3ERED

Crystal structure of the arginine repressor protein from mycobacterium tuberculosis in complex with the dna operator
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arginine repressor
publication title Crystal structure of the arginine repressor protein in complex with the DNA operator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01316 Arg_repressor Arginine repressor, DNA binding domain
D PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ereD01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ereD02
3VA7A 3I71A 5D4SA 1BGWA 2L3DA 3ROUA 1ZN2A 1Z91A 5BPDA 3TDZC 1ZRCA 4KAWX 4HV5A 5IT3A 3J7AO 2FMLA 5JVOA 1STZA 5K1YA 4GFQA 3GO5A 2YX4A 2VT3A 1V4RA 1YTYA 4WXDA 1XMKA 1CF7B 1Z7UA 4CO8A 3MEXA 4UUVA 4HZFA 3U9GA 1P4WA 4HDVA 4DDQA 1YFHA 3W6JB 3HRTA 5CVIA 3V8LA 3SHFA 2X4HA 4EM2A 2WTEA 1IN7A 3F8CA 1XDSA 2GZWA 2FMYA 2XAFA 2HTSA 1USTA 1HBXG 3BOQA 2FXAA 3O3KA 2EA2A 1DDNA 2LDUA 4WXCA 1PDNC 1TBXA 3RKXA 4G7OF 3IRRA 2XROA 2YX7A 4IXAA 1K78A 1S29A 3KP4A 1AOYA 3BUEA 2VBXA 4UVBA 5E1XA 3R4KA 4Y15A 4M9XA 2L4MA 3H3ZA 1CF7A 2A69F 1FSHA 1I6XA 3QP5A 4RGUA 4A5NA 3FZVA 2F5FA 2ZO4A 2P6TA 4CDGA 2VBZA 2OZ6A 1LEAA 1IW7F 4M71A 2GWRA 3N4MA 2UWMA 3IWZA 4ETSA 3I58A 2DFIA 3K2ZA 3HOTA 2JSCA 4A5MA 1XSXA 2FNPA 2Y0MA 3DV8A 3TKYA 1F5TA 1KYWA 4XLNF 1KU3A 2DPUA 2XAHA 1SFXA 4ZH4F 1WI9A 4OIPF 2VE8A 5LGNA 2W25A 1ZYRF 2E7XA 1XDUA 3E5XA 3JW4A 3OV8A 3CO6C 2ETHA 5HS7A 2W24A 2XAQA 2MH9A 3CDHA 2FRHA 2YPRA 3FWEA 1HKSA 4IF4A 1E2XA 1TNTA 2ZNYA 4FX0A 4Q48A 4AIHA 5BPIA 1LDKB 3EETA 3ABUA 1BOAA 4G94A 4LG0B 3RJPA 4I7HA 1YS7A 3GWZA 2IP2A 3REOA 5FLXK 1DUXC 1D5VA 1YYVA 4EQQA 2QZ8A 2BE5F 3GVAA 3ZN1A 1QGPA 2XUBA 5BQTA 1FT9A 2XGXA 4RB0A 2CQKA 3T1BA 1T38A 1JGSA 2KKOA 3NEUA 3SQNA 2P8TA 4HQMA 2P7VB 1UCRA 1IAWA 1FBUA 2C6YA 2HOEA 3QU6A 2VBYA 5D4RA 2FBKA 1SAXA 4LG0A 3GX4X 2IJLA 2Y48A 2QLZA 4M9ZA 1HSTA 1XGSA 5FB2A 1SD5A 3F6VA 1BC8C 4E70A 3Q9SA 5LBQA 2M8EA 3VODA 2UZKA 5ICFA 4AIKA 1HQCA 4Y13A 4IRIA 1GVJA 2DU9A 4BH9A 1BI0A 2CGPA 2XKPA 5FFZA 5FD6A 2UXXA 3MQ0A 1G3WA 1OYWA 1W5TA 4BHPA 1S7OA 2H27A 5D8KB 3HSFA 4F7ZA 2R3SA 2LKPA 3IRQA 1BBYA 4Q4ZF 3WGHA 2P5KA 1YG2A 1P92A 2V1DA 4LLGF 2IT0A 1FP2A 1T6SA 4EM0B 3DEUA 4IPAA 3IKVA 2YU3A 3J81Z 3J80Z 2O61A 2P5VA 4NB5A 4HDUA 4CZZA 1IN4A 3F6OA 5TRDA 2E1NA 1XXCA 3EQLF 5H6RA 5L3DA 3ZPLA 2Z33A 5H6QA 2QQAA 2P7CB 2HYGD 2DQLA 3BY6A 4YIIA 4I0BA 4KDDA 1WQGA 4ENKA 2XRNA 3H3UA 2PN6A 2RKHA 2A68F 2KIUA 2PMUA 