3ER9B

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase complex with uu and 3'-deoxy atp
Total Genus 158
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
158
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 158
structure length 445
sequence length 468
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
B PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
B PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3er9B01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3er9B03
3OWGA 3ER8C 2GA9D 3ER9B 3ERCC 2GAFD
chains in the Genus database with same CATH superfamily
2FMSA 4YN4A 3I01A 5J0UA 2JNSA 4EZYA 3DDGA 1R8CA 2EFKA 4BNEA 4KLSA 1XSPA 3CAZA 2HN1A 2YL9A 4NXZA 1HUZA 4IM3A 7ICMA 5IILA 3T46A 9ICXA 1VJ7A 4RPXA 4I2HA 2OW7A 7ICEA 4LVSA 1KDHA 2QFFA 1HXKA 4EP7A 1ZQBA 2ND0A 5C5BB 4FO1A 2ZH2A 3QA8A 4EZZA 1MIYA 9ICRA 5J0OA 1ZQXA 3UQ0A 5BPCA 4HY9A 4JLXA 8ICZA 4X5VA 1ZQFA 3WFOA 7ICGA 3WFPA 9ICEA 4K4HA 3PMNA 2VANA 1BPBA 4WC1A 2QKWA 1Q78A 2GWSA 5J0WA 5CWRA 3G9GA 3BVWA 2PFPA 4O5EA 4FHPA 1E2UA 3UITA 3UPQA 2FICA 4R66A 3GDXA 4O9MA 4OAIZ 4JNEA 3H37A 3JPNA 4GXJA 4KLEA 3JCFA 1OAOA 2OO2A 4I2BA 1PS3A 2D4CA 4JWEA 5CHEA 4R5LA 4IW0A 2BCRA 3RJKA 4FH3A 4M2YA 1LQ7A 4NPHA 4PGYA 3CZSA 5BOLA 4UAZA 4ATMA 1SU8A 4UBCA 7ICQA 9ICUA 4RQ8A 3FD9A 5IIMA 1ZQLA 4EZVA 4UB2A 1SU6A 2B56A 3C18A 4WC7A 2JNKA 5E84A 2EFLA 4OAHA 7ICFA 1ZWWA 3OK8A 1ZQJA 4AZCA 1ZQHA 4M0AA 3ISCA 3PHZA 4IG8A 2ELBA 5HREA 5HRGA 1R33A 8ICEA 4PH5A 5HRFA 2OW6A 7ICNA 5HRLA 8ICGA 1ZQVA 5B3PA 4RQ3A 4EGWA 5CFUA 9ICBA 2YLAA 4AVMA 2ID1A 9ICWA 2ND1A 3EJQA 3TFSA 5J0SA 1BPEA 4RT2A 2BCSA 3OVBA 2ZH8A 4FM3A 2BCUA 8ICXA 4K4IA 3RJEA 3MBYA 1KNYA 4WC6A 2PFOA 7ICUA 9ICVA 8ICIA 5HRBA 2PY6A 4XUSA 5IIJA 3KAWA 4EZUA 2X3VA 3BLBA 3O3NB 1QWUA 5J2AA 1O7DB 1I4DA 4X4UA 5BOMA 4E80A 4I2CA 4UB4A 8ICNA 5HRDA 2YIVX 4FO6A 4I2DA 2BCVA 4KB6A 4EZWA 3QE6A 4RQ6A 1JMSA 2YIBA 4X4TA 1ZQSA 2PXIA 3B51X 3DX3A 4WPEA 1XSNA 3DPOA 2IHOA 2BPGA 9ICOA 1HTYA 1MJGA 3BVUA 3WFSC 4QZEA 2FMPA 4EZNA 4K98A 3V7LA 5HC9A 3JPOA 4R65A 4MF2A 4KM5A 5D4BA 1ZQKA 2O5AA 5IINA 5DKWA 4F5QA 4QZ8A 4AT7B 3AQLA 4NQIA 8ICQA 4QZGA 4QZBA 2F7PA 4K9AA 1WDZA 2YL8A 1UEVA 4WOYA 8ICVA 4M9HA 9ICGA 7ICKA 3D4YA 3I2WA 4HR1B 4PGXA 3ABHA 2BBJA 4IQTA 4UD4A 2OBMA 1VFGA 1GNTA 2IHMA 1ZQNA 4NXWA 2X5CA 1TQTA 4UDYX 3ER9B 4I2IA 3C5FA 7ICOA 3RPMA 2M2VA 3EJSA 5DBCA 3RJGA 5HRKA 8ICMA 