3ERED

Crystal structure of the arginine repressor protein from mycobacterium tuberculosis in complex with the dna operator
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
b'AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Crystal structure of the arginine repressor protein in complex with the DNA operator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01316 Arg_repressor Arginine repressor, DNA binding domain
D PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ereD01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ereD02
1QQIA 1Q1HA 3T0YA 3KETA 1IXSB 1G3YA 3BPVA 4RGSA 2P5MA 3BROA 2O6GE 2Z99A 4KDDA 2H27A 2FNAA 3WGHA 3I54A 3EDPA 1QZZA 3R4KA 4FHTA 4LB6B 3RPQA 2PLYA 3L7WA 3MCZA 4ZYEA 2OAZA 3ZN0A 3TQNA 4LJZF 1WIHA 1EH6A 4S04A 3RYPA 3SXYA 1XGNA 5E18F 4KDPA 5CYVA 1Z7UA 4UHTA 2O0YA 4HLYA 2MLGA 1DDNA 4UVAA 4WXDA 2STWA 1PP8F 3V7CA 1S29A 4HZFA 2GQQA 3B73A 3ISPA 3KP2A 2Z9OA 3QX3A 5FB2A 3O2PE 4U7DA 2EV5A 1OYIA 3WG9A 2DAOA 1TLHB 5FD5A 5ERIA 4IRHA 3CDHA 5CVJA 3QP6A 2QQBA 1ZG3A 2XASA 1FZPB 4KIBA 5ICEA 2MH9A 3S2WA 2D45A 4LMYA 2RVCA 3GYHX 1FY7A 4RS8A 3FMRA 1ZAOA 1O7LA 2HYFA 2OQRA 2GA2A 4MQVA 2FQ3A 1O3QA 1YFHA 4I7HA 1HBXG 2IJLA 3O6BB 3HYIA 4U88A 4RB1A 3F22A 4M6YA 4KUMA 1R1UA 3J80K 3TGNA 4JBAA 2HWVA 2FNPA 2W57A 2DK8A 4HV5A 1SFUA 4ZH4F 3FXQA 4EM1A 2LKPA 1O3SA 4CDGA 1WQHA 5AIQA 3VOEA 5J6XA 3GLXA 3ZMSA 4EM2A 2H94A 5D4RA 5DD4A 2FXAA 2H09A 1UB9A 3K9TA 2W84A 4CO8A 1TW3A 4RB3C 1OYYA 3HOSA 3RI4A 3ABUA 2MA3A 4YIIA 5ICFA 4RGRA 2WWYA 4A0ZA 1WWXA 4EJTA 4BQAA 4ENJA 3E5UA 5H20A 3VB2A 1I1SA 4DQ2A 3DP7A 5F64A 1O3TA 4Z2YA 1S6LA 1HKQA 4G6QA 4LG0A 4XRFA 4ESJA 1XXCA 2STTA 3WE2A 2MH2A 2R7DA 5EEGA 4L0YB 5L3GA 4TV7A 4A2UA 3CUQC 1CF7B 3ECHA 2CFXA 3CUQA 3ROUA 4UNOA 2D1VA 2QENA 2ZMEB 2IRFG 4LLNA 3BWGA 1MJBA 4BHPA 3FHZA 1RI7A 1XB4A 2BGCA 3I53A 4R8HA 3NUHA 2IP2A 1S7OA 4KYWA 1I6XA 5HVQC 4I2OA 3E6DA 1TQIA 3WTUC 5FFXA 2G7HA 3BJ6A 4LD5A 2XKPA 5F6FA 3GXOA 2BBYA 1OMIA 5ED4A 4IVNA 4YFXF 3J81Z 5JVTA 4CYDA 3K1PA 3DPLC 2HKOA 1XSXA 2DO7A 1K79A 3F21A 2A69F 1U5TC 3DF8A 1LVAA 1K78B 3KFWX 5IT9K 2PJPA 1BI2A 3RIRA 3SZPA 2ZO4A 2CWEA 3R6SA 4IF4A 1KGSA 3E97A 4OMYA 2G9WA 4RAYA 2C6YA 3FOEA 2QVOA 2F5EA 2PQ8A 3M8EA 2CQKA 1F9NA 1G3SA 2DQLA 4EM0B 4BHCA 3SZTA 6PAXA 1IW7F 3TOBA 3F72A 4IPAA 1NHAA 5KK1A 1P4WA 5HLHA 3KZYA 3JTGA 4LLLA 5LGUA 5D5UB 5HS7A 1FBSA 4KMUX 1ULYA 1BC7C 1FLIA 3REOA 2DT5A 2KIMA 2CW0F 3E3VA 3QU3A 3F8NA 2P7VB 3T8TA 1DP7P 2OU2A 1B6AA 1ZRDA 1F1ZA 3LA2A 3L4KA 1I27A 4OIRF 2KIFA 2COMA 5K5RA 4LG0B 3GW2A 2QBYA 2XAQA 1REPC 1W7PD 4FM9A 1J59A 3TDZC 1B1BA 2GIVA 2IT0A 5BMZA 5DV5A 4MHGA 2BYVE 3HSFA 5K5OA 1ZGAA 1XDSA 4A0YA 4XLPF 4CZZA 4M71A 3ML6A 3PQJA 1XMAA 2M30A 2PBIA 3LPXA 1O7FA 2ELHA 1G3WA 1BC8C 2OA4A 2IA0A 3F6VA 2Y3PA 4B09A 4A12A 3HTSB 1T6SA 2DQRA 2IA1A 2OBPA 4OMZA 1TQMA 5E1ZB 2XUBA 3ZMZA 4L9JA 2VC0A 1BN5A 4HQEA 4ON0A 1YW8A 5BPIA 3F6OA 1J5YA 1EH8A 3V8LA 2F5CA 2GXGA 3GWZA 1Z91A 1SD4A 1JHHA 2EB7A 1LJ9A 2XAFA 3W6KB 1IZ1A 1HQCA 5ILUA 2MC3A 4P9FA 5D6EA 2M87A 1ZLJA 2VBXA 4I01A 2XAGA 1XGSA 1MJ9A 2XVCA 5LHGA 3EQLF 1ZRFA 4HX8A 1XXAA 3E6BA 3SFZA 3C7JA 2E7XA 2XKOA 2F2EA 4G8XA 4EGYA 4EVIA 5E1XA 4CHUA 5E20A 2JRTA 1YYVA 4F7ZA 4EJOA 2EJRA 4ESFA 3GFIA 2HR3A 4HDVA 4JK1X 4GFQA 4A6EA 3R61A 5CLSA 5LEJA 2NNNA 1FNNA 3LWFA 1LQ1A 1Y0UA 2QQ9A 2VXZA 4BH9A 3IWZA 1SMYF 2ADUA 1RZ4A 1GE9A 1C0WA 2A6EF 1HW2A 4G7OF 5CVVA 4GGGA 4R1HA 1BIBA 4FT8A 1BM9A 2FBHA 2A07F 1LB2A 1B59A 4WK8F 4XSZF 1QBJA 1GXQA 1DUXC 3ZN1A 1H0MA 3M7GA 4WF2A 2QYOA 3P9IA 2XRNA 2M5WA 1FBUA 3V7RA 3DV8A 4ENMA 1S3JA 1S7AA 2A3SA 3NEUA 3J80Z 1FOKA 1EH1A 3IHUA 1R00A 1PDNC 2ZNZA 3K2ZA 5FD6A 4BAYA 4J3NA 2XAJA 4EJWA 3KLOA 1YTYA 1YW9A 3LA7A 4IXAA 4G7HF 3DXJF 3V4GA 3T1BA 5LHHA 2KJCA 1W4MA 1YIOA 3HUGA 4OOIA 4BHBA 5DD8A 1IN8A 5BS6A 1KQ0A 3TKYA 1CF7A 3TOAA 2QZ8A 3LAPA 2JPCA 3I0TA 1LDKB 5LBQA 2VONA 2FOKA 3VFZA 4L18B 2PMUA 1CGPA 1KYWA 4HW0A 2QWWA 2EFPA 2UXNA 4PGHA 2ZMEA 5JHUA 1B4BA 1W7PB 2P4WA 2WC2A 4RGUA 1DPUA 2RV8A 4G7ZF 3CLOA 3H3ZA 1LEBA 3KP3A 4MGRA 4GYIA 3V7SA 3T8RA 2NRAC 3U2RA 5HS9A 3V8JA 1L0OC 2KWAA 4HA8A 2ZFZA 3NRVA 1ZVUA 3DQVC 1LEAA 4AVPA 4ZYHA 3K1NA 2YX7A 4L9TA 3MFKA 4NHJA 2VODA 1HW1A 2K86A 4AIKA 2W25A 4Y13A 2DK5A 1H9GA 1P2FA 4WXCA 3BJOA 2XCRB 1K78A 3T5XA 3L9FA 2Z33A 2RGRA 3WTWC 2GA1A 3WODF 1D8JA 3P9CA 4P55A 1WQFA 4XSXF 4EQQA 1QPMA 2XIGA 1RUNA 4L5JA 3DPTA 4EGZA 1O57A 4O3MA 1OPCA 4RGXA 4B8XA 5LGTA 3KP5A 3QPHA 3MZHA 1JGSA 1EH7A 3F3XA 3KE2A 3HRMA 4LGWA 1MZBA 1QNTA 2E7WA 1USTA 1AOYA 4HF1A 4GCVA 4HOBA 2ZFWA 5FO5A 4S05A 1QGPA 4PCQA 3MZYA 3D5LA 3FXUA 5J8FA 3ZP5A 1S8NA 3I58A 1D3YA 4M72A 3OV8A 2Y0MA 3RKXA 2FBIA 4HX7A 2YPRA 3KEQA 5D8LB 4CICA 2HQRA 3OOPA 1EK8A 1LNWA 3MEXA 2ZXJA 2EV0A 3IL2A 4P96A 1T38A 4YFNF 1XSDA 2P7CB 1R7JA 1TBXA 4G0WA 1J7KA 5FLXK 1K7AA 3FM5A 2GXBA 1Z1DA 2RC4A 4EV0A 5JR3A 5FFZA 1RUOA 4MEYF 2TDXA 1I5ZA 2HTSA 1USSA 1B9MA 5HLIA 3WU1B 3KP7A 4H0EA 4LLGF 2F5DA 4A5NA 2QLZA 2IPQX 1FYKA 4MTEA 3OEPA 1BOAA 1ZN2A 2V1XA 1Z05A 2OZ6A 1HSJA 1XGMA 1SFEA 3GF2A 2D2WA 2DTRA 3ZPLA 2HS5A 4KB4A 4M9ZA 2Z5UA 3FMQA 4EMSA 4UV8A 3RPUA 1R5GA 1HSTA 1GVJA 1V4RA 5HOOA 3LQQA 