2VBWA 3S2WA 1WKMA 3RYRA 4L9TA 3MMLB 5ILVA 3SZPA 4M74A 3BPVA 3C18A 2H6BA 3DQVC 3L2CA 2HS5A 2EFPA 3KLOA 4LB6B 3CAGA 2EJRA 4WK8F 2D1HA 1QZZA 2D45A 2RGVA 2V1UA 2A5YB 4MQ9F 1TW3A 2QBYA 3M9AA 5LRSA 4KT5C 3EYYA 3JAMZ 4WCGA 1YQAA 4RB3C 3M8EA 4KIGA 2FF4A 1LVAA 5ICCA 2EWNA 2F5DA 2IA0A 4G6DA 5DCMA 2XAGA 3V7CA 1O7LA 3P9IA 1EH8A 2PEXA 3RI4A 1BC7C 3C3WA 3WE2A 2OBPA 2PI0A 3BZ6A 1XGNA 3AAFA 4EJUA 1LB2A 2FE3A 1IF1A 2PLYA 1EV7A 2RVCA 4U0VA 1TNSA 4ENJA 2VOPA 1ZAOA 2MA3A 3O6BB 1USSA 3E6BA 5BS6A 3MZHA 1L3LA 3TOBA 2ZMEA 3C7JA 3L7WA 2CO5A 4L0ZB 1SMTA 2JZYA 4WF2A 2M1BA 3HTSB 3KEOA 1XCBA 1BIAA 3F3XA 4AD9A 4MGRA 1QNTA 2K86A 3T8RA 2HWVA 2NRAC 1FYLA 1UHMA 2P5MA 1YIOA 4G0VA 4H0EA 1EH6A 4HBLA 3EYIA 1IZ1A 1IXRC 4PGHA 2BYVE 3MCZA 2NAZA 2MLGA 4P96A 2L4AA 5LEJA 3Q9VA 3OEPA 1O3RA 1FSEA 2HYFA 3LFKA 5J8FA 2O0YA 2GIVA 3ECHA 2XCRB 1UHWA 1J7KA 4MTDA 1FY7A 3EUHA 1T0FA 3KLNA 5HLIA 1WQ2A 5A2QK 5D5VB 2OAZA 2XAJA 1G3SA 2M45A 2RQPA 2W85A 1R23A 4L0YB 4FT8A 2OZUA 3WU1B 3GUDA 4XBFA 5CVRA 2G9WA 1YLFA 4ESJA 4EJOA 3GLXA 3GFMA 4LK1F 1ZGAA 3E5UA 5ICGA 4KN7X 3KCCA 2O03A 1MZBA 1HXDA 4IRGA 3U2RA 1XMAA 1OKRA 5DD8A 2LF7A 2W84A 1Z1DA 4KA4A 3J81K 4ENMA 1FBSA 3R60A 2MC3A 1OYIA 5FGMA 3V8KA 4A6EA 2STTA 2DQRA 2EV0A 2HR3A 4RGSA 3FOEA 3ZMZA 4I0AA 1ZG5A 5E8GA 1JXSA 4MEXF 5D5WB 4P9UA 3KETA 3I64A 4HX8A 5CJ9A 3HRMA 1Z6TA 4LFUA 1G3YA 2JT1A 1BM9A 3FM5A 1TW2A 1BJAA 5J8CA 1FYMA 3MFKA 3I0TA 2Y75A 1G3TA 5BMZA 2QQBA 3WTUC 3DP7A 3IWFA 3ERED 2Z99A 3LA7A 5ILUA 2V9VA 1WQFA 1QPMA 2VOOA 3M1EA 5IT9Z 4HLXA 4BAYA 1S8NA 3SFZA 4TV7A 4LK0F 4RAYA 1W4MA 2ISYA 3TQNA 1GHCA 2AXLA 2FNAA 2E1CA 3HRUA 2FBIA 1P6RA 2O3FA 4GCVA 1FOKA 3T0YA 2QM3A 2A61A 3KE2A 1J9IA 3WTVC 3W6KB 2ZFZA 1R58A 2MBFA 1ZLKA 2HKXA 3FM3A 3T8TA 3HOSA 1LJ9A 2OU2A 2ESNA 1TQIA 1EH7A 3KFWX 3BROA 1BI1A 4RB1A 4HX7A 4R8HA 2OD5A 1BI3A 3RIRA 3PFIA 3TO7A 1B59A 2HQRA 5DEQA 4OINF 2GQQA 1FLIA 3DXJF 2HTJA 4CYDA 1W5SA 1B1BA 2DO7A 4N0BA 1LDJA 4DNCA 3VOEA 3RKYA 3TDUC 4K2EA 3F21A 1KQ9A 3WU0A 4GYIA 4LJZF 2PG4A 1TQMA 2LSOA 1SD4A 1YW7A 4EGZA 2A07F 3FMRA 4G8XA 5DV5A 2NYXA 1Q1HA 4OIQF 2CG4A 3IKTA 3R0AA 2O8XA 1KQ0A 2A3SA 1D8KA 1R00A 2BV6A 2LF8A 3NQOA 3ZMTA 3L9FA 3TO6A 4Y17A 2PJPA 3IC7A 3K69A 1GXQA 3I53A 4OIRF 3O2PE 1K6OA 1R1VA 4U7DA 4OIOF 3TO9A 4A2UA 1ISEA 1ZHFA 2J5PA 2OA4A 2XV4S 3WG9A 2OQRA 5E18F 4HF0A 3LAPA 3WTTC 2VC0A 1I1GA 1J2XA 5LGUA 4LLLA 5LGTA 1ZARA 1TQPA 4KMUX 1S3JA 1R1UA 1OR7A 2HDCA 3DF8A 3ISPA 2IA1A 4MEYF 1PUEE 2FU4A 