3ERCC

Crystal structure of the heterodimeric vaccinia virus mrna polyadenylate polymerase with three fragments of rna and 3'-deoxy atp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
468
structure length
445
Chain Sequence
NITLKIIETYLGRVPSVNEYHMLKSQARNIQKITVFNKDIFVSLVKKNKKRFFSDVNTSASEIKDRILSYFSKQTQTYNIGKLFTIIELQSVLVTTYTDILGVLTINVTSMEELARDMLNSMNVAVVSSLVKNVNKLMEEYLRRHNKSCICYGSYSLYLINPNIRYGDIDILQTNSRTFLIDLAFLIKFITGNNIILSKIPYLRNYMVIKDENDNHIIDSFNIRQDTMNVVPKIFIDNIYIVDPTFQLLNMIKMFSQIDRLEDLSKDPEKFNARMATMLEYVRYTHGIVFDGKRNNMPMKCIIDENNRIVTVTTKDYFSFKKCLVYLDENVLSSDILDLNADTSCDFESVTNSVYLIHDNIMYTYFSNTILLSDKGKVHEISARGLCAHILLYQMLTSGEYKQCLSDLLNSMMNRDKIPIYSHTERDKKPGRHGFINIEKDIIVF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerase Translocation with Respect to Single-Stranded Nucleic Acid: Looping or Wrapping of Primer around a Poly(A) Polymerase
pubmed doi rcsb
source organism Vaccinia virus wr
molecule tags Transcription, transferase/dna, rna
molecule keywords Cap-specific mRNA (nucleoside-2'-O-)-methyltransferase
total genus 136
structure length 445
sequence length 468
chains with identical sequence D
ec nomenclature ec 2.7.7.19: Polynucleotide adenylyltransferase.
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF03296 Pox_polyA_pol Poxvirus poly(A) polymerase nucleotidyltransferase domain
C PF12629 Pox_polyA_pol_C Poxvirus poly(A) polymerase C-terminal domain
C PF12630 Pox_polyA_pol_N Poxvirus poly(A) polymerase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1270.320 Mainly Alpha Up-down Bundle Substrate Binding Domain Of Dnak; Chain:A; Domain 2 Substrate Binding Domain Of Dnak; Chain:A; Domain 2 3ercC01
3.30.460.60 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase; domain 2 3ercC03
2GAFD 3ER9B 3OWGA 3ERCC 2GA9D 3ER8C
chains in the Genus database with same CATH superfamily
5J0PA 3LLLA 4K98A 4EZZA 4NXXA 3BUPA 4QZEA 4I2AA 5IIKA 3ACOA 4QZCA 4PHPA 4RQ4A 1ZQKA 5CHEA 2ZHAA 5D61A 9ICRA 4X4UA 4FHWA 1KEJA 4ATBA 5IIIA 5HRBA 4QZBA 3UQ0A 4I2CA 4WC2A 4AZGA 5J29A 4RQ0A 4JN4A 4WCWA 1ZQHA 3MBYA 2ZH5A 2KHOA 2M2UA 3T47A 3KAVA 7ICKA 3JPTA 1BPZA 3EJSA 4UB5A 4IQWA 4KLGA 2OW6A 4AZHA 2PMRA 3RV0A 4KLOA 3VKHA 1HTYA 2ND1A 4LVSA 2M2TA 4E80A 2Z0NA 2WYHA 4FO1A 4R5LA 5HHIA 2FMQA 9ICEA 3O3NB 5C5BB 2DVIA 1ZQXA 1TQSA 4F5QA 2ZH4A 3SOGA 2ND0A 3D4YA 1RPLA 3UITA 1R8BA 8ICWA 7ICNA 4PGXA 4I2FA 5HRDA 5CJ7A 4NLZA 3F7WA 4UB3A 7ICVA 4GXJA 5J0WA 8ICEA 1UPXA 1XSNA 4AT8B 4PGQA 4RQ2A 3OUYA 4X0BA 4AZ5A 3WFQE 8ICZA 