3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
b'NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
2GAFD 2GA9D 3ERCC 3ER9B 3ER8C 3OWGA
chains in the Genus database with same CATH superfamily
4NXZA 5J0RA 3RJEA 4PGYA 3RV0A 5J2BA 1I4DA 7ICKA 4RWPA 3RJIA 3I39X 4JNEA 5HRHA 4NM2A 1DKXA 3VKHA 4F5RA 5D49A 1ZQKA 3JPRA 5DB9A 3JYYA 8ICUA 3LVTA 1OA1A 3GI7A 2ELBA 4ATMA 4RT3A 3JPQA 3BUIA 5J2JA 2BCUA 3L3OM 5J0YA 3ISBA 2ISPA 4O5KA 3WFOA 4NXTA 2RAJA 4XQ8A 3OK8A 4YMMA 3DX3A 4IM2A 2DR8A 8ICOA 8ICFA 4JWDA 1TQTA 1BPZA 5IIOA 4XUSA 9ICNA 4IQWA 3K75D 4WC3A 2I9GA 5J2HA 4AT7B 8ICGA 1ZYLA 4EZQA 2OO2A 2OW6A 4AT8A 1HUOA 5C5BA 9ICUA 3D50A 4AZCB 4OAHA 4IQVA 4X4RA 4NKUA 4EGWA 3O3NB 1ZQWA 4RQ8A 3ER9B 1WOTA 4YD2A 4R64A 2BBHA 5D62A 4M9GA 4R5JA 3B51X 4QZCA 1R8AA 8ICVA 7ICSA 3C2MA 3CKDA 3ZEDA 2HN2A 2B51A 4DOCA 3RJJA 5DBAA 4EZTA 3DX1A 1KNYA 3OWGA 4P4PA 5DECA 5DB7A 4EZNA 4MFCA 7ICHA 3HAIA 5D46A 4O9MA 2F18A 2O1PA 1JQRA 2ISOA 5E84A 3ER8C 5KBPA 3HAHA 5TKYA 4EZSA 7ICQA 3NYBA 1BPXA 4KLOA 4KLSA 5DDYA 4BNEA 4NXWA 3RJGA 9ICHA 3EJSA 5IIJA 5F2VO 4M47A 1BPEA 1PS3A 1UETA 4YMOA 5CP2A 1TQVA 2C08A 9ICGA 5D61A 4OAGA 4QZ9A 4NPHA 3K7DA 4X5VA 2PFPA 4M0AA 4UDXX 3EJRA 3I01A 3HW8A 2B4VA 9ICCA 9ICVA 4M2YA 2GAFD 1GPJA 7ICTA 4QZFA 1SU6A 2RFFA 3EJPA 1ZQNA 4KLQA 4X0AA 4D8JA 3EJUA 4NLZA 4AZ7A 1R33A 4NXVA 4AT9B 4AZBA 4KLUA 4X4SA 1ZQOA 8ICHA 1MIYA 2QXLA 3H37A 3T46A 1HWWA 5IIKA 5J0WA 4G6QA 4I2DA 3OUYB 4R5KA 4UB2A 4KLFA 4UDYX 3DPQA 3L9DA 1ZQTA 4RWOA 2P66A 8ICTA 4I2JA 2LXYA 3L3PA 1U00A 5HRDA 8ICNA 3Q84A 3RJFA 1ZQUA 4NSWA 2FICA 3NWIA 2OBMA 4LZDA 4I27A 7ICIA 3SYVA 1ZQZA 2PXIA 4KLIA 4WC7A 4AT7A 3OV7A 3CAZA 4WPEA 4LVSA 3I04A 5DEDA 3TFRA 3UQ0A 2EFKA 3DX4A 4AZGA 1UPXA 4P4MA 4EV6A 2Q66A 4AZCA 2O0I1 1BPDA 2ZH3A 4YD1A 3BVTA 4X4OA 3UQ2A 3RJHA 3PMLA 4LEVA 4KLGA 1DKZA 5HC9A 2IHMA 2JNSA 2Q12A 1VJ7A 4R5IA 4PH5A 4RPZA 4R66A 5BOLA 4F01A 2ZH8A 5J0PA 4IG8A 4AZIA 4R65A 2PMRA 1I4LA 2Z8YA 4NKTA 3GDXA 4AZ6A 1X03A 1MQ2A 4O69A 4IWOA 5HREA 3AQLA 8ICIA 3HJ4A 1TVAA 1MIWA 4E7XA 3LQCB 4PGQA 3MDCA 3UPQA 3V72A 4JWMA 3DX0A 3NKUA 4XQ7A 2BCSA 3OHXM 4F5QA 4JL9A 3V7KA 9ICLA 2ALWA 4WBYA 2YIAA 2GF4A 4KLJA 4FO6A 4JLZA 5CFUA 2B56A 3C5GA 4WC5A 4KLHA 1ZQRA 4TUSA 2O5AA 4QZ8A 4RQ4A 4E8FA 8ICQA 4YMNA 4WC2A 4JWNA 4IWPA 5HR9A 5J2AA 3D52A 1MQ3A 4X0BA 3AQNA 3AU2A 5B3PA 3M3WA 9ICSA 2BCRA 