3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
3ER9B 2GA9D 3OWGA 3ER8C 2GAFD 3ERCC
chains in the Genus database with same CATH superfamily
3ACOA 2D4CA 3WFQE 4AZHA 4EZXA 2M2UA 4M2YA 3JCFA 4UAWA 2EFKA 4GXIA 4I2AA 4X5VA 4NXUA 3HAHA 2F18A 3DPQA 3I04A 3O3NB 4KIKA 4X4NA 4WQKA 4IM2A 8ICYA 4I2JA 4TUSA 2ZH4A 5J2DA 4M9NA 2EX3B 8ICZA 3OVBA 9ICVA 4RPYA 4Z6EA 3NYBA 3WFOA 1SU7A 3RH5A 2FICA 1ZQSA 4WC6A 8ICFA 4AZCB 3CKDA 4KLHA 2BPGA 3C7NA 1ZQIA 1ZQFA 4UAYA 4X4TA 4R5LA 9ICTA 4R5KA 3ZEDA 8ICCA 4MFCA 4I2CA 4K4HA 2Z0OA 4H6IA 9ICHA 7ICIA 3RJFA 8ICAA 2X5CA 4EZRA 1GPJA 3ER8C 4ATBB 3ISCA 4FZSA 4JWNA 3I39X 7ICFA 9ICXA 1OA1A 3DYTA 3C5GA 4PHAA 3ISBA 5J0OA 7ICJA 4X0BA 4G6QA 4EZQA 2YLAA 1SU8A 5EOZA 4HX0A 4WCWA 3RV0A 3UQ0A 5HREA 7ICSA 3TFRA 2BBHA 4WQLA 1VFGA 4EZVA 4MKPA 2WYIA 4AZ7A 7ICGA 2ZH6A 3JPNA 1DKZA 1UEUA 3QNIA 5CWRA 3TFSA 5HRKA 2PFNA 7ICVA 3V7KA 3BVVA 3QE6A 3C18A 3BLBA 5BOMA 4QZ9A 2YIVX 4M0AA 5J2FA 2ZH7A 5E84A 3OUYA 4EBJA 4JLZA 3EJPA 1MIVA 3MDAA 5J2HA 4O6AA 2QXLA 1ZQKA 4KLEA 3MCRA 3CVRA 4HY9A 4YMOA 4O68A 3B52X 4K4IA 3HAJA 3CZNA 3PNCA 4WC3A 1ZQDA 1BPEA 4M47A 3AU6A 1E1DA 5FIGA 9ICJA 4LEZA 3ABHA 2ZHBA 3BUIA 4FZPA 1JN3A 4X0AA 4R66A 3OVAA 4UB1A 1WOTA 1HUOA 4JNEA 2WYHA 4JL9A 2D1LA 3C2KA 2PFQA 5F2VO 4PO2A 5BPCA 4YD2A 4NLNA 4KLUA 4KLGA 2N3KA 8ICUA 8ICKA 3DX1A 7ICNA 4EEDA 4EV6A 4F5NA 4F5QA 1ZQXA 4MFAA 9ICSA 5FLEX 1UPXA 3RV1A 1MQ3A 4EZYA 2BCSA 3EJRA 4D8JA 3JPPA 2BCRA 4I2EA 4JWIA 4QZ8A 3EF2A 2OW6A 4E81A 9ICWA 5CA7A 3ERCC 2C08A 8ICGA 1Y2OA 3V7LA 1HWWA 4NXVA 2X3VA 5CJ7A 9ICUA 4QZDA 4F5PA 3D2FA 3QWEA 4QZAA 4I29A 2ID1A 3RH4A 7ICMA 5D46A 4NXZA 4NPHA 4I2DA 4JWMA 4M0MA 3BUQA 1XSNA 4EZTA 4X4RA 1O7DB 3BVWA 3UXNA 4TUPA 4TURA 5HC9A 8ICHA 7ICLA 1KNYA 2W9MA 5HRGA 2O1PA 4X4SA 4IG8A 4H6HA 3LMFA 8ICPA 2HHPA 4TUQA 4WBYA 3CK6A 3HJ4A 2O5AA 4M5DA 1ZQWA 2B51A 3OGUA 9ICCA 4IWPA 2QFFA 4FH3A 2M2VA 1JAJA 5IIOA 4AT9B 1NO5A 9ICMA 5J0TA 2HN2A 2PY6A 4FM3A 4R5IA 4EGWA 4O69A 1ZQRA 2F1AA 8ICNA 4WC0A 4DCNC 4EEBA 1PS3A 4F5RA 3NVOA 4PGXA 5J2EA 2LXYA 4IM3A 1ZQMA 5IINA 4RQ8A 1URUA 4WBZA 1I4LA 3UITA 4UBCA 3HWTA 4AT8A 5CFTA 1XSPA 4RQ7A 8ICJA 5DB8A 1ZQPA 3VKHA 1ZQUA 3T48A 5J2CA 4RT3A 3C2LA 2EWRA 1BPDA 2PFOA 4PH5A 3Q0KA 4LZGA 4XQ8A 2JNSA 2ZXQA 4H8SA 3HJ1A 4I0UA 2GWSA 2Z8YA 4M9LA 4UBBA 1R8AA 4OAFA 4M9HA 1ZQQA 1YLQA 3RJGA 4RQ5A 4IWOA 1ZQVA 4AZBA 