3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
3ERCC 2GA9D 3ER8C 2GAFD 3OWGA 3ER9B
chains in the Genus database with same CATH superfamily
3T46A 2KHOA 9ICLA 3RV1A 3HAHA 1ZQMA 3T48A 3NVOA 5B3QA 4K4IA 4H6IA 4XA5A 3AQMA 5J2IA 3MDAA 3HAIA 2JNKA 3C2LA 2PMRA 3MDCA 3BUPA 5D49A 4M04A 4AVMA 2WYIA 3MGIA 4KLEA 4N7RA 9ICBA 4PH5A 5J2BA 4H6HA 4HX0A 1OAOA 9ICJA 4O5CA 4UB4A 1O7DB 4G6QA 8ICTA 2RAJA 4AZBA 3DPOA 2RAIA 1YLQA 1TQVA 3MCRA 4O69A 5DECA 5J29A 4KM5A 2ZH2A 4PHEA 2F7OA 3AQLA 3JYYA 9ICKA 3H37A 2OW7A 2BPGA 3JPRA 4IWPA 4FZPA 5IIIA 2P66A 1ZQHA 1F5AA 4WC1A 2BCUA 1TQSA 5HREA 1MIYA 4M9GA 4M2YA 4KB6A 3AUOA 3ISBA 4PO2A 4XQ7A 3EJTA 5J0WA 3WFOA 3UXNA 3LK9A 2YIVX 3B51X 4RWPA 7ICNA 2DR7A 3ISDA 2WINM 3D4ZA 4P4MA 1HXKA 4E81A 5CWRA 4RQ1A 4FM3A 4OAHA 9ICIA 4QZGA 5BOLA 5J2EA 2Q13A 4EZQA 4OAFA 2HHPA 1ZQQA 7ICSA 1ZQXA 4I2HA 4ATBB 1DKZA 4I1QA 5HRHA 4NXUA 1WOTA 3HWTA 1ZQCA 3I39X 4P2HA 2ZXQA 4UD4A 4FHVA 3WFPA 3C7NA 3C2KA 4IQTA 9ICHA 3CV5A 3WFRE 4WH5A 4WQLA 2YIAA 2DRBA 4EBJA 2BCRA 4F5NA 3BVUA 3T49A 1O7DC 5B3PA 4UDYX 1JN3A 2M2VA 5KBPA 4DYLA 3UITA 4RQ6A 4WPCA 1Q78A 4HYBA 1R8BA 8ICGA 4XQ8A 5D46A 1DKYA 5CHEA 4ATBA 4IQUA 3RJKA 5J0XA 5BOMA 4RPXA 7ICHA 1TFWA 2N3KA 3JPPA 4IG8A 4I28A 4FO1A 2PBEA 4AT7B 5HRFA 3SYVA 4Z6CA 3C2MA 4XUSA 3L9DA 2O1PA 4MF2A 4JLCA 2M2UA 4MF8A 3CAZA 4M9NA 5DDYA 5J2CA 3I2WA 4IM0A 8ICOA 4EZUA 4AZGA 4O9MA 4NLNA 1SU7A 1UETA 2YIBA 2ND0A 3JCFA 4S3NA 3FD9A 3V72A 7ICEA 3DX3A 4AZ7A 1XSLA 1QWNA 1MQ2A 3NKUA 4EZZA 4EEDA 3ER9B 3ABHA 4QZEA 1MQ3A 3UPSA 2Z0VA 4WBYA 4MFCA 1ZQRA 2BCSA 1I4TA 4E3CA 4UD5A 8ICLA 3DDGA 3H3AA 1PS3A 5J0RA 2ZH8A 4MFFA 4PGQA 5HRLA 5J2AA 3I01A 3JPNA 4F5RA 4KLMA 1ZQAA 4JWDA 5DBAA 4RQ2A 4O68A 5CFSA 4I2FA 2NCZA 4JWMA 3BUQA 1ZQEA 4M9JA 2I9GA 4UAZA 5CHGA 4RQ4A 8ICJA 4AT9B 4FZSA 1BPXA 3CZNA 4UB2A 2ZH7A 4EZNA 4F01A 4RWQA 1ZQBA 7ICQA 4YMOA 4KLHA 2B51A 2OW6A 2RT6A 2GAFD 1ZWWA 2EFKA 3C18A 4RT3A 4UB1A 3JPSA 4NPHA 2ZH3A 3RJFA 2DR8A 4NXZA 4LVSA 5JTGA 4WC6A 9ICEA 4PGXA 4FHYA 1HUOA 4PHPA 4FHWA 3LVTA 8ICIA 4TUQA 3OVSA 2PFNA 9ICGA 5EOZA 4NXXA 2Z8YA 4LZGA 4K9BA 1R34A 4EZTA 3HJ1A 2ELBA 2YL9A 5IIKA 2EFLA 4D8JA 2V0OA 3L3PA 5DBCA 2X5CA 3CK6A 4JWIA 3WFQE 4AZ6A 3D2FA 4WC2A 1JMSA 5DDMA 3A98A 4GXIA 1ZQWA 1XSPA 1JQKA 1TFYA 7ICKA 2DR9A 2C08A 2D1LA 7ICIA 3MBYA 3UXPA 3RJGA 7ICJA 5DB9A 7ICFA 9ICUA 1YWMA 4LEWA 4X4TA 