3UXOA 1O7DC 8ICHA 3BVVA 2DR5A 2ZH7A 2BCQA 4NLKA 3D51A 3OGUA 4JWMA 4XQ8A 1R33A 3ERCC 4R5IA 4TUPA 1QWNA 2RAJA 1ZQWA 4EZRA 3QNIA 4QZAA 4M9HA 8ICXA 1I4TA 3UXNA 2ZH8A 3B0XA 1F5AA 4LZDA 9ICNA 5DB9A 4YMOA 3TFSA 7ICSA 4I2GA 5D63A 1KNYA 3L3PA 4PGYA 2Z0VA 3OK8A 3ISDA 2X3XA 4E81A 5DECA 4UBCA 5E84A 1ZQGA 4KB6A 4XUSA 4K4IA 2O0I1 1NOMA 1JQRA 1BPDA 3OVBA 2BCUA 1R5EA 3G9GA 1X04A 2X3VA 9ICXA 1LQ7A 3JPSA 2MI7A 4EZTA 4FZSA 4KLDA 3DYTA 4MFCA 4NXUA 4IWQA 4WC4A 1ZQPA 4UAWA 4EBKA 2HN2A 3C5FA 9ICJA 2DRBA 5DBBA 1XSPA 4WQLA 3BVTA 2YLAA 2RT6A 4EZPA 4WC1A 2PY6A 4RWOA 4LT6A 3BUIA 3OV7A 4K4GA 3T48A 5F2VO 2PFNA 2NCZA 2EFKA 1MIYA 4EV6A 4X4NA 1QX1A 3JCFA 3HX0A 3B53X 1DKXA 1QWUA 4XA5A 1ZQCA 1DKYA 4M9LA 3C66A 3PMNA 2ID1A 3JPPA 5C5BA 2IHMA 3WFPA 3QA8A 3DPOA 3DDGA 4M9GA 2OZNB 3BVUA 3L3OM 3JPOA 3OVSA 7ICFA 1X03A 1URUA 1WOTA 4E8FA 3BLBA 3HAHA 2X3WA 4MKPA 4XQ7A 5TZVA 2PFPA 1GNLA 4RT2A 1SU6A 4EZSA 5CWRA 4PO2A 1ZQIA 3SYVA 2YIAA 4S3NA 2F7RA 4RPYA 3L9DA 1HUOA 4JLXA 1GN9A 4KM5A 4NQIA 4EBJA 3RH5A 9ICKA 4NM1A 4EZVA 1ZQMA 5BOLA 8ICOA 4R64A 1JMSA 5D62A 4ATMA 4AZIA 4N7RA 4UDXX 5J0OA 3RJFA 4KLMA 5CFTA 4K96A 1ZJNA 4FO6A 4WOYA 4R65A 8ICRA 4K9BA 3RPMA 5BPCA 9ICFA 3I39X 5J0RA 2B4VA 3UPSA 2NRKA 1TV9A 9ICBA 1SU8A 5DB6A 4KLJA 1FA0A 1YWMA 5J0TA 4K9AA 9ICAA 3B52X 2BPGA 5DB8A 2ZH2A 4O69A 4JLZA 3AU6A 1TVAA 1GPJA 4NY8A 8ICNA 2OW7A 2YKTA 4UAYA 4WC0A 4RT3A 4X4PA 4RPZA 3NWIA 2F1AA 3CK6A 4X4QA 8ICBA 1HUZA 2RAKA 1ZQBA 4EZUA 4X0AA 3D4ZA 3WFSC 3O3MB 2BPCA 3LQCB 2YI9A 4IW0A 5DDMA 2BCRA 3GDXA 3NVOA 2Z0OA 5IIOA 2M2WA 5CFSA 5J2DA 4I27A 3T4AG 2GA9D 2ZH3A 3B51X 3LK9A 9ICSA 4Z6CA 1MIWA 3CKDA 4DOBA 4EZXA 3HW8A 2WINM 3V7JA 1BPXA 3Q0KA 4I29A 4Z6EA 4WPCA 4RQ3A 4IM3A 3RH6A 5DBCA 4YD2A 1ZQEA 1NO5A 4EZOA 4XRHA 4UB4A 3ABHA 3JZ0A 2RFFA 5D49A 4O5KA 4FM3A 2DR8A 3FD9A 4FZOA 2FCLA 5CFUA 1ZQAA 4XJEA 4P4PA 2VANA 3AQKA 4M04A 4QZHA 4O68A 3C2KA 4F5OA 1RZTA 2I9GA 2YLLA 5B3PA 4QZFA 1MQ3A 2F7QA 1JQKA 4DO9A 4IQVA 1YLQA 2P66A 3NKUA 2ZH6A 2QXLA 8ICJA 4M5DA 5J2CA 4Z6FA 4X4RA 1E9VA 8ICMA 3MCRA 4LZGA 9ICCA 7ICJA 8ICFA 3HJ1A 5J0UA 7ICUA 1BPYA 4FZPA 2B56A 5B3QA 3C5GA 1ZQUA 1TFWA 2JNSA 3HAIA 4NSWA 5HRKA 1U00A 3RH4A 4H6HA 1ZQNA 1VJ7A 5J2HA 4YN4A 1SUFA 1ZJMA 1XSLA 2OBMA 3D2FA 1R89A 8ICTA 5CA7A 4LEZA 4NM2A 8ICYA 2EWFA 5HRIA 1SU7A 4AT9A 4AT8A 1JN3A 4AVMA 3JPRA 8ICGA 2FICA 4ATBB 3V7KA 4I2DA 3KAWA 5J0XA 4KLIA 3PLTA 4B9QA 3CZNA 5DB7A 1BPEA 4WBZA 3UQ2A 3EF2A 5HRGA 1MQ2A 9ICHA 3M3WA 3C18A 3HIYA 2BCVA 5J2BA 2D1LA 3BVWA 3EJPA 3A98A 4R5KA 4UAZA 3TFRA 2YI8A 7ICLA 3O3OB 8ICLA 5CHGA 3HJ4A 2IHOA 2ISPA 