3JPOA 4K96A 2DR9A 2RT6A 1R33A 3UXPA 2PMRA 4PGQA 2FYVA 5DECA 2FMQA 5HRLA 3UPQA 4Z6DA 4I2FA 2ND0A 2FMSA 5HRIA 7ICKA 3T46A 4NXTA 5CB1A 2ZH9A 1XSLA 2F7QA 3K75D 3OHXM 4KB6A 4FHPA 9ICKA 1R8CA 4QZBA 3WFRE 4KLSA 8ICLA 2X3XA 5CHGA 1R34A 5B3PA 2ZH1A 9ICOA 5D61A 5J0RA 4I27A 4PGYA 4E3CA 4PHEA 2BPFA 8ICOA 4XJEA 4FHYA 3OWGA 5D49A 2DVIA 2ISPA 4AZCA 1I49A 2ZH2A 3PMNA 4X4UA 2GAFD 3RJIA 8ICBA 4IQTA 4RQ1A 5IILA 1KEJA 3G9GA 2YI9A 7ICUA 2Z0NA 3BVXA 4Z6FA 3RJHA 2YKTA 4EZWA 4LVSA 3L3OM 4ATBA 2F7OA 2BBJA 2ELBA 4NSWA 4RWNA 9ICGA 4R5GA 1NOMA 2ZHAA 1ZQHA 4P4MA 4F01A 1VJ7A 2RAJA 3AUOA 3C2MA 1BPXA 5J0YA 4RWQA 4LT6A 4QZFA 2RAKA 4JWDA 7ICEA 2ALWA 3SOGA 4WC5A 3BVUA 4YCXA 4FH5A 5C5BB 2RFFA 3DX2A 1JMSA 5JTGA 3UXOA 9ICBA 4QZCA 1TQWA 5J2IA 7ICPA 5BOLA 3MGIA 3ISDA 4K97A 4AT7B 5J0SA 2BCUA 3RJEA 9ICLA 2YLLA 3D51A 4KLLA 2YIBA 3T4AG 1V4AA 4FHVA 4IW0A 5DDMA 3DDFA 3DX0A 3QA8A 1X03A 4R65A 1ZQBA 4UDYX 2NCZA 2Q13A 5HRHA 1TQTA 4RQ3A 3DX4A 3KAVA 4DOCA 4UB5A 4O9MA 1TQUA 4HR1B 1W9MA 2JNKA 4MF8A 4K98A 3OK8A 1JQKA 4AZGA 5DB6A 4YN4A 3VEAA 4IQUA 4IM0A 5DB7A 4WOYA 4BNEA 3B53X 3BUBA 5J2GA 4O5KA 3H38A 1HUZA 8ICXA 5HRBA 4MF2A 2YL9A 1ZJNA 2P66A 2YL8A 5HRDA 1DKXA 3JZ0A 4NKTA 3K7DA 5HHHA 3RJJA 3AQMA 1QX1A 3A98A 4UDXX 2ISOA 4NKUA 3LLLA 4B9QA 5IIJA 2M2TA 3RJKA 1TQSA 1LQ7A 8ICVA 4KLQA 1GN9A 3WFSC 4KIKB 2OBLA 4K9BA 4O67A 3B0YA 4KLJA 4P4OA 4EZUA 4E7XA 4EZNA 3HW8A 4YMNA 4NXXA 5J2BA 3CV5A 3EJUA 5B3QA 4AKVA 5J0QA 3OV7A 4NLKA 3BUPA 4RQ2A 3V7JA 4KM5A 1QWUA 4LEVA 4RQ6A 4K4GA 4R5JA 1TFYA 2DR8A 4DYLA 1I4DA 3GDXA 2F7PA 4NM1A 5J29A 2RAIA 5J2JA 3PMLA 4RQ4A 3KAWA 3PLTA 5DBCA 1YWMA 3FD9A 4IWQA 5HR9A 3UPSA 4FO1A 5HHIA 1Q79A 3T47A 3JPQA 1ZQJA 4P4PA 3JPTA 2NRKA 5J0UA 4KLIA 1ZQEA 1UEVA 5J0WA 1ZWWA 4O5EA 3JPSA 3RH6A 4AVMA 4NQIA 9ICEA 2IUBA 1TV9A 4KLFA 4FHXA 2X3WA 2OO2A 4FHWA 5DB9A 2Q66A 3D2EA 5D62A 1OU5A 1TFWA 9ICAA 5CFUA 4OAGA 3HX0A 4XRHA 4RT2A 8ICEA 1HTYA 5KBPA 3D50A 4WPCA 1GNTA 3D4ZA 4O5CA 1PX5A 5IIKA 4R63A 2OBMA 1MJGA 9ICFA 2PBEA 3OUYB 2BCQA 3NWIA 4AT9A 1QWNA 2DR5A 2F7RA 7ICQA 4RWOA 7ICRA 4NLZA 1JQRA 4S3NA 4FZOA 2ZH5A 2ZH8A 5HRFA 3H39A 5DKWA 3AQNA 8ICWA 3HAIA 1TVAA 4WH5A 2PFPA 4RWPA 3H37A 5CP2A 5TZVA 4F5OA 3C66A 2GA9D 1FA0A 4QZIA 3CAZA 4OAHA 4GXKA 1ZQAA 8ICTA 3OVSA 3GI7A 2EFLA 2OW7A 1ZQTA 4KLTA 3VEBA 4X4PA 2KHOA 2FMPA 1ZQOA 3DPPA 4UB4A 4EZSA 4X4QA 2HN1A 