2ZH1A 4NY8A 1OA1A 5DB6A 4X4UA 2ALWA 3LMFA 2BCVA 1R5EA 1NOMA 1ZQIA 4P4PA 2ZHAA 4K98A 3VEAA 3HAJA 8ICVA 3RJHA 4OAGA 3B53X 3QNJA 4WC5A 8ICEA 4WBZA 9ICVA 2ND1A 2PFPA 4IWQA 1GN9A 4NKTA 3UQ0A 5C5BB 2PFOA 8ICYA 9ICPA 4EZXA 3V7LA 3MGHA 4KLUA 4JNFA 1VJ7A 2VANA 4WC3A 4TURA 4KLGA 8ICFA 1DKXA 9ICWA 5BPCA 5HHIA 3V7KA 3RV0A 8ICAA 2OBLA 1ZJNA 4RQ8A 7ICLA 2BBJA 4I2DA 5J0SA 3PNCA 1E2UA 4K97A 4LEZA 1XSNA 2PXIA 3ER8C 2OBMA 5D61A 1Q79A 5DBBA 1RZTA 4F5PA 1HWWA 4YMMA 3HX0A 3OV7A 5IIMA 8ICWA 1URUA 3AQKA 4TUPA 4LT6A 1TQWA 1ZQNA 4DCNC 8ICUA 9ICNA 3T4AG 4RPZA 8ICMA 2GA9D 4K4HA 5J0QA 4M0AA 4NSWA 2BBHA 4UB5A 5D62A 4I2AA 3WFSC 5HC9A 1SU6A 4EZRA 4RQ0A 4JWNA 3ZEDA 4NXVA 3ACOA 3RJJA 2EX3B 1ZQJA 2ISPA 4WC7A 1MJGA 4QZ9A 5TZVA 4IW0A 5J2GA 4DOAA 5HRDA 3BLBA 3D51A 3RPMA 3K75D 4GXJA 4I2CA 4QZAA 3PHZA 3B52X 1TQUA 3LQCB 4JL9A 1KNYA 4PHAA 5J0TA 4MKPA 3OK8A 2M2TA 3PMNA 2PY6A 4Z6DA 3NWIA 4FHPA 4TUSA 2F1AA 3ISCA 4XJEA 4UAWA 1ZQTA 2PFQA 2ZHBA 2DVIA 7ICGA 2Q66A 2YLLA 3DPQA 5CR0A 1FA0A 8ICZA 4I29A 3OVBA 4EZOA 2RAKA 5CJ7A 4R5KA 4EP7A 5DEDA 3EJSA 1QX1A 5TKYA 3JPTA 4RPYA 1HUZA 9ICTA 4E80A 4LZDA 3QNIA 1ZYLA 3RJEA 3NYBA 2BPFA 3Q0KA 4Z6FA 4KLIA 2EWRA 2IUBA 2OO2A 4M9LA 4KLSA 4X4SA 3C5GA 1VFGA 2D4CA 2QXLA 4WPEA 4AT7A 5IINA 1GNLA 4R5LA 4R5IA 3L3OM 5CA7A 4LEVA 4WC0A 5J2HA 2WYHA 2F7PA 3BVVA 2LXYA 1ZQVA 4EBKA 5FIGA 5J2KA 4QZDA 1BPYA 4M9HA 1JAJA 4AT8B 2FYVA 4P4OA 3T47A 4R64A 1QWUA 3TFSA 4M0MA 2F18A 1E9VA 3RH4A 9ICFA 3C66A 5J0UA 4UAYA 4FH5A 1TVAA 1ZQLA 4EZWA 3BVTA 3F7WA 4X4NA 4IM2A 3CKDA 3LLLA 4I2GA 7ICMA 3V7JA 2F1BA 4UB3A 4KLLA 3B0YA 3C5FA 1WDZA 4EZVA 4AZCB 1GPJA 4YD1A 4E8FA 3BVWA 3O3NB 3O3MB 1U00A 4OAIZ 1BPDA 4HR1B 4YD2A 4X0AA 4RQ5A 3BUIA 4AT9A 1ZQYA 4AT8A 4EEBA 5CB1A 2O5AA 4KLFA 4X4OA 2BPCA 2FMSA 4I0UA 3UPQA 8ICXA 2FICA 2ZH4A 2ZH9A 4F00A 4RWOA 1E1DA 3Q84A 4EZSA 4I2JA 4NM1A 4KLJA 1I4LA 3D4YA 4KIKB 4AZIA 1TV9A 4O6AA 4DOBA 9ICSA 3B0XA 4QZ8A 4JLXA 4UBCA 2FMQA 4AZCA 2ZH6A 4JWCA 4QZHA 4MFAA 4PGYA 3D2EA 1HTYA 3I04A 1PX5A 2MI7A 2M2WA 1ZQKA 3KAVA 4O5EA 3JPOA 4NXWA 4HR1A 2EWFA 4EGWA 4ATMA 4X0BA 7ICUA 4BNEA 3JZ0A 2ID1A 4EV6A 3M3WA 4EZPA 4FH3A 1MIWA 2IHOA 3DDFA 5D63A 9ICMA 4DOCA 2YI9A 1BPBA 3HIYA 1ZQSA 8ICNA 7ICVA 5CFUA 5CFTA 5E84A 1X03A 1ZQUA 5F2VO 3DX2A 3QA8A 4NM2A 2X3XA 4AZHA 1RPLA 4KIKA 2QFFA 3AU2A 4K9AA 4JLZA 9ICQA 1BPZA 1SU8A 1UPXA 1R33A 