4MFFA 9ICIA 4AVMA 2PBEA 4PHDA 4F5PA 4K8VA 4FHWA 4QZAA 1ZQAA 1SU7A 2DR7A 3OUYA 3RV1A 2RAKA 2F7QA 3DPOA 3BVVA 1TFYA 4UD5A 4UBCA 7ICRA 1GNLA 2ZH1A 4K98A 1TV9A 4E81A 3JPSA 5J2CA 5DBCA 1KDHA 4E80A 5IILA 4KLDA 7ICVA 4EEBA 3Q0KA 4M04A 4LEWA 2YI9A 4GXJA 8ICYA 3CZSA 4EZVA 4HR1B 1ZQFA 5D4BA 2F1BA 1X04A 3WFQE 2YLAA 3VEAA 1XSLA 1JMSA 3C18A 5D63A 4RQ2A 3RJKA 4O5CA 5HHHA 3HX0A 3PMNA 1JAJA 4Z6CA 3CK6A 8ICXA 5CR0A 4LEYA 4UB1A 3TFSA 4PPXA 5DB8A 5J29A 4FM3A 1FA0A 4MKPA 3QNJA 1UEVA 1ZQHA 4WCWA 4IW0A 4Z6DA 4XA5A 4DOAA 4WBZA 9ICRA 4RQ5A 1URUA 4M9JA 4B9QA 4M9LA 4P2HA 5B3QA 4Z6EA 7ICUA 2F7OA 1MIVA 4UAYA 9ICAA 4NLNA 4FHYA 1R5EA 3OGUA 3LMFA 4WQLA 4DCNC 1GN9A 2QKWA 3NVOA 3FD9A 3UXOA 4H6IA 8ICWA 3QNIA 7ICJA 3JPNA 1QWUA 4GXIA 2NCZA 2KHOA 3KAVA 5CFTA 4I2HA 4RQ3A 3BVXA 8ICAA 4X4VA 4X4UA 3WFRE 3QWEA 1ZQEA 4RQ7A 4DO9A 4QZBA 4PHEA 4PO2A 8ICKA 2YLLA 4Z6FA 3D2FA 8ICLA 3CV5A 4EZYA 4I2BA 3EF2A 4EZPA 2BPCA 4K4GA 4FO1A 4UBBA 2ZH6A 4QZDA 3CZNA 9ICTA 1RZTA 4EBKA 1O7DB 9ICXA 4PGXA 4EZOA 1ZQMA 9ICEA 2D4CA 3A98A 5IIMA 5CWRA 2ZH7A 1ZQJA 3HAJA 2M2TA 5CJ7A 4S3NA 1HUZA 1ZQCA 3SOGA 1MJGA 3ACOA 2YI8A 3C2KA 2IUBA 1R8CA 2N3KA 3RH4A 7ICMA 1R89A 2BBJA 3O3OB 2PFQA 5DB6A 4EEDA 1NOMA 1I49A 2ZHBA 4M9NA 4KLTA 1SUFA 3HJ1A 5CHGA 3O3MB 4H6HA 3B0XA 4LT6A 3EJQA 5TZVA 2PY6A 1V4AA 3BUBA 3PLTA 2HHPA 4R5GA 4RWNA 4UD4A 1E9VA 3B0YA 2DRBA 4P4OA 3OVAA 1XSNA 2M2WA 3AU6A 2RAIA 3F7WA 5J0QA 4WC6A 2ND1A 5CHEA 4M5DA 4RQ0A 1ZQQA 1ZJNA 4O5EA 1ZQPA 5C5BB 2ZXQA 1TQWA 9ICJA 3DDGA 4H8SA 2M2UA 1RPLA 3LLLA 1UEUA 2NRKA 4RT2A 4EP7A 3OVSA 5J2IA 1TFWA 4JWEA 4MF8A 2YL5A 1ZQVA 1ZQBA 4K4HA 3H38A 5DBBA 4I28A 1ZQLA 4K9BA 1TQSA 5J0XA 2WYIA 9ICFA 2OZNB 5FIGA 2VANA 2YIBA 5J0OA 4O6AA 3BUQA 1R34A 4IM0A 1TQUA 2X3VA 2V0OA 4K97A 1Q78A 4RQ6A 2PFOA 4FHVA 8ICPA 3BUPA 1ZQYA 2Z0VA 3AQMA 4WC4A 4FHXA 4HX0A 4RPXA 4X4NA 4UB4A 1OU5A 5JTGA 2ID1A 4E3CA 4UAZA 4YN4A 2OW7A 5J2KA 5CFSA 3T49A 2Q13A 5HRKA 4I29A 4F00A 4WC0A 4AT9A 2ZH9A 4O68A 7ICFA 5IINA 3T4AG 3B52X 4WOYA 4I0UA 5DKWA 4M9HA 5J2GA 8ICMA 4FH5A 2X3XA 3PNCA 4FZSA 4FH3A 2FMSA 3CVRA 1QWNA 3KDRA 3MCRA 2FMQA 8ICCA 3VEBA 4JLXA 4XJEA 1YLQA 4UB3A 4XRHA 2HN1A 4NQIA 4QZHA 4TUQA 4N7RA 4MF2A 1ZQDA 4PHPA 3AQKA 1VFGA 4AZHA 2BPFA 3MGIA 4PHAA 1O7DC 3MDAA 2EX3B 5BOMA 8ICSA 5HRLA 3JPTA 3JZ0A 5J0TA 4TURA 2DR5A 1BPYA 1WDZA 2DR9A 2EWRA 4I1QA 5IIIA 3ISCA 3T47A 1DKYA 