5HRHA 3K7DA 4F5RA 8ICKA 1GN9A 5DB6A 4X4OA 1JAJA 3EJPA 3JPQA 2YI8A 3NVOA 4R5GA 2M2TA 8ICOA 4K9BA 9ICNA 4KIKA 4JWMA 2NCZA 2WYHA 3HJ4A 3B53X 4I29A 9ICAA 5DBBA 2Q12A 4AZHA 4NLKA 4WC0A 5HR9A 9ICLA 4NXTA 4XRHA 1YLQA 3OWGA 5D63A 3C2LA 3VEBA 4RWNA 2D1LA 4K8VA 5B3QA 4R63A 3KAVA 4PHAA 4LZGA 5DBAA 3HWTA 3ISBA 4RQ1A 4NLNA 3CVRA 4OAFA 3BUDA 4IM2A 5CFSA 2ISPA 4NXXA 3JPPA 4KLJA 4RWOA 3SOGA 3PLTA 3QNJA 4JN4A 3HAIA 5J2IA 2DR5A 7ICPA 7ICSA 4LZDA 4NSWA 4F5NA 4WC5A 5J0PA 7ICVA 4RQ5A 5IIKA 4E81A 2N3KA 4QZFA 1MIVA 3HIYA 3VEAA 4H8SA 3D4ZA 4FH5A 3I39X 9ICKA 2F7QA 4WC2A 5J0TA 3DPQA 2DRAA 2ZXQA 3BUQA 1R8AA 1ZQZA 8ICAA 2GF4A 3T49A 5F2VO 2ZHAA 2ZH3A 1OA0A 1TQSA 1I49A 4MKPA 5DB9A 3RV0A 4PHEA 2HHPA 3RH6A 5J0RA 3OVSA 2BBHA 1JN3A 5JTGA 2FYVA 3D52A 3V72A 4WBZA 1ZQDA 3Q84A 2RFFA 4NXUA 4ATBB 4O67A 3AQNA 1TV9A 4AZ7A 3MGIA 4O5KA 3LLLA 1ZQWA 3RJJA 2Z0NA 4IQWA 3B0XA 3NKUA 3AQMA 1U00A 4ATBA 3O3OB 4JWCA 1X04A 4AZBA 4GXKA 1GPJA 5D62A 4YMMA 4JL9A 4Z6FA 3OUYB 4K97A 1HUOA 3H38A 3DX0A 1BPYA 4FHVA 1MQ2A 4AT8A 4KLDA 1UETA 3B0YA 2DVIA 4KLLA 4KLUA 9ICQA 5KBPA 9ICJA 4AKVA 4X4SA 1QX1A 2DR9A 5J2FA 2DR7A 4OAGA 5DEDA 3D2EA 4I2FA 3RH4A 5J0XA 1URUA 4F00A 4WPCA 4RWPA 3A98A 1PX5A 5J2GA 2DRBA 4IM0A 4YMNA 4JLCA 1MIWA 3D50A 2F18A 2C08A 9ICMA 8ICWA 3C7NA 2ZH7A 3DDFA 1V4AA 4XJEA 4DO9A 1RPLA 4M47A 4RQ4A 4Z6DA 4UB1A 9ICSA 2PBEA 1F5AA 3JPTA 2Z8YA 2O1PA 2F7OA 5CFTA 5CA7A 3HX0A 3AU6A 1I4TA 4QZIA 4PGQA 4HYBA 4QZDA 4DYLA 4M9JA 4NKUA 5J2BA 2ZHBA 3OHXM 4I2JA 5J2JA 4NKTA 1NOMA 4KLTA 5HHHA 4QZHA 4E3CA 4TUSA 4LEWA 4LEYA 4H6HA 3GI7A 4K4GA 2RAIA 4AZIA 2PMRA 3QNIA 4AZCB 4EZSA 1GNLA 2Q13A 4HX0A 1XSLA 4KIKB 1ZQEA 2B4VA 4LT6A 4RQ7A 4IQUA 7ICRA 3UPSA 4I28A 5DDYA 1I4LA 3ER8C 2ZH1A 3MDAA 4EZQA 4D8JA 4UB5A 4X4VA 1NO5A 4QZ9A 4DOCA 4EEDA 3C2KA 3TFRA 3JYYA 1SU7A 4AZGA 1DKXA 3BUIA 1ZQMA 3EJRA 1ZQYA 8ICBA 3C5GA 3HAJA 2B51A 4DOAA 2FCLA 3HW8A 4P2HA 1OU5A 5CHGA 3JZ0A 2QXLA 1ZQQA 2ZH4A 3NYBA 5CB1A 2BCQA 4I1QA 3K75D 2EX3B 3HAHA 4KLOA 3D2FA 4R64A 2KHOA 4H6IA 4KLIA 2PFQA 2YLLA 4JWNA 2Z0OA 2F1BA 5J2HA 4TUPA 2YI9A 5HHIA 4P4PA 3LK9A 4F5PA 1ZQGA 4P4MA 4G6QA 3H3AA 5J2DA 1ZQIA 2ZH5A 3PNCA 4DOBA 5C5BA 4K96A 4IWQA 4R5JA 2LM0A 3CV5A 4E8FA 2RAKA 4K99A 3ERCC 3HJ1A 4B9QA 4XA5A 2WYIA 4NXVA 4M5DA 2PFNA 1ZQAA 3CK6A 4NLZA 1ZQOA 1R89A 3L3OM 4EZOA 4FHYA 4KLHA 3DX2A 4PO2A 4EBKA 4RQ0A 2EWFA 3AU2A 4AZ5A 4P4OA 5CJ7A 4UDXX 3AUOA 3OUYA 1MQ3A 1JQKA 4KLFA 