4G9YA 2Q0OA 4CGZA 4HLXA 3CAGA 1DD5A 4HYEA 3FMSA 3IKVA 2B0LA 2OZUA 4G0UA 2H6BA 3JTHA 5DUIA 3ZMDA 2JZYA 1L3LA 3VODA 1XCBA 1DPRA 5JI6A 4I09A 1V3FA 1FSHA 1YS7A 3E6MA 4BYYA 3E5XA 1XXBA 3CUOA 1XMKA 1MKMA 3ULQB 2VBZA 4KT5C 1IRFA 2K27A 4QWQA 3F8CA 2IA2A 3RTRA 3N97A 1R5HA 2YX4A 4HQMA 3JSOA 2PG4A 2VT2A 3RKYA 3M9AA 2FE3A 3L4JA 1XCVA 2MLKA 3KLNA 2HFHA 1KQ8A 3C18A 3QPTA 3BUEA 2Y75A 2LSOA 3BP8A 1O3RA 3FZVA 4U0VA 5AONA 4MTDA 4O5VA 1BI3A 4KB2A 1ZRCA 2L02A 4YFKF 3LA3A 3HTUA 4I98B 4A0XA 1ZHFA 3HRUA 4JQFA 2E1NA 3C1DA 2EWNA 2DI3A 5F1RA 2ZKZA 4HX4A 5L3EA 1ON1A 2Q8KA 5AIPA 3O3KA 3J7AO 1U6GA 5E8IA 3KEOA 3WTVC 5L3DA 5DCMB 1ZARA 3CO6C 2XHKA 2A6HF 4G0VA 5TJJA 1HXDA 3LSTA 1G3TA 2G7UA 2M1BA 2ZJ2A 5L3CA 1Z6RA 2DU9A 4A5MA 3KZZA 1E17A 2L3DA 2VOOA 1IUYA 1WI9A 3L00A 3HHHA 4L0ZB 4Q5SF 3SQNA 3PQKA 1VTNC 1MD0A 2GWRA 1IAWA 3CO7C 2FMYA 5CVUA 4IHTA 3JAMK 4N0BA 3PFIA 3V8KA 1F4KA 2HKXA 2J5OA 2ESHA 3ZMVA 2JSCA 4RB0A 1U78A 3MAJA 2NAZA 4O6JA 5LGNA 4L5IA 1IRGA 4PZJA 1W7PA 5E17F 2EFQA 3F23A 3P7NA 3LQRA 3RYRA 3E5QA 5KVRA 2K4JA 1MDMB 5EEHA 1R36A 2XCQA 2EA2A 2E1CA 5A2QK 1JE8A 2PHCB 1ON2A 1J9IA 5D8KB 2NNYA 1U5TB 5DDGA 1FSEA 3EYIA 4EJUA 3MQ0A 5CVRA 3HRSA 5DCFA 4E70A 2JPBA 2A68F 3IKTA 4M6XA 1F5TA 1IS1A 1TNSA 4KN4X 5TRDA 4ZZLA 3WTZA 3IRRA 2HZTA 4UXNA 2HGCA 2NYXA 3GUDA 5JVOA 4KIGA 3I5UA 1EV7A 1SD6A 4U7BA 4FX0A 4AIJA 4OU0A 3RKWA 2QQAA 3Q5FA 2O8XA 4XLNF 2IVMA 4EJVA 3B02A 1ZGJA 3FM3A 2EK5A 5H6RA 4MQ9F 1X3UA 3H3UA 1FP1D 3QU6A 3H92A 1IN7A 3BDDA 2YSRA 4OIOF 3HRTA 1UFMA 4WWCA 2UXXA 4OINF 3ZMUA 1ZREA 4KNYA 4U0YA 1KU7A 2Q2EA 1R22A 3MWMA 5LRRA 2IW5A 2RQPA 4Y15A 1R1VA 5D5WB 3I59B 4UVBA 1GHCA 3Q9SA 3KP4A 2CGPA 2HEOA 1U2WA 1JHFA 2LNBA 4M9XA 3FXRA 4NQWA 2MBFA 1A04A 2W85A 1KU9A 1B4AA 5DUKA 2Y48A 1BBYA 3LFKA 4BXUA 2KKOA 4A6DA 3HOTA 4PDKA 2CYYA 5D5XB 2P5VA 2X4HA 4DDQA 1T98A 5LEKA 1KA8A 5K5QA 3P9KA 1D8KA 3DKWA 4G94A 1FYLA 2XCOA 4KICA 4P5OA 1WRJA 1YG2A 3SHFA 2RGVA 5HS8A 1IN4A 2VBWA 3FF5A 3DEUA 2KIUA 4HF0A 2HDCA 1FYMA 2QUFA 1Z6TA 1TW2A 1J2XA 2GAUA 3QRFF 2EA4A 3G3ZA 5E8GA 2L01A 3ZMTA 1R23A 2F5FA 4BNCA 4WX9A 3R0JA 1K6OA 5CJ9A 5DYMA 3WTSC 2VBYA 3I64A 2A5YB 1HW5A 3BPXA 5L3BA 4KFCA 2XAHA 3ECOA 5JFRA 1T0FA 2A61A 3F8FA 1BJAA 1FP2A 4Y17A 5FLXZ 2XV4S 2WV0A 1KQ9A 3GFJA 1UCRA 5E1WA 2L54A 4YIFA 3K69A 3QOPA 3C3WA 1PP7U 2M45A 4I0BA 4ENKA 5HDNA 2P6TA 1D5VA 1IN5A 3G73A 3WTXC 2OD5A 5ICGA 4D0PA 2YU3A 2PEXA 1SD5A 4RB2C 2ETHA 1P4XA 1IF1A 2V1DA 4HBLA 3GX4X 3VEPA 2V1UA 2O61A 1SMTA 3ZQ7A 4AD9A 2ESNA 3EUHA 1T2KA 4G6DA 2JT1A 4GXOA 4HV6A 1R1TA 2D1HA 1XD7A 5HDGA 4HDUA 1ONVA 5J8CA 1H9TA 4HAMA 1LDDA 4ENNA 2CG4A 1WQGA 1BJTA 3TO6A 5DEQA 2EFOA 5IT9Z 3GFLA 3HIFA 2UWMA 2AS5F 4KC6A 2O3FA 1GXPA 1E2XA 5ILSA 4AIHA 3BY6A 2CSOA 4ESBA 3WE3A 2V6CA 3TDUC 3TO7A 3GZ6A 1RNLA 4I0AA 4IRIA 5HDKA 5D4SA 4WCGA 2H6CA 3CTAA 3KP6A 1XSVA 5DCMA 3VA7A 3IC7A 2VOPA 2KRFA 3ABTA 2ZBKA 3GFMA 4ETSA 3JSPA 2RDPA 3U1DA 2PMHA 2JTVA 3IWFA 3FWEA 2FRHA 3GEZA 3IRQA 4LK0F 5LLQA 5LHIA 1ZG1A 2R3SA 1YO5C 3FX3A 1FPQA 1XDUA 2VN2A 2P5LC 1JXSA 4Q4ZF 1STZA 4FX4A 2K7LA 1WKMA 2J5PA 4LFUA 1P4AA 2EV6A 4ZZDA 1XGOA 2L4MA 3EETA 3E6CC 2BEOA 1ZH5A 1MJAA 4UUVA 4I02A 3TO9A 1ODDA 4RAZA 1ZG5A 2QM3A 1R58A 2DBBA 4GO1A 1QO0D 1G6NA 3GZ5A 2P6SA 3WGIA 3I71A 4KAWX 4P9UA 3RDIA 1FWZA 3L09A 2V79A 3D0SA 4MNUA 1MDMA 4Q48A 3GO5A 2HQNA 4OIQF 2WTEA 3WTYC 3COAC 3BZ6A 4U0WA 2EFNA 3RJPA 1U5TA 3R0AA 1FT9A 1YS6A 3WGGA 3M8FA 2O03A 3HSRA 2XGXA 4QLCU 1W5SA 2FMLA 1IN6A 1BGWA 3LAJA 3L2CA 2VE9A 3JAMZ 4WXHA 4K2EA 4LK1F 1WQ2A 1ZLKA 5D5VB 2M8EA 4KMFA 5H6QA 3FOFA 2EFWA 1FX7A 2FU4A 4UV9A 2ACJA 3F8BA 2L4AA 4YG2F 2MD5A 5LRSA 1OR7A 1KYZA 1P92A 5BPDA 3ELKA 3K0LA 1J0RA 3K1MA 1LDJA 1U8RA 2FA5A 1FC3A 3HSEA 1BI0A 5A2QZ 2BV6A 2FBKA 2LF7A 4OIPF 4AWXB 2AXLA 4N9IA 3BOQA 1YQAA 2KJBA 3CJNA 3N4MA 2XROA 4IRGA 1SD7A 2RKHA 1TTYA 1W5TA 2ISZA 3HHGA 3AAFA 3J81K 4MEXF 4L9VA 2FSWA 2DFIA 2LDUA 1IXRC 3I59A 2K02A 1PUEE 3QAHA 1G4DA 1MGTA 3CUQB 1U3EM 1BIAA 2X0LA 4IJAA 4R79A 5ILVA 5CVIA 3ERED 4ASNA 3I4PA 2GZWA 2FEZA 3NQOA 4KIFA 4ZYDA 1AB4A 1AWCA 3MMLB 5L3FA 2ISYA 3GVAA 2BE5F 2W24A 2RNJA 5FGMA 3JW4A 2YR2A 3F8MA 5BOXA 2DPDA 5IT3A 1OKRA 4N9HA 5K1YA 4UVCA 1RIOH 4M9SA 5BQTA 3R60A 1B9NA 2DPUA 2V9VA 2LF8A 3EYYA 3U9GA 2FF4A 1J75A 1IXCA 3QP5A 4GYGA 4HF2A 1P6RA 5D6FA 2K4BA 3KCCA 4ZYGA 2VC1A 4DNCA 1YW7A 4PGGA 4KN7X 2NS0A 1TQPA 1TNTA 2UZKA 1SFXA 2PI0A 1SAXA 1ISEA 2VE8A 2RN7A 1BI1A 1HKTA 2P8TA 4NB5A 2VT3A 4XBFA 1HKSA 2DLLA 2HTJA 2PFBA 1T39A 2OQGA 1UHMA 1KU2A 1QZYA 4L9NA 1I1GA 3OREA 1KU3A 2R7FA 3WTTC 4KA4A 2DW4A 3OPFA 2Z3YA 1FBQA 3BJAA 1OYWA 2HYGD 1UHWA 3W6JB 2CO5A 4IHSA 1Z9CA 2PN6A 2P5KA 4M74A 3DFGA 5ICCA 5HLGA 4CXFA 1WSUA 2ZNYA 2HOEA 4LB5A 2ZCWA 4Q47A 1XN7A 1YLFA 3M1EA 4M73A 3Q9VA 2QBYB 1ZYRF 3WU0A
chains in the Genus database with same CATH superfamily