8ICEA 3DPPA 5HRGA 4JNFA 3V7LA 3G9GA 4KLLA 4EBJA 4EZXA 2ZH4A 5J2EA 1QX1A 3QA8A 4GXKA 2FMPA 4KIKB 3C66A 2BE3A 3HIYA 4NXUA 5J2DA 7ICLA 2ZHAA 3JCFA 2BCVA 2ZH2A 3MGHA 3PHZA 1HTYA 1JQKA 3UITA 4O67A 8ICRA 2FCLA 9ICKA 1NO5A 3QE6A 4EZRA 2GA9D 4X4TA 3DDFA 4TUPA 1ZQIA 3D2EA 4AKVA 4FZOA 4I2IA 9ICBA 3H3AA 4KM5A 3RH6A 2IHOA 2ND0A 4ATBB 4QZIA 2QFFA 3JPOA 3HWTA 2YKTA 2ZH5A 2X5CA 3T48A 4F5NA 3ABHA 4NY8A 1Y2OA 9ICMA 4JWCA 4NM1A 4F5OA 2Z0OA 2F1AA 4M0MA 1R8BA 5HRFA 1GNTA 5J2FA 4LEZA 4IM3A 4WQKA 1I4TA 4K99A 4QZEA 4IQUA 5CA7A 4X4PA 2BPGA 8ICZA 1E2UA 3WFPA 4KB6A 4OAFA 3UXNA 3C2LA 4HY9A 4MFAA 4DOBA 4JLCA 1OA0A 2YIVX 3DX2A 3D51A 9ICQA 3I2WA 4OAIZ 1JN3A 4NXXA 5J0SA 3MBYA 4KLEA 9ICWA 3ISDA 2X3WA 4JWIA 4AZ5A 3BVUA 3BVWA 4R63A 3AUOA 4KLMA 4EZWA 4K96A 1ZQXA 1E1DA 1KEJA 1OAOA 4HR1A 3V7JA 4I2CA 4YCXA 3C5FA 4HYBA 3H39A 3JPPA 2Z0NA 4WH5A 1YWMA 4UAWA 8ICJA 2M2VA 3LK9A 3BUDA 3EJTA 4AT8B 9ICOA 1LQ7A 2D1LA 7ICNA 5DDMA 2F7RA 4EZZA 2GWSA 1HXKA 2JNKA 5BPCA 3UXPA 4NLKA 5CB1A 4IQTA 4EZUA 3BLBA 1F5AA 1PX5A 4IWQA 7ICEA 3D4ZA 4X4QA 2EFLA 2PFNA 2FYVA 4KIKA 4DYLA 2W9MA 1ZQSA 4K9AA 4I2FA 9ICPA 3DYTA 1SU8A 2WYHA 5EOZA 4I2AA 2YL8A 8ICBA 1Q79A 2LM0A 1XSPA 2OBLA 3RPMA 4FHPA 5HHIA 4QZGA 1ZJMA 2RT6A 5HRBA 4RQ1A 7ICOA 5FLEX 4R5LA 1BPBA 5J0UA 3D4YA 4UB5A 2WINM 2YL6A 7ICPA 4JN4A 4ATBA 2MI7A 2BCQA 3UPSA 4RWQA 3RH5A 3WFSC 4WC1A 4RPYA 2EWFA 5HRIA 3C7NA 2F7PA 1ZQGA 2DRAA 1W9MA 4FZPA 3KAWA 2YL9A 2DVIA 4K4IA 4WPCA 4I2EA 4I2GA 3ERCC 3OVBA 3B53X 7ICGA 4LZGA 1ZWWA
chains in the Genus database with same CATH topology
3D2FA 4LEVA 4EZYA 1DKZA 3DPPA 2JNSA 3EF2A 3RV0A 4EZPA 4JNFA 4FO1A 4R5IA 3I39X 4JNEA 4EZXA 1DKXA 4F01A 3VKHA 3QA8A 4EZOA 4KIKB 3A98A 2Z8YA 1OA1A 3GI7A 3L3OM 4NXUA 4O69A 4IWOA 4NXTA 1MJGA 2YI8A 2N3KA 4IM2A 1JQKA 3UITA 3PHZA 4O67A 4JWDA 2FCLA 3NKUA 4EZRA 2GA9D 3O3OB 3OHXM 3D2EA 4JL9A 4KM5A 2IHOA 2ND0A 2QFFA 1SUFA 2X5CA 2YIAA 3T48A 3O3MB 4H6HA 4JLZA 5CFUA 2B56A 1ZYLA 2PY6A 4EZQA 4JWCA 4R5GA 1E9VA 4OAHA 4M0MA 3O3NB 1GNTA 4LEZA 4IM3A 3F7WA 3ER9B 4WQKA 4K99A 5D62A 4IWPA 2ND1A 5CHEA 1E2UA 4KB6A 5B3PA 4OAFA 4HY9A 4JLCA 4R5JA 1OA0A 2YIVX 4K8VA 3B51X 4JWEA 1SU7A 4OAIZ 4NXXA 3RV1A 3ZEDA 3DPOA 2B51A 4EZTA 4JWIA 3OWGA 4K9BA 1GNLA 4K98A 4E81A 4EZNA 4EZWA 4K96A 1E1DA 5FIGA 1OAOA 2YIBA 4HR1A 4O6AA 5E84A 3ER8C 4IM0A 5TKYA 4EZSA 4LEWA 2YI9A 4HYBA 4K97A 