2IW5A 2L01A 4M6YA 4HV6A 4O3MA 1A04A 3I59B 5FFXA 1FWZA 3FOFA 3D0SA 1JE8A 3ZMVA 4KICA 1Z6RA 2GXBA 4U0WA 5HS9A 4L9NA 4IVNA 2DTRA 2HEOA 4KUMA 1WIHA 1FX7A 2H94A 3V4GA 1ZG3A 3GFJA 2RGRA 2K02A 4M6XA 3ELKA 1KQ8A 2P4WA 1SD6A 1FNNA 2OQGA 2BGCA 3P7NA 2K7LA 2ZKZA 2XIGA 2FSWA 2A6EF 1RUOA 3CTAA 2Z3YA 4YFKF 3ZP5A 5K5OA 3HUGA 1IRFA 3R6SA 1IN8A 4YIFA 5K5RA 3JTHA 4LGWA 3ABTA 1ON1A 4OU0A 1G4DA 4LMYA 5J6XA 1I5ZA 4KN4X 1ODDA 1ZH5A 3KZYA 1U6GA 5FO5A 3LAJA 3I59A 4G0UA 3RKWA 1Z9CA 4BHBA 2A6HF 2KIFA 4ZYDA 2DAOA 1AB4A 3ULQB 4EM1A 1R1TA 3HSEA 1B4BA 3BJOA 5EEHA 3M8FA 1EK8A 3OREA 1BN5A 3I5UA 5CVVA 4PGGA 1SMYF 5DCFA 4ESBA 5L3FA 4LB5A 3LQRA 1I1SA 4RS8A 4KNYA 1CGPA 4A0XA 3COAC 1K79A 4YG2F 1IN5A 1KU7A 5DYMA 2EFNA 2DK8A 5D6FA 1C0WA 2EK5A 1MKMA 2R7DA 4KC6A 2ZXJA 1ULYA 2WC2A 4L5IA 3JTGA 1YO5C 2LNBA 1TTYA 1MJAA 5CYVA 4P5OA 1NHAA 2K4JA 1PP8F 2EFOA 1LDDA 3PQKA 3JSOA 1VTNC 3BJAA 1LEBA 2EFQA 3VFZA 1FPQA 1ZVUA 1OYYA 1ZRDA 1XSVA 2KJCA 3B73A 2KJBA 4LD5A 4WWCA 1W7PB 2R7FA 4I2OA 2MLKA 2VE9A 3HTUA 4L5JA 5LEKA 1FP1D 3VB2A 2ZJ2A 4O6JA 1H9GA 4UV9A 1FZPB 4M72A 4YFNF 4KIBA 3WE3A 2Q8KA 3WTZA 1BI2A 4ZZDA 3LA3A 4JBAA 3Q5FA 2Y3PA 3QPHA 3CO7C 1KGSA 5HLGA 4EGYA 5DDGA 4FHTA 2PHCB 2RNJA 2QENA 5D5XB 1J5YA 4WX9A 4ON0A 1YW9A 3E3VA 1GE9A 4MHGA 1Y0UA 5LLQA 2JRTA 4D0PA 1QBJA 1ON2A 2M87A 1WQHA 4U7BA 1WSUA 1DD5A 3V8JA 3WODF 4EJVA 2DPDA 4NQWA 4Z2YA 2IRFG 4S04A 1XXBA 3FXUA 1R5HA 1XGMA 1SD7A 1S7AA 1ZREA 3T5XA 1RUNA 1W7PD 3GEZA 3ML6A 3FHZA 2AS5F 3QAHA 1E17A 3L4JA 3E6MA 1MD0A 2QQ9A 3F22A 5E1ZB 4KB4A 1U8RA 3KP2A 3MWMA 6PAXA 1BIBA 3QRFF 4G7HF 3CUOA 5HS8A 3IL2A 1HKQA 5FLXZ 3QX3A 2QVOA 4FX4A 4UXNA 3WTXC 1GXPA 2MD5A 2FQ3A 2L02A 1RIOH 1IXSB 5E1WA 1FC3A 3C1DA 1KYZA 4XSZF 2JTVA 5ILSA 2EA4A 1R5GA 4J3NA 2P6SA 4GO1A 4QLCU 2ESHA 2JPCA 4B09A 2VXZA 4AIJA 3TGNA 3HRSA 4BQAA 5EEGA 2VT2A 3J80K 2RDPA 5CLSA 5HLHA 1T98A 4G7ZF 1KA8A 2WWYA 1IXCA 3U1DA 5JVTA 2J5OA 1X3UA 3ZMSA 1JHFA 3FF5A 1HW2A 2H09A 4U0YA 2Z9OA 4R1HA 2HKOA 1K78B 3L4KA 1O3QA 2XVCA 5L3CA 4BHCA 5KK1A 3QU3A 1RI7A 4RAZA 2CSOA 4RB2C 3KEQA 4GXOA 5HDNA 2VONA 4XSXF 5L3GA 3CLOA 5E20A 2Z5UA 4S05A 3DKWA 4NHJA 2ZNZA 3VEPA 2VN2A 3JSPA 2O6GE 5CVJA 4GYGA 1P2FA 4G6QA 4HX4A 1AWCA 3HHHA 2EV5A 2EFWA 3RPUA 2E7WA 4L9JA 4UNOA 2PBIA 1K7AA 1FBQA 1KU9A 4I09A 4KDPA 3KZZA 4IHSA 4HW0A 1O7FA 3IHUA 4P55A 5H20A 1SFUA 2VC1A 4ASNA 4HA8A 4PDKA 3JAMK 4Q47A 3WGGA 1WRJA 3BWGA 2V6CA 2L54A 1YS6A 2CYYA 2DT5A 2D1VA 1O57A 4JQFA 5JI6A 3GW2A 2XCQA 