2I9GA 4UAZA 4K9AA 4XA5A 1R5EA 5D4BA 4DOAA 4I28A 1ZYLA 4E80A 2BE3A 4JN4A 2V0OA 2PXIA 4KLMA 1WDZA 4RQ0A 3MDCA 3V72A 1SUFA 1X04A 3DDGA 4I1QA 2IHOA 4UB2A 3HIYA 3LK9A 2YI8A 4PPXA 2YL6A 2Q12A 1BPYA 9ICPA 8ICMA 4JLCA 3T49A 4KLOA 4JNFA 4PHDA 4M9JA 3Q84A 1MQ2A 2M2WA 4K8VA 2WINM 3CZSA 4Z6CA 1Q78A 3AQLA 3SYVA 2EWFA 8ICQA 5DBBA 3DPOA 4LEWA 5CFSA 4NM2A 5DDYA 8ICIA 1SU6A 3M3WA 4JWCA 1R8BA 1R89A 5J0PA 1ZQNA 4WC7A 7ICHA 3EJTA 1OA0A 4P2HA 1BPBA 5CHEA 4UD5A 3O3MB 4MFFA 4LZDA 1ZQCA 9ICQA 3MBYA 3DX3A 1U00A 4E8FA 3MGHA 8ICSA 2LM0A 4WC4A 5TKYA 4QZEA 3AU2A 3B51X 4IQVA 1O7DC 1E9VA 3LVTA 5D63A 4AZIA 3L9DA 4R64A 2B56A 3D52A 4M04A 7ICTA 3EJQA 1MIYA 4OAIZ 4QZHA 2ZH3A 2Z0VA 3ER9B 4WC2A 4HYBA 3F7WA 3I01A 2GF4A 5IIIA 2YL5A 4UB3A 4XQ7A 3JPRA 3EJSA 1ZQLA 2ND1A 3H3AA 4NY8A 1TQVA 2DR7A 7ICOA 1I4TA 4JWEA 3PHZA 3C5FA 2O0I1 3I2WA 4EZZA 3BVTA 5C5BA 5J2AA 4QZGA 4I2BA 3LQCB 9ICNA 4X4OA 4WC1A 2BCVA 1E2UA 2F1BA 2B4VA 4EP7A 1BPZA 1UETA 4N7RA 4AT7A 4LEYA 2MI7A 4RPZA 3L3PA 3QNJA 4EZPA 1ZQGA 2VANA 4WPEA 1ZJMA 1RZTA 3AQKA 4I2IA 4ATMA 2OZNB 1MIWA 5J0XA 3WFPA 5IIMA 4XUSA 2FCLA 4AT8B 4FO6A 1F5AA 2BPCA 4GXJA 2IHMA 4NXWA 5DBAA 5J2KA 1RPLA 4JLXA 4K99A 4DOBA 4I2GA 1ZQZA 4YMMA 4HR1A 3RPMA 4M9GA 3O3OB 4IQWA 4X4VA 4EBKA 4EZOA 4F00A 4UD4A 1GNLA 1DKYA 3D4YA 1HXKA 4AZ6A 1OAOA 2YIAA 4AZ5A 4PHPA 1KDHA 4DO9A 1ZQYA 8ICRA 4RPXA 9ICRA 3JYYA 5DEDA 4YD1A 2DRBA 3B0XA 3BUDA 4I2HA 3KDRA 3UQ2A 2DRAA 3NKUA 2QKWA 4KLDA 9ICIA 5CR0A
chains in the Genus database with same CATH topology
2GA9D 4EZXA 4OAHA 4NPHA 3GI7A 4M0MA 3VEBA 4NXUA 2KHOA 3DPQA 3I04A 3O3NB 4KIKA 4EZTA 4WQKA 4K97A 4IM2A 3DPPA 4EZSA 2EX3B 4K9AA 2YIBA 3T4AG 4H6HA 1SU7A 1ZYLA 3LMFA 4IW0A 4JN4A 3QA8A 4UDYX 2NCZA 3C7NA 1SUFA 4R5LA 2IHOA 4R5KA 3KAVA 2YI8A 3ZEDA 2B51A 4HR1B 1W9MA 4IWPA 4K98A 4JLCA 2QFFA 1JQKA 4H6IA 4JNFA 3T49A 3VEAA 4IM0A 4WOYA 2X5CA 3B53X 2WINM 4EZRA 1GPJA 3ER8C 4K8VA 2EWFA 3I39X 2PY6A 1OA1A 4FM3A 4R5IA 3DPOA 4LEWA 4O69A 5CFSA 1SU6A 4JWCA 4G6QA 4EZQA 1DKXA 1SU8A 3K7DA 4HX0A 1OA0A 3RV0A 4IM3A 5CHEA 3A98A 3O3MB 4UDXX 4WQLA 4EZVA 4MKPA 1U00A 3UITA 4B9QA 1DKZA 2LM0A 5TKYA 5CFTA 1GN9A 3B51X 4KIKB 2OBLA 4K9BA 4O67A 1E9VA 4EZUA 3VKHA 3T48A 5D63A 2YIVX 4EZNA 2EWRA 4NXXA 5E84A 2B56A 4JLZA 5B3QA 2JNSA 4O6AA 2QXLA 2Z8YA 4KM5A 3MCRA 4OAIZ 4HY9A 4OAFA 4LEVA 4O68A 3B52X 4IWOA 4R5JA 4K96A 3ER9B 