2BPC A;  4WQL A;  5B3Q A;  4LEZ A;  3UXP A;  3RH6 A;  4JWD A;  4JNE A;  4NXZ A;  3UXN A;  4NLN A;  2ZH6 A;  3RJK A;  4RQ1 A;  1QWU A;  1QWN A;  4AT9 A;  4LEW A;  1ZQB A;  5IIL A;  2FCL A;  2YL5 A;  3DX0 A;  4EZR A;  4WC5 A;  1ZJM A;  1ZQU A;  3M3W A;  4AVM A;  4QZB A;  1YLQ A;  3QA8 A;  4FZO A;  5C5B A;  3FD9 A;  1QX1 A;  3PML A;  1WDZ A;  4O5K A;  8ICY A;  1SU7 A;  4M9L A;  5J0U A;  4UBC A;  9ICA A;  2DR8 A;  4RPZ A;  3KAW A;  7ICN A;  2M2W A;  4QZA A;  1ZQA A;  3AQK A;  4FH3 A;  1ZJN A;  8ICU A;  5D46 A;  4EGW A;  1URU A;  3OV7 A;  4XUS A;  4M0A A;  2YIV X;  2ZH7 A;  1X03 A;  2OW6 A;  4RWQ A;  3MGH A;  5IIN A;  3JPR A;  4UDX X;  4M9J A;  1HTY A;  2WYH A;  1WOT A;  5IIK A;  4QZ8 A;  4FHW A;  4EZO A;  3H37 A;  3O3M B;  2LXY A;  2F7P A;  5HRB A;  5J0Y A;  4EV6 A;  3KAV A;  5CA7 A;  3BVX A;  4NKU A;  1JN3 A;  1VFG A;  5D61 A;  3UQ2 A;  8ICW A;  3RJJ A;  4F5N A;  4DOA A;  5FIG A;  5CB1 A;  4UBB A;  4KLS A;  2BCR A;  3JCF A;  4EP7 A;  3O3N B;  5BPC A;  4O5E A;  4QZC A;  2OW7 A;  3NWI A;  5D49 A;  4I2F A;  1ZYL A;  3JPO A;  5J29 A;  2B51 A;  1XSN A;  4AKV A;  4K8V A;  3EJU A;  1R5E A;  4IWO A;  7ICF A;  4RQ3 A;  4RWP A;  4IQW A;  3DX3 A;  2O1P A;  2ISP A;  8ICB A;  4MFA A;  1TFY A;  4RT3 A;  4XRH A;  4R5I A;  2D1L A;  3O3O B;  5D63 A;  4GXJ A;  2EFL A;  3WFP A;  3T49 A;  5DB7 A;  4WPC A;  5HRI A;  4GXK A;  3RH4 A;  4KLG A;  4I0U A;  7ICP A;  4WC6 A;  2BBH A;  4KLF A;  3RV0 A;  5DDY A;  1KEJ A;  3I39 X;  2HN1 A;  3MBY A;  2IUB A;  5CFS A;  3ISC A;  4EBJ A;  3D50 A;  1I4T A;  2PXI A;  5DDM A;  8ICE A;  3DX1 A;  2M2V A;  4PHA A;  1UET A;  4X4Q A;  1ZQQ A;  5CHG A;  2QFF A;  2M2U A;  4H6I A;  1VJ7 A;  4MKP A;  1ZQS A;  3JPP A;  3BUD A;  4K99 A;  5J0T A;  5CJ7 A;  3EJP A;  4AZI A;  2Z8Y A;  5IIO A;  4QZG A;  3C5F A;  4IG8 A;  5HRD A;  4UB1 A;  1BPZ A;  1ZQC A;  4P4P A;  5IIJ A;  5J0R A;  3EJT A;  4MF8 A;  4AT9 B;  5DB9 A;  4YD2 A;  3ISB A;  3V7J A;  4EZX A;  4QZD A;  4UB2 A;  1ZQE A;  3VKH A;  8ICH A;  4D8J A;  4WBZ A;  4IM2 A;  5J0X A;  1Q79 A;  