1QQIA 1Q1HA 2ZJPF 2GAGC 3H0GJ 3T0YA 3KETA 1TT0A 1IXSB 3A0HC 3JSTA 4NDLA 1G3YA 3BPVA 3GSIA 2ZXHA 1SVOA 4RGSA 1J6WA 3Q0UA 3BROA 2O6GE 2P5MA 2Z99A 1SANA 2DA5A 4XKBA 2E2HC 1JT0A 1FEXA 4NC8A 4KDDA 2AQFA 3T00A 2VJIA 2H27A 2FNAA 3WGHA 3I54A 2X6XA 3EDPA 3PM1A 1QZZA 3QPLA 5E3LA 3R4KA 4FHTA 3FXOA 4LB6B 2BZTA 2TCTA 2X51A 4RA2A 3RPQA 4CCOA 1LFBA 3A01B 3L7WA 2PLYA 3TFHA 2ZB9A 5IP7K 2HOAA 1NK2P 3H36A 3MCZA 1TWFC 1A6QA 1J09A 4ZYEA 2OAZA 3ZN0A 3TQNA 2A68A 5D4DA 4LJZF 1WIHA 1EH6A 3HOWC 2BOLA 5E68A 4S04A 3RYPA 4F92B 4IX7A 3SXYA 2M7BA 3FKIJ 1XGNA 5J1YA 3BLYA 5E18F 2OCCH 2A6TA 3HKZN 2KLOA 4MFDA 1AKHB 5CYVA 4KDPA 4QIWD 5C44C 1Z7UA 3LSPA 1XG1A 2H1KA 1TZLA 4UHTA 3CJTB 3OMYA 3QODA 2O0YA 4A3BK 3G71I 2L0KA 1R71A 4HLYA 2MLGA 1BA5A 1DDNA 4LOWA 2DMNA 3IAS2 5IY5H 4UVAA 4WXDA 2STWA 4XKWA 1YITI 3IP4B 1PP8F 3V7CA 2KISA 1S29A 4HZFA 2GQQA 3B73A 3ISPA 3KP2A 2O8KA 2Z9OA 1YX5A 3H35A 2R7XA 3QX3A 5FB2A 4XORA 1DGRM 3O2PE 2R7ZA 3H5NA 2L7MP 2ZSIB 4U7DA 2AQEA 2YU9K 2EV5A 1OYIA 3WG9A 3BTCA 2HVQA 1X31C 2GLOA 5FKLA 5EZGA 4MQ9A 4CUGA 2DAOA 3RQIA 5C4XK 1TLHB 5FD5A 5ERIA 4IRHA 1E3PA 4QIWL 5IYCK 3CDHA 5CVJA 3QP6A 2M4KA 3HOZJ 2QQBA 3OS2A 1ZG3A 2XASA 3K7AJ 4X1EA 4D5FA 1U0JA 2HPIA 5EZHA 2JA8J 4OIOA 1FZPB 4KIBA 3S2HC 2E71A 3VYRB 4QTRA 5ICEA 2NVTK 3AG4H 2MH9A 4F52A 2A5WA 4ZC3A 3S2WA 2D45A 4A3CJ 4E7SA 3S1QJ 1TWGK 2WB1L 2OF7A 4LMYA 2RVCA 3GYHX 1W36D 1FY7A 4RS8A 1XZQA 3JRIA 3FMRA 1ZAOA 4PFPA 4J19A 5F08A 3AL0C 2ZUFA 5M5YK 1O7LA 2HYFA 3W3CA 3J7YJ 2OQRA 2ID6A 4LIUA 2GA2A 2Y9ZA 3GTMC 3S2DC 5C4JC 2F48A 2Z2SB 3BR0A 4MQVA 2MFZA 2FQ3A 2R92J 1MH4A 1O3QA 4GDFA 1X1DA 5IOTA 1YFHA 4I7HA 1HBXG 2IJLA 3O6BB 2AHQA 4I99C 3HYIA 4U88A 3FDYA 4RB1A 3F22A 4A93K 4M6YA 4KUMA 2E1MB 3BR6A 4PABA 2NVXJ 1R1UA 3SEZA 3J80K 3CF5F 1MBJA 2NVQK 3TGNA 2O5IA 5GTIC 4JBAA 2ZUEA 1V54H 2HWVA 2FNPA 2DYRH 2W57A 2DK8A 4HV5A 4DGWB 1SFUA 2GXAA 4ZH4F 1LKXA 2B63A 2HNHA 5JVGF 4XKCA 2GOXB 3EUHC 3FXQA 4EM1A 2WB1A 2LKPA 1HOMA 4A3IK 2KZVA 1O3SA 4D5CA 4CDGA 3H0DA 1WQHA 5AIQA 3VOEA 4RLQA 5IOZA 5J6XA 2M0MA 3GLXA 2Y69H 1PVEA 4E7JA 2D6FC 1Z21A 3ZMSA 4EM2A 1HDDC 1G2HA 3RKQA 3GTGJ 4QSHA 3BG7A 3DPUA 1NG7A 2KP6A 3GTQJ 2IS4A 3ABKH 4FETA 4YRVA 4C3JK 2H94A 5D4RA 5DD4A 3S1RJ 2FXAA 2H09A 1UB9A 3GBGA 2EBIA 2WAEA 2LLKA 1BOBA 2YUSA 3F9KA 3S1MJ 3K9TA 2W84A 4CO8A 1TW3A 1JTYA 4RB3C 3EUKL 1OYYA 1RESA 3HOSA 3RI4A 2V6EA 1D1BA 1TWHJ 5B5EC 4XOTA 1X1AA 3ABUA 3S0XA 3GTGA 3GTLJ 1TWAJ 2MA3A 4Y52C 2LRDA 4JX4A 2LVSA 1EI6A 4YIIA 1X4PA 2G0EA 5ICFA 4RGRA 2WWYA 2LMDA 4A0ZA 1KQ4A 1R9TC 2W7NA 4A3KC 1WWXA 4EJTA 4M3EA 4BXXJ 4NUBA 4FE7A 3RPUD 4BQAA 4ENJA 3UR3C 1R9TA 2H8WA 3E5UA 5H20A 1VQ8I 3DTKA 1OCOH 1BR4A 1WJAA 2JJ7A 2MYSA 3VB2A 4RDUA 1I1SA 4DQ2A 5B1AH 3DP7A 5F64A 1O3TA 4LR2A 4Z2YA 1S6LA 4J01A 1ERDA 1HKQA 4A3LC 4G6QA 3VWBA 4LG0A 1IRZA 4XRFA 3OYNA 3ABLH 4BY7J 1IO2A 3PO3C 3DEEA 2I8DA 4ESJA 3IUOA 3FKIK 1XXCA 3LMMA 5F27A 3WE2A 2NS7A 2STTA 2MH2A 1WSRA 2HU9A 4L5EA 1F36A 1I3AA 1RR7A 2CQQA 2GOMA 2HDWA 3HUGB 4RAFA 1F7UA 2IGNA 2IGKA 2R7DA 1BR1A 5EEGA 4L0YB 5L3GA 4TV7A 4KMAA 4A2UA 3CUQC 1CF7B 2NVYA 1VQKI 3ECHA 1GT0C 3AH5A 1U9NA 3O8HA 1FOWA 2EZKA 4FQGA 2CFXA 3K4CA 2ELJA 3CUQA 1WJCA 1BDFA 3ROUA 1VF9A 3NARA 2DA1A 3ZCOA 2YS9A 4UNOA 2D1VA 2QENA 3GTKC 2ZMEB 2IRFG 3S16C 4LLNA 4PAAA 2XAUA 2MG4A 3BWGA 5M3FJ 2EBBA 1MJBA 4BJ6C 3KYCB 1ETOA 4BHPA 2R4GA 3CDLA 3FHZA 4A3EJ 1RI7A 5EEAA 1XB4A 3H1CA 2BGCA 3FHNA 3I53A 4R8HA 3NUHA 2IP2A 2M2EA 1S7OA 3MKWB 3M3YJ 3OYCA 1K83J 4KYWA 5JHFA 2F4OB 1I6XA 5HVQC 1I50J 4I2OA 1WPKA 2JVHA 3GZNB 3E6DA 1TQIA 3DTEA 4C3IJ 3K7AK 3WTUC 5FFXA 3W2WA 2G7HA 3BJ6A 2IGOA 4E7LA 4E7IA 2RQQA 4LD5A 3CCYA 4A3CK 2K9SA 3ZGKA 2XKPA 5DTDA 3S1QK 3LFUA 4RMNA 5F6FA 3GXOA 2DJIA 4E7KA 2BBYA 2F4IA 1OMIA 5ED4A 4IVNA 4YFXF 2JK3A 1WH7A 3J81Z 4QPOA 5JVTA 3D5RC 4KMDA 3G2BA 1JKQC 1PJ5A 4CYDA 1O2AA 3OSFA 3LSGA 2R5YA 3K1PA 2DN0A 2R92K 2IGMA 3DPLC 1A31A 2HKOA 1I3QJ 1XSXA 2DO7A 3GLLA 1K79A 4GZYA 3F21A 2XB5A 2A69F 1U5TC 3DF8A 1LVAA 1K78B 4C2MJ 5J4YA 3KFWX 5IT9K 2HXIA 3K4LA 4PJLA 1SC7A 3L2QA 2PJPA 1SFKA 5EG0A 4X0GA 4X6AJ 2X9DA 4PJNA 1D0ZA 4KJZA 1BI2A 3EPZA 3RIRA 4G6TB 3SZPA 4RAGA 1X58A 1O24A 2ZO4A 2R7WA 4QJVA 2HQ5A 3DU6A 2CWEA 4BLBA 3R6SA 4IF4A 4V2FA 1KGSA 4XQFA 3AG3H 3DKXA 1MMSA 2WA0A 3E97A 4OMYA 2PMZD 2G9WA 4YELA 4RAYA 1RR8C 1XPPA 2VKEA 2C6YA 3FOEA 2KDZA 2QVOA 2X6OA 2F5EA 2PQ8A 3M8EA 2CQKA 4DYCA 1F9NA 4M3DA 1ETVA 1G3SA 2DQLA 4EM0B 2R7SA 3OS0A 3GTGK 4BHCA 1G51A 3I4MJ 3GTQK 1Y1WA 2NS8A 3SZTA 2LREA 3K4JA 6PAXA 4XNFA 1IW7F 4LK0A 3NAUA 3TOBA 2M0CA 3F72A 3JRFA 4IPAA 4DW6A 1NHAA 3S1RK 1IUFA 3HOXC 3LNQA 5KK1A 1P4WA 2X6YA 1ETQA 3QWLA 5HLHA 3KZYA 3U1KA 3S1MK 3JTGA 4UY8I 2BVLA 4LLLA 3ABMH 1Z7LA 3CJQB 5LGUA 5D5UB 5HS7A 1FBSA 4KMUX 1KZHA 1TWHK 3EUAA 3K10A 1ULYA 3ZRGA 1BC7C 3TBIA 3GTPA 2LYCA 4Q4ZA 1X2NA 1FLIA 4A3FC 3W2AA 3REOA 2DT5A 2E60A 2KIMA 1WI3A 3BTIA 2CW0F 2W82A 1WCMC 2Q1ZB 3E3VA 3QU3A 3F8NA 2HZDA 2DCEA 2P7VB 3T8TA 3TW6A 4BXXK 1DP7P 4NC6A 2F4MB 2OU2A 3G6EI 1B6AA 2OPTA 1F1ZA 3LA2A 1YOVB 4HNTA 1ZRDA 1DCOA 2VUMJ 3L4KA 5FJ8J 3GTOJ 1I27A 4OIRF 3LSIA 1I6HJ 2KIFA 2COMA 2NVUB 5K5RA 3C2BA 4LG0B 2VQCA 3GW2A 2QBYA 2XAQA 1REPC 2NVYK 2K9LA 1W7PD 2ZSHB 4FM9A 1J59A 3TDZC 2DA3A 3GTJJ 1MSEC 1B1BA 4CH7A 2GIVA 2IT0A 3CQZA 2DJNA 1WVRA 5BMZA 5DV5A 4MHGA 4BY7K 2BYVE 3HSFA 2FUG2 3S8PA 3K70D 3QOEA 5K5OA 1ZGAA 5F0HA 1XDSA 4A0YA 2HVSA 4XLPF 1POGA 4UUSB 4CZZA 2EPFA 4M71A 2V6TA 4OIQA 5J47A 3ML6A 3PQJA 1ZR4A 1XMAA 2M30A 5JFEA 4HG2A 2PBIA 3N3YA 3LPXA 1O7FA 2ELHA 