4WH5A 4NXWA 4EZVA 4HR1B 4HX0A 5D61A 3VEAA 4OAGA 4E3CA 5D63A 4NPHA 3K7DA 5CFSA 3T49A 4UDXX 4F00A 3I01A 4EZZA 2B4VA 2GAFD 1GPJA 4O68A 4LEYA 4EZUA 4FM3A 1SU6A 4IWQA 3QNJA 3T4AG 3B52X 4MKPA 4IW0A 4WOYA 4KIKA 4D8JA 4NXVA 4K9AA 4B9QA 1SU8A 2QXLA 5B3QA 3T46A 4G6QA 3KDRA 4R5KA 2LM0A 3DPQA 4UDYX 2OBLA 3VEBA 3MCRA 4JLXA 4XJEA 3LMFA 1U00A 2RT6A 4WQLA 5FLEX 1GN9A 4R5LA 4N7RA 2WINM 3FD9A 4H6IA 2OBMA 4JN4A 2NCZA 2KHOA 3KAVA 5CFTA 2EX3B 2EWFA 3C7NA 1W9MA 3I04A 3KAWA 3ERCC 1UPXA 4PO2A 2EWRA 3B53X 3T47A 1DKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  2GA9 D;  3ERC C;  3ER9 B;  3ER8 C;  3OWG A; 
#chains in the Genus database with same CATH topology
 4NXZ A;  5J0R A;  3RJE A;  4PGY A;  3RV0 A;  5J2B A;  1I4D A;  7ICK A;  4RWP A;  3RJI A;  3I39 X;  4JNE A;  5HRH A;  4NM2 A;  1DKX A;  3VKH A;  4F5R A;  5D49 A;  1ZQK A;  3JPR A;  5DB9 A;  3JYY A;  8ICU A;  3LVT A;  1OA1 A;  3GI7 A;  2ELB A;  4ATM A;  4RT3 A;  3JPQ A;  3BUI A;  5J2J A;  2BCU A;  3L3O M;  5J0Y A;  3ISB A;  2ISP A;  4O5K A;  3WFO A;  4NXT A;  2RAJ A;  4XQ8 A;  3OK8 A;  4YMM A;  3DX3 A;  4IM2 A;  2DR8 A;  8ICO A;  8ICF A;  4JWD A;  1TQT A;  1BPZ A;  5IIO A;  4XUS A;  9ICN A;  4IQW A;  3K75 D;  4WC3 A;  2I9G A;  5J2H A;  4AT7 B;  8ICG A;  1ZYL A;  4EZQ A;  2OO2 A;  2OW6 A;  4AT8 A;  1HUO A;  5C5B A;  9ICU A;  3D50 A;  4AZC B;  4OAH A;  4IQV A;  4X4R A;  4NKU A;  4EGW A;  3O3N B;  1ZQW A;  4RQ8 A;  3ER9 B;  1WOT A;  4YD2 A;  4R64 A;  2BBH A;  5D62 A;  4M9G A;  4R5J A;  3B51 X;  4QZC A;  1R8A A;  8ICV A;  7ICS A;  3C2M A;  3CKD A;  3ZED A;  2HN2 A;  2B51 A;  4DOC A;  3RJJ A;  5DBA A;  4EZT A;  3DX1 A;  1KNY A;  3OWG A;  4P4P A;  5DEC A;  5DB7 A;  4EZN A;  4MFC A;  7ICH A;  3HAI A;  5D46 A;  4O9M A;  2F18 A;  2O1P A;  1JQR A;  2ISO A;  5E84 A;  3ER8 C;  5KBP A;  3HAH A;  5TKY A;  4EZS A;  7ICQ A;  3NYB A;  1BPX A;  4KLO A;  4KLS A;  5DDY A;  4BNE A;  4NXW A;  3RJG A;  9ICH A;  3EJS A;  5IIJ A;  5F2V O;  4M47 A;  1BPE A;  1PS3 A;  1UET A;  4YMO A;  5CP2 A;  1TQV A;  2C08 A;  9ICG A;  5D61 A;  4OAG A;  4QZ9 A;  4NPH A;  3K7D A;  4X5V A;  2PFP A;  4M0A A;  4UDX X;  3EJR A;  3I01 A;  3HW8 A;  2B4V A;  9ICC A;  9ICV A;  4M2Y A;  2GAF D;  1GPJ A;  7ICT A;  4QZF A;  1SU6 A;  2RFF A;  3EJP A;  1ZQN A;  4KLQ A;  4X0A A;  4D8J A;  3EJU A;  4NLZ A;  