4AKVA 5CP2A 5DB8A 3DX1A 4HY9A 4R66A 4K4GA 3DX4A 3CVRA 1UEVA 4E7XA 4JN4A 4IM3A 4KLDA 4JNEA 3CZSA 4YCXA 9ICAA 3H39A 3OUYB 4H8SA 3OGUA 1SUFA 1W9MA 2B4VA 3H38A 4Z6EA 3BVXA 3GDXA 4QZCA 2ZH5A 4IQVA 3OWGA 5C5BA 4FHXA 4K96A 2FMPA 4RQ3A 9ICXA 1ZQOA 9ICRA 3KAWA 5IILA 7ICRA 1LQ7A 4DO9A 3ERCC 3DYTA 5J2JA 4QZIA 3SOGA 5HRBA 2YLAA 1I49A 2YL5A 4YN4A 4X4QA 1Y2OA 4NXTA 4M47A 2QKWA 4KLTA 2YL8A 1OU5A 5J0OA 2DR5A 4O67A 4KLQA 4WC4A 1ZQGA 4KLOA 8ICRA 1ZQDA 3G9GA 4PPXA 1UEUA 4O5KA 4I2EA 3OVAA 4X4PA 4NKUA 4K8VA 2BCQA 3D52A 3RH5A 2GWSA 1R8AA 2O0I1 3OUYA 2JNSA 1GNTA 4R63A 5HHHA 5HRKA 4I2BA 1KEJA 3DPPA 2Z0OA 4JWEA 4X4RA 1ZJMA 3PMLA 8ICQA 1BPEA 4FO6A 2OZNB 2W9MA 3OHXM 3EJQA 4B9QA 2B56A 4PHDA 3HW8A 4X4VA 4AZ5A 1R8CA 3KDRA 3RJIA 2HN1A 8ICCA 4NLKA 4I2IA 7ICPA 3RH6A 4F5QA 4RWNA 1TQTA 3HJ4A 4RT2A 2YI8A 1NO5A 5D4BA 2X3VA 5HRIA 3DX0A 1KDHA 7ICOA 5J2FA 5J2DA 5HRGA 3TFRA 4XRHA 1X04A 5FLEX 2NRKA 4EZYA 3VEBA 2RFFA 2ISOA 2FCLA 3D50A 1R89A 4I27A 3GI7A 3PLTA 5J0PA 3QWEA 1OA0A 5J0YA 1ZQFA 1ZQPA 4NLZA 2Z0NA 4QZBA 3UXOA 3AQNA 4K99A 4RQ7A 3JPQA 5IIOA 8ICHA 8ICPA 3O3OB 4WCWA 1ZQZA 4UDXX 4F5OA 4GXKA 2DRAA 1V4AA 4UBBA 2IHMA 1I4DA 3BUDA 2X3WA 1JQRA 5DB7A 4FZOA 2F7RA 3EJRA 3VKHA 3UQ2A 2YKTA 4IQWA 4R5JA 4R65A 7ICTA 9ICOA 2YL6A 8ICKA 8ICBA 4LEYA 9ICCA 2LM0A 3QE6A 4NQIA 4QZFA 3K7DA 4IWOA 2GF4A 3EJPA 1MIVA 3AU6A 4WQKA 8ICSA 4YMNA 2F7QA 2Q12A 3BUBA 3EJUA 5DKWA 4R5GA 5HR9A 3EF2A 5IIJA 2HN2A 4WOYA 4M5DA 4X5VA 2BE3A
chains in the Genus database with same CATH topology
3T46A 4JLZA 2KHOA 1SU6A 4EZRA 3ZEDA 1SU8A 3RV1A 4NXVA 1UPXA 3T48A 5B3QA 4H6IA 4E3CA 2EX3B 1MJGA 4HY9A 4IW0A 3I01A 4JN4A 3PHZA 3B52X 4IM3A 4JWDA 4O68A 4JNEA 5CFSA 2NCZA 4JL9A 4N7RA 4H6HA 4MKPA 4HX0A 1OAOA 2PY6A 1SUFA 1W9MA 2B4VA 4XJEA 4EZNA 3OWGA 4G6QA 4K96A 4F01A 3DPQA 4KIKA 3KAWA 3DPOA 4O69A 3MCRA 4EZOA 3ERCC 2B51A 4KM5A 2RT6A 4R5KA 2GAFD 5TKYA 4NPHA 4OAIZ 1ZYLA 4IWPA 4NXTA 2EWRA 4O67A 4KB6A 2QXLA 4NXXA 4PO2A 1GNLA 4R5LA 2Z8YA 4K8VA 4R5IA 3L3OM 4K9BA 2YIVX 2JNSA 1GNTA 3B51X 4EZTA 4LEVA 2WINM 3DPPA 4JWEA 4D8JA 2X5CA 5FIGA 4E81A 4JWIA 3D2FA 3OHXM 3T47A 4B9QA 2B56A 3A98A 4FM3A 4OAHA 1JQKA 3KDRA 4EZQA 4M0MA 4OAFA 1E9VA 4EZWA 3F7WA 4IM2A 4LEWA 2YI8A 1DKZA 1OA1A 4NXUA 4EZVA 3I39X 3LMFA 1GPJA 4K98A 3O3NB 3O3MB 1U00A 5FLEX 3VEAA 4HR1B 4EZYA 3VEBA 4OAGA 3B53X 3C7NA 3QNJA 2FCLA 3GI7A 