4CCMA 1T56A 1G3WA 2K40A 1PYVA 2HVRA 4F91B 1BC8C 4BGDA 2OA4A 2IA0A 3FKJA 2NOGA 2Y0SL 3S32A 2JA5J 3F6VA 3FXLA 5E3OA 2Y3PA 1MNEA 2KZGA 4B09A 3A01A 4A12A 3HTSB 4FZBA 3KYDB 1T6SA 2DQRA 2IA1A 2OBPA 3BTJA 3BR2A 5M3FK 5C3EC 1TWCJ 4OMZA 2ME6A 3HG9A 1TQMA 5E1ZB 2JH3A 4Y7NK 4BBSK 4A3EK 2L7FP 3D1NI 5IP7C 2XUBA 2ICWG 4L9JA 3ZMZA 1XC5A 1AKHA 4GT9A 2VC0A 4LK1A 1IV6A 4Y4RA 1WOPA 3M3YK 2ECBA 4GTFA 2E2JJ 1K83K 1BN5A 3H3VD 1I50K 1APLC 5FKMA 3CCUI 4ON0A 4HQEA 1YW8A 5BPIA 3F6OA 2D5VA 4C3IK 1J5YA 1EH8A 3FK6A 3Q3QA 3V8LA 2F5CA 2W1OA 2GXGA 3GWZA 5FRMA 3DCFA 4A3BC 1Z91A 3RZOJ 2CV2A 4AU7A 1SD4A 2OC6A 1JHHA 4A3GJ 5IYDJ 2EB7A 4A3JJ 2FQOA 1E3HA 1LJ9A 2Y0SA 2QA4I 2R93C 1W5CC 1MSFC 3K4NA 2EILH 2XAFA 1BR2A 4NNJA 3W6KB 1IZ1A 4OIPA 1X1BA 1HQCA 1VI0A 5ILUA 2N8GA 1I3QK 2YU9C 2MC3A 4P9FA 2DMPA 5D6EA 4QPQA 2M87A 1ZLJA 2CRGA 1VQ9I 1F7VA 2FOWA 2YU9A 2JMWA 2VBXA 5C4XC 1YNNA 1D5YA 4X6AK 5IYCC 3RZDK 4I01A 2VLAA 2XAGA 4BKXA 2EZHA 3A03A 1PJ6A 1XGSA 1SVLA 3X2QH 1MJ9A 2KDOA 2XVCA 1MBHA 5LHGA 1YHQI 3EQLF 1Y0NA 1T8IA 4KISA 1Y1WK 1ZRFA 4MEXA 4AYBD 4HX8A 1V5VA 2NOJB 3OYAA 1XXAA 3DBLB 2NVTC 2JA7C 3E6BA 1JGGA 3SFZA 5IYBJ 1A36A 1TWGC 3C7JA 2E7XA 2XKOA 3AG2H 4Y3OA 1XPXA 2QKLB 1WHUA 1ENHA 3PUFA 1TWGA 2F2EA 3ASNH 1WH5A 4JOMA 1ZQ1C 4HNUA 4G8XA 4P1WA 3GTPK 4EGYA 2E1MC 2HOTA 4EVIA 5E1XA 4CHUA 5E20A 2JRTA 1BW5A 1YYVA 2MW8A 3I4MK 4PJMA 4XLEA 2LFBA 1H88C 1OCPA 3BCAA 2LOOA 4F7ZA 4EJOA 1IDYA 2EJRA 5B1BH 4ESFA 3GFIA 2HR3A 4A93C 1W1WE 1GLNA 2EZIA 4CSWA 2HQAA 2K85A 4HDVA 4JK1X 4C3HJ 2XPUA 4GFQA 1UG0A 1SEUA 4A6EA 1T95A 3R61A 5CLSA 5LEJA 3LSHA 2NNNA 1FNNA 3LWFA 1LQ1A 2L5QA 1Y0UA 3LSMA 4A3DJ 4AYBL 2QQ9A 2VXZA 4BH9A 4GTLA 5GPCA 3IWZA 4BE2A 1SMYF 2BE5A 3D5SC 5EJCA 1ZGWA 2ADUA 1RZ4A 1GE9A 2DT6A 3M4OJ 1C0WA 2A6EF 1HW2A 4G7OF 4A3IC 5CVVA 4KITB 3P5JA 4GGGA 4R1HA 1BIBA 4FT8A 2VUMK 5FJ8K 1BM9A 3GTOK 1I6HK 2FBHA 3S17J 4LITA 5K7HA 5DM7F 2A07F 1LB2A 1B59A 2K3PA 4XSZF 4WK8F 4F93B 2QSHX 1QBJA 5EGHA 2IXSA 1GXQA 3KX2A 3PFYA 1DUXC 3ZN1A 3AQPA 1H0MA 3GTJK 4C3JC 3LOCA 3M7GA 4WF2A 4BY1C 1SFOA 4PSXA 1N78A 2QYOA 4ANJA 2VKDA 1WZ2A 4D7NA 3KZIC 3P9IA 2XRNA 2M5WA 2E2HJ 4IHYA 3PO2K 1LFUP 3K4MA 1FBUA 3V7RA 3DV8A 1IL2A 4ENMA 3H0GA 3TEDA 2CUJA 1S3JA 2R5ZB 5TGTA 1S7AA 3BT9A 2A3SA 3NEUA 4AYBA 4JK1A 3J80Z 1FOKA 1EH1A 1S9HA 1EKEA 3IHUA 3HPHA 1R00A 1PDNC 2ZNZA 3K2ZA 5FD6A 4BAYA 4J3NA 2XAJA 2JA5K 3LL7A 3OYLA 4EJWA 1TWFJ 3JRAA 1LE8B 3KLOA 1YTYA 4AIDA 1YW9A 3LA7A 2E36A 2WY8Q 4IXAA 4G7HF 5J1UA 4WJ4A 1TWCK 3DXJF 3V4GA 2CJJA 3T1BA 2VJ5A 5LHHA 4KM8A 3OY9A 2KJCA 1W4MA 3AFHA 1ETKA 1WOSA 1YIOA 3HUGA 4OOIA 2CV0A 5GPAA 4BHBA 5DD8A 1DCHA 2VKHA 1IN8A 3FKIC 5BS6A 2E2JK 1QU3A 1MW7A 1KQ0A 3TKYA 1CF7A 3TOAA 2QZ8A 4IQ4A 4BJTA 2IAIA 3LAPA 2JPCA 3I0TA 3S15C 4BDZA 1IG7A 3FKIA 1LDKB 5LBQA 2R7ZC 2VONA 3SJMA 2FOKA 2ZMEC 1RC9A 3RZOK 3VFZA 4L18B 1NTCA 4CCJA 2PMUA 1CGPA 2VQLA 1KYWA 4HW0A 2RH6A 2QWWA 2EFPA 2UXNA 3MVPA 4PGHA 5IYDK 4A3JK 2ZMEA 3K4BA 4QIWN 4GTAA 5JHUA 1B4BA 1W7PB 2P4WA 4NOIA 2WC2A 1BJZA 4RGUA 1RKTA 1DPUA 3DLAA 2RV8A 4HPQA 4G7ZF 3CLOA 5HNHA 3H3ZA 1O28A 1LEBA 3KP3A 1DQUA 2QF7A 3ZQGA 4MGRA 4GYIA 1Y6IA 2WB1N 1MNMC 3V7SA 3T8RA 1X4OA 2NRAC 3CMMA 3L2UA 2CFOA 3U2RA 1VQ5I 4FCYA 5HS9A 3V8JA 1ZYRA 1L0OC 1MH3A 2M8GX 2TRTA 4HA8A 2CW8A 3NRVA 5LD2C 2KWAA 2ZFZA 3CCSI 1ZVUA 3DQVC 1LEAA 4AVPA 3ZQFA 4ZYHA 2XGDA 1PJRA 1QA6A 3K1NA 3LSRA 3S14J 2YX7A 4L9TA 3MFKA 2LY1A 4NHJA 1JKPC 3K7AC 3HGGA 2VODA 1MBGA 1G59A 1HW1A 4AM3A 1P7JA 3OIQA 2XF6A 3OSGA 2K86A 3GTMJ 3S1QC 5C4JJ 2W25A 4AIKA 4J00A 2ELKA 4Y13A 2XGCA 3H3VK 1UELB 3DEWA 2DK5A 3SZYA 2R7VA 1X3ZB 5IP9K 1H9GA 1P2FA 3DBRB 3I3LA 3I4NJ 3WHBA 4WXCA 3BJOA 1ITYA 4DYQA 2XCRB 1K78A 3T5XA 3L9FA 2Z33A 2R92C 2OTJI 1OCRH 2VASA 2HI3A 1K61A 5LFAA 5JLWA 2RGRA 3WTWC 2GA1A 3WODF 2B63C 1D8JA 2R92A 4LJZA 3P9CA 2VI6A 4P55A 3J7AY 1WQFA 4XSXF 5IOYA 4M3GA 2EINH 1FJLA 3HOYC 1WFXA 2VJJA 5K7FA 2W4SA 4EQQA 1QPMA 2NVXA 2XIGA 2K5CA 3BR5A 4L5JA 1RUNA 4JX5A 3DPTA 4EGZA 2E1OA 1O57A 3S3NA 4O3MA 1OPCA 4RGXA 2MABA 2IEKA 1SFOK 1B8IB 4KARA 2DOFA 3CCQI 2WADA 4B8XA 4MIMA 5LGTA 5HL8A 1O2FB 2ECCA 3HOUC 3KP5A 3QPHA 2R7TA 3MZHA 1JGSA 1VRQC 2LG4A 1EH7A 3F3XA 4ABZA 3KE2A 3HRMA 4LGWA 2E2IJ 1MZBA 3S17K 3H0GK 1QNTA 2E7WA 3TP0A 3GTGC 4U87A 3GTQC 2LH9A 3WU2C 1USTA 1AOYA 4IZZA 1JT6A 2E5NA 1JUMA 4HF1A 4GCVA 4OAYA 4HOBA 3GTQA 2ZFWA 5FO5A 1ZELA 2Q2EB 4S05A 4Y52J 1QGPA 4PCQA 3MZYA 3D5LA 3FXUA 5J8FA 3ZP5A 1S8NA 2QKMB 3I58A 1Y39A 1D3YA 4ZDLA 4M72A 2Y31A 3V42A 3BG6A 4B48A 3OV8A 3PUBA 5E79C 2Y0MA 3RKXA 2FBIA 3L2RA 3DU5A 4HX7A 4D7MA 1TWHA 5DS9A 2YPRA 3KEQA 5D8LB 4CICA 1JOEA 2BY2A 2HQRA 2DOEA 3OOPA 1EK8A 1P9QC 3GTLA 1LNWA 3ZOBA 3Q0WA 1TWAA 2PJRB 2KHMA 3W6VA 4NQWB 1VQ6I 3MEXA 2ZXJA 2EV0A 4A3LJ 1ZXOA 2V6SA 3IL2A 4P96A 1D1AA 1X3WB 4EATA 1T38A 2FJ1A 1WOOA 2ID3A 1IQ0A 5JLXA 2QSFX 4YFNF 2LBFB 2DXIA 1XSDA 2NVYC 2VJ4A 2P7CB 1R7JA 1TBXA 3T01A 3CMYA 3HM5A 1O4XA 4UUSA 4G0WA 1J7KA 5FLXK 1FOXA 1K7AA 3BQZA 4BY7C 3FM5A 2GXBA 1WJ5A 1Z1DA 2RC4A 4UB8C 4EV0A 2VQHA 5FFZA 5JR3A 1RUOA 3BP3A 4MEYF 2JA6J 3OL4A 2TDXA 1I5ZA 2HTSA 2P0WA 5B3SH 1USSA 1TP4A 5CPRB 1B9MA 5HLIA 1IE0A 3WU1B 4PFOA 5TJ3A 3KP7A 4NBQA 