4AZ7 A;  1R33 A;  4NXV A;  4AT9 B;  4AZB A;  4KLU A;  4X4S A;  1ZQO A;  8ICH A;  1MIY A;  2QXL A;  3H37 A;  3T46 A;  1HWW A;  5IIK A;  5J0W A;  4G6Q A;  4I2D A;  3OUY B;  4R5K A;  4UB2 A;  4KLF A;  4UDY X;  3DPQ A;  3L9D A;  1ZQT A;  4RWO A;  2P66 A;  8ICT A;  4I2J A;  2LXY A;  3L3P A;  1U00 A;  5HRD A;  8ICN A;  3Q84 A;  3RJF A;  1ZQU A;  4NSW A;  2FIC A;  3NWI A;  2OBM A;  4LZD A;  4I27 A;  7ICI A;  3SYV A;  1ZQZ A;  2PXI A;  4KLI A;  4WC7 A;  4AT7 A;  3OV7 A;  3CAZ A;  4WPE A;  4LVS A;  3I04 A;  5DED A;  3TFR A;  3UQ0 A;  2EFK A;  3DX4 A;  4AZG A;  1UPX A;  4P4M A;  4EV6 A;  2Q66 A;  4AZC A;  2O0I 1;  1BPD A;  2ZH3 A;  4YD1 A;  3BVT A;  4X4O A;  3UQ2 A;  3RJH A;  3PML A;  4LEV A;  4KLG A;  1DKZ A;  5HC9 A;  2IHM A;  2JNS A;  2Q12 A;  1VJ7 A;  4R5I A;  4PH5 A;  4RPZ A;  4R66 A;  5BOL A;  4F01 A;  2ZH8 A;  5J0P A;  4IG8 A;  4AZI A;  4R65 A;  2PMR A;  1I4L A;  2Z8Y A;  4NKT A;  3GDX A;  4AZ6 A;  1X03 A;  1MQ2 A;  4O69 A;  4IWO A;  5HRE A;  3AQL A;  8ICI A;  3HJ4 A;  1TVA A;  1MIW A;  4E7X A;  3LQC B;  4PGQ A;  3MDC A;  3UPQ A;  3V72 A;  4JWM A;  3DX0 A;  3NKU A;  4XQ7 A;  2BCS A;  3OHX M;  4F5Q A;  4JL9 A;  3V7K A;  9ICL A;  2ALW A;  4WBY A;  2YIA A;  2GF4 A;  4KLJ A;  4FO6 A;  4JLZ A;  5CFU A;  2B56 A;  3C5G A;  4WC5 A;  4KLH A;  1ZQR A;  4TUS A;  2O5A A;  4QZ8 A;  4RQ4 A;  4E8F A;  8ICQ A;  4YMN A;  4WC2 A;  4JWN A;  4IWP A;  5HR9 A;  5J2A A;  3D52 A;  1MQ3 A;  4X0B A;  3AQN A;  3AU2 A;  5B3P A;  3M3W A;  9ICS A;  2BCR A;  4MFF A;  9ICI A;  4AVM A;  2PBE A;  4PHD A;  4F5P A;  4K8V A;  4FHW A;  4QZA A;  1ZQA A;  1SU7 A;  2DR7 A;  3OUY A;  3RV1 A;  2RAK A;  2F7Q A;  3DPO A;  3BVV A;  1TFY A;  4UD5 A;  4UBC A;  7ICR A;  1GNL A;  2ZH1 A;  4K98 A;  1TV9 A;  4E81 A;  3JPS A;  5J2C A;  5DBC A;  1KDH A;  4E80 A;  5IIL A;  4KLD A;  7ICV A;  4EEB A;  3Q0K A;  4M04 A;  4LEW A;  2YI9 A;  4GXJ A;  8ICY A;  3CZS A;  4EZV A;  4HR1 B;  1ZQF A;  5D4B A;  2F1B A;  1X04 A;  3WFQ E;  2YLA A;  3VEA A;  1XSL A;  1JMS A;  3C18 A;  5D63 A;  4RQ2 A;  3RJK A;  4O5C A;  5HHH A;  3HX0 A;  3PMN A;  1JAJ A;  4Z6C A;  3CK6 A;  8ICX A;  5CR0 A;  4LEY A;  4UB1 A;  3TFS A;  4PPX A;  5DB8 A;  5J29 A;  4FM3 A;  1FA0 A;  4MKP A;  3QNJ A;  1UEV A;  1ZQH A;  4WCW A;  4IW0 A;  4Z6D A;  4XA5 A;  4DOA A;  4WBZ A;  9ICR A;  