3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
2GAFD 3ERCC 3OWGA 3ER9B 2GA9D 3ER8C
chains in the Genus database with same CATH superfamily
4IQTA 1BPEA 4I2FA 4DYLA 4EBJA 1OAOA 1ZQWA 1ZJMA 1R8AA 3B0YA 4F5OA 1PX5A 2F7RA 1RZTA 4DOCA 4JL9A 2GF4A 4KLSA 4RWNA 4KLJA 1E9VA 1SUFA 4WPCA 4MFAA 3V7KA 4I27A 3BVXA 3OHXM 4FHVA 4HR1B 2EFLA 4E3CA 4NLNA 4ATBA 4QZ8A 3GDXA 1JQKA 5DBAA 9ICKA 3C66A 4R64A 4OAHA 4O5KA 4Z6DA 3KDRA 4I28A 3ER9B 2BBHA 4UAYA 3DDFA 1RPLA 4UB1A 5CP2A 4M2YA 4WC5A 2FMSA 4I2AA 1ZQBA 4AZBA 4H8SA 2ISOA 4DOBA 4EZVA 2DR7A 4NKTA 1TFWA 2W9MA 4KLTA 4HYBA 3BUPA 5J29A 4F5NA 5J2CA 4KLIA 4NM1A 3V72A 7ICSA 5CJ7A 4P4MA 3RJFA 1UETA 1ZQZA 4KIKA 2B56A 3GI7A 4E7XA 4AT8A 2Q13A 4OAGA 3JPQA 3QNIA 3D4YA 3I04A 4NXZA 3ER8C 1DKYA 4M0AA 9ICOA 4EZWA 3D51A 4QZEA 1ZQMA 1ZQEA 4R5KA 3UXNA 3C2MA 5HRIA 1URUA 4ATBB 4X4SA 3M3WA 1ZQKA 2Z0OA 3BVWA 2BCUA 2F1BA 4NXVA 1UPXA 2BE3A 5CA7A 2JNSA 5J2HA 2NRKA 4WC4A 4I2EA 3OK8A 4MKPA 4HR1A 1ZQNA 5CFSA 4AT7A 4AKVA 4AZIA 1UEVA 1ZQXA 4M47A 4F01A 4QZBA 4PHAA 4LT6A 3RH4A 1XSPA 7ICFA 2O1PA 1MIVA 2YIVX 2M2UA 4WC0A 4E80A 2QKWA 4AT9A 4UB2A 2DRBA 2ZH9A 3QA8A 2BPGA 1BPZA 1DKXA 8ICRA 2X5CA 4RQ1A 5J2BA 3JPNA 9ICTA 2B51A 1HWWA 1LQ7A 4UD4A 2ELBA 1Q78A 1F5AA 5DB8A 1KEJA 2PY6A 4TUQA 3CKDA 1JAJA 4JN4A 4QZHA 5BOLA 2ZH3A 7ICPA 4YD1A 3OV7A 3I2WA 4G6QA 4EZXA 3DX2A 4K4GA 1ZQIA 1TQSA 3WFRE 4O5EA 7ICTA 3ERCC 3EJTA 4I2HA 2PFOA 2NCZA 3MGIA 4FH3A 9ICMA 4AZCA 4R5IA 3UXPA 3HAHA 5B3PA 3JZ0A 4EZQA 4YCXA 4OAIZ 4GXJA 2HN2A 5HRGA 3JPRA 2YIAA 4AT8B 2EWRA 1XSLA 1ZQCA 4I29A 3C5FA 3HX0A 1SU7A 5HRFA 2LM0A 4YMMA 3V7JA 4KLQA 4YN4A 3AQNA 2ZH4A 8ICNA 3EJSA 2M2WA 2BCVA 4K98A 3D50A 9ICJA 4K9BA 1TQTA 1PS3A 4O67A 5IIMA 5J0OA 4JWNA 9ICVA 3LVTA 3HJ4A 3SYVA 2B4VA 4FO6A 3PNCA 3O3NB 4NLKA 3BUBA 2Q66A 8ICEA 8ICHA 2ZH8A 3C18A 4PH5A 5J0WA 4RQ5A 3B51X 4JWIA 1OA1A 3T49A 3C2KA 3RJKA 9ICPA 1ZQOA 5J0QA 4H6IA 2BPCA 4XJEA 2DR9A 4P4OA 1TV9A 2DR8A 4FO1A 4AZHA 4MFCA 4RT3A 4RQ3A 1MQ2A 4Z6FA 4UB3A 3UITA 4I0UA 3RH5A 9ICNA 3H3AA 2YLLA 2YL5A 4NLZA 4KLEA 1MIWA 3UXOA 2BCRA 4EZYA 3BVVA 4EZPA 3T47A 4NXXA 8ICMA 4FM3A 1TQVA 4WPEA 3H37A 5J2FA 3HJ1A 4YD2A 5IIOA 4X4RA 2F7PA 2ZH1A 1VFGA 2ZXQA 5JTGA 7ICGA 4DO9A 1HXKA 4KLGA 4KLOA 1ZWWA 3DPOA 3G9GA 2PBEA 4I2DA 7ICMA 5HRHA 4KLMA 3H39A 1JMSA 4NXUA 2YKTA 2PFPA 4FHYA 4AT9B 4M0MA 4EZOA 2F1AA 2QFFA 4RPXA 