2RT6A 3F7WA 4HYBA 3I01A 2ND1A 1E1DA 4JWDA 5FIGA 4LEZA 3KAWA 4JWEA 3PHZA 2ND0A 4EZZA 3FD9A 3T46A 4NXTA 4IWQA 4KB6A 4JNEA 3OHXM 4JL9A 1E2UA 2B4VA 4FO1A 5B3PA 4N7RA 3T47A 4PO2A 5D61A 4LEYA 3QNJA 4E3CA 4EZPA 4XJEA 2N3KA 3OWGA 2FCLA 2GAFD 3D2EA 4NXWA 5D62A 5FLEX 4K99A 1UPXA 4JLXA 5CFUA 4OAGA 3RV1A 4EZYA 4HR1A 3O3OB 2YI9A 1GNTA 4EZOA 4F00A 1GNLA 2OBMA 1DKYA 1MJGA 4D8JA 1OAOA 4EZWA 3L3OM 4JWIA 2YIAA 3EF2A 4E81A 4R5GA 3ERCC 4F01A 3KDRA 4NXVA 3NKUA 4WH5A 3D2FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ER9 B;  2GA9 D;  3OWG A;  3ER8 C;  2GAF D;  3ERC C; 
#chains in the Genus database with same CATH topology
 3ACO A;  2D4C A;  3WFQ E;  4AZH A;  4EZX A;  2M2U A;  4M2Y A;  3JCF A;  4UAW A;  2EFK A;  4GXI A;  4I2A A;  4X5V A;  4NXU A;  3HAH A;  2F18 A;  3DPQ A;  3I04 A;  3O3N B;  4KIK A;  4X4N A;  4WQK A;  4IM2 A;  8ICY A;  4I2J A;  4TUS A;  2ZH4 A;  5J2D A;  4M9N A;  2EX3 B;  8ICZ A;  3OVB A;  9ICV A;  4RPY A;  4Z6E A;  3NYB A;  3WFO A;  1SU7 A;  3RH5 A;  2FIC A;  1ZQS A;  4WC6 A;  8ICF A;  4AZC B;  3CKD A;  4KLH A;  2BPG A;  3C7N A;  1ZQI A;  1ZQF A;  4UAY A;  4X4T A;  4R5L A;  9ICT A;  4R5K A;  3ZED A;  8ICC A;  4MFC A;  4I2C A;  4K4H A;  2Z0O A;  4H6I A;  9ICH A;  7ICI A;  3RJF A;  8ICA A;  2X5C A;  4EZR A;  1GPJ A;  3ER8 C;  4ATB B;  3ISC A;  4FZS A;  4JWN A;  3I39 X;  7ICF A;  9ICX A;  1OA1 A;  3DYT A;  3C5G A;  4PHA A;  3ISB A;  5J0O A;  7ICJ A;  4X0B A;  4G6Q A;  4EZQ A;  2YLA A;  1SU8 A;  5EOZ A;  4HX0 A;  4WCW A;  3RV0 A;  3UQ0 A;  5HRE A;  7ICS A;  3TFR A;  2BBH A;  4WQL A;  1VFG A;  4EZV A;  4MKP A;  2WYI A;  4AZ7 A;  7ICG A;  2ZH6 A;  3JPN A;  1DKZ A;  1UEU A;  3QNI A;  5CWR A;  3TFS A;  5HRK A;  2PFN A;  7ICV A;  3V7K A;  3BVV A;  3QE6 A;  3C18 A;  3BLB A;  5BOM A;  4QZ9 A;  2YIV X;  4M0A A;  5J2F A;  2ZH7 A;  5E84 A;  3OUY A;  4EBJ A;  4JLZ A;  3EJP A;  1MIV A;  3MDA A;  5J2H A;  4O6A A;  2QXL A;  1ZQK A;  4KLE A;  3MCR A;  3CVR A;  4HY9 A;  4YMO A;  4O68 A;  3B52 X;  4K4I A;  3HAJ A;  3CZN A;  3PNC A;  4WC3 A;  1ZQD A;  1BPE A;  4M47 A;  3AU6 A;  1E1D A;  5FIG A;  9ICJ A;  4LEZ A;  3ABH A;  2ZHB A;  3BUI A;  4FZP A;  1JN3 A;  4X0A A;  4R66 A;  3OVA A;  4UB1 A;  1WOT A;  1HUO A;  4JNE A;  2WYH A;  4JL9 A;  2D1L A;  3C2K A;  2PFQ A;  5F2V O;  4PO2 A;  5BPC A;  4YD2 