2ND1A 4IWQA 1GN9A 4WH5A 1OA0A 2YIAA 4WQLA 4EZXA 3T49A 4K99A 5B3PA 4UDYX 4JNFA 3O3OB 1DKXA 4UDXX 3UITA 4F00A 1E1DA 4EZSA 4HYBA 3RV0A 4KIKB 2OBLA 4O6AA 1DKYA 5CHEA 4JLXA 3VKHA 1E2UA 4K97A 4LEZA 2N3KA 4JWCA 4R5JA 4FO1A 3D2EA 3I04A 3KAVA 3ER8C 2OBMA 2LM0A 4NXWA 4HR1A 2EWFA 4JLCA 5D61A 4LEYA 3K7DA 4EZPA 4IWOA 2IHOA 5D63A 4WQKA 4IM0A 2YI9A 4EZUA 5CFUA 5CFTA 1SU7A 5E84A 2YIBA 2ND0A 3FD9A 3T4AG 4R5GA 2GA9D 3EF2A 4WOYA 3QA8A 3NKUA 4EZZA 3ER9B 5D62A 2QFFA 4K9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERC C;  2GA9 D;  3ER8 C;  2GAF D;  3OWG A;  3ER9 B; 
#chains in the Genus database with same CATH topology
 3T46 A;  2KHO A;  9ICL A;  3RV1 A;  3HAH A;  1ZQM A;  3T48 A;  3NVO A;  5B3Q A;  4K4I A;  4H6I A;  4XA5 A;  3AQM A;  5J2I A;  3MDA A;  3HAI A;  2JNK A;  3C2L A;  2PMR A;  3MDC A;  3BUP A;  5D49 A;  4M04 A;  4AVM A;  2WYI A;  3MGI A;  4KLE A;  4N7R A;  9ICB A;  4PH5 A;  5J2B A;  4H6H A;  4HX0 A;  1OAO A;  9ICJ A;  4O5C A;  4UB4 A;  1O7D B;  4G6Q A;  8ICT A;  2RAJ A;  4AZB A;  3DPO A;  2RAI A;  1YLQ A;  1TQV A;  3MCR A;  4O69 A;  5DEC A;  5J29 A;  4KM5 A;  2ZH2 A;  4PHE A;  2F7O A;  3AQL A;  3JYY A;  9ICK A;  3H37 A;  2OW7 A;  2BPG A;  3JPR A;  4IWP A;  4FZP A;  5III A;  2P66 A;  1ZQH A;  1F5A A;  4WC1 A;  2BCU A;  1TQS A;  5HRE A;  1MIY A;  4M9G A;  4M2Y A;  4KB6 A;  3AUO A;  3ISB A;  4PO2 A;  4XQ7 A;  3EJT A;  5J0W A;  3WFO A;  3UXN A;  3LK9 A;  2YIV X;  3B51 X;  4RWP A;  7ICN A;  2DR7 A;  3ISD A;  2WIN M;  3D4Z A;  4P4M A;  1HXK A;  4E81 A;  5CWR A;  4RQ1 A;  4FM3 A;  4OAH A;  9ICI A;  4QZG A;  5BOL A;  5J2E A;  2Q13 A;  4EZQ A;  4OAF A;  2HHP A;  1ZQQ A;  7ICS A;  1ZQX A;  4I2H A;  4ATB B;  1DKZ A;  4I1Q A;  5HRH A;  4NXU A;  1WOT A;  3HWT A;  1ZQC A;  3I39 X;  4P2H A;  2ZXQ A;  4UD4 A;  4FHV A;  3WFP A;  3C7N A;  3C2K A;  4IQT A;  9ICH A;  3CV5 A;  3WFR E;  4WH5 A;  4WQL A;  2YIA A;  2DRB A;  4EBJ A;  2BCR A;  4F5N A;  3BVU A;  3T49 A;  1O7D C;  5B3P A;  4UDY X;  1JN3 A;  2M2V A;  5KBP A;  4DYL A;  3UIT A;  4RQ6 A;  4WPC A;  1Q78 A;  4HYB A;  1R8B A;  8ICG A;  4XQ8 A;  5D46 A;  1DKY A;  5CHE A;  4ATB A;  4IQU A;  3RJK A;  5J0X A;  5BOM A;  4RPX A;  7ICH A;  1TFW A;  2N3K A;  3JPP A;  4IG8 A;  4I28 A;  4FO1 A;  2PBE A;  4AT7 B;  5HRF A;  3SYV A;  4Z6C A;  3C2M A;  4XUS