4H0EA 4ZH4A 2L9VA 4LLGF 2DMTA 4A3MJ 3DTIA 5IORA 1QHGA 3SDBA 2F5DA 4BKWA 4A5NA 1QVTA 3J7ZI 1S7EA 2QLZA 2E35A 2IPQX 2CUFA 1FYKA 2ZC2A 4RMFA 4MTEA 3OEPA 1BOAA 1ZN2A 2QSGX 3L1PA 1MBKA 1D0YA 4F3QA 4G12A 2V1XA 5KNLA 1Z05A 2W48A 4XCHA 1CQTA 2BXZA 2KMUA 1O29A 3HOZK 4Y7NC 2OZ6A 1WJEA 1HSJA 4BBSC 3LSKA 4A3EC 1XGMA 1SFEA 4D1QA 2JA8K 3GF2A 2D2WA 2DTRA 3ZPLA 4BBRC 2HS5A 5FRNA 3JRHA 3A1YA 2M4GA 4KB4A 1QRYA 4M9ZA 3S1NC 2Z5UA 5IOQA 3FMQA 4XN3A 1K83C 4EMSA 2DA2A 2PPBA 3AD8C 4UV8A 4N4OB 3GDZA 1R5GA 1HSTA 3RPUA 3S14K 1X1CA 3WG7H 1GVJA 1K83A 1V4RA 5HOOA 3LQQA 1I50A 1TC3C 3KPHA 2WAQD 4IL6C 4G9YA 2KFDA 2Q0OA 1Y1VJ 4CGZA 4HLXA 4BQOA 3CAGA 1DD5A 4HYEA 3FMSA 3IKVA 2B0LA 2OZUA 3T02A 4G0UA 3MKYB 2H6BA 2JVGA 3JTHA 5DUIA 3ZMDA 2JZYA 4DIQA 1Z3XA 3OYKA 2M9HA 2NVXK 2MSYA 1L3LA 4MO7A 3HOVJ 3I4NK 1FIPA 4PJ0C 3VODA 1K4SA 1XCBA 4C30A 5CQEA 3SYTA 4DBQA 1DPRA 3VYUB 5JI6A 1I3QC 4I09A 1VQNI 1PJ7A 5TMFA 2X85A 1V3FA 1FSHA 1Y1VA 2R0QC 1I3QA 1USMA 1YS7A 3E6MA 2X1CA 4LG3A 5FLVA 4BYYA 1YCLA 3E5XA 1XXBA 3CUOA 3RZDC 1XMKA 1MKMA 4JP0A 3ULQB 3DBHB 2VBZA 1Y1WC 4KT5C 4B43A 2WAQL 1IRFA 2K27A 2BXYA 4KM9A 4BACA 1UMQA 4QWQA 4HEA2 2WBMA 3F8CA 2V26A 3I55I 2IA2A 3RTRA 3N97A 5HNFA 1FTTA 1R5HA 2YX4A 2RNGA 1EA3A 1JI8A 2BHYA 4HQMA 3JSOA 2PA8D 1JTXA 2PG4A 5M5XJ 2VT2A 3RKYA 3Q0VA 2V1NA 3IV5A 2E2IK 3M9AA 3HOXJ 3AKZA 3GTPC 2FE3A 3L4JA 3G4CA 1XCVA 3BCBA 4HSTA 2MLKA 3H9QA 2HFHA 3KLNA 1KQ8A 3C18A 3I4MC 3QPTA 3ZQQA 3BUEA 2Y75A 5FLMJ 2PMZN 2V4JC 2LSOA 4O2DA 3BP8A 3HDDA 1O3RA 3FZVA 3GTLK 5F0CA 1TWAK 4U0VA 4FISA 1WJDA 4A3FJ 4Y52K 2PMZL 5AONA 4MTDA 4FE4A 4O5VA 1WCMJ 1BI3A 4KB2A 1ZRCA 1R49A 2FX0A 3UKGA 3GEHA 2GIZA 4ZJZA 3FK7A 3MKZA 2L02A 1RKWA 4IHXA 1RPWA 4YFKF 3LA3A 3HTUA 2Z1DA 1OLTA 4I98B 4A0XA 1ZHFA 1O25A 3CQZC 5M5WJ 3HRUA 1A6IA 4JQFA 2E1NA 3C1DA 2EWNA 1ZBSA 2DI3A 5F1RA 2ZKZA 4HX4A 3MD2A 2KQRA 5L3EA 2PA8L 4YFXA 1ON1A 4GTEA 2Q8KA 1HC8A 2VUMC 2ZFUA 3GTOC 5AIPA 3O3KA 4BEHB 1I6HC 4CYCB 3PNYA 1U6GA 3J7AO 2WV1A 5E8IA 1Z0XA 3KEOA 2IBDA 1R4MB 4ZDOA 2VUMA 3WTVC 5L3DA 2GM4A 3GTOA 5DCMB 3Q3SA 1ZARA 4MFEA 2K9NA 3CO6C 2XHKA 2DYSH 2Y0SN 3W2VA 2A69A 2A6HF 3GTJC 4HRIA 4G0VA 5TJJA 1VGXA 4N4NB 1HXDA 2X1DA 2XPVA 2JN6A 2CH0A 3BG9A 1G3TA 3LSTA 1RRJA 2G7UA 3GTJA 2M1BA 5M5YJ 2PMZA 1V55H 2ZJ2A 1Z6RA 2H1LA 5L3CA 2P81A 2R5ZA 2DU9A 2JA6K 4MLOA 4A5MA 4BXFA 3PO2C 3KZZA 3OYDA 1YJNI 4II3A 2O9LA 1IGNA 1E17A 2L3DA 3N05A 2VOOA 1IUYA 1WI9A 3L00A 2AO9A 2MGQA 2UUZA 3TTGA 3HHHA 4A3MK 1LE8A 1WJBA 5C3EJ 4W97A 2IS2A 3HL2A 2QCOA 4L0ZB 4Q5SF 1C0AA 4BLAA 3SQNA 1DCPA 3A8JA 3VSKA 3PQKA 1W0UA 4BQQA 1IC8A 3CZ6A 1VTNC 2JA5A 2B7EA 1MD0A 4DZJA 4I6ZA 4CCLA 2GWRA 3SFIA 1TWCC 1QZEA 3CO7C 1IAWA 3CJRB 3A2KA 1ACIA 2FMYA 2E34A 1IW7A 5CVUA 1TWCA 3N0CA 5IOSA 4IHTA 3JAMK 3OYJA 4N0BA 3AD7C 2VQGA 3PFIA 1K4TA 4A3BJ 2L7ZA 4KT6A 1YRNB 3NWSA 3V8KA 3F0CA 2LC2A 1F4KA 2HKXA 2J5OA 2JWTA 3NWTA 4CZCA 3CCLI 2ESHA 4LOCA 3ZMVA 1YNJA 2JSCA 4XR6A 4RB0A 2RREA 1U78A 2R93J 3MAJA 2NAZA 2HPMA 1D1CA 4O6JA 1I6VA 2CW0A 5LGNA 3PNTA 4OAZA 4L5IA 1IRGA 4PZJA 3RZOC 1W7PA 5E17F 2EFQA 3F23A 1MNDA 3P7NA 1Y1VK 3LQRA 5IYDC 2LY2A 3RYRA 4XONA 3K70C 3E5QA 5KVRA 2K4JA 5FKKA 1N77A 1MDMB 3HB9A 4C2MK 3A0BC 5EEHA 1R36A 3RSNA 2XCQA 1KONA 4OIRA 3HOVK 2EA2A 3CDIA 2LD5A 3H3VL 1ETXA 4AVZA 2E1CA 1JUPA 2IS6A 5A2QK 5HODA 5C4XJ 3ZXSA 1JE8A 1LUJB 1H8AC 4DZPA 2PHCB 1ON2A 4BU2A 1J9IA 5D8KB 2NNYA 1U5TB 5DDGA 1FSEA 3HBLA 3EYIA 4KMHA 4EJUA 1G8XA 1VZ0A 4XLPA 1Z77A 2JA7J 1VQ7I 2XPWA 3MQ0A 5CVRA 3SDGA 3PSIA 3HRSA 1YIJI 4RLFA 1MMGA 5DCFA 4E70A 1S72I 2JPBA 4ZTFA 2OTLI 2A68F 3IKTA 3IAM2 4M6XA 1F5TA 1USOA 1MBFA 3CCEI 3K2AA 1IS1A 3E1SA 4BS9A 1TNSA 4KN4X 5J1RA 2V9KA 5TRDA 3G4SI 4ZZLA 1BW6A 2UV1A 3WTZA 2QEXI 4ZTJA 3IRRA 2O7OA 1OCTC 4BUPA 4AUXA 2HZTA 4UXNA 5IP9C 1GDTA 2HGCA 4A93J 1I39A 2NYXA 2LK2A 4AYBN 3HOXK 2NVQC 4PSWA 1IDZA 3GUDA 1XS9A 4KIGA 5JVOA 3OWTA 5FLMK 3I5UA 2VKVA 4Q5SA 1EV7A 1SD6A 4FASD 5J40A 4U7BA 3PIOF 4BE0A 2DODA 2ZXWH 4FX0A 4AIJA 1EF4A 2CFAB 4OU0A 4PUSA 3RKWA 2PX9A 1GUUA 1WCMK 2QQAA 5GAHJ 2BW3B 3Q5FA 2O8XA 1U8BA 2XSDC 4YIRX 2NXNB 1SAUA 2KT0A 1U9OA 4XLNF 1B8IA 2IVMA 4EJVA 3B02A 3C2GA 2CQ7A 1ZGJA 1QPIA 3FM3A 5EGEA 2EK5A 5H6RA 4LIVA 1HDPA 4MQ9F 5GP9A 1X3UA 1IJWC 3OR1C 2XF7A 1SFOC 3H3UA 1FP1D 3QU6A 3DLLF 3H92A 1IN7A 4KASA 3FISA 3BDDA 3SZZA 2YSRA 2LY9A 4C3JJ 3OR2C 3JREA 4OIOF 3TFIA 2HOSA 4BY1J 4DOZA 3HRTA 3KIOA 1UFMA 4WWCA 3HXAA 2UXXA 3S17C 4OINF 3SEQA 3ZMUA 1ZREA 4KNYA 3H0GC 4U0YA 4KN4A 1KU7A 1OQYA 2Y30A 2Q2EA 1R22A 3MWMA 1DU6A 1BS2A 4JX6A 1WGXA 5LRRA 2IW5A 2Y9YA 2RQPA 2IS1A 1X2MA 1PUFB 5J3LA 3OYHA 4Y15A 1R1VA 5D5WB 3I59B 1OCZH 1P7IA 1Z3YA 2CW7A 3K4KA 3OOUA 4UVBA 1GHCA 2GSOA 3Q9SA 3HKZD 3KP4A 2CGPA 2HEOA 1U2WA 4IKFA 1JHFA 2LNBA 3MN2A 5GTHC 4M9XA 4XL9A 4YEJA 3FXRA 3EQLA 1SVMA 2PJRA 2E2HA 3HOWJ 4NQWA 2MBFA 1A04A 2W85A 1KU9A 4RM3A 2L9NA 4FTHA 1B4AA 2HYJA 3ASOH 1YX3A 2XDVA 2Y48A 1BBYA 1XMXA 3LFKA 4V2GA 5DUKA 2KKOA 4A6DA 4BXUA 3HOTA 5C3EK 4PDKA 5C44J 2CYYA 5D5XB 2P5VA 3GMEA 1HLVA 4XLCA 2E19A 2LBFA 2X4HA 4DDQA 3H9JA 1T98A 1KA8A 5LEKA 5K5QA 3P9KA 1D8KA 3DKWA 4G94A 5E3NA 1FYLA 2XCOA 4KICA 4P5OA 2X1EA 3HC7A 4B4CA 1M1EB 1TWFA 1WRJA 