2PBEA 4JWEA 2FMPA 2O1PA 2DRAA 5CP2A 2PXIA 3QE6A 3CAZA 4AZCB 3RJGA 5D46A 7ICGA 4EZQA 4QZDA 4UDYX 4MFAA 4K97A 4M9NA 2Z8YA 3DX4A 4DYLA 1V4AA 3RJKA 5HRLA 2C08A 3QNJA 4JWCA 4X4TA 1ZQFA 8ICQA 2DR7A 9ICWA 9ICQA 1Q79A 3RJEA 3DX0A 1UETA 4F5NA 4YD1A 4M0AA 4OAFA 4P4OA 1I4LA 8ICCA 4NXVA 4IWOA 5J0SA 4YCXA 2F1BA 4HX0A 4OAGA 2F18A 3BUDA 1ZQOA 4K99A 3BVXA 4TURA 4KLHA 1TQVA 3EJQA 3GI7A 4F01A 1HXKA 3C7NA 1TQUA 4HY9A 7ICRA 4NLNA 2HN1A 3K7DA 1ZQLA 1HWWA 3EJTA 4EZYA 4F5PA 4Z6DA 4QZ9A 2EX3B 7ICTA 4PHAA 4JNEA 4WH5A 3MDAA 2PFQA 1Y2OA 5FLEX 4YMMA 4DOCA 4O5EA 3ER8C 4I2JA 4PHDA 4EZNA 5IIJA 4RWPA 2V0OA 3AQNA 4AZ7A 4F5RA 4AZCA 3AQLA 4M0MA 3PNCA 4UD5A 4PH5A 3OWGA 3B0YA 4QZ8A 3VEBA 3CZSA 1OA0A 2D4CA 4EP7A 5EOZA 4M9JA 3D50A 9ICUA 4AZBA 4I2IA 3DX3A 4H6IA 4EEBA 4JWIA 3V7LA 3OUYB 4AKVA 2YL8A 3OHXM 4LEVA 3MDCA 2ZHBA 2ZH9A 7ICIA 5J2FA 3D2EA 2WYIA 3BUBA 4KLFA 5IIMA 4P2HA 3I2WA 7ICHA 1OA1A 3BUQA 3LVTA 4FHYA 4NKTA 4YMNA 4RWNA 2HHPA 7ICMA 4H8SA 2FYVA 2OO2A 3H39A 2B51A 4HYBA 4RQ6A 1O7DB 4GXIA 5J2EA 2YL5A 3ZEDA 4TUSA 4I28A 5DDYA 4JL9A 5DKWA 4AT7B 4I2HA 4EZWA 1PX5A 5HRHA 4MF2A 2ZH1A 7ICEA 9ICOA 4NXWA 1W9MA 2JNKA 7ICOA 4MF8A 1ZQRA 1ZQYA 5FIGA 1MJGA 3DPQA 2IUBA 2ALWA 1JAJA 8ICSA 3JYYA 1ZQZA 4QZGA 4RQ8A 3H37A 4UB2A 1TFYA 2Q66A 1I4DA 4IM2A 9ICMA 2YL9A 3RJIA 5D4BA 8ICVA 4GXKA 2BCSA 4KIKB 1PS3A 3T49A 4UD4A 3K75D 5HREA 3MGHA 3V72A 5BOMA 2BPFA 4M47A 2BBJA 3RV1A 4WC5A 9ICGA 4NKUA 4TUQA 2ISOA 4I2BA 4K8VA 2ZXQA 2LXYA 4DOAA 4OAHA 1R34A 3VEAA 4R5GA 4FH5A 4MFFA 1R8CA 2OBLA 3H3AA 4X5VA 2PFOA 5DEDA 1ZQJA 3UPQA 1MIVA 4R66A 8ICKA 1BPBA 3T46A 4NXZA 2BBHA 8ICPA 4NXTA 4I1QA 4E7XA 4NPHA 2W9MA 5J2KA 4WC6A 3C2MA 1R8AA 5HC9A 3ER9B 4EEDA 1KDHA 2YL6A 2ELBA 4WC7A 4P4MA 4I2EA 4FHVA 4IQUA 2N3KA 4AT7A 4UB1A 8ICIA 2O5AA 4DCNC 3HWTA 3D52A 3ISCA 4KLQA 3I01A 1VFGA 5J0YA 3C2LA 4D8JA 4KLEA 5J0QA 5DBAA 4OAIZ 2YIBA 4HR1A 4O9MA 9ICIA 5J2JA 4M2YA 3H38A 4JWNA 4WC3A 2FMSA 1ZQQA 2EFLA 3UXPA 1GNTA 1OAOA 4R63A 1ZWWA 2F7OA 5CR0A 3JPNA 5JTGA 4LEWA 4FHXA 4O67A 4RWQA 4R5JA 5J2AA 4RPXA 3AUOA 3RJJA 3HAJA 3Q84A 1E1DA 2X5CA 3ISBA 5J2GA 2GF4A 4JLCA 1UEVA 9ICVA 5KBPA 9ICTA 4EGWA 4PPXA 4JNFA 5IILA 4HR1B 2EWRA 1DKZA 4WQKA 2LM0A 3OVAA 3WFRE 3PHZA 4QZIA 4LEYA 1OU5A 2DR9A 2F7PA 4IWPA 1ZQVA 3EJRA 3AQMA 5CB1A 2Q13A 3EJUA 5TKYA 4K4HA 4AT9B 4IQTA 8ICAA 4I0UA 1UEUA 4WPEA 4RQ5A 2GAFD 4IM0A 4KLSA 5HHHA 3JPQA 4O6AA 4E3CA 2QFFA 2Q12A 3DX1A 4JWDA 3WFOA 2QKWA 3I04A 4G6QA 3QWEA 3AU2A 1ZQSA 7ICPA 4KLTA 4RQ1A 4O5CA 1I49A 3RJHA 3DPPA 4BNEA 3CV5A 1Q78A 9ICPA 4X4SA 5J2IA 7ICQA 3DX2A 4F00A 1ZYLA 3KDRA 4WBYA 4PHEA 4KIKA 2GWSA 4FH3A 4X4OA 4AZ6A 1E2UA 4FHPA 3MGIA 1ZQDA 3DDFA 3LMFA 8ICUA 1ZQTA 1WDZA 5IINA 4KLLA 4KLUA 1TQTA 2M2VA 4IG8A 1TQWA 2YIVX 5HR9A 4UBBA 4X4VA 9ICLA 3PMLA 2BE3A 3NYBA 2RAIA 5HRFA 4RQ7A 3CVRA