A;  4NLN A;  4KLU A;  4KLG A;  2N3K A;  8ICU A;  8ICK A;  3DX1 A;  7ICN A;  4EED A;  4EV6 A;  4F5N A;  4F5Q A;  1ZQX A;  4MFA A;  9ICS A;  5FLE X;  1UPX A;  3RV1 A;  1MQ3 A;  4EZY A;  2BCS A;  3EJR A;  4D8J A;  3JPP A;  2BCR A;  4I2E A;  4JWI A;  4QZ8 A;  3EF2 A;  2OW6 A;  4E81 A;  9ICW A;  5CA7 A;  3ERC C;  2C08 A;  8ICG A;  1Y2O A;  3V7L A;  1HWW A;  4NXV A;  2X3V A;  5CJ7 A;  9ICU A;  4QZD A;  4F5P A;  3D2F A;  3QWE A;  4QZA A;  4I29 A;  2ID1 A;  3RH4 A;  7ICM A;  5D46 A;  4NXZ A;  4NPH A;  4I2D A;  4JWM A;  4M0M A;  3BUQ A;  1XSN A;  4EZT A;  4X4R A;  1O7D B;  3BVW A;  3UXN A;  4TUP A;  4TUR A;  5HC9 A;  8ICH A;  7ICL A;  1KNY A;  2W9M A;  5HRG A;  2O1P A;  4X4S A;  4IG8 A;  4H6H A;  3LMF A;  8ICP A;  2HHP A;  4TUQ A;  4WBY A;  3CK6 A;  3HJ4 A;  2O5A A;  4M5D A;  1ZQW A;  2B51 A;  3OGU A;  9ICC A;  4IWP A;  2QFF A;  4FH3 A;  2M2V A;  1JAJ A;  5IIO A;  4AT9 B;  1NO5 A;  9ICM A;  5J0T A;  2HN2 A;  2PY6 A;  4FM3 A;  4R5I A;  4EGW A;  4O69 A;  1ZQR A;  2F1A A;  8ICN A;  4WC0 A;  4DCN C;  4EEB A;  1PS3 A;  4F5R A;  3NVO A;  4PGX A;  5J2E A;  2LXY A;  4IM3 A;  1ZQM A;  5IIN A;  4RQ8 A;  1URU A;  4WBZ A;  1I4L A;  3UIT A;  4UBC A;  3HWT A;  4AT8 A;  5CFT A;  1XSP A;  4RQ7 A;  8ICJ A;  5DB8 A;  1ZQP A;  3VKH A;  1ZQU A;  3T48 A;  5J2C A;  4RT3 A;  3C2L A;  2EWR A;  1BPD A;  2PFO A;  4PH5 A;  3Q0K A;  4LZG A;  4XQ8 A;  2JNS A;  2ZXQ A;  4H8S A;  3HJ1 A;  4I0U A;  2GWS A;  2Z8Y A;  4M9L A;  4UBB A;  1R8A A;  4OAF A;  4M9H A;  1ZQQ A;  1YLQ A;  3RJG A;  4RQ5 A;  4IWO A;  1ZQV A;  4AZB A;  3JPO A;  4K96 A;  2DR9 A;  2RT6 A;  1R33 A;  3UXP A;  2PMR A;  4PGQ A;  2FYV A;  5DEC A;  2FMQ A;  5HRL A;  3UPQ A;  4Z6D A;  4I2F A;  2ND0 A;  2FMS A;  5HRI A;  7ICK A;  3T46 A;  4NXT A;  5CB1 A;  2ZH9 A;  1XSL A;  2F7Q A;  3K75 D;  3OHX M;  4KB6 A;  4FHP A;  9ICK A;  1R8C A;  4QZB A;  3WFR E;  4KLS A;  8ICL A;  2X3X A;  5CHG A;  1R34 A;  5B3P A;  2ZH1 A;  9ICO A;  5D61 A;  5J0R A;  4I27 A;  4PGY A;  4E3C A;  4PHE A;  2BPF A;  8ICO A;  4XJE A;  4FHY A;  3OWG A;  5D49 A;  2DVI A;  2ISP A;  4AZC A;  1I49 A;  2ZH2 A;  3PMN A;  4X4U A;  2GAF D;  3RJI A;  8ICB A;  4IQT A;  4RQ1 A;  5IIL A;  1KEJ A;  3G9G A;  2YI9 A;  7ICU A;  2Z0N A;  3BVX A;  4Z6F A;  3RJH A;  2YKT A;  4EZW A;  4LVS A;  3L3O M;  4ATB A;  