A;  3L9D A;  2O1P A;  4MF2 A;  4JLC A;  2M2U A;  4MF8 A;  3CAZ A;  4M9N A;  5DDY A;  5J2C A;  3I2W A;  4IM0 A;  8ICO A;  4EZU A;  4AZG A;  4O9M A;  4NLN A;  1SU7 A;  1UET A;  2YIB A;  2ND0 A;  3JCF A;  4S3N A;  3FD9 A;  3V72 A;  7ICE A;  3DX3 A;  4AZ7 A;  1XSL A;  1QWN A;  1MQ2 A;  3NKU A;  4EZZ A;  4EED A;  3ER9 B;  3ABH A;  4QZE A;  1MQ3 A;  3UPS A;  2Z0V A;  4WBY A;  4MFC A;  1ZQR A;  2BCS A;  1I4T A;  4E3C A;  4UD5 A;  8ICL A;  3DDG A;  3H3A A;  1PS3 A;  5J0R A;  2ZH8 A;  4MFF A;  4PGQ A;  5HRL A;  5J2A A;  3I01 A;  3JPN A;  4F5R A;  4KLM A;  1ZQA A;  4JWD A;  5DBA A;  4RQ2 A;  4O68 A;  5CFS A;  4I2F A;  2NCZ A;  4JWM A;  3BUQ A;  1ZQE A;  4M9J A;  2I9G A;  4UAZ A;  5CHG A;  4RQ4 A;  8ICJ A;  4AT9 B;  4FZS A;  1BPX A;  3CZN A;  4UB2 A;  2ZH7 A;  4EZN A;  4F01 A;  4RWQ A;  1ZQB A;  7ICQ A;  4YMO A;  4KLH A;  2B51 A;  2OW6 A;  2RT6 A;  2GAF D;  1ZWW A;  2EFK A;  3C18 A;  4RT3 A;  4UB1 A;  3JPS A;  4NPH A;  2ZH3 A;  3RJF A;  2DR8 A;  4NXZ A;  4LVS A;  5JTG A;  4WC6 A;  9ICE A;  4PGX A;  4FHY A;  1HUO A;  4PHP A;  4FHW A;  3LVT A;  8ICI A;  4TUQ A;  3OVS A;  2PFN A;  9ICG A;  5EOZ A;  4NXX A;  2Z8Y A;  4LZG A;  4K9B A;  1R34 A;  4EZT A;  3HJ1 A;  2ELB A;  2YL9 A;  5IIK A;  2EFL A;  4D8J A;  2V0O A;  3L3P A;  5DBC A;  2X5C A;  3CK6 A;  4JWI A;  3WFQ E;  4AZ6 A;  3D2F A;  4WC2 A;  1JMS A;  5DDM A;  3A98 A;  4GXI A;  1ZQW A;  1XSP A;  1JQK A;  1TFY A;  7ICK A;  2DR9 A;  2C08 A;  2D1L A;  7ICI A;  3MBY A;  3UXP A;  3RJG A;  7ICJ A;  5DB9 A;  7ICF A;  9ICU A;  1YWM A;  4LEW A;  4X4T A;  2ZH1 A;  4NY8 A;  1OA1 A;  5DB6 A;  4X4U A;  2ALW A;  3LMF A;  2BCV A;  1R5E A;  1NOM A;  1ZQI A;  4P4P A;  2ZHA A;  4K98 A;  3VEA A;  3HAJ A;  8ICV A;  3RJH A;  4OAG A;  3B53 X;  3QNJ A;  4WC5 A;  8ICE A;  4WBZ A;  9ICV A;  2ND1 A;  2PFP A;  4IWQ A;  1GN9 A;  4NKT A;  3UQ0 A;  5C5B B;  2PFO A;  8ICY A;  9ICP A;  4EZX A;  3V7L A;  3MGH A;  4KLU A;  4JNF A;  1VJ7 A;  2VAN A;  4WC3 A;  4TUR A;  4KLG A;  8ICF A;  1DKX A;  9ICW A;  5BPC A;  5HHI A;  3V7K A;  3RV0 A;  8ICA A;  2OBL A;  1ZJN A;  4RQ8 A;  7ICL A;  2BBJ A;  4I2D A;  5J0S A;  3PNC A;  1E2U A;  4K97 A;  4LEZ A;  1XSN A;  2PXI A;  3ER8 C;  2OBM A;  5D61 A;  1Q79 A;  5DBB A;  1RZT A;  4F5P A;  1HWW A;  4YMM A;  3HX0 A;  3OV7 A;  5IIM A;  8ICW A;  