4WH5A 3L3PA 3M3WA 4S3NA 2ZH6A 4X4RA 5J2CA 1ZYLA 4Z6EA 3WFQE 2HN2A 4UB3A 3UXNA 2BPFA 3EF2A 4JWIA 5D49A 4N7RA 4XQ7A 5IIOA 4PPXA 2OZNB 4M9GA 4AT8B 7ICLA 4EBJA 1WOTA 1TQWA 7ICIA 4YD2A 4DCNC 2YKTA 3L9DA 4IWPA 8ICRA 1KEJA 4EZXA 9ICTA 1R34A 4AT7A 5J29A 5TKYA 3DPPA 2FMQA 2NRKA 4FHXA 3JPRA 2YL6A 3LMFA 4PHPA 5DB8A 4M9LA 8ICTA 3D51A 1QWNA 4JNFA 1TVAA 4QZAA 3C2MA 4NM2A 4NY8A 4WQLA 3CKDA 3AQKA 3V7JA 4WQKA 4X0AA 3OV7A 3RJIA 1ZJNA 4M0MA 5TZVA 4TUQA 3BUPA 1R8BA 2GA9D 9ICCA 4JLZA 3F7WA 4YCXA 4NM1A 2IUBA 4FZOA 4FZPA 4X4PA 4MF8A 4KLQA 4O6AA 1Q79A 9ICPA 2M2UA 2X3XA 3EJUA 1Y2OA 2W9MA 5D61A 1ZQCA 4O68A 3MDCA 3H39A 4R5IA 8ICCA 7ICTA 3BUBA 4WCWA 4F5OA 5J0YA 3UQ2A 2ISOA 4EZRA 5IIIA 1O7DC 5J2KA 2I9GA 3MGHA 4F01A 4KLMA 5DB7A 1E9VA 3BVXA 4AT9A 4I27A 1TFYA 4RT3A 2BPCA 3QWEA 3WFRE 8ICUA 4I0UA 4IQVA 8ICLA 2F1AA 4M9NA 3ISDA 3DX4A 1YWMA 5D46A 5J0QA 3I04A 5CP2A 4AZ6A 4FHWA 4E7XA 4X4QA 2O0I1 1UPXA 3PMLA 3LQCB 4AT9B 4UAWA 2EWRA 4WC4A 3OGUA 3UXPA 3ACOA 3SYVA 4MFCA 3VKHA 4WBYA 1DKZA 1E1DA 1JQRA 4RPZA 1ZJMA 3DX1A 4YD1A 2OBLA 3B52X 4HR1A 4I2AA 4X0BA 2X3WA 9ICHA 4LEZA 1SUFA 4RPYA 3NWIA 9ICIA 5DECA 4MFFA 2V0OA 4EEBA 4UAYA 2YL5A 1ZQPA 4R5KA 4RWQA 3BVVA 3OVAA 3JPSA 2RT6A 1DKYA 2Q66A 2YIAA 3MCRA 1HWWA 8ICYA 4EZTA 4GXIA 3LVTA 2ZH9A 1ZQRA 1W9MA 1BPZA 8ICHA 2GAFD 1R5EA 1TFWA 4UBBA 3O3MB 4YMOA 1RZTA 4I2EA 3T48A 1ZQUA 2M2WA 1TQVA 2RAJA 4Z6CA 3V7KA 4WC3A 2ALWA 5FIGA 4LEVA 4KLGA 4EZPA 2F7RA 4FZSA 5DDMA 1OA1A 4JWDA 4PHDA 8ICFA 3C66A 1UEUA 3T4AG 3RJHA 2LXYA 4IWOA 8ICSA 4QZCA 3Q0KA 4I2GA 4O5CA 7ICJA 3UXOA 3CZNA 3T47A 3RJFA 8ICJA 5EOZA 5J2EA 3EJTA 3BVTA 3ZEDA 1X03A 5CR0A 4XQ8A 1ZQTA 9ICFA 3RH5A 2DR8A 4X4NA 3RV1A 4RQ2A 4M04A 4TURA 4MFAA 1BPXA 2BE3A 1FA0A 4O69A 3DYTA 2Z0VA 2WINM 7ICHA 4UD5A 3KDRA 1TQUA 1BPDA 2MI7A 5HRIA 8ICPA 5FLEX 4EV6A 2P66A
chains in the Genus database with same CATH topology
3DPPA 3I01A 2JNSA 3LMFA 3C7NA 4XJEA 4EZYA 4K9AA 4JNFA 4WOYA 4HR1B 4WQLA 2Z8YA 4IM3A 5CFTA 3T46A 4WQKA 2OBMA 4M0MA 4HYBA 1GNTA 3OHXM 2GA9D 4NXWA 2X5CA 4UDYX 2QFFA 3ER9B 4JLZA 2ND0A 3F7WA 4FO1A 3QA8A 4EZZA 4E3CA 4O6AA 3K7DA 4LEWA 1GN9A 4LEYA 4H6HA 4HY9A 4JLXA 3GI7A 2YI8A 5D61A 4R5GA 4O68A 4EZSA 1GNLA 4R5IA 4K9BA 4KIKA 2NCZA 3B53X 4HX0A 4KIKB 2B4VA 1E2UA 3UITA 4NXTA 3OWGA 4EZRA 5D63A 3VEBA 4F01A 3ER8C 4K8VA 4JNEA 1E9VA 4EZQA 4D8JA 4OAIZ 5B3QA 1OAOA 3KAVA 1SU7A 1DKXA 4JWEA 5CHEA 4R5LA 4IW0A 4OAFA 3I04A 