2Q13 A;  4R66 A;  4HR1 A;  1MJG A;  2DVI A;  1GN9 A;  5C5B B;  3AQM A;  4O9M A;  4WC4 A;  4X0B A;  4M2Y A;  2C08 A;  4EZU A;  4M9H A;  1OA1 A;  2JNS A;  3C66 A;  7ICI A;  4DYL A;  3C18 A;  5J0W A;  4LVS A;  9ICC A;  1BPY A;  9ICL A;  1HUZ A;  3B0Y A;  4NXX A;  2OO2 A;  2FMP A;  5TKY A;  2FIC A;  4RWN A;  5CFU A;  2ISO A;  3AQL A;  7ICH A;  4KM5 A;  4NXU A;  4FZP A;  9ICU A;  4UB3 A;  4JLX A;  1ZQJ A;  1SU8 A;  7ICS A;  4WH5 A;  4N7R A;  2ID1 A;  2WYI A;  4EZZ A;  4IQU A;  3RV1 A;  4AZC A;  4WOY A;  4IM0 A;  4WCW A;  4AZ6 A;  5BOL A;  2ZH2 A;  2RT6 A;  9ICP A;  3RJE A;  4UAY A;  3OUY A;  3JPN A;  5F2V O;  2NRK A;  3JPQ A;  4X5V A;  3DDG A;  4I2I A;  2FYV A;  3HX0 A;  1I4L A;  1NO5 A;  4LEV A;  4NPH A;  3MDA A;  3UIT A;  4F5R A;  4JNF A;  3BLB A;  4R5K A;  4Z6C A;  3D4Z A;  3PLT A;  2ZH8 A;  4X4P A;  3B52 X;  4QZI A;  3DX4 A;  8ICV A;  1I4D A;  5EOZ A;  3ACO A;  3Q0K A;  4H6H A;  2QKW A;  3WFR E;  3EJS A;  1ZQI A;  4I28 A;  4OAF A;  3BUB A;  1OA0 A;  3OWG A;  2KHO A;  3C2M A;  1HXK A;  8ICN A;  7ICM A;  4LZG A;  4QZE A;  2ND0 A;  1R33 A;  8ICK A;  4X4N A;  3HAH A;  4NLK A;  1O7D C;  2NCZ A;  1ZQD A;  2Z0O A;  4JWC A;  4NXV A;  4M9G A;  5D62 A;  3OVB A;  3HIY A;  3D4Y A;  4LT6 A;  4X4T A;  2X3W A;  1JQK A;  2DRA A;  1ZQV A;  4HX0 A;  8ICA A;  4RQ5 A;  2YI8 A;  3LLL A;  2ZHA A;  1GNT A;  9ICN A;  4UAZ A;  4AT7 B;  2EWF A;  4EZV A;  4K97 A;  1F5A A;  8ICO A;  8ICP A;  3GDX A;  4GXI A;  5HRK A;  4ATB A;  1FA0 A;  5J2B A;  4QZH A;  4F5P A;  3HJ4 A;  3V7L A;  1E1D A;  4M04 A;  4AZ7 A;  3HAI A;  1ZQR A;  3L3O M;  4MFF A;  2RAJ A;  4DOC A;  5J0S A;  1ZQL A;  2ELB A;  3CAZ A;  4KLL A;  1UPX A;  4KLJ A;  4G6Q A;  4Z6E A;  4K96 A;  9ICQ A;  1GNL A;  4X4S A;  4RQ6 A;  3QWE A;  1DKY A;  2EWR A;  2YL8 A;  3DX2 A;  4IWP A;  5CWR A;  4HR1 B;  4WPE A;  5DKW A;  3L9D A;  4K4G A;  1BPB A;  7ICT A;  1BPD A;  2DR7 A;  4IW0 A;  3GI7 A;  1GPJ A;  4QZF A;  1UEU A;  4KLQ A;  2Z0N A;  2PY6 A;  4R64 A;  9ICM A;  9ICE A;  1TQU A;  4FH5 A;  4R63 A;  4M0M A;  3CKD A; 