4DBRA 1YG2A 3S3MA 3ADAC 4H4KC 2KRCA 2AXTC 1HF0A 3HPGA 3G4AA 3SHFA 2RGVA 1J6VA 3BR1A 1ORKA 3S15J 1ZR2A 5L46A 1HQMA 5HS8A 3OIOA 2R7ZJ 1IN4A 4A3GK 3HKZL 1OFCX 2X6WA 2LKXA 2CV1A 2VBWA 3OYBA 1MMAA 3FF5A 3DEUA 2KIUA 5E3MA 1OCCH 1N25A 4HF0A 2HDCA 2WB1D 1FYMA 1MMNA 1JJ8C 2QUFA 3BG3A 2R93K 1Z6TA 5KHDA 1TW2A 1SMYA 1X19A 1J2XA 2GAUA 9ANTA 3DWLE 3QRFF 2EA4A 1LPQA 3G3ZA 1IRXA 5E8GA 3CCJI 2L01A 2A6EA 3ZMTA 4G7OA 1R23A 2F5FA 1JKOC 2DDAA 4BNCA 4XLNA 5EDNA 4P5BA 4WX9A 4HNVA 3S2HJ 5KAFC 2W7VA 3R0JA 1JJ6C 2VB6A 1VQOI 1K6OA 1DU0A 5CJ9A 3CCMI 3BTLA 2MC4A 2R7RA 5DYMA 3WTSC 4XSZA 2VBYA 1XTAA 1VLOA 3JRCA 4ITVA 3HOZC 3I64A 2A5YB 1ETYA 2JA8C 1HW5A 3FBIB 1J98A 2L9SA 1AA7A 1T0FC 4A3CC 4NC7A 3BPXA 5IYBK 4ILDA 3S2DJ 5L3BA 4KFCA 4C45A 3HKZA 4GTCA 2XAHA 3ECOA 3HXLA 5JFRA 4OINA 2JA7K 1T0FA 2A61A 3F8FA 3ERMA 1BJAA 3O8GA 1FP2A 4Y17A 5FLXZ 3S14C 1AHDP 3MKLA 2XV4S 2WV0A 1MBEA 2R7QA 1KQ9A 3GFJA 1HCRA 1UCRA 1UV7A 4XK4A 5E1WA 4Y33A 4GTDA 2L54A 2R7OA 5EF6A 3CESA 2VL8A 3ONQA 4YIFA 1JQWA 3K69A 3QOPA 3C3WA 1PP7U 3FBNB 2B63J 1MMDA 3GTMA 2QQ8A 2DT7B 2M45A 4I0BA 4ENKA 4C3HK 1GV2A 5HDNA 3M8JA 2X48A 2P6TA 2NVXC 5GADJ 4G7HA 3I4NC 1D5VA 3DXJA 1IN5A 3E7LA 3G73A 4HSRA 3OYMA 3HOYJ 3WTXC 2LR8A 3IH4A 2OD5A 5ICGA 4D0PA 2YU3A 4A3DK 2CUZA 5F0FA 2DA6A 2L2OA 3WHCA 1VQPI 3TMOA 4LQYA 2OCEA 2PEXA 3VYSB 1B72B 4P5AA 1SD5A 4RB2C 3M4OK 2ETHA 1P4XA 1IF1A 1Q1VA 2V1DA 4HBLA 3GX4X 4C2TA 3VEPA 2V1UA 1XZPB 3HOUJ 2O61A 1SMTA 3ZQ7A 4AD9A 2ESNA 3EUHA 3TFJA 4A69C 1T2KA 4G6DA 2JT1A 2H8RA 4GXOA 2DDBA 4HV6A 3A8KA 1R1TA 4S0HB 3PIPF 2D1HA 2COBA 2EIJH 4B3XA 1XD7A 2V9PA 5HDGA 1OISA 1UZCA 4HDUA 1ONVA 5J8CA 2ZJRF 1W36C 1H9TA 3S1RC 4HAMA 4BY1K 4M6VA 1LDDA 4ENNA 3S1MC 2BHZA 2CG4A 4BDYA 3A8IA 4G7ZA 2E2IC 1WQGA 2GBYA 3E0JB 3A4CA 1A35A 2E2HK 4W1UA 1VFCA 3TO6A 1VQMI 1R9TJ 1BJTA 1TWHC 4A3KJ 4XLHA 3AD9C 3CLQA 1O27A 2E2IA 2RAEA 5DEQA 3PNVA 2BVMA 1YE9A 2EFOA 5IT9Z 3GFLA 3HIFA 2UWMA 1TWAC 2AS5F 3GTLC 5M3MJ 4KC6A 2O3FA 3OS1A 3JR9A 1GXPA 1E0EA 1E2XA 5ILSA 4AIHA 3BY6A 2CSOA 4ESBA 3WE3A 2R7UA 3G1OA 4BXXC 1TWFK 1T33A 1H89C 2V6CA 3HOWK 3PO3J 3TDUC 3TO7A 5FROA 3GZ6A 3ESWB 5CQGA 4XKVA 3TL4X 1RNLA 5C44K 1YJ9I 2NVYJ 4BEHA 4CYCA 2JSPA 4I0AA 4IRIA 1R5ID 5HDKA 5D4SA 4WCGA 2EQRA 2H6CA 3CTAA 3KP6A 4WJ3M 1XSVA 5DCMA 4BQNA 2K3FA 3IH2A 3IPJA 3IC7A 3VA7A 2VOPA 2KRFA 3GIRA 3ABTA 1MIJA 2ZBKA 2HXOA 3GFMA 3VPRA 2RDPA 4ETSA 3JSPA 3U1DA 3CCVI 3WODA 2PMHA 3S15K 2EIMH 1AU7A 3AQOA 4XSXA 3GTKJ 2R7ZK 3S16J 3CD6I 1VNDA 2JTVA 2K9QA 3IWFA 3U21A 3FWEA 2FRHA 3GEZA 4PJJA 3IRQA 3BZKA 5K7ZA 2JA6C 1FOYA 2EH3A 4ZYAA 2DFEA 4LK0F 5LLQA 2JA6A 2DMUA 2JA2A 4BL0B 1EFWA 2KRHA 5IP6A 5LHIA 4C9YA 1ZG1A 2R3SA 2DMQA 5GAGJ 1YO5C 4A3MC 2Y2ZA 3FX3A 1TT5B 5FKOA 2E5ZA 4C2UA 1ETWA 1FPQA 1XDUA 2VN2A 3QPSA 4Y7NJ 2P5LC 4GFBA 1JXSA 3GTKA 4BBSJ 4Q4ZF 1STZA 4B1RA 4FX4A 3HJEA 2K7LA 2O5JA 3S2HK 1WKMA 2J5PA 2XGEA 4LFUA 4IOAF 1V5GA 1P4AA 2EV6A 4BBRJ 1VJEA 3M3YC 3I9V2 1JUSA 5BNGA 4ZZDA 2O5RA 1XGOA 2L4MA 3EETA 3E6CC 3VYTB 3S1NJ 1I50C 4D9JA 1ZK8A 2BEOA 1ZH5A 2F5VA 1MJAA 2WAFA 4CA0A 4DYRA 4UUVA 4C3IC 4I02A 1IV8A 3TO9A 1ODDA 4BE1A 4IHWA 4RAZA 1YRNA 3OIPA 3VSLA 2ZXIA 3H9GA 1ZG5A 1NK3P 2QM3A 1R58A 2DBBA 2GSUA 4GO1A 3GTMK 3S2DK 1QO0D 1G6NA 5C4JK 1XZQB 2GAHC 3GZ5A 2P6SA 3WGIA 3JRGA 3ZQLA 3BC8A 3I71A 1WSVA 3M1CA 2OJED 4Z6YA 4KAWX 3QYBA 4P9UA 3RDIA 1FWZA 3L09A 3AL0B 1FMWA 3I56I 3MMYB 1J6XA 2V79A 2DTZA 3D0SA 4MNUA 1MDMA 3QYFA 3H5AA 3DKYA 4Q48A 1Y1VC 1Z67A 4E7HA 4WILA 2K9MA 2HQNA 3GO5A 4UUTA 4OIQF 2L7KA 5CHPA 2EIKH 3RQ4A 4C2MC 2B63K 3KYLA 1WORA 2ME0A 2WTEA 3WTYC 3HOVC 4RBOA 3COAC 2WAQN 3BZ6A 4YFNA 4U0WA 2A05A 2EFNA 4X6AC 3RJPA 1U5TA 3R0AA 3HOYK 1FT9A 1YS6A 3FXJA 3WGGA 3RZDJ 4XRMA 1O26A 2DFFA 3M8FA 2O03A 2JRMA 1F43A 3HSRA 2VPRA 1Y1WJ 5H2FC 3BQYA 2XGXA 1BL0A 4QLCU 1W5SA 2FMLA 5CKTA 4MEYA 3C2HA 4V19K 3CF2A 1IN6A 3JRDA 4XLFA 1BGWA 3LAJA 3L2CA 3TW7A 4IEJA 2VE9A 1NG6A 3JAMZ 4WXHA 1X1PA 4K2EA 2XF5A 3OYIA 1VQLI 3HOUK 4LK1F 1WQ2A 1ZLKA 3BP8C 5D5VB 1O2BA 2M8EA 1ZKGA 3GTPJ 4LLGA 4KMFA 1T08B 2MD0A 5H6QA 3FXKA 2I5UA 3FOFA 5TISC 1R4NB 2EFWA 5KCMA 1OR7C 1FX7A 2FU4A 4UV9A 3KEYA 4B47A 2ACJA 1EQRA 3F8BA 2L4AA 2VXDA 3FIWA 4YG2F 2JQ7A 1A5JA 2MD5A 3VDXA 5LRSA 1OR7A 2XC7A 3G1MA 1KYZA 1P92A 2VIXA 5BPDA 3ELKA 3OYEA 3K0LA 2CFAA 1R9TK 4A3KK 5FLMC 3ZQHA 1J0RA 3K1MA 2EZLA 2BW3A 2F6CA 1LDJA 2WAQA 1U8RA 5M3MK 1L0WA 2FA5A 4M3BA 2DFHA 5B66C 1FC3A 3HGYA 3HSEA 1BI0A 5DM6F 5A2QZ 2BV6A 2FBKA 3GEEA 3M07A 3CQZJ 2LF7A 4OIPF 1V5FA 2AXLA 4N9IA 4AWXB 1INNA 3BOQA 1YQAA 2KJBA 4A3LK 1V5EA 4GTBA 1WCMA 3HEFA 2Y0SD 3CJNA 3N4MA 2LKSA 4AH6A 4B44A 2ZJQF 2V6UA 3PO3K 2XROA 4IOCF 2QGUA 5F04A 1OJLA 2KIQA 4IRGA 1SD7A 2RKHA 1F93A 1XX5A 1TTYA 1W5TA 2BY0A 3LSJA 3PL8A 3QYEA 5EGOA 2XRLA 2ISZA 3HHGA 4PK4A 3AAFA 3K6GA 2BY1A 3H5RA 4I76A 3J81K 4MEXF 4B3AA 4XRSG 4L9VA 2FSWA 2DFIA 2CMPA 3AG1H 1PUFA 2LDUA 3CCRI 1IXRC 4XLAA 2XB0X 3ZQIA 4RM2A 1LFPA 3B6CA 3I59A 2K02A 4DJAA 3JRBA 1PUEE 3PO2J 3QAHA 1G4DA 2M7AA 3B6AA 1MGTA 3CUQB 1U3EM 3GTKK 3IH3A 3S16K 1BIAA 3PJRA 2X0LA 4OWRB 4IJAA 4R79A 5ILVA 1ZQ3P 3BZCA 2JA5C 1ZTRA 4CCKA 5IP7J 4F55A 4KMUA 2FQTA 5CVIA 3HZJA 3SZGA 3ERED 1FMVA 