chains in the Genus database with same CATH topology
1SUFA 4K98A 2OBMA 3D2FA 4EZZA 4NXXA 4LEZA 4IM2A 2EWFA 1SU7A 5CHEA 5D61A 4MKPA 4KIKB 1GNLA 1SU6A 3KAWA 3T49A 4EZSA 4PO2A 2YIAA 3RV1A 4JN4A 4B9QA 4K8VA 3EF2A 2KHOA 4JLXA 1GN9A 3KAVA 4R5GA 3T47A 3VEAA 4KM5A 2OBLA 4EZVA 4OAHA 5D62A 3RV0A 4N7RA 3VKHA 4UDXX 2ND1A 5CFTA 4R5KA 4K96A 3A98A 3T46A 2YI8A 3O3OB 4NXTA 4WOYA 4K9BA 4FO1A 4NPHA 4R5LA 2IHOA 3I39X 3O3NB 4JWEA 2B4VA 1SU8A 3ER9B 4EZQA 2ND0A 4UDYX 3UITA 4K9AA 4K97A 3B52X 2N3KA 2Z8YA 3F7WA 4O69A 4JLZA 1GPJA 3QNJA 1UPXA 4JWCA 3I01A 4D8JA 4OAIZ 2YIBA 4OAFA 1U00A 4HR1A 4NXVA 4IWOA 4EZUA 4HX0A 4OAGA 1GNTA 3O3MB 4K99A 1OAOA 2YI9A 3GI7A 4IW0A 4F01A 3C7NA 4R5IA 3ERCC 4LEWA 5CFSA 4O67A 4EZRA 4R5JA 4HY9A 1E1DA 3T4AG 2X5CA 3K7DA 2GA9D 4JLCA 4EZYA 3B51X 2EX3B 4JNEA 4JNFA 4WH5A 4HR1B 2EWRA 1DKZA 4WQKA 5D63A 2LM0A 3PHZA 5FLEX 4LEYA 4EZXA 4E81A 4IWPA 2WINM 5E84A 3ER8C 4KB6A 4EZNA 4IM3A 4EZOA 5TKYA 4M0MA 2GAFD 4FM3A 4IM0A 4EZTA 3FD9A 3OWGA 4O6AA 4E3CA 2QFFA 3VEBA 2FCLA 1OA0A 4JWDA 4NXUA 5CFUA 4IWQA 4XJEA 3I04A 4G6QA 4H6IA 4JWIA 4O68A 3OHXM 4LEVA 4WQLA 5B3PA 3D2EA 1JQKA 3DPPA 1OA1A 4EZPA 2PY6A 3NKUA 2QXLA 4F00A 3T48A 1ZYLA 3KDRA 4HYBA 2B51A 1E9VA 2NCZA 4KIKA 3ZEDA 1E2UA 4JL9A 3B53X 1DKXA 3MCRA 3LMFA 4EZWA 1DKYA 4NXWA 1W9MA 2B56A 5B3QA 2YIVX 3QA8A 5FIGA 1MJGA 2JNSA 3DPOA 3DPQA 2RT6A 3L3OM 4H6HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GAF D;  3ER9 B;  3OWG A;  3ERC C;  2GA9 D;  3ER8 C; 
#chains in the Genus database with same CATH topology
 5J0P A;  3LLL A;  4K98 A;  4EZZ A;  4NXX A;  3BUP A;  4QZE A;  4I2A A;  5IIK A;  3ACO A;  4QZC A;  4PHP A;  4RQ4 A;  1ZQK A;  5CHE A;  2ZHA A;  5D61 A;  9ICR A;  4X4U A;  4FHW A;  1KEJ A;  4ATB A;  5III A;  5HRB A;  4QZB A;  3UQ0 A;  4I2C A;  4WC2 A;  4AZG A;  5J29 A;  4RQ0 A;  4JN4 A;  4WCW A;  1ZQH A;  3MBY A;  2ZH5 A;  2KHO A;  2M2U A;  3T47 A;  3KAV A;  7ICK A;  3JPT A;  1BPZ A;  3EJS A;  4UB5 A;  4IQW A;  4KLG A;  2OW6 A;  4AZH A;  2PMR A;  3RV0 A;  4KLO A;  3VKH A;  1HTY A;  2ND1 A;  4LVS A;  2M2T A;  4E80 A;  2Z0N A;  2WYH A;  4FO1 A;  4R5L A;  5HHI A;  2FMQ A;  9ICE A;  3O3N B;  5C5B B;  2DVI A;  1ZQX A;  1TQS A;  4F5Q A;  2ZH4 A;  3SOG A;  2ND0 A;  3D4Y A;  1RPL A;  3UIT A;  1R8B A;  8ICW A;  7ICN A;  4PGX A;  4I2F A;  5HRD A;  5CJ7 A;  4NLZ A;  