3FMQA 1MJBA 5AONA 4Q5SF 4EVIA 2XKOA 3K1PA 1U2WA 2F5EA 2NNYA 1F9NA 1HKTA 3ZN0A 4EJTA 4ZZLA 2HZTA 3QP6A 4ESFA 2GAUA 2V1XA 3SXYA 4I02A 1JHHA 3DPTA 3HYIA 5K5QA 5AIPA 4EJWA 3ZQ7A 2HGCA 3P9KA 5HOOA 5DUKA 2X0LA 5ERIA 5HDGA 2RC4A 1MGTA 4JK1X 3K9TA 1DP7P 4OMYA 2GA2A 2EB7A 4R79A 1ZLJA 1J0RA 3P9CA 3ZMUA 2JPBA 4BYYA 4O5VA 3FXQA 5L3EA 3LA2A 3M7GA 4KB2A 4FM9A 4LLNA 1ZG1A 4PZJA 3LPXA 1R7JA 1TLHB 4HF2A 4UV8A 1RNLA 4L18B 3BP8A 1R22A 2GXGA 4N9HA 1U5TB 4L9VA 2CWEA 2IVMA 1U78A 4KYWA 1RZ4A 2QYOA 4CHUA 4A6DA 3G73A 4XRFA 3K1MA 1P4XA 4UHTA 2Q0OA 1SFEA 3KP6A 1ZGJA 3E6DA 1S6LA 2PQ8A 3E5QA 2YR2A 4HQEA 2FBHA 3ECOA 3HHGA 3GXOA 4CICA 5CVUA 2P5LC 4HF1A 4IJAA 1XN7A 1D3YA 2NNNA 3I4PA 2ISZA 3RYPA 1J59A 2ZBKA 2DW4A 3MAJA 3I54A 2W57A 3OPFA 1YW8A 2QUFA 2M5WA 4A0YA 4XLPF 1I27A 3F8FA 1F1ZA 1U5TA 2RN7A 2UXNA 3L09A 3D5LA 5F6FA 5A2QZ 5AIQA 1T2KA 2NS0A 4OMZA 4HYEA 1R36A 1J75A 4ZYHA 3CUQB 3LSTA 5E8IA 5KVRA 1F4KA 1ZRFA 5DD4A 5L3BA 3G3ZA 2XCOA 5FD5A 2F2EA 1DPRA 3HIFA 2ADUA 5HDKA 2ACJA 1B6AA 5JR3A 4B8XA 1P4AA 2PMHA 3DPLC 3SZTA 3MZYA 1OMIA 3NRVA 2FOKA 3K0LA 2BEOA 4OOIA 1D8JA 4UVAA 4I98B 2TDXA 3N97A 5LRRA 5LHHA 1L0OC 4EMSA 5HVQC 3WTWC 3OOPA 2PFBA 3CUQA 1PP7U 3BJ6A 1IN6A 3QPTA 5IT9K 1QZYA 4A0ZA 2STWA 2ELHA 2YSRA 1B4AA 2DI3A 5JFRA 3QOPA 4HOBA 4MQVA 3FX3A 2QBYB 2FA5A 3F23A 4WXHA 2IPQX 3RTRA 1HSJA 1KU2A 1OPCA 2K4BA 2BBYA 2VODA 5E17F 4G9YA 1XXAA 5F1RA 1O3SA 4GGGA 3R61A 5DCMB 1B9MA 1IS1A 1G6NA 3L00A 5ED4A 2V79A 2QWWA 3RDIA 4HLYA 1IUYA 1U5TC 2KRFA 1XGOA 1QQIA 5F64A 4I01A 3F8BA 5LHIA 4AWXB 4BXUA 2HQNA 2HFHA 2ZMEB 4P9FA 2CFXA 2F5CA 3K1NA 3F8NA 3V7SA 3GZ6A 4U88A 1BJTA 4MNUA 5JHUA 2K27A 3ZMDA 5LHGA 3R0JA 1MJ9A 2DBBA 4N9IA 2CW0F 1XCVA 1LQ1A 1ONVA 1U3EM 4YFXF 2WV0A 1V3FA 3FXRA 1W7PA 2GA1A 3DFGA 1LNWA 1XB4A 3LWFA 1FYKA 3TOAA 3CUQC 3BDDA 4IHTA 4QWQA 4BNCA 1H0MA 2D2WA 4DQ2A 1EH1A 4KMFA 4UVCA 1H9TA 3GZ5A 2KWAA 4CXFA 4ZYGA 1DPUA 3KP7A 5D6EA 3GYHX 4KIFA 1MDMB 2KIMA 4M9SA 3E6CC 3H92A 2FEZA 2EV6A 1QO0D 4G0WA 4KFCA 4M73A 4AVPA 2XHKA 1IRGA 2DLLA 5ICEA 4CGZA 3V7RA 5D8LB 1XD7A 3CJNA 3BPXA 3KP3A 3F72A 1UB9A 2DK5A 3GF2A 2ZFWA 4ENNA 4RGRA 4ZYEA 2XASA 3PQJA 4IRHA 4HAMA 1REPC 3WGIA 2G7HA 4A12A 2ZCWA 4PCQA 5DUIA 3KP5A 1WWXA 1MDMA 3FMSA 5TJJA 1XSDA 2H6CA 3EDPA 3GFIA 2IA2A 1UFMA 2B0LA 4EV0A 2G7UA 1HW1A 3GFLA 3B02A 2M30A 3LQQA 1Z05A 5D5UB 2Q2EA 3WTYC 3HSRA 3E97A 2RV8A 4RGXA 4MTEA 3RPQA 2COMA 2MH2A 1T39A 3F8MA 5BOXA 1B9NA 1HW5A 3NUHA 1O3TA 3WTSC