2F7O A;  2BBJ A;  2ELB A;  4NSW A;  4RWN A;  9ICG A;  4R5G A;  1NOM A;  2ZHA A;  1ZQH A;  4P4M A;  4F01 A;  1VJ7 A;  2RAJ A;  3AUO A;  3C2M A;  1BPX A;  5J0Y A;  4RWQ A;  4LT6 A;  4QZF A;  2RAK A;  4JWD A;  7ICE A;  2ALW A;  3SOG A;  4WC5 A;  3BVU A;  4YCX A;  4FH5 A;  5C5B B;  2RFF A;  3DX2 A;  1JMS A;  5JTG A;  3UXO A;  9ICB A;  4QZC A;  1TQW A;  5J2I A;  7ICP A;  5BOL A;  3MGI A;  3ISD A;  4K97 A;  4AT7 B;  5J0S A;  2BCU A;  3RJE A;  9ICL A;  2YLL A;  3D51 A;  4KLL A;  2YIB A;  3T4A G;  1V4A A;  4FHV A;  4IW0 A;  5DDM A;  3DDF A;  3DX0 A;  3QA8 A;  1X03 A;  4R65 A;  1ZQB A;  4UDY X;  2NCZ A;  2Q13 A;  5HRH A;  1TQT A;  4RQ3 A;  3DX4 A;  3KAV A;  4DOC A;  4UB5 A;  4O9M A;  1TQU A;  4HR1 B;  1W9M A;  2JNK A;  4MF8 A;  4K98 A;  3OK8 A;  1JQK A;  4AZG A;  5DB6 A;  4YN4 A;  3VEA A;  4IQU A;  4IM0 A;  5DB7 A;  4WOY A;  4BNE A;  3B53 X;  3BUB A;  5J2G A;  4O5K A;  3H38 A;  1HUZ A;  8ICX A;  5HRB A;  4MF2 A;  2YL9 A;  1ZJN A;  2P66 A;  2YL8 A;  5HRD A;  1DKX A;  3JZ0 A;  4NKT A;  3K7D A;  5HHH A;  3RJJ A;  3AQM A;  1QX1 A;  3A98 A;  4UDX X;  2ISO A;  4NKU A;  3LLL A;  4B9Q A;  5IIJ A;  2M2T A;  3RJK A;  1TQS A;  1LQ7 A;  8ICV A;  4KLQ A;  1GN9 A;  3WFS C;  4KIK B;  2OBL A;  4K9B A;  4O67 A;  3B0Y A;  4KLJ A;  4P4O A;  4EZU A;  4E7X A;  4EZN A;  3HW8 A;  4YMN A;  4NXX A;  5J2B A;  3CV5 A;  3EJU A;  5B3Q A;  4AKV A;  5J0Q A;  3OV7 A;  4NLK A;  3BUP A;  4RQ2 A;  3V7J A;  4KM5 A;  1QWU A;  4LEV A;  4RQ6 A;  4K4G A;  4R5J A;  1TFY A;  2DR8 A;  4DYL A;  1I4D A;  3GDX A;  2F7P A;  4NM1 A;  5J29 A;  2RAI A;  5J2J A;  3PML A;  4RQ4 A;  3KAW A;  3PLT A;  5DBC A;  1YWM A;  3FD9 A;  4IWQ A;  5HR9 A;  3UPS A;  4FO1 A;  5HHI A;  1Q79 A;  3T47 A;  3JPQ A;  1ZQJ A;  4P4P A;  3JPT A;  2NRK A;  5J0U A;  4KLI A;  1ZQE A;  1UEV A;  5J0W A;  1ZWW A;  4O5E A;  3JPS A;  3RH6 A;  4AVM A;  4NQI A;  9ICE A;  2IUB A;  1TV9 A;  4KLF A;  4FHX A;  2X3W A;  2OO2 A;  4FHW A;  5DB9 A;  2Q66 A;  3D2E A;  5D62 A;  1OU5 A;  1TFW A;  9ICA A;  5CFU A;  4OAG A;  3HX0 A;  4XRH A;  4RT2 A;  8ICE A;  1HTY A;  5KBP A;  3D50 A;  4WPC A;  1GNT A;  3D4Z A;  4O5C A;  1PX5 A;  5IIK A;  4R63 A;  2OBM A;  1MJG A;  9ICF A;  2PBE A;  3OUY B;  2BCQ A;  3NWI A;  4AT9 A;  1QWN A;  2DR5 A;  2F7R A;  7ICQ A;  4RWO A;  7ICR A;  4NLZ A;  