3F7W A;  4UB3 A;  7ICV A;  4GXJ A;  5J0W A;  8ICE A;  1UPX A;  1XSN A;  4AT8 B;  4PGQ A;  4RQ2 A;  3OUY A;  4X0B A;  4AZ5 A;  3WFQ E;  8ICZ A;  3UXO A;  1O7D C;  8ICH A;  3BVV A;  2DR5 A;  2ZH7 A;  2BCQ A;  4NLK A;  3D51 A;  3OGU A;  4JWM A;  4XQ8 A;  1R33 A;  3ERC C;  4R5I A;  4TUP A;  1QWN A;  2RAJ A;  1ZQW A;  4EZR A;  3QNI A;  4QZA A;  4M9H A;  8ICX A;  1I4T A;  3UXN A;  2ZH8 A;  3B0X A;  1F5A A;  4LZD A;  9ICN A;  5DB9 A;  4YMO A;  3TFS A;  7ICS A;  4I2G A;  5D63 A;  1KNY A;  3L3P A;  4PGY A;  2Z0V A;  3OK8 A;  3ISD A;  2X3X A;  4E81 A;  5DEC A;  4UBC A;  5E84 A;  1ZQG A;  4KB6 A;  4XUS A;  4K4I A;  2O0I 1;  1NOM A;  1JQR A;  1BPD A;  3OVB A;  2BCU A;  1R5E A;  3G9G A;  1X04 A;  2X3V A;  9ICX A;  1LQ7 A;  3JPS A;  2MI7 A;  4EZT A;  4FZS A;  4KLD A;  3DYT A;  4MFC A;  4NXU A;  4IWQ A;  4WC4 A;  1ZQP A;  4UAW A;  4EBK A;  2HN2 A;  3C5F A;  9ICJ A;  2DRB A;  5DBB A;  1XSP A;  4WQL A;  3BVT A;  2YLA A;  2RT6 A;  4EZP A;  4WC1 A;  2PY6 A;  4RWO A;  4LT6 A;  3BUI A;  3OV7 A;  4K4G A;  3T48 A;  5F2V O;  2PFN A;  2NCZ A;  2EFK A;  1MIY A;  4EV6 A;  4X4N A;  1QX1 A;  3JCF A;  3HX0 A;  3B53 X;  1DKX A;  1QWU A;  4XA5 A;  1ZQC A;  1DKY A;  4M9L A;  3C66 A;  3PMN A;  2ID1 A;  3JPP A;  5C5B A;  2IHM A;  3WFP A;  3QA8 A;  3DPO A;  3DDG A;  4M9G A;  2OZN B;  3BVU A;  3L3O M;  3JPO A;  3OVS A;  7ICF A;  1X03 A;  1URU A;  1WOT A;  4E8F A;  3BLB A;  3HAH A;  2X3W A;  4MKP A;  4XQ7 A;  5TZV A;  2PFP A;  1GNL A;  4RT2 A;  1SU6 A;  4EZS A;  5CWR A;  4PO2 A;  1ZQI A;  3SYV A;  2YIA A;  4S3N A;  2F7R A;  4RPY A;  3L9D A;  1HUO A;  4JLX A;  1GN9 A;  4KM5 A;  4NQI A;  4EBJ A;  3RH5 A;  9ICK A;  4NM1 A;  4EZV A;  1ZQM A;  5BOL A;  8ICO A;  4R64 A;  1JMS A;  5D62 A;  4ATM A;  4AZI A;  4N7R A;  4UDX X;  5J0O A;  3RJF A;  4KLM A;  5CFT A;  4K96 A;  1ZJN A;  4FO6 A;  4WOY A;  4R65 A;  8ICR A;  4K9B A;  3RPM A;  5BPC A;  9ICF A;  3I39 X;  5J0R A;  2B4V A;  3UPS A;  2NRK A;  1TV9 A;  9ICB A;  1SU8 A;  5DB6 A;  4KLJ A;  1FA0 A;  1YWM A;  5J0T A;  4K9A A;  9ICA A;  3B52 X;  2BPG A;  5DB8 A;  2ZH2 A;  4O69 A;  4JLZ A;  3AU6 A;  1TVA A;  1GPJ A;  4NY8 A;  8ICN A;  2OW7 A;  2YKT A;  4UAY A;  4WC0 A;  4RT3 A;  4X4P A;  4RPZ A;  3NWI A;  2F1A A;  3CK6 A;  4X4Q A;  8ICB A;  1HUZ A;  2RAK A;  1ZQB A;  4EZU A;  4X0A A;  3D4Z A;  3WFS C;  3O3M B;  2BPC A;  3LQC B;  2YI9 A;  4IW0 A;  5DDM A;  2BCR A;  3GDX A;  3NVO A;  2Z0O A;  5IIO A;  2M2W A;  5CFS A;  5J2D A;  4I27 A;  3T4A G;  2GA9 D;  2ZH3 A;  3B51 X;  3LK9 A;  9ICS