4IM2A 5CFSA 4NXXA 4NPHA 1UPXA 3QNJA 4JN4A 2B51A 2EWRA 2FCLA 3VKHA 1SU8A 2QXLA 1DKZA 1E1DA 2EX3B 3FD9A 3D2FA 4EZVA 2OBLA 1SU6A 2KHOA 3B52X 4HR1A 4E81A 2N3KA 4H6IA 2B56A 5E84A 4OAHA 3VEAA 4LEZA 1SUFA 2YI9A 3I39X 3PHZA 4G6QA 3DPQA 4R5KA 4K96A 2RT6A 1DKYA 4IWQA 5B3PA 3T49A 2YIAA 4R5JA 3MCRA 2LM0A 5CFUA 1OA0A 4EZTA 4K99A 4MKPA 3ERCC 2ND1A 4B9QA 1W9MA 4NXVA 2GAFD 3RV0A 3O3MB 5TKYA 4FM3A 3T48A 3L3OM 5FIGA 4EZOA 4LEVA 4NXUA 4O67A 4PO2A 4EZPA 2EWFA 2PY6A 3NKUA 3KAWA 1OA1A 4JWDA 1U00A 4UDXX 3O3OB 4JWCA 1JQKA 3T4AG 4IWOA 4EZUA 1GPJA 4WH5A 3O3NB 4JL9A 5D62A 4K97A 3T47A 1ZYLA 2YIVX 3ZEDA 4KB6A 4EZWA 2YIBA 3RV1A 3EF2A 4JWIA 4N7RA 3B51X 4O69A 3DPOA 2IHOA 4OAGA 1MJGA 2WINM 3D2EA 4EZNA 4K98A 4IWPA 3KDRA 4F00A 4EZXA 4KM5A 3A98A 5FLEX 4IM0A 4JLCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWG A;  3ER8 C;  2GA9 D;  3ER9 B;  3ERC C;  2GAF D; 
#chains in the Genus database with same CATH topology
 2FMS A;  4YN4 A;  3I01 A;  5J0U A;  2JNS A;  4EZY A;  3DDG A;  1R8C A;  2EFK A;  4BNE A;  4KLS A;  1XSP A;  3CAZ A;  2HN1 A;  2YL9 A;  4NXZ A;  1HUZ A;  4IM3 A;  7ICM A;  5IIL A;  3T46 A;  9ICX A;  1VJ7 A;  4RPX A;  4I2H A;  2OW7 A;  7ICE A;  4LVS A;  1KDH A;  2QFF A;  1HXK A;  4EP7 A;  1ZQB A;  2ND0 A;  5C5B B;  4FO1 A;  2ZH2 A;  3QA8 A;  4EZZ A;  1MIY A;  9ICR A;  5J0O A;  1ZQX A;  3UQ0 A;  5BPC A;  4HY9 A;  4JLX A;  8ICZ A;  4X5V A;  1ZQF A;  3WFO A;  7ICG A;  3WFP A;  9ICE A;  4K4H A;  3PMN A;  2VAN A;  1BPB A;  4WC1 A;  2QKW A;  1Q78 A;  2GWS A;  5J0W A;  5CWR A;  3G9G A;  3BVW A;  2PFP A;  4O5E A;  4FHP A;  1E2U A;  3UIT A;  3UPQ A;  2FIC A;  4R66 A;  3GDX A;  4O9M A;  4OAI Z;  4JNE A;  3H37 A;  3JPN A;  4GXJ A;  4KLE A;  3JCF A;  1OAO A;  2OO2 A;  4I2B A;  1PS3 A;  2D4C A;  4JWE A;  5CHE A;  4R5L A;  4IW0 A;  2BCR A;  3RJK A;  4FH3 A;  4M2Y A;  1LQ7 A;  4NPH A;  4PGY A;  3CZS A;  5BOL A;  4UAZ A;  4ATM A;  1SU8 A;  4UBC A;  7ICQ A;  9ICU A;  4RQ8 A;  3FD9 A;  5IIM A;  1ZQL A;  4EZV A;  4UB2 A;  1SU6 A;  2B56 A;  3C18 A;  4WC7 A;  2JNK A;  5E84 A;  2EFL A;  4OAH A;  7ICF A;  1ZWW A;  3OK8 A;  1ZQJ A;  4AZC A;  1ZQH A;  4M0A A;  3ISC A;  3PHZ A;  4IG8 A;  2ELB A;  5HRE A;  5HRG A;  1R33 A;  8ICE A;  4PH5 A;  5HRF A;  2OW6 A;  7ICN A;  5HRL A;  8ICG A;  1ZQV A;  5B3P A;  4RQ3 A;  4EGW A;  5CFU A;  9ICB A;  2YLA A;  4AVM A;  2ID1 A;  9ICW A;  2ND1 A;  