#chains in the Genus database with same CATH homology
 4EZY A;  4HY9 A;  4EZX A;  3MCR A;  4K9A A;  2OBM A;  3VKH A;  2WIN M;  5E84 A;  4D8J A;  4IM2 A;  4FM3 A;  3EF2 A;  4HR1 A;  4HYB A;  4O67 A;  1MJG A;  1GN9 A;  4JLC A;  4R5L A;  3NKU A;  2N3K A;  4R5G A;  4WQL A;  4EZU A;  3ER8 C;  1OA1 A;  2JNS A;  5B3Q A;  4K9B A;  4EZW A;  4LEZ A;  4JWD A;  4JNE A;  4UDY X;  4NXX A;  4OAI Z;  4KB6 A;  5TKY A;  4E3C A;  4LEW A;  4EZT A;  5CFU A;  2FCL A;  4EZR A;  4EZS A;  2OBL A;  5B3P A;  4KM5 A;  4NXU A;  4IM3 A;  3D2E A;  4EZP A;  4JLX A;  1SU8 A;  3QA8 A;  4XJE A;  2GA9 D;  2IHO A;  4N7R A;  3FD9 A;  4WH5 A;  4EZZ A;  4JL9 A;  3RV1 A;  4O6A A;  3VEA A;  1SU7 A;  3T47 A;  3VEB A;  3DPO A;  4NXT A;  4WOY A;  4IM0 A;  3D2F A;  1U00 A;  1E9V A;  3I04 A;  2GAF D;  1E2U A;  3KAW A;  4JWI A;  4F01 A;  2RT6 A;  2YIV X;  3B53 X;  4IWQ A;  3K7D A;  4LEY A;  3B51 X;  4UDX X;  2X5C A;  4LEV A;  4NPH A;  1DKX A;  2YI9 A;  3A98 A;  3UIT A;  4EZO A;  4JNF A;  3F7W A;  3O3M B;  4R5K A;  4B9Q A;  3KAV A;  4NXW A;  3B52 X;  5D61 A;  3T48 A;  4H6H A;  5FIG A;  4EZN A;  3PHZ A;  1SUF A;  4OAF A;  3O3N B;  1OA0 A;  3OWG A;  2KHO A;  3I01 A;  1W9M A;  5CHE A;  2EX3 B;  2ND0 A;  4EZQ A;  1ZYL A;  2B51 A;  4K8V A;  4K98 A;  5CFT A;  4IWO A;  4WQK A;  2NCZ A;  4JWC A;  4NXV A;  4E81 A;  3T4A G;  5D62 A;  4OAH A;  4PO2 A;  1JQK A;  4R5I A;  5D63 A;  3O3O B;  4HX0 A;  3T49 A;  2YI8 A;  1GNT A;  4O69 A;  3DPQ A;  2EWF A;  4EZV A;  4K97 A;  3RV0 A;  1SU6 A;  3QNJ A;  3I39 X;  1OAO A;  2YIA A;  4KIK B;  3ER9 B;  4FO1 A;  3T46 A;  5CFS A;  4F00 A;  1E1D A;  3L3O M;  1DKZ A;  4OAG A;  2QXL A;  4JWE A;  1UPX A;  4JN4 A;  4G6Q A;  3ERC C;  4K96 A;  2ND1 A;  1GNL A;  4JLZ A;  2QFF A;  3DPP A;  4H6I A;  1DKY A;  2EWR A;  4O68 A;  4MKP A;  4IWP A;  4HR1 B;  4K99 A;  2Z8Y A;  2B56 A;  2B4V A;  4KIK A;  4IW0 A;  3GI7 A;  1GPJ A;  3OHX M;  2LM0 A;  2YIB A;  3ZED A;  2PY6 A;  3KDR A;  4R5J A;  3LMF A;  4M0M A;  5FLE X;  3C7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...