A;  4Z6C A;  1MIW A;  3CKD A;  4DOB A;  4EZX A;  3HW8 A;  2WIN M;  3V7J A;  1BPX A;  3Q0K A;  4I29 A;  4Z6E A;  4WPC A;  4RQ3 A;  4IM3 A;  3RH6 A;  5DBC A;  4YD2 A;  1ZQE A;  1NO5 A;  4EZO A;  4XRH A;  4UB4 A;  3ABH A;  3JZ0 A;  2RFF A;  5D49 A;  4O5K A;  4FM3 A;  2DR8 A;  3FD9 A;  4FZO A;  2FCL A;  5CFU A;  1ZQA A;  4XJE A;  4P4P A;  2VAN A;  3AQK A;  4M04 A;  4QZH A;  4O68 A;  3C2K A;  4F5O A;  1RZT A;  2I9G A;  2YLL A;  5B3P A;  4QZF A;  1MQ3 A;  2F7Q A;  1JQK A;  4DO9 A;  4IQV A;  1YLQ A;  2P66 A;  3NKU A;  2ZH6 A;  2QXL A;  8ICJ A;  4M5D A;  5J2C A;  4Z6F A;  4X4R A;  1E9V A;  8ICM A;  3MCR A;  4LZG A;  9ICC A;  7ICJ A;  8ICF A;  3HJ1 A;  5J0U A;  7ICU A;  1BPY A;  4FZP A;  2B56 A;  5B3Q A;  3C5G A;  1ZQU A;  1TFW A;  2JNS A;  3HAI A;  4NSW A;  5HRK A;  1U00 A;  3RH4 A;  4H6H A;  1ZQN A;  1VJ7 A;  5J2H A;  4YN4 A;  1SUF A;  1ZJM A;  1XSL A;  2OBM A;  3D2F A;  1R89 A;  8ICT A;  5CA7 A;  4LEZ A;  4NM2 A;  8ICY A;  2EWF A;  5HRI A;  1SU7 A;  4AT9 A;  4AT8 A;  1JN3 A;  4AVM A;  3JPR A;  8ICG A;  2FIC A;  4ATB B;  3V7K A;  4I2D A;  3KAW A;  5J0X A;  4KLI A;  3PLT A;  4B9Q A;  3CZN A;  5DB7 A;  1BPE A;  4WBZ A;  3UQ2 A;  3EF2 A;  5HRG A;  1MQ2 A;  9ICH A;  3M3W A;  3C18 A;  3HIY A;  2BCV A;  5J2B A;  2D1L A;  3BVW A;  3EJP A;  3A98 A;  4R5K A;  4UAZ A;  3TFR A;  2YI8 A;  7ICL A;  3O3O B;  8ICL A;  5CHG A;  3HJ4 A;  2IHO A;  2ISP A;  2PBE A;  4JWE A;  2FMP A;  2O1P A;  2DRA A;  5CP2 A;  2PXI A;  3QE6 A;  3CAZ A;  4AZC B;  3RJG A;  5D46 A;  7ICG A;  4EZQ A;  4QZD A;  4UDY X;  4MFA A;  4K97 A;  4M9N A;  2Z8Y A;  3DX4 A;  4DYL A;  1V4A A;  3RJK A;  5HRL A;  2C08 A;  3QNJ A;  4JWC A;  4X4T A;  1ZQF A;  8ICQ A;  2DR7 A;  9ICW A;  9ICQ A;  1Q79 A;  3RJE A;  3DX0 A;  1UET A;  4F5N A;  4YD1 A;  4M0A A;  4OAF A;  4P4O A;  1I4L A;  8ICC A;  4NXV A;  4IWO A;  5J0S A;  4YCX A;  2F1B A;  4HX0 A;  4OAG A;  2F18 A;  3BUD A;  1ZQO A;  4K99 A;  3BVX A;  4TUR A;  4KLH A;  1TQV A;  3EJQ A;  3GI7 A;  4F01 A;  1HXK A;  3C7N A;  1TQU A;  4HY9 A;  7ICR A;  4NLN A;  2HN1 A;  3K7D A;  1ZQL A;  1HWW A;  3EJT A;  4EZY A;  4F5P A;  4Z6D A;  4QZ9 A;  2EX3 B;  7ICT A;  4PHA A;  4JNE A;  4WH5 A;  3MDA A;  2PFQ A;  1Y2O A;  5FLE X;  4YMM A;  4DOC A;  4O5E A;  3ER8 C;  4I2J A;  4PHD A;  4EZN A;  5IIJ A;  4RWP A;  2V0O A;  3AQN A;  4AZ7 A;  4F5R A;  4AZC A;  3AQL A;  4M0M A;  3PNC A;  4UD5 A;  4PH5 A;  3OWG A;  3B0Y A;  4QZ8 A;  3VEB A;  3CZS A;  1OA0 A;  2D4C A;  4EP7 A;  5EOZ A;  4M9J A;  3D50 A;  9ICU A;  4AZB A;  