chains in the Genus database with same CATH superfamily
2A6EA 3VA7A 1C0AA 3I71A 4YFKA 1P7IA 5D4DA 5D4SA 4FZBA 2QGUA 3GLLA 1BGWA 2L3DA 3ROUA 1ZN2A 4RMNA 1Z91A 2JRMA 4CYCB 5BPDA 1O26A 3TDZC 1ZRCA 4KAWX 4HV5A 3BCAA 5IT3A 3J7AO 2FMLA 1S72I 5JVOA 1STZA 5K1YA 1IC8A 4GFQA 3GO5A 2YX4A 3I4MJ 2VT3A 1TWHK 1OCCH 1TWAK 1V4RA 3JR9A 1I50K 1YTYA 4WXDA 1XMKA 1CF7B 1Z7UA 4CO8A 3DU6A 3MEXA 4UUVA 4HZFA 2K40A 3OWTA 5IYDJ 3U9GA 3BC8A 1P4WA 4HDVA 3PFYA 4DDQA 1YFHA 1TWFK 2PMZD 4BY1K 3W6JB 2VLAA 3HRTA 1WJDA 5CVIA 3V8LA 1SMYA 2NVXA 3SHFA 3OYMA 2X4HA 2JA7J 4EM2A 2B9SA 3HKZN 2WTEA 1H88C 1IN7A 1X1PA 3F8CA 1XDSA 2GZWA 1FEXA 1NG6A 4XKCA 2FMYA 5M3MJ 2XAFA 2V26A 2HTSA 1USTA 1HBXG 3JSTA 3BOQA 2FXAA 3O3KA 1FMWA 2DXIA 4ZTFA 3K6GA 2EA2A 1DDNA 2LDUA 2ME0A 2KIQA 4WXCA 1PDNC 3PM1A 1TBXA 4HEA2 2HDDA 1W5CC 2CFAB 3RKXA 4F3QA 4YG2A 3OYJA 3IRRA 2F48A 4G7OF 2XROA 3N3YA 5IP7J 2M4KA 3GTGA 2YX7A 4IXAA 4CYCA 1K78A 1S29A 3KP4A 1AOYA 1XZQB 3BUEA 2H8RA 2VBXA 4E7JA 2TCTA 2R7VA 4UVBA 2NXNB 3K4JA 5E1XA 3R4KA 4Y15A 3L2QA 4M9XA 4BJ5C 2EIKH 2L4MA 2R7UA 3H3ZA 1CF7A 4A3BK 3HKZD 4Y33A 2WADA 4Y52K 1IBAA 5M5XK 2A69F 5GPCA 1TWCK 1VQMI 4NOIA 1FSHA 1FIAA 3TW6A 4W97A 3S93A 4C2MK 1JKQC 1I6XA 3QP5A 1A36A 3OS1A 4RGUA 4A5NA 3FZVA 3FDYA 1GLNA 3S0XA 2F5FA 2ZO4A 1I6HK 2P6TA 4CDGA 3S1QJ 3S14K 4UB6C 2WB1N 2VBZA 4CSWA 2B63J 4C3HC 2OZ6A 5C44C 3DKYA 1LEAA 1IW7F 4M71A 1TWGC 2GWRA 3N4MA 1RR8C 2UWMA 3IWZA 2CFAA 2DFFA 2LLKA 2JA7A 4ETSA 3S17C 3I58A 2DFIA 3PUBA 5FLMK 3K2ZA 5C3EJ 3HOTA 2JSCA 3C2BA 3S8PA 4A5MA 1XSXA 2X1EA 1I3QC 2FNPA 3BR5A 5FKNA 2Y0MA 3GZNB 3DV8A 3TKYA 1F5TA 1KYWA 4XLNF 1KU3A 2DPUA 3BR0A 2XAHA 4YFNA 1SFXA 1W36C 2HYJA 4ZH4F 1WI9A 1W0UA 1LFBA 2CUZA 4OIPF 4KMDA 2VE8A 5LGNA 2W25A 1ZYRF 2QCOA 1X4OA 4DJAA 2E7XA 5M5YJ 1XDUA 2WB1D 1LFUP 3E5XA 3JW4A 3OV8A 3CO6C 2ETHA 5HS7A 4I6ZA 2CQ7A 2W24A 1UMQA 3IAS2 5IPAA 4CCOA 3UR3C 2XAQA 2V1NA 1IGNA 1HI9A 2MH9A 3CDHA 4A3JC 2FRHA 4J01A 2Y2ZA 2HVQA 2YPRA 2E5ZA 3FWEA 2VQHA 4O2DA 1HKSA 4IF4A 3F9KA 1E2XA 1TNTA 2DOAA 2ZNYA 4AM3A 2B63A 4FX0A 2NVXC 2KISA 4Q48A 4CA0A 4GRIA 4Y7NC 1UZCA 4RAGA 4AIHA 1WCMK 1PUFA 5IORA 5JLWA 5BPIA 1O2BA 1SFKA 5IYCK 3CC7I 3L4JA 1LDKB 3EETA 3ABUA 1BOAA 4RM2A 1IDYA 2LYCA 2BOLA 3GMEA 2HPIA 2JA8K 4G94A 4IKFA 4LG0B 4ZJZA 5C4JJ 2F4OB 3WODA 3RJPA 1U9OA 1B8IB 2R5YB 2QSFX 1MMNA 4I7HA 1YS7A 3GWZA 1HDDC 4YRVA 5F1JA 3RZOC 2HZDA 2IP2A 1VQOI 4A3IK 4BY7K 1Z7LA 3REOA 4D7NA 5FLXK 2DYSH 1O2AA 1DUXC 3OSFA 2K9LA 1D5VA 1YYVA 1PJ6A 