1JQR A;  4S3N A;  4FZO A;  2ZH5 A;  2ZH8 A;  5HRF A;  3H39 A;  5DKW A;  3AQN A;  8ICW A;  3HAI A;  1TVA A;  4WH5 A;  2PFP A;  4RWP A;  3H37 A;  5CP2 A;  5TZV A;  4F5O A;  3C66 A;  2GA9 D;  1FA0 A;  4QZI A;  3CAZ A;  4OAH A;  4GXK A;  1ZQA A;  8ICT A;  3OVS A;  3GI7 A;  2EFL A;  2OW7 A;  1ZQT A;  4KLT A;  3VEB A;  4X4P A;  2KHO A;  2FMP A;  1ZQO A;  3DPP A;  4UB4 A;  4EZS A;  4X4Q A;  2HN1 A;  2I9G A;  4UAZ A;  4K9A A;  4XA5 A;  1R5E A;  5D4B A;  4DOA A;  4I28 A;  1ZYL A;  4E80 A;  2BE3 A;  4JN4 A;  2V0O A;  2PXI A;  4KLM A;  1WDZ A;  4RQ0 A;  3MDC A;  3V72 A;  1SUF A;  1X04 A;  3DDG A;  4I1Q A;  2IHO A;  4UB2 A;  3HIY A;  3LK9 A;  2YI8 A;  4PPX A;  2YL6 A;  2Q12 A;  1BPY A;  9ICP A;  8ICM A;  4JLC A;  3T49 A;  4KLO A;  4JNF A;  4PHD A;  4M9J A;  3Q84 A;  1MQ2 A;  2M2W A;  4K8V A;  2WIN M;  3CZS A;  4Z6C A;  1Q78 A;  3AQL A;  3SYV A;  2EWF A;  8ICQ A;  5DBB A;  3DPO A;  4LEW A;  5CFS A;  4NM2 A;  5DDY A;  8ICI A;  1SU6 A;  3M3W A;  4JWC A;  1R8B A;  1R89 A;  5J0P A;  1ZQN A;  4WC7 A;  7ICH A;  3EJT A;  1OA0 A;  4P2H A;  1BPB A;  5CHE A;  4UD5 A;  3O3M B;  4MFF A;  4LZD A;  1ZQC A;  9ICQ A;  3MBY A;  3DX3 A;  1U00 A;  4E8F A;  3MGH A;  8ICS A;  2LM0 A;  4WC4 A;  5TKY A;  4QZE A;  3AU2 A;  3B51 X;  4IQV A;  1O7D C;  1E9V A;  3LVT A;  5D63 A;  4AZI A;  3L9D A;  4R64 A;  2B56 A;  3D52 A;  4M04 A;  7ICT A;  3EJQ A;  1MIY A;  4OAI Z;  4QZH A;  2ZH3 A;  2Z0V A;  3ER9 B;  4WC2 A;  4HYB A;  3F7W A;  3I01 A;  2GF4 A;  5III A;  2YL5 A;  4UB3 A;  4XQ7 A;  3JPR A;  3EJS A;  1ZQL A;  2ND1 A;  3H3A A;  4NY8 A;  1TQV A;  2DR7 A;  7ICO A;  1I4T A;  4JWE A;  3PHZ A;  3C5F A;  2O0I 1;  3I2W A;  4EZZ A;  3BVT A;  5C5B A;  5J2A A;  4QZG A;  4I2B A;  3LQC B;  9ICN A;  4X4O A;  4WC1 A;  2BCV A;  1E2U A;  2F1B A;  2B4V A;  4EP7 A;  1BPZ A;  1UET A;  4N7R A;  4AT7 A;  4LEY A;  2MI7 A;  4RPZ A;  3L3P A;  3QNJ A;  4EZP A;  1ZQG A;  2VAN A;  4WPE A;  1ZJM A;  1RZT A;  3AQK A;  4I2I A;  4ATM A;  2OZN B;  1MIW A;  5J0X A;  3WFP A;  5IIM A;  4XUS A;  2FCL A;  4AT8 B;  4FO6 A;  1F5A A;  2BPC A;  4GXJ A;  2IHM A;  4NXW A;  5DBA A;  5J2K A;  1RPL A;  4JLX A;  4K99 A;  4DOB A;  4I2G A;  1ZQZ A;  4YMM A;  4HR1 A;  3RPM A;  4M9G A;  3O3O B;  4IQW A;  4X4V A;  4EBK A;  4EZO A;  4F00 A;  4UD4 A;  1GNL A;  1DKY A;  3D4Y A;  1HXK A;  4AZ6 A;  1OAO A;  2YIA A;  4AZ5 A;  4PHP A;  1KDH A;  4DO9 A;  1ZQY A;  8ICR A;  4RPX A;  9ICR A;  3JYY A;  5DED A;  4YD1 A;  2DRB A;  3B0X A;  3BUD A;  4I2H A;  3KDR A;  3UQ2 A;  2DRA A;  3NKU A;  2QKW A;  4KLD A;  9ICI A;  5CR0 A; 