4RQ5 A;  1URU A;  4M9J A;  4B9Q A;  4M9L A;  4P2H A;  5B3Q A;  4Z6E A;  7ICU A;  2F7O A;  1MIV A;  4UAY A;  9ICA A;  4NLN A;  4FHY A;  1R5E A;  3OGU A;  3LMF A;  4WQL A;  4DCN C;  1GN9 A;  2QKW A;  3NVO A;  3FD9 A;  3UXO A;  4H6I A;  8ICW A;  3QNI A;  7ICJ A;  3JPN A;  1QWU A;  4GXI A;  2NCZ A;  2KHO A;  3KAV A;  5CFT A;  4I2H A;  4RQ3 A;  3BVX A;  8ICA A;  4X4V A;  4X4U A;  3WFR E;  3QWE A;  1ZQE A;  4RQ7 A;  4DO9 A;  4QZB A;  4PHE A;  4PO2 A;  8ICK A;  2YLL A;  4Z6F A;  3D2F A;  8ICL A;  3CV5 A;  4EZY A;  4I2B A;  3EF2 A;  4EZP A;  2BPC A;  4K4G A;  4FO1 A;  4UBB A;  2ZH6 A;  4QZD A;  3CZN A;  9ICT A;  1RZT A;  4EBK A;  1O7D B;  9ICX A;  4PGX A;  4EZO A;  1ZQM A;  9ICE A;  2D4C A;  3A98 A;  5IIM A;  5CWR A;  2ZH7 A;  1ZQJ A;  3HAJ A;  2M2T A;  5CJ7 A;  4S3N A;  1HUZ A;  1ZQC A;  3SOG A;  1MJG A;  3ACO A;  2YI8 A;  3C2K A;  2IUB A;  1R8C A;  2N3K A;  3RH4 A;  7ICM A;  1R89 A;  2BBJ A;  3O3O B;  2PFQ A;  5DB6 A;  4EED A;  1NOM A;  1I49 A;  2ZHB A;  4M9N A;  4KLT A;  1SUF A;  3HJ1 A;  5CHG A;  3O3M B;  4H6H A;  3B0X A;  4LT6 A;  3EJQ A;  5TZV A;  2PY6 A;  1V4A A;  3BUB A;  3PLT A;  2HHP A;  4R5G A;  4RWN A;  4UD4 A;  1E9V A;  3B0Y A;  2DRB A;  4P4O A;  3OVA A;  1XSN A;  2M2W A;  3AU6 A;  2RAI A;  3F7W A;  5J0Q A;  4WC6 A;  2ND1 A;  5CHE A;  4M5D A;  4RQ0 A;  1ZQQ A;  1ZJN A;  4O5E A;  1ZQP A;  5C5B B;  2ZXQ A;  1TQW A;  9ICJ A;  3DDG A;  4H8S A;  2M2U A;  1RPL A;  3LLL A;  1UEU A;  2NRK A;  4RT2 A;  4EP7 A;  3OVS A;  5J2I A;  1TFW A;  4JWE A;  4MF8 A;  2YL5 A;  1ZQV A;  1ZQB A;  4K4H A;  3H38 A;  5DBB A;  4I28 A;  1ZQL A;  4K9B A;  1TQS A;  5J0X A;  2WYI A;  9ICF A;  2OZN B;  5FIG A;  2VAN A;  2YIB A;  5J0O A;  4O6A A;  3BUQ A;  1R34 A;  4IM0 A;  1TQU A;  2X3V A;  2V0O A;  4K97 A;  1Q78 A;  4RQ6 A;  2PFO A;  4FHV A;  8ICP A;  3BUP A;  1ZQY A;  2Z0V A;  3AQM A;  4WC4 A;  4FHX A;  4HX0 A;  4RPX A;  4X4N A;  4UB4 A;  1OU5 A;  5JTG A;  2ID1 A;  4E3C A;  4UAZ A;  4YN4 A;  2OW7 A;  5J2K A;  5CFS A;  3T49 A;  2Q13 A;  5HRK A;  4I29 A;  4F00 A;  4WC0 A;  4AT9 A;  2ZH9 A;  4O68 A;  7ICF A;  5IIN A;  3T4A G;  3B52 X;  4WOY A;  4I0U A;  5DKW A;  4M9H A;  5J2G A;  8ICM A;  4FH5 A;  2X3X A;  3PNC A;  4FZS A;  4FH3 A;  2FMS A;  3CVR A;  1QWN A;  3KDR A;  3MCR A;  2FMQ A;  8ICC A;  3VEB A;  4JLX A;  