4F5RA 3TFRA 2Z8YA 9ICHA 4K9AA 5DBCA 4Z6EA 4AZ7A 5DBBA 3JPSA 8ICJA 4NXWA 2V0OA 3EJPA 5J0PA 5J2IA 2YI9A 9ICRA 1MJGA 4MF2A 1ZQJA 3HIYA 9ICUA 2YL6A 2OW6A 5DECA 4UAZA 5HR9A 3H38A 2YIBA 4KIKB 4UD5A 4KLUA 2ZHBA 5J2GA 9ICSA 4FZSA 4AVMA 4E8FA 2ZH2A 5DKWA 4I2CA 5FIGA 4FHXA 3NWIA 3MDAA 2P66A 4O6AA 2BCQA 4I2JA 8ICXA 3MDCA 4E81A 2X3XA 1R8CA 1DKZA 4LZDA 2ALWA 4FZOA 4B9QA 5KBPA 2YLAA 5HRKA 5CWRA 4RQ8A 2PFQA 4IG8A 8ICVA 8ICZA 5B3QA 3Q0KA 4M9HA 1U00A 4IM2A 4GXIA 4O5CA 9ICCA 4WH5A 4M9LA 8ICFA 4XA5A 4LEWA 4EGWA 5J0TA 1KDHA 4LVSA 1R89A 2VANA 4WBYA 2WYHA 1ZQSA 3UPSA 4BNEA 3Q84A 3D2EA 3PHZA 4EP7A 1ZQVA 3AU2A 4JLZA 5CFUA 4DOAA 4K97A 8ICGA 8ICTA 4AZ5A 1R34A 4JLXA 3UQ2A 1ZQTA 5DB7A 2OBLA 3WFPA 5FLEX 3A98A 2ND0A 3RJJA 3L3PA 2DVIA 3KAVA 4KB6A 2I9GA 4NPHA 4I1QA 3BUDA 4EZRA 3OUYB 7ICKA 1ZQDA 3DYTA 8ICYA 8ICKA 4HX0A 4NKUA 1TQUA 1E1DA 5DDMA 4M04A 4EZTA 8ICPA 4UBBA 5C5BA 3BVTA 4LZGA 2YL8A 4PGYA 2O0I1 2OO2A 5D49A 4TURA 4RPYA 4R5JA 4R5GA 8ICBA 4X0BA 4X5VA 1KNYA 7ICNA 2BBJA 4X4VA 1GNLA 4UB5A 4M9GA 5D63A 3V7LA 2RT6A 4RQ7A 3L9DA 3F7WA 5F2VO 1R8BA 1JQRA 4WCWA 8ICLA 4PGXA 9ICLA 2FICA 4NY8A 3EJQA 3JYYA 4K96A 9ICEA 1ZYLA 3FD9A 3UPQA 4NM2A 4S3NA 3EF2A 3MGHA 4IQVA 1O7DB 8ICWA 1ZQHA 3VEBA 5C5BB 4YMNA 2FMQA 4QZIA 4WQLA 3OGUA 3CV5A 2OBMA 3D52A 1ZQFA 4IW0A 3RPMA 2X3VA 3VEAA 2IHOA 1HUZA 9ICAA 3I39X 4X4UA 1SU6A 1YLQA 4EBKA 3AQMA 4TUSA 3HW8A 4RQ6A 4LEZA 5J0RA 4IWOA 5IIJA 2O5AA 5D46A 3OUYA 4X4TA 8ICUA 4KLDA 2PMRA 4RWPA 4QZ9A 3BUIA 5HC9A 4NSWA 4I2IA 2QXLA 2HHPA 2D4CA 3WFOA 3EJRA 3BVUA 4RWOA 4EZSA 1VJ7A 5J2KA 4UB4A 1MQ3A 1V4AA 4K4HA 4M5DA 4XQ8A 2GA9D 5J0YA 5HHHA 3LK9A 5D61A 5CHEA 1OU5A 3CAZA 3O3OB 5IIKA 4JNEA 3RV1A 7ICRA 4F00A 3AUOA 5IINA 5TKYA 3KAWA 2Q12A 3BLBA 4DCNC 4R63A 4N7RA 2OZNB 4EEDA 2RAKA 3WFSC 3CZSA 5BOMA 4JWDA 4YMOA 4R5LA 4I2BA 4PO2A 3AU6A 4IWQA 4K8VA 4O9MA 8ICAA 4KLHA 8ICIA 4JWEA 1WDZA 3PMNA 4WC3A 4H6HA 2ND1A 4FHPA 2WYIA 4X4NA 4RPZA 4IM0A 1FA0A 4FHWA 4UBCA 4IQWA 3DDGA 2ISPA 2FCLA 3B52X 8ICCA 5HRDA 5HRBA 3CZNA 5J0SA 2EFKA 7ICIA 4WC6A 1ZQPA 4RT2A 1I4LA 1QWUA 3DX1A 4LEYA 4KM5A 2BPFA 2M2TA 4R66A 3C5GA 4KLFA 4AZCB 1BPBA 4JWMA 2EX3B 2KHOA 4EZUA 3DPPA 4M9JA 3RH6A 9ICQA 1HTYA 2Z0NA 2PXIA 4WC2A 4WOYA 3ABHA 1R33A 4RQ0A 3QWEA 8ICSA 2ZH7A 1GNTA 4X4PA 4WC7A 4K99A 3ISDA 2MI7A 4X0AA 4WQKA 4F5QA 1Y2OA 5HHIA 5DDYA 4I2GA 2GWSA 9ICGA 