#chains in the Genus database with same CATH homology
 2GA9 D;  4EZX A;  4OAH A;  4NPH A;  3GI7 A;  4M0M A;  3VEB A;  4NXU A;  2KHO A;  3DPQ A;  3I04 A;  3O3N B;  4KIK A;  4EZT A;  4WQK A;  4K97 A;  4IM2 A;  3DPP A;  4EZS A;  2EX3 B;  4K9A A;  2YIB A;  3T4A G;  4H6H A;  1SU7 A;  1ZYL A;  3LMF A;  4IW0 A;  4JN4 A;  3QA8 A;  4UDY X;  2NCZ A;  3C7N A;  1SUF A;  4R5L A;  2IHO A;  4R5K A;  3KAV A;  2YI8 A;  3ZED A;  2B51 A;  4HR1 B;  1W9M A;  4IWP A;  4K98 A;  4JLC A;  2QFF A;  1JQK A;  4H6I A;  4JNF A;  3T49 A;  3VEA A;  4IM0 A;  4WOY A;  2X5C A;  3B53 X;  2WIN M;  4EZR A;  1GPJ A;  3ER8 C;  4K8V A;  2EWF A;  3I39 X;  2PY6 A;  1OA1 A;  4FM3 A;  4R5I A;  3DPO A;  4LEW A;  4O69 A;  5CFS A;  1SU6 A;  4JWC A;  4G6Q A;  4EZQ A;  1DKX A;  1SU8 A;  3K7D A;  4HX0 A;  1OA0 A;  3RV0 A;  4IM3 A;  5CHE A;  3A98 A;  3O3M B;  4UDX X;  4WQL A;  4EZV A;  4MKP A;  1U00 A;  3UIT A;  4B9Q A;  1DKZ A;  2LM0 A;  5TKY A;  5CFT A;  1GN9 A;  3B51 X;  4KIK B;  2OBL A;  4K9B A;  4O67 A;  1E9V A;  4EZU A;  3VKH A;  3T48 A;  5D63 A;  2YIV X;  4EZN A;  2EWR A;  4NXX A;  5E84 A;  2B56 A;  4JLZ A;  5B3Q A;  2JNS A;  4O6A A;  2QXL A;  2Z8Y A;  4KM5 A;  3MCR A;  4OAI Z;  4HY9 A;  4OAF A;  4LEV A;  4O68 A;  3B52 X;  4IWO A;  4R5J A;  4K96 A;  3ER9 B;  2RT6 A;  3F7W A;  4HYB A;  3I01 A;  2ND1 A;  1E1D A;  4JWD A;  5FIG A;  4LEZ A;  3KAW A;  4JWE A;  3PHZ A;  2ND0 A;  4EZZ A;  3FD9 A;  3T46 A;  4NXT A;  4IWQ A;  4KB6 A;  4JNE A;  3OHX M;  4JL9 A;  1E2U A;  2B4V A;  4FO1 A;  5B3P A;  4N7R A;  3T47 A;  4PO2 A;  5D61 A;  4LEY A;  3QNJ A;  4E3C A;  4EZP A;  4XJE A;  2N3K A;  3OWG A;  2FCL A;  2GAF D;  3D2E A;  4NXW A;  5D62 A;  5FLE X;  4K99 A;  1UPX A;  4JLX A;  5CFU A;  4OAG A;  3RV1 A;  4EZY A;  4HR1 A;  3O3O B;  2YI9 A;  1GNT A;  4EZO A;  4F00 A;  1GNL A;  2OBM A;  1DKY A;  1MJG A;  4D8J A;  1OAO A;  4EZW A;  3L3O M;  4JWI A;  2YIA A;  3EF2 A;  4E81 A;  4R5G A;  3ERC C;  4F01 A;  3KDR A;  4NXV A;  3NKU A;  4WH5 A;  3D2F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...