4I2I A;  3DX3 A;  4H6I A;  4EEB A;  4JWI A;  3V7L A;  3OUY B;  4AKV A;  2YL8 A;  3OHX M;  4LEV A;  3MDC A;  2ZHB A;  2ZH9 A;  7ICI A;  5J2F A;  3D2E A;  2WYI A;  3BUB A;  4KLF A;  5IIM A;  4P2H A;  3I2W A;  7ICH A;  1OA1 A;  3BUQ A;  3LVT A;  4FHY A;  4NKT A;  4YMN A;  4RWN A;  2HHP A;  7ICM A;  4H8S A;  2FYV A;  2OO2 A;  3H39 A;  2B51 A;  4HYB A;  4RQ6 A;  1O7D B;  4GXI A;  5J2E A;  2YL5 A;  3ZED A;  4TUS A;  4I28 A;  5DDY A;  4JL9 A;  5DKW A;  4AT7 B;  4I2H A;  4EZW A;  1PX5 A;  5HRH A;  4MF2 A;  2ZH1 A;  7ICE A;  9ICO A;  4NXW A;  1W9M A;  2JNK A;  7ICO A;  4MF8 A;  1ZQR A;  1ZQY A;  5FIG A;  1MJG A;  3DPQ A;  2IUB A;  2ALW A;  1JAJ A;  8ICS A;  3JYY A;  1ZQZ A;  4QZG A;  4RQ8 A;  3H37 A;  4UB2 A;  1TFY A;  2Q66 A;  1I4D A;  4IM2 A;  9ICM A;  2YL9 A;  3RJI A;  5D4B A;  8ICV A;  4GXK A;  2BCS A;  4KIK B;  1PS3 A;  3T49 A;  4UD4 A;  3K75 D;  5HRE A;  3MGH A;  3V72 A;  5BOM A;  2BPF A;  4M47 A;  2BBJ A;  3RV1 A;  4WC5 A;  9ICG A;  4NKU A;  4TUQ A;  2ISO A;  4I2B A;  4K8V A;  2ZXQ A;  2LXY A;  4DOA A;  4OAH A;  1R34 A;  3VEA A;  4R5G A;  4FH5 A;  4MFF A;  1R8C A;  2OBL A;  3H3A A;  4X5V A;  2PFO A;  5DED A;  1ZQJ A;  3UPQ A;  1MIV A;  4R66 A;  8ICK A;  1BPB A;  3T46 A;  4NXZ A;  2BBH A;  8ICP A;  4NXT A;  4I1Q A;  4E7X A;  4NPH A;  2W9M A;  5J2K A;  4WC6 A;  3C2M A;  1R8A A;  5HC9 A;  3ER9 B;  4EED A;  1KDH A;  2YL6 A;  2ELB A;  4WC7 A;  4P4M A;  4I2E A;  4FHV A;  4IQU A;  2N3K A;  4AT7 A;  4UB1 A;  8ICI A;  2O5A A;  4DCN C;  3HWT A;  3D52 A;  3ISC A;  4KLQ A;  3I01 A;  1VFG A;  5J0Y A;  3C2L A;  4D8J A;  4KLE A;  5J0Q A;  5DBA A;  4OAI Z;  2YIB A;  4HR1 A;  4O9M A;  9ICI A;  5J2J A;  4M2Y A;  3H38 A;  4JWN A;  4WC3 A;  2FMS A;  1ZQQ A;  2EFL A;  3UXP A;  1GNT A;  1OAO A;  4R63 A;  1ZWW A;  2F7O A;  5CR0 A;  3JPN A;  5JTG A;  4LEW A;  4FHX A;  4O67 A;  4RWQ A;  4R5J A;  5J2A A;  4RPX A;  3AUO A;  3RJJ A;  3HAJ A;  3Q84 A;  1E1D A;  2X5C A;  3ISB A;  5J2G A;  2GF4 A;  4JLC A;  1UEV A;  9ICV A;  5KBP A;  9ICT A;  4EGW A;  4PPX A;  4JNF A;  5IIL A;  4HR1 B;  2EWR A;  1DKZ A;  4WQK A;  2LM0 A;  3OVA A;  3WFR E;  3PHZ A;  4QZI A;  4LEY A;  1OU5 A;  2DR9 A;  2F7P A;  4IWP A;  1ZQV A;  3EJR A;  3AQM A;  5CB1 A;  2Q13 A;  3EJU A;  5TKY A;  4K4H A;  4AT9 B;  4IQT A;  8ICA A;  4I0U A;  1UEU A;  4WPE A;  4RQ5 A;  2GAF D;  4IM0 A;  4KLS A;  5HHH A;  3JPQ A;  4O6A A;  4E3C A;  2QFF A;  2Q12 A;  3DX1 A;  4JWD A;  3WFO A;  2QKW A;  3I04 A;  4G6Q A;  3QWE A;  3AU2 A;  1ZQS A;  7ICP A;  4KLT A;  4RQ1 