1URU A;  3AQK A;  4TUP A;  4LT6 A;  1TQW A;  1ZQN A;  4DCN C;  8ICU A;  9ICN A;  3T4A G;  4RPZ A;  8ICM A;  2GA9 D;  4K4H A;  5J0Q A;  4M0A A;  4NSW A;  2BBH A;  4UB5 A;  5D62 A;  4I2A A;  3WFS C;  5HC9 A;  1SU6 A;  4EZR A;  4RQ0 A;  4JWN A;  3ZED A;  4NXV A;  3ACO A;  3RJJ A;  2EX3 B;  1ZQJ A;  2ISP A;  4WC7 A;  1MJG A;  4QZ9 A;  5TZV A;  4IW0 A;  5J2G A;  4DOA A;  5HRD A;  3BLB A;  3D51 A;  3RPM A;  3K75 D;  4GXJ A;  4I2C A;  4QZA A;  3PHZ A;  3B52 X;  1TQU A;  3LQC B;  4JL9 A;  1KNY A;  4PHA A;  5J0T A;  4MKP A;  3OK8 A;  2M2T A;  3PMN A;  2PY6 A;  4Z6D A;  3NWI A;  4FHP A;  4TUS A;  2F1A A;  3ISC A;  4XJE A;  4UAW A;  1ZQT A;  2PFQ A;  2ZHB A;  2DVI A;  7ICG A;  2Q66 A;  2YLL A;  3DPQ A;  5CR0 A;  1FA0 A;  8ICZ A;  4I29 A;  3OVB A;  4EZO A;  2RAK A;  5CJ7 A;  4R5K A;  4EP7 A;  5DED A;  3EJS A;  1QX1 A;  5TKY A;  3JPT A;  4RPY A;  1HUZ A;  9ICT A;  4E80 A;  4LZD A;  3QNI A;  1ZYL A;  3RJE A;  3NYB A;  2BPF A;  3Q0K A;  4Z6F A;  4KLI A;  2EWR A;  2IUB A;  2OO2 A;  4M9L A;  4KLS A;  4X4S A;  3C5G A;  1VFG A;  2D4C A;  2QXL A;  4WPE A;  4AT7 A;  5IIN A;  1GNL A;  4R5L A;  4R5I A;  3L3O M;  5CA7 A;  4LEV A;  4WC0 A;  5J2H A;  2WYH A;  2F7P A;  3BVV A;  2LXY A;  1ZQV A;  4EBK A;  5FIG A;  5J2K A;  4QZD A;  1BPY A;  4M9H A;  1JAJ A;  4AT8 B;  2FYV A;  4P4O A;  3T47 A;  4R64 A;  1QWU A;  3TFS A;  4M0M A;  2F18 A;  1E9V A;  3RH4 A;  9ICF A;  3C66 A;  5J0U A;  4UAY A;  4FH5 A;  1TVA A;  1ZQL A;  4EZW A;  3BVT A;  3F7W A;  4X4N A;  4IM2 A;  3CKD A;  3LLL A;  4I2G A;  7ICM A;  3V7J A;  2F1B A;  4UB3 A;  4KLL A;  3B0Y A;  3C5F A;  1WDZ A;  4EZV A;  4AZC B;  1GPJ A;  4YD1 A;  4E8F A;  3BVW A;  3O3N B;  3O3M B;  1U00 A;  4OAI Z;  1BPD A;  4HR1 B;  4YD2 A;  4X0A A;  4RQ5 A;  3BUI A;  4AT9 A;  1ZQY A;  4AT8 A;  4EEB A;  5CB1 A;  2O5A A;  4KLF A;  4X4O A;  2BPC A;  2FMS A;  4I0U A;  3UPQ A;  8ICX A;  2FIC A;  2ZH4 A;  2ZH9 A;  4F00 A;  4RWO A;  1E1D A;  3Q84 A;  4EZS A;  4I2J A;  4NM1 A;  4KLJ A;  1I4L A;  3D4Y A;  4KIK B;  4AZI A;  1TV9 A;  4O6A A;  4DOB A;  9ICS A;  3B0X A;  4QZ8 A;  4JLX A;  4UBC A;  2FMQ A;  4AZC A;  2ZH6 A;  4JWC A;  4QZH A;  4MFA A;  4PGY A;  3D2E A;  1HTY A;  3I04 A;  1PX5 A;  2MI7 A;  2M2W A;  1ZQK A;  3KAV A;  4O5E A;  3JPO A;  4NXW A;  4HR1 A;  2EWF A;  4EGW A;  