2CUEA 1E3OC 3FXMA 1D0XA 3CMEI 4ASNA 3TP3A 1VH2A 3I4PA 2GZWA 2FEZA 1NH3A 3NQOA 5F1JA 1HI9A 4KIFA 3QQAA 4UB6C 4ZYDA 1WJFA 1AB4A 3A02A 3L2VA 1AWCA 2VPLA 1FTZA 1TL8A 3MMLB 5L3FA 2JUCA 3OYGA 4BBRK 2ISYA 3GVAA 1JKRC 2E2JC 2BE5F 2W24A 2RNJA 4XICA 3S1NK 5FGMA 1RU0A 3JW4A 2XSJC 1IBAA 2YR2A 5FKNA 3F8MA 3ZR8X 3PSFA 5BOXA 2DPDA 4II2A 5IT3A 1OKRA 4N9HA 1YX2A 2Z16A 4UVCA 2JUGA 5K1YA 1RIOH 1N75A 4YG2A 4M9SA 5BQTA 3R60A 4A3GC 1DP3A 4A3JC 1B9NA 1UHSA 1W0TA 5KAIC 4ZDPA 2DPUA 2FD5A 2GSNA 2M3AA 1R6RA 2YU9J 4EEFG 2V9VA 2LF8A 4YFKA 3EYYA 3U9GA 2R5YB 2FF4A 2WY7Q 3RCOA 1QVUA 3S93A 4XM3A 4CCNA 1DGWY 1J75A 2CS3A 4IQJA 1IXCA 3QP5A 4GYGA 4HF2A 2R93A 5IYCJ 1P6RA 5D6FA 2K4BA 3KCCA 4M3FA 4ZYGA 2VC1A 2W00A 2HDDA 4E6KG 4DNCA 1YW7A 4IHVA 1RETA 4PGGA 4KN7X 5EG0B 3BR3A 3CP8A 2NVTJ 4IO9F 2NS0A 1TQPA 5HLTA 1TNTA 2UZKA 4P9SA 1SFXA 1TWGJ 2I10A 2PI0A 2DA4A 3G1LA 3GEIA 4QJVB 5GAEJ 1YJWI 1SAXA 1HA8A 3GCMA 1ISEA 2BY3A 2VE8A 2A6HA 2CQNA 2RN7A 1BI1A 5EYRA 3CC7I 2B9SA 1HKTA 2P8TA 4NB5A 2VT3A 4XBFA 1HKSA 1S5LC 2KL4A 4E7ZA 5IYBC 2DLLA 2HTJA 1QHHD 2PFBA 1Y8QB 1T39A 1FIAA 2OQGA 1UHMA 4XRSA 1KU2A 3CC4I 4KATA 1QZYA 4L9NA 1I1GA 2JA7A 3OREA 1GVDA 1KU3A 4JYKA 5M5XK 2R7FA 3WTTC 1GV5A 2OUMA 4GRIA 1JVIA 2M34A 4KA4A 1UJ8A 2DW4A 3OPFA 3MZ8A 5IP9J 3JCUC 3OYFA 1YI2I 3L2WA 1K6YA 4XN0A 3UNGC 4XMYA 2NVQJ 5J4VA 2Z3YA 1FBQA 1Y56A 2LP0A 3CC2I 3BJAA 4M1XA 4XIDA 4A3FK 2LTPA 1EJ9A 1OYWA 2HYGD 1UHWA 3BG5A 4C3HC 3W6JB 4XOPA 5IPAA 2CO5A 3N0BA 4IHSA 5TMCA 3ZQCA 1Z9CA 1UAAA 2PN6A 2CQXA 4A3IJ 2P5KA 3S3OA 1B72A 1VQ4I 2DOAA 4A3DC 4M74A 3CP2A 4BJ5C 3DFGA 5ICCA 2CU7A 5HLGA 4KN7A 4CXFA 2KPMA 5M5WK 1XZPA 1WSUA 2ZNYA 2HOEA 2FQ4A 1LVKA 4AC0A 4LB5A 3CQZK 2OV7A 3M4OC 2ZCWA 1UG2A 4Q47A 1XN7A 1YLFA 3M1EA 1SFOJ 2DA7A 4M73A 4E4HA 2V7FA 3Q9VA 3CMAI 1Y8RB 2QBYB 1ZYRF 2L9RA 5EGOB 3WU0A 3OL3A
chains in the Genus database with same CATH topology
1QQIA 1Q1HA 3T0YA 3KETA 1IXSB 1G3YA 3BPVA 4RGSA 2P5MA 3BROA 2O6GE 2Z99A 4KDDA 2H27A 2FNAA 3WGHA 3I54A 3EDPA 1QZZA 3R4KA 4FHTA 4LB6B 3RPQA 2PLYA 3L7WA 3MCZA 4ZYEA 2OAZA 3ZN0A 3TQNA 4LJZF 1WIHA 1EH6A 4S04A 3RYPA 3SXYA 1XGNA 5E18F 4KDPA 5CYVA 1Z7UA 4UHTA 2O0YA 4HLYA 2MLGA 1DDNA 4UVAA 4WXDA 2STWA 1PP8F 3V7CA 1S29A 4HZFA 2GQQA 3B73A 3ISPA 3KP2A 2Z9OA 3QX3A 5FB2A 3O2PE 2R7ZA 4U7DA 2EV5A 1OYIA 3WG9A 2DAOA 1TLHB 5FD5A 5ERIA 4IRHA 3CDHA 5CVJA 3QP6A 2QQBA 1ZG3A 2XASA 1FZPB 4KIBA 5ICEA 2MH9A 3S2WA 2D45A 4LMYA 2RVCA 3GYHX 1FY7A 4RS8A 3FMRA 1ZAOA 1O7LA 2HYFA 2OQRA 2GA2A 4MQVA 2FQ3A 1O3QA 5IOTA 1YFHA 4I7HA 1HBXG 2IJLA 3O6BB 3HYIA 4U88A 4RB1A 3F22A 4M6YA 4KUMA 1R1UA 3J80K 3TGNA 4JBAA 2HWVA 2FNPA 2W57A 2DK8A 4HV5A 1SFUA 4ZH4F 2B63A 3FXQA 4EM1A 2LKPA 1O3SA 4CDGA 1WQHA 5AIQA 3VOEA 5J6XA 3GLXA 3ZMSA 4EM2A 2H94A 5D4RA 5DD4A 2FXAA 2H09A 1UB9A 3K9TA 2W84A 4CO8A 1TW3A 4RB3C 1OYYA 3HOSA 3RI4A 3ABUA 3S0XA 3GTGA 2MA3A 4YIIA 5ICFA 4RGRA 2WWYA 4A0ZA 1KQ4A 1WWXA 4EJTA 4BQAA 4ENJA 1R9TA 3E5UA 5H20A 3VB2A 1I1SA 4DQ2A 3DP7A 5F64A 1O3TA 4LR2A 4Z2YA 1S6LA 1HKQA 4G6QA 4LG0A 4XRFA 4ESJA 1XXCA 2STTA 3WE2A 2MH2A 2R7DA 5EEGA 4L0YB 5L3GA 4TV7A 4KMAA 4A2UA 3CUQC 1CF7B 2NVYA 3ECHA 3AH5A 2CFXA 3CUQA 3ROUA 4UNOA 2D1VA 2QENA 2ZMEB 2IRFG 4LLNA 3BWGA 1MJBA 4BHPA 3FHZA 1RI7A 1XB4A 2BGCA 3I53A 4R8HA 3NUHA 2IP2A 1S7OA 4KYWA 1I6XA 5HVQC 4I2OA 3E6DA 1TQIA 3WTUC 5FFXA 2G7HA 3BJ6A 4LD5A 2XKPA 5F6FA 3GXOA 2BBYA 1OMIA 5ED4A 4IVNA 4YFXF 3J81Z 5JVTA 4KMDA 4CYDA 1O2AA 3K1PA 3DPLC 2HKOA 1XSXA 2DO7A 1K79A 3F21A 2A69F 1U5TC 3DF8A 1LVAA 1K78B 3KFWX 5IT9K 2PJPA 1BI2A 3RIRA 3SZPA 1O24A 2ZO4A 4BLBA 2CWEA 3R6SA 4IF4A 1KGSA 3E97A 4OMYA 2G9WA 4RAYA 2C6YA 3FOEA 2QVOA 2F5EA 2PQ8A 3M8EA 2CQKA 1F9NA 1G3SA 2DQLA 4EM0B 4BHCA 1Y1WA 3SZTA 6PAXA 1IW7F 3TOBA 3F72A 4IPAA 1NHAA 5KK1A 1P4WA 5HLHA 3KZYA 3JTGA 4LLLA 5LGUA 5D5UB 5HS7A 1FBSA 4KMUX 1ULYA 1BC7C 3GTPA 1FLIA 3REOA 2DT5A 2KIMA 2CW0F 3E3VA 3QU3A 3F8NA 2P7VB 3T8TA 1DP7P 3AQOA 2OU2A 1B6AA 1ZRDA 1F1ZA 3LA2A 3L4KA 1I27A 4OIRF 2KIFA 2COMA 5K5RA 4LG0B 3GW2A 2QBYA 2XAQA 1REPC 1W7PD 4FM9A 1J59A 3TDZC 1B1BA 2GIVA 2IT0A 3CQZA 5BMZA 5DV5A 4MHGA 2BYVE 3HSFA 5K5OA 1ZGAA 1XDSA 4A0YA 4XLPF 4CZZA 4M71A 3ML6A 3PQJA 1XMAA 2M30A 5JFEA 2PBIA 3N3YA 3LPXA 1O7FA 2ELHA 1G3WA 1BC8C 2OA4A 2IA0A 3F6VA 2Y3PA 4B09A 4A12A 3HTSB 4FZBA 1T6SA 2DQRA 2IA1A 2OBPA 4OMZA 2JH3A 1TQMA 5E1ZB 2XUBA 3ZMZA 4L9JA 4GT9A 2VC0A 4GTFA 1BN5A 4HQEA 4ON0A 1YW8A 5BPIA 3F6OA 1J5YA 1EH8A 3Q3QA 3V8LA 2F5CA 2GXGA 3GWZA 1Z91A 1SD4A 1JHHA 2EB7A 1LJ9A 2XAFA 3W6KB 1IZ1A 1HQCA 5ILUA 2MC3A 4P9FA 5D6EA 2M87A 1ZLJA 2YU9A 2VBXA 4I01A 2XAGA 1XGSA 1MJ9A 2XVCA 5LHGA 3EQLF 1ZRFA 4HX8A 1XXAA 3E6BA 3SFZA 3C7JA 2E7XA 2XKOA 1TWGA 2F2EA 4G8XA 4EGYA 4EVIA 5E1XA 4CHUA 5E20A 2JRTA 1YYVA 4F7ZA 4EJOA 2EJRA 4ESFA 3GFIA 2HR3A 4HDVA 4JK1X 4GFQA 4A6EA 3R61A 5CLSA 5LEJA 2NNNA 1FNNA 3LWFA 1LQ1A 1Y0UA 2QQ9A 2VXZA 4BH9A 4GTLA 3IWZA 1SMYF 2ADUA 1RZ4A 1GE9A 1C0WA 2A6EF 1HW2A 4G7OF 5CVVA 4GGGA 4R1HA 1BIBA 4FT8A 1BM9A 2FBHA 2A07F 1LB2A 1B59A 4WK8F 4XSZF 1QBJA 5EGHA 1GXQA 1DUXC 3AQPA 3ZN1A 1H0MA 4C3JC 3M7GA 4WF2A 1SFOA 2QYOA 3P9IA 2XRNA 2M5WA 1FBUA 3V7RA 3DV8A 4ENMA 3H0GA 1S3JA 1S7AA 2A3SA 3NEUA 3J80Z 