2JNKA 3VKHA 1UEUA 4O69A 2FYVA 2DR5A 2BCSA 7ICOA 2IUBA 4PHEA 2Z0VA 5J2JA 4LEVA 4QZDA 3LMFA 3BUQA 4UDXX 4K4IA 4UAWA 1W9MA 1BPDA 3OVSA 7ICEA 9ICWA 1NO5A 4M9NA 5D4BA 5HREA 4RQ2A 1BPYA 7ICVA 4D8JA 3MBYA 4RWQA 3HWTA 5DB6A 2GAFD 3QNJA 1X03A 1GN9A 2M2VA 4Z6CA 1E2UA 3T4AG 4XUSA 4HY9A 4QZFA 3ISBA 1ZQQA 1ZJNA 1I4DA 4MFFA 7ICLA 3ACOA 4AZ6A 3O3MB 4AT7B 1OA0A 3B53X 4WC1A 3SOGA 4RQ4A 3JPPA 1ZQLA 4NXTA 3QE6A 4EEBA 4PGQA 1ZQGA 2IHMA 5J2DA 1R5EA 3TFSA 3NYBA 3RV0A 1TQWA 4XRHA 5J2AA 4TUPA 5CB1A 3RJHA 2EWFA 4EV6A 1BPXA 3JCFA 4IWPA 4ATMA 3CK6A 2RAIA 5J0UA 4X4OA 5D62A 3ISCA 4QZCA 3HAIA 2FMPA 1JN3A 3JPOA 3NKUA 2DRAA 2D1LA 2LXYA 3PLTA 4UDYX 2F18A 5DEDA 3CVRA 4GXKA 3C7NA 3MCRA 5DB9A 4FH5A 5J0XA 8ICQA 7ICUA 3K75D 9ICXA 7ICHA 4FZPA 2ID1A 3K7DA 4PHPA 4QZGA 1I4TA 3OWGA 4WBZA 3L3OM 3ZEDA 2RAJA 3JPTA 3EJUA 1MIYA 4PPXA 7ICJA 1WOTA 4QZAA 2ZH6A 2OW7A 2X3WA 5IIIA 3C2LA 2ZH5A 2N3KA 4EZZA 5E84A 3HAJA 1QWNA 1ZQUA 4O68A 3LLLA 5HRLA 3PMLA 3OVAA 4JLCA 2F7OA 5CHGA 3D4ZA 5BPCA 5EOZA 5IILA 3OVBA 1SU8A 7ICQA 4EZNA 3WFQE 3D2FA 1GPJA 1Q79A 3AQLA 5CR0A 1ZQRA 4IQUA 1XSNA 4JNFA 4OAFA 1QX1A 3T48A 2ZHAA 4P2HA 1ZQYA 4R65A 3DX0A 1O7DC 4IM3A 4F5PA 4JWCA 1NOMA 4PHDA 4P4PA 2C08A 3DX3A 5J2EA 4MF8A 3I01A 1I49A 1ZQAA 2YL9A 9ICFA 3UQ0A 4AZGA 1HUOA 4XQ7A 2YI8A 4NQIA 3RJIA 4KLLA 3LQCB 3DX4A 4X4QA 1TFYA 2HN1A 2PFNA 1YWMA 2RFFA 3NVOA 9ICBA 1X04A 2WINM 3DPQA 5CFTA 5TZVA 1TVAA 3T46A 8ICOA 3B0XA 3RJEA 9ICIA 3RJGA 3AQKA 2F7QA
chains in the Genus database with same CATH topology
4K97A 2EX3B 2KHOA 4EZUA 3DPPA 4JLXA 4K98A 4K9BA 1OAOA 2OBLA 5FLEX 4WOYA 3A98A 2ND0A 4O67A 1GNTA 4K99A 3KAVA 4KB6A 4JL9A 4NPHA 4EZRA 4WQKA 1E9VA 1SUFA 3OHXM 2B4VA 4HX0A 3O3NB 4HR1B 4E3CA 1JQKA 1E1DA 3VKHA 3B51X 4JWIA 1OA1A 3T49A 4EZTA 4OAHA 4O69A 3KDRA 4H6IA 4XJEA 4R5JA 4R5GA 3ER9B 4LEVA 3LMFA 4UDXX 4FO1A 1W9MA 1GNLA 5D63A 2RT6A 3F7WA 3UITA 4D8JA 4EZVA 4HYBA 2GAFD 3QNJA 4EZYA 1GN9A 4K96A 1E2UA 1ZYLA 3FD9A 4HY9A 3T47A 3T4AG 4EZPA 4NXXA 3EF2A 3O3MB 4FM3A 4KIKA 3GI7A 1OA0A 3B53X 4OAGA 3VEBA 4NXTA 3I04A 4WQLA 3ER8C 1DKYA 4EZWA 2OBMA 4IW0A 3RV0A 3VEAA 2IHOA 3I39X 4R5KA 1SU6A 2EWFA 3DPOA 4IWPA 4LEZA 4NXVA 1UPXA 5D62A 4IWOA 3NKUA 4NXUA 2JNSA 4M0MA 4UDYX 4EZOA 2QFFA 4MKPA 2Z8YA 4HR1A 4K9AA 3C7NA 3MCRA 5CFSA 2QXLA 3PHZA 4NXWA 4EZSA 4F01A 2YI9A 3K7DA 1MJGA 3OWGA 2YIVX 2GA9D 3L3OM 