3EJQ A;  3TFS A;  5J0S A;  1BPE A;  4RT2 A;  2BCS A;  3OVB A;  2ZH8 A;  4FM3 A;  2BCU A;  8ICX A;  4K4I A;  3RJE A;  3MBY A;  1KNY A;  4WC6 A;  2PFO A;  7ICU A;  9ICV A;  8ICI A;  5HRB A;  2PY6 A;  4XUS A;  5IIJ A;  3KAW A;  4EZU A;  2X3V A;  3BLB A;  3O3N B;  1QWU A;  5J2A A;  1O7D B;  1I4D A;  4X4U A;  5BOM A;  4E80 A;  4I2C A;  4UB4 A;  8ICN A;  5HRD A;  2YIV X;  4FO6 A;  4I2D A;  2BCV A;  4KB6 A;  4EZW A;  3QE6 A;  4RQ6 A;  1JMS A;  2YIB A;  4X4T A;  1ZQS A;  2PXI A;  3B51 X;  3DX3 A;  4WPE A;  1XSN A;  3DPO A;  2IHO A;  2BPG A;  9ICO A;  1HTY A;  1MJG A;  3BVU A;  3WFS C;  4QZE A;  2FMP A;  4EZN A;  4K98 A;  3V7L A;  5HC9 A;  3JPO A;  4R65 A;  4MF2 A;  4KM5 A;  5D4B A;  1ZQK A;  2O5A A;  5IIN A;  5DKW A;  4F5Q A;  4QZ8 A;  4AT7 B;  3AQL A;  4NQI A;  8ICQ A;  4QZG A;  4QZB A;  2F7P A;  4K9A A;  1WDZ A;  2YL8 A;  1UEV A;  4WOY A;  8ICV A;  4M9H A;  9ICG A;  7ICK A;  3D4Y A;  3I2W A;  4HR1 B;  4PGX A;  3ABH A;  2BBJ A;  4IQT A;  4UD4 A;  2OBM A;  1VFG A;  1GNT A;  2IHM A;  1ZQN A;  4NXW A;  2X5C A;  1TQT A;  4UDY X;  3ER9 B;  4I2I A;  3C5F A;  7ICO A;  3RPM A;  2M2V A;  3EJS A;  5DBC A;  3RJG A;  5HRK A;  8ICM A;  5HRH A;  3K7D A;  4F5R A;  8ICK A;  1GN9 A;  5DB6 A;  4X4O A;  1JAJ A;  3EJP A;  3JPQ A;  2YI8 A;  3NVO A;  4R5G A;  2M2T A;  8ICO A;  4K9B A;  9ICN A;  4KIK A;  4JWM A;  2NCZ A;  2WYH A;  3HJ4 A;  3B53 X;  4I29 A;  9ICA A;  5DBB A;  2Q12 A;  4AZH A;  4NLK A;  4WC0 A;  5HR9 A;  9ICL A;  4NXT A;  4XRH A;  1YLQ A;  3OWG A;  5D63 A;  3C2L A;  3VEB A;  4RWN A;  2D1L A;  4K8V A;  5B3Q A;  4R63 A;  3KAV A;  4PHA A;  4LZG A;  5DBA A;  3HWT A;  3ISB A;  4RQ1 A;  4NLN A;  3CVR A;  4OAF A;  3BUD A;  4IM2 A;  5CFS A;  2ISP A;  4NXX A;  3JPP A;  4KLJ A;  4RWO A;  3SOG A;  3PLT A;  3QNJ A;  4JN4 A;  3HAI A;  5J2I A;  2DR5 A;  7ICP A;  7ICS A;  4LZD A;  4NSW A;  4F5N A;  4WC5 A;  5J0P A;  7ICV A;  4RQ5 A;  5IIK A;  4E81 A;  2N3K A;  4QZF A;  1MIV A;  3HIY A;  3VEA A;  4H8S A;  3D4Z A;  4FH5 A;  3I39 X;  9ICK A;  2F7Q A;  4WC2 A;  5J0T A;  3DPQ A;  2DRA A;  2ZXQ A;  3BUQ A;  1R8A A;  1ZQZ A;  8ICA A;  2GF4 A;  3T49 A;  5F2V O;  2ZHA A;  2ZH3 A;  1OA0 A;  1TQS A;  1I49 A;  4MKP A;  5DB9 A;  3RV0 A;  4PHE A;  2HHP A;  3RH6 A;  5J0R A;  3OVS A;  2BBH A;  1JN3 A;  5JTG A;  2FYV A;  3D52 A;  3V72 A;  4WBZ A;  1ZQD A;  3Q84 A;  2RFF A;  4NXU