4EQQA 2JA6A 2QZ8A 2BE5F 3GVAA 4NUBA 4KM8A 3ZN1A 2VL8A 1LVKA 4N4NB 4BBRJ 5M5WJ 1J6VA 4LR2A 3WHBA 4YELA 1YJWI 1QGPA 3MVPA 3GTJA 4PJLA 4A3LJ 2XUBA 4IOCF 3FHNA 5BQTA 1FT9A 2XAUA 2XGXA 5TMFA 4RB0A 2CQKA 3T1BA 1T38A 2ELKA 1P7JA 3FXJA 1JGSA 2CV2A 5J4YA 2CUFA 2KKOA 4C2TA 2IS6A 3I4MC 3NEUA 4HSTA 4ILDA 3HKZL 1W0TA 3SQNA 1SEUA 3FK6A 2P8TA 4HQMA 5JVGF 2P7VB 4HRIA 3IUOA 2MD0A 3KEYA 1UCRA 2X48A 1IAWA 3S15J 1FBUA 3GTKJ 3W2VA 2BZTA 4BJ6C 3O8GA 5IYDC 2L9SA 2C6YA 5B1BH 2HOEA 4E7SA 1BW6A 5FKOA 3QU6A 1LUJB 2VBYA 2FBKA 5D4RA 1SAXA 3VYTB 1D0ZA 2HU9A 5GAHJ 4LG0A 1RR7A 3GX4X 3HXLA 2JA7C 3G6EI 4DW6A 4IOAF 3S1NJ 3A1YA 4LIVA 1DP3A 4A3MK 2IJLA 2Y48A 2QLZA 4M9ZA 1HSTA 1XGSA 5FB2A 1SD5A 3F6VA 1BC8C 4E70A 1FTZA 1JKOC 1YX3A 3Q9SA 2LY2A 5LBQA 2M8EA 3VODA 2UZKA 3S32A 2K3FA 5ICFA 2K85A 4AIKA 5C4XK 1N78A 4DBQA 4IO9F 4XSZA 3K7AK 5IP7C 1HQCA 1FJLA 4Y13A 1VQKI 2LBFA 4IRIA 1V55H 2EQRA 1GVJA 1EJ9A 2DU9A 4F55A 4BEHA 4BH9A 1BI0A 2CGPA 2XKPA 4C3IK 1JOEA 1YIJI 5FFZA 5FD6A 5FROA 3ONQA 2UXXA 3MQ0A 1N77A 1G3WA 2DA5A 1OYWA 3ZQIA 1W5TA 1GV5A 4BHPA 4GT9A 3HOVK 4DZJA 3G1MA 1S7OA 2FOWA 4GDFA 3NWTA 2H27A 5K7ZA 5D8KB 4G7ZA 3HSFA 4F7ZA 1ZBSA 2R3SA 2LKPA 2XPVA 2HXIA 3IRQA 4BDYA 3Q3QA 1BBYA 2R7WA 4Q4ZF 3CC4I 3AG2H 2WA0A 3GTKA 3WGHA 3OIQA 2P5KA 3S1QC 1YG2A 1P92A 2V1DA 4LLGF 1YNNA 2B63C 4HNTA 2IT0A 2L7ZA 1FP2A 1T6SA 4EM0B 3DEUA 4IPAA 3CMAI 3IKVA 4FE7A 1QVTA 2YU3A 3J81Z 3J80Z 2O61A 1DQUA 5C3EC 2OPTA 2P5VA 4RM3A 4NB5A 4HDUA 2KZGA 3MKLA 1IN4A 4CZZA 3OYNA 1K83K 2VKHA 1OCZH 1QZEA 2JUCA 1VH2A 1O29A 1UV7A 1JGGA 3F6OA 3LL7A 3Q3SA 2D5VA 5TRDA 2E1NA 1XXCA 3EQLF 5H6RA 5L3DA 4QIWD 3ZPLA 1OLTA 2Z33A 2L7KA 3LSHA 4GTBA 1MMGA 5H6QA 2QQAA 3OYDA 2P7CB 1T08B 2DQLA 2HYGD 3BY6A 4YIIA 4QJVA 4PSWA 4I0BA 4KDDA 1GDTA 2FX0A 3OYGA 1WQGA 4ENKA 5M3FK 4C2UA 4D9JA 2XRNA 2AHQA 3H3UA 3S2HK 2KDZA 2PN6A 2RKHA 3CLQA 5GTHC 2A68F 3CD6I 2KIUA 2PMUA 3M8JA 2VBWA 1Z3XA 2KDOA 1WZ2A 3S2WA 4XQFA 2Z2SB 3D1NI 1WKMA 1BDFA 3T00A 3RYRA 4L9TA 2F4MB 2ZSHB 3MMLB 3CESA 5ILVA 4G7OA 3SZPA 4M74A 3TW7A 3BPVA 1MIJA 3C18A 3U21A 3S16K 2H6BA 3DQVC 4NC8A 3L2CA 2R0QC 3OYKA 2HS5A 1HQMA 2EFPA 3KLOA 1BA5A 4X6AK 4LB6B 3CAGA 5F08A 2EJRA 3B6AA 4C3JK 1F7UA 2LC2A 5E3OA 2VUMJ 4WK8F 2D1HA 1OCTC 2A69A 2BY3A 2HQAA 4I99C 2XB0X 1QZZA 2D45A 2RGVA 3L1PA 2V1UA 1R71A 2GM4A 2A5YB 4Q5SA 1ITYA 5C4JC 4MQ9F 1TW3A 3DEEA 2QBYA 1T95A 2ZXWH 1E3PA 3M9AA 4RLQA 3HL2A 2X51A 4IX7A 5LRSA 2XRLA 2VJIA 4KT5C 4A3GC 3EYYA 2EINH 3JAMZ 