3ZEDA 5D61A 5CHEA 3O3OB 4JNEA 3QA8A 3RV1A 4F00A 1DKXA 2X5CA 2YIBA 5TKYA 3KAWA 4KIKB 2B51A 4N7RA 2N3KA 4EZZA 5E84A 4O68A 2PY6A 4JWDA 4JLCA 4JN4A 4R5LA 1SU8A 5FIGA 4PO2A 4EZNA 4IWQA 3D2FA 1GPJA 4K8VA 4O6AA 4G6QA 4JWEA 4EZXA 4H6HA 2ND1A 4JNFA 4OAFA 3T48A 4E81A 3ERCC 1DKZA 4IM0A 4B9QA 4IM3A 2NCZA 4JWCA 3I01A 5B3QA 2FCLA 3B52X 4R5IA 1U00A 4IM2A 5B3PA 2YI8A 4EZQA 4WH5A 4OAIZ 4LEWA 2WINM 2YIAA 3DPQA 2EWRA 5CFTA 3T46A 1SU7A 4LEYA 4KM5A 2LM0A 3D2EA 4JLZA 5CFUA 2B56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3ERC C;  3OWG A;  3ER9 B;  2GA9 D;  3ER8 C; 
#chains in the Genus database with same CATH topology
 4IQT A;  1BPE A;  4I2F A;  4DYL A;  4EBJ A;  1OAO A;  1ZQW A;  1ZJM A;  1R8A A;  3B0Y A;  4F5O A;  1PX5 A;  2F7R A;  1RZT A;  4DOC A;  4JL9 A;  2GF4 A;  4KLS A;  4RWN A;  4KLJ A;  1E9V A;  1SUF A;  4WPC A;  4MFA A;  3V7K A;  4I27 A;  3BVX A;  3OHX M;  4FHV A;  4HR1 B;  2EFL A;  4E3C A;  4NLN A;  4ATB A;  4QZ8 A;  3GDX A;  1JQK A;  5DBA A;  9ICK A;  3C66 A;  4R64 A;  4OAH A;  4O5K A;  4Z6D A;  3KDR A;  4I28 A;  3ER9 B;  2BBH A;  4UAY A;  3DDF A;  1RPL A;  4UB1 A;  5CP2 A;  4M2Y A;  4WC5 A;  2FMS A;  4I2A A;  1ZQB A;  4AZB A;  4H8S A;  2ISO A;  4DOB A;  4EZV A;  2DR7 A;  4NKT A;  1TFW A;  2W9M A;  4KLT A;  4HYB A;  3BUP A;  5J29 A;  4F5N A;  5J2C A;  4KLI A;  4NM1 A;  3V72 A;  7ICS A;  5CJ7 A;  4P4M A;  3RJF A;  1UET A;  1ZQZ A;  4KIK A;  2B56 A;  3GI7 A;  4E7X A;  4AT8 A;  2Q13 A;  4OAG A;  3JPQ A;  3QNI A;  3D4Y A;  3I04 A;  4NXZ A;  3ER8 C;  1DKY A;  4M0A A;  9ICO A;  4EZW A;  3D51 A;  4QZE A;  1ZQM A;  1ZQE A;  4R5K A;  3UXN A;  3C2M A;  5HRI A;  1URU A;  4ATB B;  4X4S A;  3M3W A;  1ZQK A;  2Z0O A;  3BVW A;  2BCU A;  2F1B A;  4NXV A;  1UPX A;  2BE3 A;  5CA7 A;  2JNS A;  5J2H A;  2NRK A;  4WC4 A;  4I2E A;  3OK8 A;  4MKP A;  4HR1 A;  1ZQN A;  5CFS A;  4AT7 A;  4AKV A;  4AZI A;  1UEV A;  1ZQX A;  4M47 A;  4F01 A;  4QZB A;  4PHA A;  4LT6 A;  3RH4 A;  1XSP A;  7ICF A;  2O1P A;  1MIV A;  2YIV X;  2M2U A;  4WC0 A;  4E80 A;  2QKW A;  4AT9 A;  4UB2 A;  2DRB A;  2ZH9 A;  3QA8 A;  2BPG A;  1BPZ A;  1DKX A;  8ICR A;  2X5C A;  4RQ1 A;  5J2B A;  3JPN A;  9ICT A;  2B51 A;  1HWW A;  1LQ7 A;  4UD4 A;  2ELB A;  1Q78 A;  1F5A A;  5DB8 A;  1KEJ A;  2PY6 A;  4TUQ A;  3CKD A;  1JAJ A;  4JN4 A;  