A;  4ATB B;  4O67 A;  3AQN A;  1TV9 A;  4AZ7 A;  3MGI A;  4O5K A;  3LLL A;  1ZQW A;  3RJJ A;  2Z0N A;  4IQW A;  3B0X A;  3NKU A;  3AQM A;  1U00 A;  4ATB A;  3O3O B;  4JWC A;  1X04 A;  4AZB A;  4GXK A;  1GPJ A;  5D62 A;  4YMM A;  4JL9 A;  4Z6F A;  3OUY B;  4K97 A;  1HUO A;  3H38 A;  3DX0 A;  1BPY A;  4FHV A;  1MQ2 A;  4AT8 A;  4KLD A;  1UET A;  3B0Y A;  2DVI A;  4KLL A;  4KLU A;  9ICQ A;  5KBP A;  9ICJ A;  4AKV A;  4X4S A;  1QX1 A;  2DR9 A;  5J2F A;  2DR7 A;  4OAG A;  5DED A;  3D2E A;  4I2F A;  3RH4 A;  5J0X A;  1URU A;  4F00 A;  4WPC A;  4RWP A;  3A98 A;  1PX5 A;  5J2G A;  2DRB A;  4IM0 A;  4YMN A;  4JLC A;  1MIW A;  3D50 A;  2F18 A;  2C08 A;  9ICM A;  8ICW A;  3C7N A;  2ZH7 A;  3DDF A;  1V4A A;  4XJE A;  4DO9 A;  1RPL A;  4M47 A;  4RQ4 A;  4Z6D A;  4UB1 A;  9ICS A;  2PBE A;  1F5A A;  3JPT A;  2Z8Y A;  2O1P A;  2F7O A;  5CFT A;  5CA7 A;  3HX0 A;  3AU6 A;  1I4T A;  4QZI A;  4PGQ A;  4HYB A;  4QZD A;  4DYL A;  4M9J A;  4NKU A;  5J2B A;  2ZHB A;  3OHX M;  4I2J A;  5J2J A;  4NKT A;  1NOM A;  4KLT A;  5HHH A;  4QZH A;  4E3C A;  4TUS A;  4LEW A;  4LEY A;  4H6H A;  3GI7 A;  4K4G A;  2RAI A;  4AZI A;  2PMR A;  3QNI A;  4AZC B;  4EZS A;  1GNL A;  2Q13 A;  4HX0 A;  1XSL A;  4KIK B;  1ZQE A;  2B4V A;  4LT6 A;  4RQ7 A;  4IQU A;  7ICR A;  3UPS A;  4I28 A;  5DDY A;  1I4L A;  3ER8 C;  2ZH1 A;  3MDA A;  4EZQ A;  4D8J A;  4UB5 A;  4X4V A;  1NO5 A;  4QZ9 A;  4DOC A;  4EED A;  3C2K A;  3TFR A;  3JYY A;  1SU7 A;  4AZG A;  1DKX A;  3BUI A;  1ZQM A;  3EJR A;  1ZQY A;  8ICB A;  3C5G A;  3HAJ A;  2B51 A;  4DOA A;  2FCL A;  3HW8 A;  4P2H A;  1OU5 A;  5CHG A;  3JZ0 A;  2QXL A;  1ZQQ A;  2ZH4 A;  3NYB A;  5CB1 A;  2BCQ A;  4I1Q A;  3K75 D;  2EX3 B;  3HAH A;  4KLO A;  3D2F A;  4R64 A;  2KHO A;  4H6I A;  4KLI A;  2PFQ A;  2YLL A;  4JWN A;  2Z0O A;  2F1B A;  5J2H A;  4TUP A;  2YI9 A;  5HHI A;  4P4P A;  3LK9 A;  4F5P A;  1ZQG A;  4P4M A;  4G6Q A;  3H3A A;  5J2D A;  1ZQI A;  2ZH5 A;  3PNC A;  4DOB A;  5C5B A;  4K96 A;  4IWQ A;  4R5J A;  2LM0 A;  3CV5 A;  4E8F A;  2RAK A;  4K99 A;  3ERC C;  3HJ1 A;  4B9Q A;  4XA5 A;  2WYI A;  4NXV A;  4M5D A;  2PFN A;  1ZQA A;  3CK6 A;  4NLZ A;  1ZQO A;  1R89 A;  3L3O M;  4EZO A;  4FHY A;  4KLH A;  3DX2 A;  4PO2 A;  4EBK A;  4RQ0 A;  2EWF A;  3AU2 A;  4AZ5 A;  4P4O A;  5CJ7 A;  4UDX X;  3AUO A;  3OUY A;  1MQ3 A;  1JQK A;  4KLF A;  