4WCGA 2COBA 1ZR2A 1YQAA 4RB3C 3M8EA 4KIGA 4BBRC 2FF4A 4XCHA 2KRHA 1LVAA 3UKGA 4KN7A 4A3LC 5ICCA 2QQ8A 2EWNA 3MKYB 2E2HJ 3FK7A 2F5DA 2IA0A 4G6DA 4M1XA 5DCMA 2XAGA 3V7CA 3S1RJ 1O7LA 5CHPA 4XIDA 3CCRI 3LSMA 1YNJA 3P9IA 4XKWA 1EH8A 2PEXA 3RI4A 1BC7C 3C3WA 3SJMA 1IJWC 1EI6A 3WE2A 2OBPA 2PI0A 3BZ6A 1XGNA 3MKWB 3GTGJ 2ZUEA 2R93K 2X6OA 2HOTA 3AAFA 4EJUA 4B47A 1LB2A 4CCMA 3SZZA 4BU2A 3IH4A 2FE3A 1IF1A 1OISA 2PLYA 3S15C 1EV7A 1DCHA 1YI2I 2RVCA 1WVRA 1LPQA 1YRNB 4XRSA 3GTKC 4U0VA 3GTMJ 1BR2A 1TNSA 3HOUJ 4ENJA 3DCFA 2FUG2 2VOPA 1ZAOA 4CCLA 2MA3A 3PSIA 1Y8RB 3CMYA 3O6BB 2NVTJ 1USSA 3N0CA 3E6BA 5BS6A 3KX2A 3RKQA 2Y9YA 3MZHA 1L3LA 2R92K 2HNHA 3BR3A 2DMUA 3TOBA 2XGDA 5HNFA 2VQCA 3BZKA 2EZLA 2ZMEA 3C7JA 3L7WA 2H8WA 2CO5A 4L0ZB 3HOYK 3K4CA 5GAEJ 3N0BA 1HCRA 3QYBA 1SMTA 2DMQA 2EILH 5TMCA 2UUZA 4XN0A 3K4NA 1TC3C 5F0HA 3PL8A 4GTAA 2JZYA 4WF2A 1EF4A 2M1BA 3HTSB 1WJFA 4G6TB 3KEOA 1XCBA 3FIWA 1BIAA 2OV7A 3OYAA 3F3XA 4AD9A 1PJ5A 4MO7A 2ZUFA 1Y1WJ 4QTRA 4MGRA 4DYRA 1QNTA 2EBIA 2K86A 2VXDA 3T8RA 5EYRA 5LFAA 3M4OJ 2HWVA 2NRAC 3AL0B 1FYLA 2E2HA 1UHMA 2P5MA 1YIOA 2LRDA 3K70C 2L2OA 2OUMA 4G0VA 4H0EA 1M1EB 1EH6A 3GTQK 2O5IA 4HBLA 1YRNA 1OCRH 3EYIA 1IZ1A 2X1CA 1IXRC 4PGHA 2BYVE 3MCZA 5IOYA 1R9TK 3K4KA 2NAZA 2MLGA 3GDZA 3JRHA 1Y6IA 1QVUA 4P96A 2L4AA 3A03A 4PUSA 5LEJA 1RKTA 3Q9VA 3OYEA 4BBSK 3OEPA 1O3RA 1PJRA 1FSEA 4BQNA 2HYFA 2E2IJ 1DGWY 3LFKA 5J8FA 3HEFA 3HDDA 2O0YA 3MZ8A 3L2WA 2V4JC 1V5GA 2GIVA 1IV8A 3ECHA 4DYQA 2XCRB 1UHWA 2JMWA 1J7KA 4MTDA 1VQLI 3RQ4A 3ZQHA 4BGDA 3ASNH 3WG7H 2NVQK 1FY7A 3EUHA 1T0FA 3IH2A 2M34A 2VKEA 3KLNA 5HLIA 3QYEA 1WQ2A 3FKJA 5D5VB 5A2QK 3DTKA 2OAZA 1G59A 2XAJA 1G3SA 1X1CA 2M45A 4D1QA 3OOUA 2I8DA 2RQPA 4JYKA 3A2KA 3AD7C 2W85A 4PJNA 1R23A 4L0YB 2IS1A 4FT8A 2OZUA 3WU1B 3GUDA 2K3PA 4XBFA 3HC7A 4E7ZA 2X9DA 5CVRA 3A8JA 2G9WA 1YLFA 4ESJA 4EJOA 3GLXA 3GFMA 1Y1WA 4LK1F 4XLPA 1ACIA 4RMFA 1TWHJ 1TWAJ 1ZGAA 2LK2A 1USMA 1GT0C 3RZDK 1I50J 5HLTA 3PIOF 4A3EK 3E5UA 5ICGA 1YX2A 1D1BA 1RETA 4RLFA 1JKRC 1O2FB 3I4NK 4BY1J 2X6WA 5KAFC 1ETYA 1TWFJ 4KN7X 4C3HK 3KCCA 3CMMA 2O03A 3PO3K 3HOZC 1MZBA 3HOWJ 1HXDA 4A3FJ 2BXZA 2R7SA 2PMZA 1EKEA 4GTCA 4IRGA 2IGKA 3U2RA 2HI3A 3S17K 1XMAA 2VQLA 1OCOH 1OKRA 2EIJH 5DD8A 5J1UA 3VYSB 2E2IA 3BQYA 2LF7A 2VJJA 2Y0SD 4BJTA 2PMZN 2W84A 4Y4RA 5J4VA 3BP3A 1Z1DA 4KA4A 2PPBA 2VUMC 4XL9A 1MBJA 4MFEA 2ZMEC 3J81K 3OYHA 4ENMA 1FBSA 2GAHC 2I10A 3H9JA 3R60A 2LREA 4NDLA 2MC3A 3SDGA 1OYIA 