4XJE A;  1YLQ A;  4UB3 A;  4XRH A;  2HN1 A;  4NQI A;  4QZH A;  4TUQ A;  4N7R A;  4MF2 A;  1ZQD A;  4PHP A;  3AQK A;  1VFG A;  4AZH A;  2BPF A;  3MGI A;  4PHA A;  1O7D C;  3MDA A;  2EX3 B;  5BOM A;  8ICS A;  5HRL A;  3JPT A;  3JZ0 A;  5J0T A;  4TUR A;  2DR5 A;  1BPY A;  1WDZ A;  2DR9 A;  2EWR A;  4I1Q A;  5III A;  3ISC A;  3T47 A;  1DKY A;  8ICE A;  3DPP A;  5HRG A;  4JNF A;  3V7L A;  3G9G A;  4KLL A;  4EBJ A;  4EZX A;  2ZH4 A;  5J2E A;  1QX1 A;  3QA8 A;  4GXK A;  2FMP A;  4KIK B;  3C66 A;  2BE3 A;  3HIY A;  4NXU A;  5J2D A;  7ICL A;  2ZHA A;  3JCF A;  2BCV A;  2ZH2 A;  3MGH A;  3PHZ A;  1HTY A;  1JQK A;  3UIT A;  4O67 A;  8ICR A;  2FCL A;  9ICK A;  1NO5 A;  3QE6 A;  4EZR A;  2GA9 D;  4X4T A;  3DDF A;  4TUP A;  1ZQI A;  3D2E A;  4AKV A;  4FZO A;  4I2I A;  9ICB A;  3H3A A;  4KM5 A;  3RH6 A;  2IHO A;  2ND0 A;  4ATB B;  4QZI A;  2QFF A;  3JPO A;  3HWT A;  2YKT A;  2ZH5 A;  2X5C A;  3T48 A;  4F5N A;  3ABH A;  4NY8 A;  1Y2O A;  9ICM A;  4JWC A;  4NM1 A;  4F5O A;  2Z0O A;  2F1A A;  4M0M A;  1R8B A;  5HRF A;  1GNT A;  5J2F A;  4LEZ A;  4IM3 A;  4WQK A;  1I4T A;  4K99 A;  4QZE A;  4IQU A;  5CA7 A;  4X4P A;  2BPG A;  8ICZ A;  1E2U A;  3WFP A;  4KB6 A;  4OAF A;  3UXN A;  3C2L A;  4HY9 A;  4MFA A;  4DOB A;  4JLC A;  1OA0 A;  2YIV X;  3DX2 A;  3D51 A;  9ICQ A;  3I2W A;  4OAI Z;  1JN3 A;  4NXX A;  5J0S A;  3MBY A;  4KLE A;  9ICW A;  3ISD A;  2X3W A;  4JWI A;  4AZ5 A;  3BVU A;  3BVW A;  4R63 A;  3AUO A;  4KLM A;  4EZW A;  4K96 A;  1ZQX A;  1E1D A;  1KEJ A;  1OAO A;  4HR1 A;  3V7J A;  4I2C A;  4YCX A;  3C5F A;  4HYB A;  3H39 A;  3JPP A;  2Z0N A;  4WH5 A;  1YWM A;  4UAW A;  8ICJ A;  2M2V A;  3LK9 A;  3BUD A;  3EJT A;  4AT8 B;  9ICO A;  1LQ7 A;  2D1L A;  7ICN A;  5DDM A;  2F7R A;  4EZZ A;  2GWS A;  1HXK A;  2JNK A;  5BPC A;  3UXP A;  4NLK A;  5CB1 A;  4IQT A;  4EZU A;  3BLB A;  1F5A A;  1PX5 A;  4IWQ A;  7ICE A;  3D4Z A;  4X4Q A;  2EFL A;  2PFN A;  2FYV A;  4KIK A;  4DYL A;  2W9M A;  1ZQS A;  4K9A A;  4I2F A;  9ICP A;  3DYT A;  1SU8 A;  2WYH A;  5EOZ A;  4I2A A;  2YL8 A;  8ICB A;  1Q79 A;  2LM0 A;  1XSP A;  2OBL A;  3RPM A;  4FHP A;  5HHI A;  4QZG A;  1ZJM A;  2RT6 A;  5HRB A;  4RQ1 A;  7ICO A;  5FLE X;  4R5L A;  1BPB A;  5J0U A;  3D4Y A;  4UB5 A;  2WIN M;  2YL6 A;  7ICP A;  4JN4 A;  4ATB A;  2MI7 A;  2BCQ A;  3UPS A;  4RWQ A;  3RH5 A;  3WFS C;  4WC1 A;  4RPY A;  2EWF A;  5HRI A;  3C7N A;  2F7P A;  1ZQG A;  2DRA A;  1W9M A;  4FZP A;  3KAW A;  2YL9 A;  2DVI A;  4K4I A;  4WPC A;  4I2E A;  4I2G A;  3ERC C;  3OVB A;  3B53 X;  7ICG A;  4LZG A;  1ZWW A; 