4WH5 A;  3L3P A;  3M3W A;  4S3N A;  2ZH6 A;  4X4R A;  5J2C A;  1ZYL A;  4Z6E A;  3WFQ E;  2HN2 A;  4UB3 A;  3UXN A;  2BPF A;  3EF2 A;  4JWI A;  5D49 A;  4N7R A;  4XQ7 A;  5IIO A;  4PPX A;  2OZN B;  4M9G A;  4AT8 B;  7ICL A;  4EBJ A;  1WOT A;  1TQW A;  7ICI A;  4YD2 A;  4DCN C;  2YKT A;  3L9D A;  4IWP A;  8ICR A;  1KEJ A;  4EZX A;  9ICT A;  1R34 A;  4AT7 A;  5J29 A;  5TKY A;  3DPP A;  2FMQ A;  2NRK A;  4FHX A;  3JPR A;  2YL6 A;  3LMF A;  4PHP A;  5DB8 A;  4M9L A;  8ICT A;  3D51 A;  1QWN A;  4JNF A;  1TVA A;  4QZA A;  3C2M A;  4NM2 A;  4NY8 A;  4WQL A;  3CKD A;  3AQK A;  3V7J A;  4WQK A;  4X0A A;  3OV7 A;  3RJI A;  1ZJN A;  4M0M A;  5TZV A;  4TUQ A;  3BUP A;  1R8B A;  2GA9 D;  9ICC A;  4JLZ A;  3F7W A;  4YCX A;  4NM1 A;  2IUB A;  4FZO A;  4FZP A;  4X4P A;  4MF8 A;  4KLQ A;  4O6A A;  1Q79 A;  9ICP A;  2M2U A;  2X3X A;  3EJU A;  1Y2O A;  2W9M A;  5D61 A;  1ZQC A;  4O68 A;  3MDC A;  3H39 A;  4R5I A;  8ICC A;  7ICT A;  3BUB A;  4WCW A;  4F5O A;  5J0Y A;  3UQ2 A;  2ISO A;  4EZR A;  5III A;  1O7D C;  5J2K A;  2I9G A;  3MGH A;  4F01 A;  4KLM A;  5DB7 A;  1E9V A;  3BVX A;  4AT9 A;  4I27 A;  1TFY A;  4RT3 A;  2BPC A;  3QWE A;  3WFR E;  8ICU A;  4I0U A;  4IQV A;  8ICL A;  2F1A A;  4M9N A;  3ISD A;  3DX4 A;  1YWM A;  5D46 A;  5J0Q A;  3I04 A;  5CP2 A;  4AZ6 A;  4FHW A;  4E7X A;  4X4Q A;  2O0I 1;  1UPX A;  3PML A;  3LQC B;  4AT9 B;  4UAW A;  2EWR A;  4WC4 A;  3OGU A;  3UXP A;  3ACO A;  3SYV A;  4MFC A;  3VKH A;  4WBY A;  1DKZ A;  1E1D A;  1JQR A;  4RPZ A;  1ZJM A;  3DX1 A;  4YD1 A;  2OBL A;  3B52 X;  4HR1 A;  4I2A A;  4X0B A;  2X3W A;  9ICH A;  4LEZ A;  1SUF A;  4RPY A;  3NWI A;  9ICI A;  5DEC A;  4MFF A;  2V0O A;  4EEB A;  4UAY A;  2YL5 A;  1ZQP A;  4R5K A;  4RWQ A;  3BVV A;  3OVA A;  3JPS A;  2RT6 A;  1DKY A;  2Q66 A;  2YIA A;  3MCR A;  1HWW A;  8ICY A;  4EZT A;  4GXI A;  3LVT A;  2ZH9 A;  1ZQR A;  1W9M A;  1BPZ A;  8ICH A;  2GAF D;  1R5E A;  1TFW A;  4UBB A;  3O3M B;  4YMO A;  1RZT A;  4I2E A;  3T48 A;  1ZQU A;  2M2W A;  1TQV A;  2RAJ A;  4Z6C A;  3V7K A;  4WC3 A;  2ALW A;  5FIG A;  4LEV A;  4KLG A;  4EZP A;  2F7R A;  4FZS A;  5DDM A;  1OA1 A;  4JWD A;  4PHD A;  8ICF A;  3C66 A;  1UEU A;  3T4A G;  3RJH A;  2LXY A;  4IWO A;  8ICS A;  4QZC A;  3Q0K A;  4I2G A;  4O5C A;  7ICJ A;  3UXO A;  3CZN A;  3T47 A;  3RJF A;  8ICJ A;  5EOZ A;  5J2E A;  3EJT A;  3BVT A;  3ZED A;  1X03 A;  5CR0 A;  4XQ8 A;  1ZQT A;  9ICF A;  3RH5 A;  2DR8 A;  4X4N A;  3RV1 A;  4RQ2 A;  4M04 A;  4TUR A;  4MFA A;  1BPX A;  2BE3 A;  1FA0 A;  4O69 A;  3DYT A;  2Z0V A;  2WIN M;  7ICH A;  4UD5 A;  3KDR A;  1TQU A;  1BPD A;  2MI7 A;  5HRI A;  8ICP A;  5FLE X;  4EV6 A;  2P66 A; 