A;  4O5C A;  1I49 A;  3RJH A;  3DPP A;  4BNE A;  3CV5 A;  1Q78 A;  9ICP A;  4X4S A;  5J2I A;  7ICQ A;  3DX2 A;  4F00 A;  1ZYL A;  3KDR A;  4WBY A;  4PHE A;  4KIK A;  2GWS A;  4FH3 A;  4X4O A;  4AZ6 A;  1E2U A;  4FHP A;  3MGI A;  1ZQD A;  3DDF A;  3LMF A;  8ICU A;  1ZQT A;  1WDZ A;  5IIN A;  4KLL A;  4KLU A;  1TQT A;  2M2V A;  4IG8 A;  1TQW A;  2YIV X;  5HR9 A;  4UBB A;  4X4V A;  9ICL A;  3PML A;  2BE3 A;  3NYB A;  2RAI A;  5HRF A;  4RQ7 A;  3CVR A; 
#chains in the Genus database with same CATH homology
 1SUF A;  4K98 A;  2OBM A;  3D2F A;  4EZZ A;  4NXX A;  4LEZ A;  4IM2 A;  2EWF A;  1SU7 A;  5CHE A;  5D61 A;  4MKP A;  4KIK B;  1GNL A;  1SU6 A;  3KAW A;  3T49 A;  4EZS A;  4PO2 A;  2YIA A;  3RV1 A;  4JN4 A;  4B9Q A;  4K8V A;  3EF2 A;  2KHO A;  4JLX A;  1GN9 A;  3KAV A;  4R5G A;  3T47 A;  3VEA A;  4KM5 A;  2OBL A;  4EZV A;  4OAH A;  5D62 A;  3RV0 A;  4N7R A;  3VKH A;  4UDX X;  2ND1 A;  5CFT A;  4R5K A;  4K96 A;  3A98 A;  3T46 A;  2YI8 A;  3O3O B;  4NXT A;  4WOY A;  4K9B A;  4FO1 A;  4NPH A;  4R5L A;  2IHO A;  3I39 X;  3O3N B;  4JWE A;  2B4V A;  1SU8 A;  3ER9 B;  4EZQ A;  2ND0 A;  4UDY X;  3UIT A;  4K9A A;  4K97 A;  3B52 X;  2N3K A;  2Z8Y A;  3F7W A;  4O69 A;  4JLZ A;  1GPJ A;  3QNJ A;  1UPX A;  4JWC A;  3I01 A;  4D8J A;  4OAI Z;  2YIB A;  4OAF A;  1U00 A;  4HR1 A;  4NXV A;  4IWO A;  4EZU A;  4HX0 A;  4OAG A;  1GNT A;  3O3M B;  4K99 A;  1OAO A;  2YI9 A;  3GI7 A;  4IW0 A;  4F01 A;  3C7N A;  4R5I A;  3ERC C;  4LEW A;  5CFS A;  4O67 A;  4EZR A;  4R5J A;  4HY9 A;  1E1D A;  3T4A G;  2X5C A;  3K7D A;  2GA9 D;  4JLC A;  4EZY A;  3B51 X;  2EX3 B;  4JNE A;  4JNF A;  4WH5 A;  4HR1 B;  2EWR A;  1DKZ A;  4WQK A;  5D63 A;  2LM0 A;  3PHZ A;  5FLE X;  4LEY A;  4EZX A;  4E81 A;  4IWP A;  2WIN M;  5E84 A;  3ER8 C;  4KB6 A;  4EZN A;  4IM3 A;  4EZO A;  5TKY A;  4M0M A;  2GAF D;  4FM3 A;  4IM0 A;  4EZT A;  3FD9 A;  3OWG A;  4O6A A;  4E3C A;  2QFF A;  3VEB A;  2FCL A;  1OA0 A;  4JWD A;  4NXU A;  5CFU A;  4IWQ A;  4XJE A;  3I04 A;  4G6Q A;  4H6I A;  4JWI A;  4O68 A;  3OHX M;  4LEV A;  4WQL A;  5B3P A;  3D2E A;  1JQK A;  3DPP A;  1OA1 A;  4EZP A;  2PY6 A;  3NKU A;  2QXL A;  4F00 A;  3T48 A;  1ZYL A;  3KDR A;  4HYB A;  2B51 A;  1E9V A;  2NCZ A;  4KIK A;  3ZED A;  1E2U A;  4JL9 A;  3B53 X;  1DKX A;  3MCR A;  3LMF A;  4EZW A;  1DKY A;  4NXW A;  1W9M A;  2B56 A;  5B3Q A;  2YIV X;  3QA8 A;  5FIG A;  1MJG A;  2JNS A;  3DPO A;  3DPQ A;  2RT6 A;  3L3O M;  4H6H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...