4ATM A;  4X0B A;  7ICU A;  4BNE A;  3JZ0 A;  2ID1 A;  4EV6 A;  3M3W A;  4EZP A;  4FH3 A;  1MIW A;  2IHO A;  3DDF A;  5D63 A;  9ICM A;  4DOC A;  2YI9 A;  1BPB A;  3HIY A;  1ZQS A;  8ICN A;  7ICV A;  5CFU A;  5CFT A;  5E84 A;  1X03 A;  1ZQU A;  5F2V O;  3DX2 A;  3QA8 A;  4NM2 A;  2X3X A;  4AZH A;  1RPL A;  4KIK A;  2QFF A;  3AU2 A;  4K9A A;  4JLZ A;  9ICQ A;  1BPZ A;  1SU8 A;  1UPX A;  1R33 A;  4AKV A;  5CP2 A;  5DB8 A;  3DX1 A;  4HY9 A;  4R66 A;  4K4G A;  3DX4 A;  3CVR A;  1UEV A;  4E7X A;  4JN4 A;  4IM3 A;  4KLD A;  4JNE A;  3CZS A;  4YCX A;  9ICA A;  3H39 A;  3OUY B;  4H8S A;  3OGU A;  1SUF A;  1W9M A;  2B4V A;  3H38 A;  4Z6E A;  3BVX A;  3GDX A;  4QZC A;  2ZH5 A;  4IQV A;  3OWG A;  5C5B A;  4FHX A;  4K96 A;  2FMP A;  4RQ3 A;  9ICX A;  1ZQO A;  9ICR A;  3KAW A;  5IIL A;  7ICR A;  1LQ7 A;  4DO9 A;  3ERC C;  3DYT A;  5J2J A;  4QZI A;  3SOG A;  5HRB A;  2YLA A;  1I49 A;  2YL5 A;  4YN4 A;  4X4Q A;  1Y2O A;  4NXT A;  4M47 A;  2QKW A;  4KLT A;  2YL8 A;  1OU5 A;  5J0O A;  2DR5 A;  4O67 A;  4KLQ A;  4WC4 A;  1ZQG A;  4KLO A;  8ICR A;  1ZQD A;  3G9G A;  4PPX A;  1UEU A;  4O5K A;  4I2E A;  3OVA A;  4X4P A;  4NKU A;  4K8V A;  2BCQ A;  3D52 A;  3RH5 A;  2GWS A;  1R8A A;  2O0I 1;  3OUY A;  2JNS A;  1GNT A;  4R63 A;  5HHH A;  5HRK A;  4I2B A;  1KEJ A;  3DPP A;  2Z0O A;  4JWE A;  4X4R A;  1ZJM A;  3PML A;  8ICQ A;  1BPE A;  4FO6 A;  2OZN B;  2W9M A;  3OHX M;  3EJQ A;  4B9Q A;  2B56 A;  4PHD A;  3HW8 A;  4X4V A;  4AZ5 A;  1R8C A;  3KDR A;  3RJI A;  2HN1 A;  8ICC A;  4NLK A;  4I2I A;  7ICP A;  3RH6 A;  4F5Q A;  4RWN A;  1TQT A;  3HJ4 A;  4RT2 A;  2YI8 A;  1NO5 A;  5D4B A;  2X3V A;  5HRI A;  3DX0 A;  1KDH A;  7ICO A;  5J2F A;  5J2D A;  5HRG A;  3TFR A;  4XRH A;  1X04 A;  5FLE X;  2NRK A;  4EZY A;  3VEB A;  2RFF A;  2ISO A;  2FCL A;  3D50 A;  1R89 A;  4I27 A;  3GI7 A;  3PLT A;  5J0P A;  3QWE A;  1OA0 A;  5J0Y A;  1ZQF A;  1ZQP A;  4NLZ A;  2Z0N A;  4QZB A;  3UXO A;  3AQN A;  4K99 A;  4RQ7 A;  3JPQ A;  5IIO A;  8ICH A;  8ICP A;  3O3O B;  4WCW A;  1ZQZ A;  4UDX X;  4F5O A;  4GXK A;  2DRA A;  1V4A A;  4UBB A;  2IHM A;  1I4D A;  3BUD A;  2X3W A;  1JQR A;  5DB7 A;  4FZO A;  2F7R A;  3EJR A;  3VKH A;  3UQ2 A;  2YKT A;  4IQW A;  4R5J A;  4R65 A;  7ICT A;  9ICO A;  2YL6 A;  8ICK A;  8ICB A;  4LEY A;  9ICC A;  2LM0 A;  3QE6 A;  4NQI A;  4QZF A;  3K7D A;  4IWO A;  2GF4 A;  3EJP A;  1MIV A;  3AU6 A;  4WQK A;  8ICS A;  4YMN A;  2F7Q A;  2Q12 A;  3BUB A;  3EJU A;  5DKW A;  4R5G A;  5HR9 A;  3EF2 A;  5IIJ A;  2HN2 A;  4WOY A;  4M5D A;  4X5V A;  2BE3 A; 