4QZH A;  5BOL A;  2ZH3 A;  7ICP A;  4YD1 A;  3OV7 A;  3I2W A;  4G6Q A;  4EZX A;  3DX2 A;  4K4G A;  1ZQI A;  1TQS A;  3WFR E;  4O5E A;  7ICT A;  3ERC C;  3EJT A;  4I2H A;  2PFO A;  2NCZ A;  3MGI A;  4FH3 A;  9ICM A;  4AZC A;  4R5I A;  3UXP A;  3HAH A;  5B3P A;  3JZ0 A;  4EZQ A;  4YCX A;  4OAI Z;  4GXJ A;  2HN2 A;  5HRG A;  3JPR A;  2YIA A;  4AT8 B;  2EWR A;  1XSL A;  1ZQC A;  4I29 A;  3C5F A;  3HX0 A;  1SU7 A;  5HRF A;  2LM0 A;  4YMM A;  3V7J A;  4KLQ A;  4YN4 A;  3AQN A;  2ZH4 A;  8ICN A;  3EJS A;  2M2W A;  2BCV A;  4K98 A;  3D50 A;  9ICJ A;  4K9B A;  1TQT A;  1PS3 A;  4O67 A;  5IIM A;  5J0O A;  4JWN A;  9ICV A;  3LVT A;  3HJ4 A;  3SYV A;  2B4V A;  4FO6 A;  3PNC A;  3O3N B;  4NLK A;  3BUB A;  2Q66 A;  8ICE A;  8ICH A;  2ZH8 A;  3C18 A;  4PH5 A;  5J0W A;  4RQ5 A;  3B51 X;  4JWI A;  1OA1 A;  3T49 A;  3C2K A;  3RJK A;  9ICP A;  1ZQO A;  5J0Q A;  4H6I A;  2BPC A;  4XJE A;  2DR9 A;  4P4O A;  1TV9 A;  2DR8 A;  4FO1 A;  4AZH A;  4MFC A;  4RT3 A;  4RQ3 A;  1MQ2 A;  4Z6F A;  4UB3 A;  3UIT A;  4I0U A;  3RH5 A;  9ICN A;  3H3A A;  2YLL A;  2YL5 A;  4NLZ A;  4KLE A;  1MIW A;  3UXO A;  2BCR A;  4EZY A;  3BVV A;  4EZP A;  3T47 A;  4NXX A;  8ICM A;  4FM3 A;  1TQV A;  4WPE A;  3H37 A;  5J2F A;  3HJ1 A;  4YD2 A;  5IIO A;  4X4R A;  2F7P A;  2ZH1 A;  1VFG A;  2ZXQ A;  5JTG A;  7ICG A;  4DO9 A;  1HXK A;  4KLG A;  4KLO A;  1ZWW A;  3DPO A;  3G9G A;  2PBE A;  4I2D A;  7ICM A;  5HRH A;  4KLM A;  3H39 A;  1JMS A;  4NXU A;  2YKT A;  2PFP A;  4FHY A;  4AT9 B;  4M0M A;  4EZO A;  2F1A A;  2QFF A;  4RPX A;  4F5R A;  3TFR A;  2Z8Y A;  9ICH A;  4K9A A;  5DBC A;  4Z6E A;  4AZ7 A;  5DBB A;  3JPS A;  8ICJ A;  4NXW A;  2V0O A;  3EJP A;  5J0P A;  5J2I A;  2YI9 A;  9ICR A;  1MJG A;  4MF2 A;  1ZQJ A;  3HIY A;  9ICU A;  2YL6 A;  2OW6 A;  5DEC A;  4UAZ A;  5HR9 A;  3H38 A;  2YIB A;  4KIK B;  4UD5 A;  4KLU A;  2ZHB A;  5J2G A;  9ICS A;  4FZS A;  4AVM A;  4E8F A;  2ZH2 A;  5DKW A;  4I2C A;  5FIG A;  4FHX A;  3NWI A;  3MDA A;  2P66 A;  4O6A A;  2BCQ A;  4I2J A;  8ICX A;  3MDC A;  4E81 A;  2X3X A;  1R8C A;  1DKZ A;  4LZD A;  2ALW A;  4FZO A;  4B9Q A;  5KBP A;  2YLA A;  5HRK A;  5CWR A;  4RQ8 A;  2PFQ A;  4IG8 A;  8ICV A;  8ICZ A;  5B3Q A;  3Q0K A;  4M9H A;  1U00 A;  4IM2 A;  4GXI A;  4O5C A;  9ICC A;  4WH5 A;  4M9L A;  8ICF