#chains in the Genus database with same CATH homology
 3DPP A;  3I01 A;  2JNS A;  3LMF A;  3C7N A;  4XJE A;  4EZY A;  4K9A A;  4JNF A;  4WOY A;  4HR1 B;  4WQL A;  2Z8Y A;  4IM3 A;  5CFT A;  3T46 A;  4WQK A;  2OBM A;  4M0M A;  4HYB A;  1GNT A;  3OHX M;  2GA9 D;  4NXW A;  2X5C A;  4UDY X;  2QFF A;  3ER9 B;  4JLZ A;  2ND0 A;  3F7W A;  4FO1 A;  3QA8 A;  4EZZ A;  4E3C A;  4O6A A;  3K7D A;  4LEW A;  1GN9 A;  4LEY A;  4H6H A;  4HY9 A;  4JLX A;  3GI7 A;  2YI8 A;  5D61 A;  4R5G A;  4O68 A;  4EZS A;  1GNL A;  4R5I A;  4K9B A;  4KIK A;  2NCZ A;  3B53 X;  4HX0 A;  4KIK B;  2B4V A;  1E2U A;  3UIT A;  4NXT A;  3OWG A;  4EZR A;  5D63 A;  3VEB A;  4F01 A;  3ER8 C;  4K8V A;  4JNE A;  1E9V A;  4EZQ A;  4D8J A;  4OAI Z;  5B3Q A;  1OAO A;  3KAV A;  1SU7 A;  1DKX A;  4JWE A;  5CHE A;  4R5L A;  4IW0 A;  4OAF A;  3I04 A;  4IM2 A;  5CFS A;  4NXX A;  4NPH A;  1UPX A;  3QNJ A;  4JN4 A;  2B51 A;  2EWR A;  2FCL A;  3VKH A;  1SU8 A;  2QXL A;  1DKZ A;  1E1D A;  2EX3 B;  3FD9 A;  3D2F A;  4EZV A;  2OBL A;  1SU6 A;  2KHO A;  3B52 X;  4HR1 A;  4E81 A;  2N3K A;  4H6I A;  2B56 A;  5E84 A;  4OAH A;  3VEA A;  4LEZ A;  1SUF A;  2YI9 A;  3I39 X;  3PHZ A;  4G6Q A;  3DPQ A;  4R5K A;  4K96 A;  2RT6 A;  1DKY A;  4IWQ A;  5B3P A;  3T49 A;  2YIA A;  4R5J A;  3MCR A;  2LM0 A;  5CFU A;  1OA0 A;  4EZT A;  4K99 A;  4MKP A;  3ERC C;  2ND1 A;  4B9Q A;  1W9M A;  4NXV A;  2GAF D;  3RV0 A;  3O3M B;  5TKY A;  4FM3 A;  3T48 A;  3L3O M;  5FIG A;  4EZO A;  4LEV A;  4NXU A;  4O67 A;  4PO2 A;  4EZP A;  2EWF A;  2PY6 A;  3NKU A;  3KAW A;  1OA1 A;  4JWD A;  1U00 A;  4UDX X;  3O3O B;  4JWC A;  1JQK A;  3T4A G;  4IWO A;  4EZU A;  1GPJ A;  4WH5 A;  3O3N B;  4JL9 A;  5D62 A;  4K97 A;  3T47 A;  1ZYL A;  2YIV X;  3ZED A;  4KB6 A;  4EZW A;  2YIB A;  3RV1 A;  3EF2 A;  4JWI A;  4N7R A;  3B51 X;  4O69 A;  3DPO A;  2IHO A;  4OAG A;  1MJG A;  2WIN M;  3D2E A;  4EZN A;  4K98 A;  4IWP A;  3KDR A;  4F00 A;  4EZX A;  4KM5 A;  3A98 A;  5FLE X;  4IM0 A;  4JLC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...