#chains in the Genus database with same CATH homology
 3D2F A;  4LEV A;  4EZY A;  1DKZ A;  3DPP A;  2JNS A;  3EF2 A;  3RV0 A;  4EZP A;  4JNF A;  4FO1 A;  4R5I A;  3I39 X;  4JNE A;  4EZX A;  1DKX A;  4F01 A;  3VKH A;  3QA8 A;  4EZO A;  4KIK B;  3A98 A;  2Z8Y A;  1OA1 A;  3GI7 A;  3L3O M;  4NXU A;  4O69 A;  4IWO A;  4NXT A;  1MJG A;  2YI8 A;  2N3K A;  4IM2 A;  1JQK A;  3UIT A;  3PHZ A;  4O67 A;  4JWD A;  2FCL A;  3NKU A;  4EZR A;  2GA9 D;  3O3O B;  3OHX M;  3D2E A;  4JL9 A;  4KM5 A;  2IHO A;  2ND0 A;  2QFF A;  1SUF A;  2X5C A;  2YIA A;  3T48 A;  3O3M B;  4H6H A;  4JLZ A;  5CFU A;  2B56 A;  1ZYL A;  2PY6 A;  4EZQ A;  4JWC A;  4R5G A;  1E9V A;  4OAH A;  4M0M A;  3O3N B;  1GNT A;  4LEZ A;  4IM3 A;  3F7W A;  3ER9 B;  4WQK A;  4K99 A;  5D62 A;  4IWP A;  2ND1 A;  5CHE A;  1E2U A;  4KB6 A;  5B3P A;  4OAF A;  4HY9 A;  4JLC A;  4R5J A;  1OA0 A;  2YIV X;  4K8V A;  3B51 X;  4JWE A;  1SU7 A;  4OAI Z;  4NXX A;  3RV1 A;  3ZED A;  3DPO A;  2B51 A;  4EZT A;  4JWI A;  3OWG A;  4K9B A;  1GNL A;  4K98 A;  4E81 A;  4EZN A;  4EZW A;  4K96 A;  1E1D A;  5FIG A;  1OAO A;  2YIB A;  4HR1 A;  4O6A A;  5E84 A;  3ER8 C;  4IM0 A;  5TKY A;  4EZS A;  4LEW A;  2YI9 A;  4HYB A;  4K97 A;  4WH5 A;  4NXW A;  4EZV A;  4HR1 B;  4HX0 A;  5D61 A;  3VEA A;  4OAG A;  4E3C A;  5D63 A;  4NPH A;  3K7D A;  5CFS A;  3T49 A;  4UDX X;  4F00 A;  3I01 A;  4EZZ A;  2B4V A;  2GAF D;  1GPJ A;  4O68 A;  4LEY A;  4EZU A;  4FM3 A;  1SU6 A;  4IWQ A;  3QNJ A;  3T4A G;  3B52 X;  4MKP A;  4IW0 A;  4WOY A;  4KIK A;  4D8J A;  4NXV A;  4K9A A;  4B9Q A;  1SU8 A;  2QXL A;  5B3Q A;  3T46 A;  4G6Q A;  3KDR A;  4R5K A;  2LM0 A;  3DPQ A;  4UDY X;  2OBL A;  3VEB A;  3MCR A;  4JLX A;  4XJE A;  3LMF A;  1U00 A;  2RT6 A;  4WQL A;  5FLE X;  1GN9 A;  4R5L A;  4N7R A;  2WIN M;  3FD9 A;  4H6I A;  2OBM A;  4JN4 A;  2NCZ A;  2KHO A;  3KAV A;  5CFT A;  2EX3 B;  2EWF A;  3C7N A;  1W9M A;  3I04 A;  3KAW A;  3ERC C;  1UPX A;  4PO2 A;  2EWR A;  3B53 X;  3T47 A;  1DKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...