A;  4XA5 A;  4LEW A;  4EGW A;  5J0T A;  1KDH A;  4LVS A;  1R89 A;  2VAN A;  4WBY A;  2WYH A;  1ZQS A;  3UPS A;  4BNE A;  3Q84 A;  3D2E A;  3PHZ A;  4EP7 A;  1ZQV A;  3AU2 A;  4JLZ A;  5CFU A;  4DOA A;  4K97 A;  8ICG A;  8ICT A;  4AZ5 A;  1R34 A;  4JLX A;  3UQ2 A;  1ZQT A;  5DB7 A;  2OBL A;  3WFP A;  5FLE X;  3A98 A;  2ND0 A;  3RJJ A;  3L3P A;  2DVI A;  3KAV A;  4KB6 A;  2I9G A;  4NPH A;  4I1Q A;  3BUD A;  4EZR A;  3OUY B;  7ICK A;  1ZQD A;  3DYT A;  8ICY A;  8ICK A;  4HX0 A;  4NKU A;  1TQU A;  1E1D A;  5DDM A;  4M04 A;  4EZT A;  8ICP A;  4UBB A;  5C5B A;  3BVT A;  4LZG A;  2YL8 A;  4PGY A;  2O0I 1;  2OO2 A;  5D49 A;  4TUR A;  4RPY A;  4R5J A;  4R5G A;  8ICB A;  4X0B A;  4X5V A;  1KNY A;  7ICN A;  2BBJ A;  4X4V A;  1GNL A;  4UB5 A;  4M9G A;  5D63 A;  3V7L A;  2RT6 A;  4RQ7 A;  3L9D A;  3F7W A;  5F2V O;  1R8B A;  1JQR A;  4WCW A;  8ICL A;  4PGX A;  9ICL A;  2FIC A;  4NY8 A;  3EJQ A;  3JYY A;  4K96 A;  9ICE A;  1ZYL A;  3FD9 A;  3UPQ A;  4NM2 A;  4S3N A;  3EF2 A;  3MGH A;  4IQV A;  1O7D B;  8ICW A;  1ZQH A;  3VEB A;  5C5B B;  4YMN A;  2FMQ A;  4QZI A;  4WQL A;  3OGU A;  3CV5 A;  2OBM A;  3D52 A;  1ZQF A;  4IW0 A;  3RPM A;  2X3V A;  3VEA A;  2IHO A;  1HUZ A;  9ICA A;  3I39 X;  4X4U A;  1SU6 A;  1YLQ A;  4EBK A;  3AQM A;  4TUS A;  3HW8 A;  4RQ6 A;  4LEZ A;  5J0R A;  4IWO A;  5IIJ A;  2O5A A;  5D46 A;  3OUY A;  4X4T A;  8ICU A;  4KLD A;  2PMR A;  4RWP A;  4QZ9 A;  3BUI A;  5HC9 A;  4NSW A;  4I2I A;  2QXL A;  2HHP A;  2D4C A;  3WFO A;  3EJR A;  3BVU A;  4RWO A;  4EZS A;  1VJ7 A;  5J2K A;  4UB4 A;  1MQ3 A;  1V4A A;  4K4H A;  4M5D A;  4XQ8 A;  2GA9 D;  5J0Y A;  5HHH A;  3LK9 A;  5D61 A;  5CHE A;  1OU5 A;  3CAZ A;  3O3O B;  5IIK A;  4JNE A;  3RV1 A;  7ICR A;  4F00 A;  3AUO A;  5IIN A;  5TKY A;  3KAW A;  2Q12 A;  3BLB A;  4DCN C;  4R63 A;  4N7R A;  2OZN B;  4EED A;  2RAK A;  3WFS C;  3CZS A;  5BOM A;  4JWD A;  4YMO A;  4R5L A;  4I2B A;  4PO2 A;  3AU6 A;  4IWQ A;  4K8V A;  4O9M A;  8ICA A;  4KLH A;  8ICI A;  4JWE A;  1WDZ A;  3PMN A;  4WC3 A;  4H6H A;  2ND1 A;  4FHP A;  2WYI A;  4X4N A;  4RPZ A;  4IM0 A;  1FA0 A;  4FHW A;  4UBC A;  4IQW A;  3DDG A;  2ISP A;  2FCL A;  3B52 X;  8ICC A;  5HRD A;  5HRB A;  3CZN A;  5J0S A;  2EFK A;  7ICI A;  4WC6 A;  1ZQP A;  4RT2 A;  1I4L A;  1QWU A;  3DX1 