1FOKA 1EH1A 3IHUA 1R00A 1PDNC 2ZNZA 3K2ZA 5FD6A 4BAYA 4J3NA 2XAJA 4EJWA 3KLOA 1YTYA 1YW9A 3LA7A 4IXAA 4G7HF 3DXJF 3V4GA 3T1BA 5LHHA 4KM8A 2KJCA 1W4MA 1YIOA 3HUGA 4OOIA 4BHBA 5DD8A 1IN8A 5BS6A 1KQ0A 3TKYA 1CF7A 3TOAA 2QZ8A 3LAPA 2JPCA 3I0TA 3FKIA 1LDKB 5LBQA 2VONA 2FOKA 3VFZA 4L18B 2PMUA 1CGPA 1KYWA 4HW0A 2RH6A 2QWWA 2EFPA 2UXNA 4PGHA 2ZMEA 4GTAA 5JHUA 1B4BA 1W7PB 2P4WA 2WC2A 4RGUA 1DPUA 2RV8A 4G7ZF 3CLOA 3H3ZA 1O28A 1LEBA 3KP3A 4MGRA 4GYIA 3V7SA 3T8RA 2NRAC 3U2RA 5HS9A 3V8JA 1L0OC 2KWAA 4HA8A 2ZFZA 3NRVA 1ZVUA 3DQVC 1LEAA 4AVPA 4ZYHA 3K1NA 2YX7A 4L9TA 3MFKA 4NHJA 2VODA 1HW1A 2K86A 4AIKA 2W25A 4Y13A 2DK5A 1H9GA 1P2FA 4WXCA 3BJOA 2XCRB 1K78A 3T5XA 3L9FA 2Z33A 2RGRA 3WTWC 2GA1A 3WODF 1D8JA 2R92A 3P9CA 4P55A 1WQFA 4XSXF 4EQQA 1QPMA 2NVXA 2XIGA 1RUNA 4L5JA 3DPTA 4EGZA 1O57A 4O3MA 1OPCA 4RGXA 4KARA 4B8XA 5LGTA 3KP5A 3QPHA 3MZHA 1JGSA 1EH7A 3F3XA 3KE2A 3HRMA 4LGWA 1MZBA 1QNTA 2E7WA 1USTA 1AOYA 4HF1A 4GCVA 4HOBA 3GTQA 2ZFWA 5FO5A 4S05A 1QGPA 4PCQA 3MZYA 3D5LA 3FXUA 5J8FA 3ZP5A 1S8NA 3I58A 1D3YA 4M72A 3OV8A 2Y0MA 3RKXA 2FBIA 4HX7A 1TWHA 2YPRA 3KEQA 5D8LB 4CICA 2HQRA 3OOPA 1EK8A 3GTLA 1LNWA 1TWAA 3MEXA 2ZXJA 2EV0A 1ZXOA 3IL2A 4P96A 1T38A 4YFNF 1XSDA 2P7CB 1R7JA 1TBXA 4G0WA 1J7KA 5FLXK 1K7AA 3FM5A 2GXBA 1Z1DA 2RC4A 4EV0A 5JR3A 5FFZA 1RUOA 4MEYF 2TDXA 1I5ZA 2HTSA 1USSA 1B9MA 5HLIA 3WU1B 5TJ3A 3KP7A 4H0EA 4LLGF 5IORA 2F5DA 4BKWA 4A5NA 2QLZA 2IPQX 1FYKA 4MTEA 3OEPA 1BOAA 1ZN2A 2V1XA 1Z05A 1O29A 2OZ6A 1HSJA 1XGMA 1SFEA 3GF2A 2D2WA 2DTRA 3ZPLA 2HS5A 4KB4A 4M9ZA 2Z5UA 5IOQA 3FMQA 4EMSA 4UV8A 3RPUA 1R5GA 1HSTA 1GVJA 1K83A 1V4RA 5HOOA 3LQQA 1I50A 4G9YA 2Q0OA 4CGZA 4HLXA 3CAGA 1DD5A 4HYEA 3FMSA 3IKVA 2B0LA 2OZUA 4G0UA 2H6BA 3JTHA 5DUIA 3ZMDA 2JZYA 1L3LA 3VODA 1XCBA 1DPRA 5JI6A 4I09A 1V3FA 1FSHA 1Y1VA 1I3QA 1YS7A 3E6MA 4BYYA 3E5XA 1XXBA 3CUOA 1XMKA 1MKMA 3ULQB 2VBZA 4KT5C 1IRFA 2K27A 4KM9A 4QWQA 3F8CA 2IA2A 3RTRA 3N97A 1R5HA 2YX4A 4HQMA 3JSOA 2PG4A 2VT2A 3RKYA 3M9AA 2FE3A 3L4JA 3G4CA 1XCVA 2MLKA 3KLNA 2HFHA 1KQ8A 3C18A 3QPTA 3BUEA 2Y75A 2LSOA 3BP8A 1O3RA 3FZVA 4U0VA 5AONA 4MTDA 4O5VA 1BI3A 4KB2A 1ZRCA 2L02A 4YFKF 3LA3A 3HTUA 4I98B 4A0XA 1ZHFA 1O25A 3HRUA 4JQFA 2E1NA 3C1DA 2EWNA 1ZBSA 2DI3A 5F1RA 2ZKZA 4HX4A 5L3EA 1ON1A 4GTEA 2Q8KA 5AIPA 3O3KA 3J7AO 1U6GA 5E8IA 3KEOA 2VUMA 3WTVC 5L3DA 3GTOA 5DCMB 1ZARA 3CO6C 2XHKA 2A6HF 4G0VA 5TJJA 1HXDA 3LSTA 1G3TA 2G7UA 3GTJA 2M1BA 2ZJ2A 5L3CA 1Z6RA 2DU9A 4A5MA 3KZZA 1E17A 2L3DA 2VOOA 1IUYA 1WI9A 3L00A 3HHHA 4L0ZB 4Q5SF 4BLAA 3SQNA 3PQKA 1VTNC 2JA5A 1MD0A 2GWRA 1IAWA 3CO7C 2FMYA 5CVUA 1TWCA 3N0CA 5IOSA 4IHTA 3JAMK 4N0BA 3PFIA 3V8KA 1F4KA 2HKXA 2J5OA 2ESHA 3ZMVA 2JSCA 4RB0A 1U78A 3MAJA 2NAZA 4O6JA 5LGNA 4L5IA 1IRGA 4PZJA 1W7PA 5E17F 2EFQA 3F23A 3P7NA 3LQRA 3RYRA 3E5QA 5KVRA 2K4JA 1MDMB 5EEHA 1R36A 2XCQA 2EA2A 2E1CA 5A2QK 1JE8A 2PHCB 1ON2A 1J9IA 5D8KB 2NNYA 1U5TB 5DDGA 1FSEA 3EYIA 4KMHA 4EJUA 3MQ0A 5CVRA 3HRSA 5DCFA 4E70A 2JPBA 2A68F 3IKTA 4M6XA 1F5TA 1IS1A 1TNSA 4KN4X 5TRDA 4ZZLA 3WTZA 3IRRA 2HZTA 4UXNA 2HGCA 2NYXA 3GUDA 5JVOA 4KIGA 3I5UA 1EV7A 1SD6A 4U7BA 4FX0A 4AIJA 2CFAB 4OU0A 3RKWA 2QQAA 3Q5FA 2O8XA 4XLNF 2IVMA 4EJVA 3B02A 1ZGJA 3FM3A 5EGEA 2EK5A 5H6RA 4MQ9F 1X3UA 3H3UA 1FP1D 3QU6A 3H92A 1IN7A 4KASA 3BDDA 2YSRA 4OIOF 3HRTA 1UFMA 4WWCA 2UXXA 4OINF 3ZMUA 1ZREA 4KNYA 4U0YA 1KU7A 2Q2EA 1R22A 3MWMA 5LRRA 2IW5A 2RQPA 4Y15A 1R1VA 5D5WB 3I59B 4UVBA 1GHCA 2GSOA 3Q9SA 3KP4A 2CGPA 2HEOA 1U2WA 1JHFA 2LNBA 4M9XA 3FXRA 2E2HA 4NQWA 2MBFA 1A04A 2W85A 1KU9A 1B4AA 5DUKA 2Y48A 1BBYA 3LFKA 4BXUA 2KKOA 4A6DA 3HOTA 4PDKA 2CYYA 5D5XB 2P5VA 2X4HA 4DDQA 1T98A 5LEKA 1KA8A 5K5QA 3P9KA 1D8KA 3DKWA 4G94A 1FYLA 2XCOA 4KICA 4P5OA 1TWFA 1WRJA 1YG2A 3G4AA 3SHFA 2RGVA 5HS8A 1IN4A 2VBWA 3FF5A 3DEUA 2KIUA 4HF0A 2HDCA 1FYMA 2QUFA 1Z6TA 1TW2A 1J2XA 2GAUA 3QRFF 2EA4A 3G3ZA 5E8GA 2L01A 3ZMTA 1R23A 2F5FA 4BNCA 4P5BA 4WX9A 3R0JA 1K6OA 5CJ9A 5DYMA 3WTSC 2VBYA 3I64A 2A5YB 1HW5A 3BPXA 4ILDA 5L3BA 4KFCA 4GTCA 2XAHA 3ECOA 5JFRA 1T0FA 2A61A 3F8FA 1BJAA 1FP2A 4Y17A 5FLXZ 2XV4S 2WV0A 1KQ9A 3GFJA 1UCRA 5E1WA 4GTDA 2L54A 4YIFA 3K69A 3QOPA 3C3WA 1PP7U 3GTMA 2M45A 4I0BA 4ENKA 5HDNA 2P6TA 1D5VA 1IN5A 3G73A 3WTXC 2OD5A 5ICGA 4D0PA 2YU3A 4LQYA 2PEXA 4P5AA 1SD5A 4RB2C 2ETHA 1P4XA 1IF1A 2V1DA 4HBLA 3GX4X 3VEPA 2V1UA 2O61A 1SMTA 3ZQ7A 4AD9A 2ESNA 3EUHA 1T2KA 4G6DA 2JT1A 4GXOA 4HV6A 1R1TA 2D1HA 1XD7A 5HDGA 4HDUA 1ONVA 5J8CA 1H9TA 4HAMA 1LDDA 4ENNA 2CG4A 1WQGA 1BJTA 3TO6A 2E2IA 1O27A 5DEQA 2EFOA 5IT9Z 3GFLA 3HIFA 2UWMA 2AS5F 4KC6A 2O3FA 1GXPA 1E2XA 5ILSA 4AIHA 3BY6A 2CSOA 4ESBA 3WE3A 2V6CA 3TDUC 3TO7A 3GZ6A 1RNLA 4I0AA 4IRIA 5HDKA 5D4SA 4WCGA 2H6CA 3CTAA 3KP6A 1XSVA 5DCMA 3VA7A 3IC7A 2VOPA 2KRFA 3ABTA 2ZBKA 3GFMA 4ETSA 3JSPA 2RDPA 3U1DA 2PMHA 2JTVA 3IWFA 3FWEA 2FRHA 3GEZA 3IRQA 4LK0F 5LLQA 2JA6A 5LHIA 1ZG1A 2R3SA 1YO5C 3FX3A 1FPQA 1XDUA 2VN2A 2P5LC 3GTKA 1JXSA 4Q4ZF 1STZA 4FX4A 2K7LA 1WKMA 2J5PA 4LFUA 1P4AA 2EV6A 4ZZDA 1XGOA 2L4MA 3EETA 3E6CC 2BEOA 1ZH5A 1MJAA 4UUVA 4C3IC 4I02A 3TO9A 1ODDA 4RAZA 1ZG5A 2QM3A 1R58A 2DBBA 2GSUA 4GO1A 1QO0D 1G6NA 3GZ5A 2P6SA 3WGIA 3I71A 4KAWX 4P9UA