#chains in the Genus database with same CATH homology
 3T46 A;  4JLZ A;  2KHO A;  1SU6 A;  4EZR A;  3ZED A;  1SU8 A;  3RV1 A;  4NXV A;  1UPX A;  3T48 A;  5B3Q A;  4H6I A;  4E3C A;  2EX3 B;  1MJG A;  4HY9 A;  4IW0 A;  3I01 A;  4JN4 A;  3PHZ A;  3B52 X;  4IM3 A;  4JWD A;  4O68 A;  4JNE A;  5CFS A;  2NCZ A;  4JL9 A;  4N7R A;  4H6H A;  4MKP A;  4HX0 A;  1OAO A;  2PY6 A;  1SUF A;  1W9M A;  2B4V A;  4XJE A;  4EZN A;  3OWG A;  4G6Q A;  4K96 A;  4F01 A;  3DPQ A;  4KIK A;  3KAW A;  3DPO A;  4O69 A;  3MCR A;  4EZO A;  3ERC C;  2B51 A;  4KM5 A;  2RT6 A;  4R5K A;  2GAF D;  5TKY A;  4NPH A;  4OAI Z;  1ZYL A;  4IWP A;  4NXT A;  2EWR A;  4O67 A;  4KB6 A;  2QXL A;  4NXX A;  4PO2 A;  1GNL A;  4R5L A;  2Z8Y A;  4K8V A;  4R5I A;  3L3O M;  4K9B A;  2YIV X;  2JNS A;  1GNT A;  3B51 X;  4EZT A;  4LEV A;  2WIN M;  3DPP A;  4JWE A;  4D8J A;  2X5C A;  5FIG A;  4E81 A;  4JWI A;  3D2F A;  3OHX M;  3T47 A;  4B9Q A;  2B56 A;  3A98 A;  4FM3 A;  4OAH A;  1JQK A;  3KDR A;  4EZQ A;  4M0M A;  4OAF A;  1E9V A;  4EZW A;  3F7W A;  4IM2 A;  4LEW A;  2YI8 A;  1DKZ A;  1OA1 A;  4NXU A;  4EZV A;  3I39 X;  3LMF A;  1GPJ A;  4K98 A;  3O3N B;  3O3M B;  1U00 A;  5FLE X;  3VEA A;  4HR1 B;  4EZY A;  3VEB A;  4OAG A;  3B53 X;  3C7N A;  3QNJ A;  2FCL A;  3GI7 A;  2ND1 A;  4IWQ A;  1GN9 A;  4WH5 A;  1OA0 A;  2YIA A;  4WQL A;  4EZX A;  3T49 A;  4K99 A;  5B3P A;  4UDY X;  4JNF A;  3O3O B;  1DKX A;  4UDX X;  3UIT A;  4F00 A;  1E1D A;  4EZS A;  4HYB A;  3RV0 A;  4KIK B;  2OBL A;  4O6A A;  1DKY A;  5CHE A;  4JLX A;  3VKH A;  1E2U A;  4K97 A;  4LEZ A;  2N3K A;  4JWC A;  4R5J A;  4FO1 A;  3D2E A;  3I04 A;  3KAV A;  3ER8 C;  2OBM A;  2LM0 A;  4NXW A;  4HR1 A;  2EWF A;  4JLC A;  5D61 A;  4LEY A;  3K7D A;  4EZP A;  4IWO A;  2IHO A;  5D63 A;  4WQK A;  4IM0 A;  2YI9 A;  4EZU A;  5CFU A;  5CFT A;  1SU7 A;  5E84 A;  2YIB A;  2ND0 A;  3FD9 A;  3T4A G;  4R5G A;  2GA9 D;  3EF2 A;  4WOY A;  3QA8 A;  3NKU A;  4EZZ A;  3ER9 B;  5D62 A;  2QFF A;  4K9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...