A;  4LEY A;  4KM5 A;  2BPF A;  2M2T A;  4R66 A;  3C5G A;  4KLF A;  4AZC B;  1BPB A;  4JWM A;  2EX3 B;  2KHO A;  4EZU A;  3DPP A;  4M9J A;  3RH6 A;  9ICQ A;  1HTY A;  2Z0N A;  2PXI A;  4WC2 A;  4WOY A;  3ABH A;  1R33 A;  4RQ0 A;  3QWE A;  8ICS A;  2ZH7 A;  1GNT A;  4X4P A;  4WC7 A;  4K99 A;  3ISD A;  2MI7 A;  4X0A A;  4WQK A;  4F5Q A;  1Y2O A;  5HHI A;  5DDY A;  4I2G A;  2GWS A;  9ICG A;  2JNK A;  3VKH A;  1UEU A;  4O69 A;  2FYV A;  2DR5 A;  2BCS A;  7ICO A;  2IUB A;  4PHE A;  2Z0V A;  5J2J A;  4LEV A;  4QZD A;  3LMF A;  3BUQ A;  4UDX X;  4K4I A;  4UAW A;  1W9M A;  1BPD A;  3OVS A;  7ICE A;  9ICW A;  1NO5 A;  4M9N A;  5D4B A;  5HRE A;  4RQ2 A;  1BPY A;  7ICV A;  4D8J A;  3MBY A;  4RWQ A;  3HWT A;  5DB6 A;  2GAF D;  3QNJ A;  1X03 A;  1GN9 A;  2M2V A;  4Z6C A;  1E2U A;  3T4A G;  4XUS A;  4HY9 A;  4QZF A;  3ISB A;  1ZQQ A;  1ZJN A;  1I4D A;  4MFF A;  7ICL A;  3ACO A;  4AZ6 A;  3O3M B;  4AT7 B;  1OA0 A;  3B53 X;  4WC1 A;  3SOG A;  4RQ4 A;  3JPP A;  1ZQL A;  4NXT A;  3QE6 A;  4EEB A;  4PGQ A;  1ZQG A;  2IHM A;  5J2D A;  1R5E A;  3TFS A;  3NYB A;  3RV0 A;  1TQW A;  4XRH A;  5J2A A;  4TUP A;  5CB1 A;  3RJH A;  2EWF A;  4EV6 A;  1BPX A;  3JCF A;  4IWP A;  4ATM A;  3CK6 A;  2RAI A;  5J0U A;  4X4O A;  5D62 A;  3ISC A;  4QZC A;  3HAI A;  2FMP A;  1JN3 A;  3JPO A;  3NKU A;  2DRA A;  2D1L A;  2LXY A;  3PLT A;  4UDY X;  2F18 A;  5DED A;  3CVR A;  4GXK A;  3C7N A;  3MCR A;  5DB9 A;  4FH5 A;  5J0X A;  8ICQ A;  7ICU A;  3K75 D;  9ICX A;  7ICH A;  4FZP A;  2ID1 A;  3K7D A;  4PHP A;  4QZG A;  1I4T A;  3OWG A;  4WBZ A;  3L3O M;  3ZED A;  2RAJ A;  3JPT A;  3EJU A;  1MIY A;  4PPX A;  7ICJ A;  1WOT A;  4QZA A;  2ZH6 A;  2OW7 A;  2X3W A;  5III A;  3C2L A;  2ZH5 A;  2N3K A;  4EZZ A;  5E84 A;  3HAJ A;  1QWN A;  1ZQU A;  4O68 A;  3LLL A;  5HRL A;  3PML A;  3OVA A;  4JLC A;  2F7O A;  5CHG A;  3D4Z A;  5BPC A;  5EOZ A;  5IIL A;  3OVB A;  1SU8 A;  7ICQ A;  4EZN A;  3WFQ E;  3D2F A;  1GPJ A;  1Q79 A;  3AQL A;  5CR0 A;  1ZQR A;  4IQU A;  1XSN A;  4JNF A;  4OAF A;  1QX1 A;  3T48 A;  2ZHA A;  4P2H A;  1ZQY A;  4R65 A;  3DX0 A;  1O7D C;  4IM3 A;  4F5P A;  4JWC A;  1NOM A;  4PHD A;  4P4P A;  2C08 A;  3DX3 A;  5J2E A;  4MF8 A;  3I01 A;  1I49 A;  1ZQA A;  2YL9 A;  9ICF A;  3UQ0 A;  4AZG A;  1HUO A;  4XQ7 A;  2YI8 A;  4NQI A;  3RJI A;  4KLL A;  3LQC B;  3DX4 A;  4X4Q A;  1TFY A;  2HN1 A;  2PFN A;  1YWM A;  2RFF A;  3NVO A;  9ICB A;  1X04 A;  2WIN M;  3DPQ A;  5CFT A;  5TZV A;  1TVA A;  3T46 A;  8ICO A;  3B0X A;  3RJE A;  9ICI A;  3RJG A;  3AQK A;  2F7Q A; 
#chains in the Genus database with same CATH homology
 4K97 A;  2EX3 B;  2KHO A;  4EZU A;  3DPP A;  4JLX A;  4K98 A;  4K9B A;  1OAO A;  2OBL A;  5FLE X;  4WOY A;  3A98 A;  2ND0 A;  4O67 A;  1GNT A;  4K99 A;  3KAV A;  4KB6 A;  4JL9 A;  4NPH A;  4EZR A;  4WQK A;  1E9V A;  1SUF A;  3OHX M;  2B4V A;  4HX0 A;  3O3N B;  4HR1 B;  4E3C A;  1JQK A;  1E1D A;  3VKH A;  3B51 X;  4JWI A;  1OA1 A;  3T49 A;  4EZT A;  4OAH A;  4O69 A;  3KDR A;  4H6I A;  4XJE A;  4R5J A;  4R5G A;  3ER9 B;  4LEV A;  3LMF A;  4UDX X;  4FO1 A;  1W9M A;  1GNL A;  5D63 A;  2RT6 A;  3F7W A;  3UIT A;  4D8J A;  4EZV A;  4HYB A;  2GAF D;  3QNJ A;  4EZY A;  1GN9 A;  4K96 A;  1E2U A;  1ZYL A;  3FD9 A;  4HY9 A;  3T47 A;  3T4A G;  4EZP A;  4NXX A;  3EF2 A;  3O3M B;  4FM3 A;  4KIK A;  3GI7 A;  1OA0 A;  3B53 X;  4OAG A;  3VEB A;  4NXT A;  3I04 A;  4WQL A;  3ER8 C;  1DKY A;  4EZW A;  2OBM A;  4IW0 A;  3RV0 A;  3VEA A;  2IHO A;  3I39 X;  4R5K A;  1SU6 A;  2EWF A;  3DPO A;  4IWP A;  4LEZ A;  4NXV A;  1UPX A;  5D62 A;  4IWO A;  3NKU A;  4NXU A;  2JNS A;  4M0M A;  4UDY X;  4EZO A;  2QFF A;  4MKP A;  2Z8Y A;  4HR1 A;  4K9A A;  3C7N A;  3MCR A;  5CFS A;  2QXL A;  3PHZ A;  4NXW A;  4EZS A;  4F01 A;  2YI9 A;  3K7D A;  1MJG A;  3OWG A;  2YIV X;  2GA9 D;  3L3O M;  3ZED A;  5D61 A;  5CHE A;  3O3O B;  4JNE A;  3QA8 A;  3RV1 A;  4F00 A;  1DKX A;  2X5C A;  2YIB A;  5TKY A;  3KAW A;  4KIK B;  2B51 A;  4N7R A;  2N3K A;  4EZZ A;  5E84 A;  4O68 A;  2PY6 A;  4JWD A;  4JLC A;  4JN4 A;  4R5L A;  1SU8 A;  5FIG A;  4PO2 A;  4EZN A;  4IWQ A;  3D2F A;  1GPJ A;  4K8V A;  4O6A A;  4G6Q A;  4JWE A;  4EZX A;  4H6H A;  2ND1 A;  4JNF A;  4OAF A;  3T48 A;  4E81 A;  3ERC C;  1DKZ A;  4IM0 A;  4B9Q A;  4IM3 A;  2NCZ A;  4JWC A;  3I01 A;  5B3Q A;  2FCL A;  3B52 X;  4R5I A;  1U00 A;  4IM2 A;  5B3P A;  2YI8 A;  4EZQ A;  4WH5 A;  4OAI Z;  4LEW A;  2WIN M;  2YIA A;  3DPQ A;  2EWR A;  5CFT A;  3T46 A;  1SU7 A;  4LEY A;  4KM5 A;  2LM0 A;  3D2E A;  4JLZ A;  5CFU A;  2B56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...