5FGMA 3V8KA 1EQRA 3AH5A 1A35A 4A6EA 1OFCX 2STTA 1QHHD 1U9NA 1YX5A 2DQRA 4Y52J 2EV0A 5M5XJ 2HR3A 3HPGA 4RGSA 3FOEA 3ZMZA 4I0AA 1SVLA 2HXOA 3HKZA 1ZG5A 2ZFUA 4C2MJ 3CCYA 4A3JK 2O5JA 5E8GA 2AQFA 1TWHA 1TWAA 1JXSA 4MEXF 1FMVA 4V2GA 2E2HC 5D5WB 3PNTA 1I50A 1FOXA 1NTCA 2E1MB 4P9UA 1B72A 3S1RC 3KETA 3I64A 4HX8A 5CJ9A 3BG5A 3HRMA 3FXOA 4B4CA 1Z6TA 4LFUA 1G3YA 4PAAA 3B6CA 2JT1A 3GTOK 1BM9A 3QODA 4JX6A 1I6HJ 3FM5A 1A6IA 3S14J 2L9RA 1TWFA 1TW2A 1BJAA 5J8CA 1FYMA 3MFKA 2Z16A 3I0TA 1HA8A 2NVYK 4Z6YA 2Y75A 4XICA 1G3TA 1K4TA 3DTIA 5BMZA 3A8IA 2QQBA 2VQGA 4JX4A 5TGTA 3WTUC 3DP7A 5L46A 4M3EA 2BY2A 3IWFA 3ERED 3GTMC 4HNUA 2L9NA 2Z99A 3HOUC 3OSGA 1X1BA 2YS9A 3H5RA 3LA7A 5ILUA 2GOMA 5FLMJ 4LG3A 4B48A 2V9VA 3BR6A 4II2A 3JRBA 3H36A 2NVTC 2M2EA 1WQFA 1QPMA 3PO2K 3CP8A 1W36D 1S7EA 2VOOA 1EA3A 3M1EA 2M8GX 2RNGA 3QPLA 4ITVA 4P5BA 5IT9Z 3RZOK 4HLXA 2ZJPF 4BAYA 1S8NA 1GV2A 3SFZA 1F36A 4TV7A 1ZR4A 3GTPK 4BXXK 4GFBA 4LK0F 3S2DK 3MN2A 4RAYA 4XK4A 4M3DA 1W4MA 1XC5A 2ISYA 2DA7A 1ERDA 2BY0A 3M3YK 5J40A 2GIZA 3TQNA 1GHCA 2AXLA 2WB1A 3BR1A 3CCSI 3FXKA 2RREA 5EF6A 2FNAA 1RKWA 3HRUA 4CCNA 2E1CA 2FBIA 1U8BA 2L7MP 2IEKA 4JOMA 1TWCA 1P6RA 2O3FA 5GPAA 1IRXA 4UY8I 4GCVA 5EG0B 3T0YA 1FOKA 1PYVA 3QYFA 3M4OC 1YHQI 4KMUA 3BG9A 2QM3A 2A61A 3KE2A 1J9IA 2GXAA 5E3MA 2KPMA 3WTVC 4PABA 2QA4I 3CP2A 3W6KB 1XPPA 1R58A 2ZFZA 4KM9A 1RPWA 3VPRA 2MBFA 5EZGA 1ZLKA 1V5VA 2HKXA 4XNFA 3FM3A 3T8TA 1AKHB 2M0CA 3HOSA 1VJEA 3H3VK 2DMNA 1LJ9A 1XZQA 3EUKL 3AG1H 1WCMJ 2OU2A 2ESNA 2KLOA 2E2IC 3RPUD 1TQIA 5M3MK 1EH7A 3BG3A 3KFWX 2DDAA 1IL2A 5IYCJ 4E7LA 2CV1A 2JA6J 2H1LA 1BR4A 2JA8J 4II3A 3BROA 4BXXC 3GTJJ 1BI1A 2CH0A 4RB1A 3H9GA 4HX7A 4R8HA 2OD5A 1BI3A 4BY7J 3RIRA 2IGOA 3PFIA 2LP0A 1B59A 2HQRA 2R7OA 3HG9A 5F0CA 3TO7A 2JH3A 4XLCA 5DEQA 4OINF 3SEQA 2GQQA 4ZDPA 1FLIA 2CW0A 3CCVI 2V9KA 1UG0A 5EG0A 3DXJF 2HTJA 4CYDA 1VLOA 1W5SA 1B1BA 4YFXA 3OYLA 1YE9A 3N05A 4KARA 2DO7A 4N0BA 1SC7A 1LDJA 3IPJA 3UNGC 3VOEA 4DNCA 1Y0NA 2PA8D 1D0YA 4PJ0C 3RKYA 3TDUC 4K2EA 4KN4A 1TWHC 1TWAC 4A93J 3F21A 1I50C 4A3KK 3OYFA 1KQ9A 3LNQA 1WOSA 4GTFA 2M3AA 2P0WA 4F93B 1WOOA 2PJRB 3WU0A 4GYIA 5B1AH 5E68A 4LJZF 1WJBA 4LITA 2AQEA 2PG4A 1TQMA 2LSOA 2PMZL 1SD4A 5IY5H 1YW7A 4BY1C 2HQ5A 4EGZA 3AQOA 2A07F 3FMRA 4G8XA 1Z77A 5DV5A 3H3VD 2NYXA 3HOWC 4A3FC 1Q1HA 3OY9A 4OIQF 2CG4A 3FKIK 2KQRA 3IKTA 3CF2A 2R7RA 3R0AA 2O8XA 2HDWA 1WCMA 5J47A 1KQ0A 2A3SA 4A3MJ 3GTGC 4LOCA 1JUPA 1U0JA 3ABLH 1D8KA 3ZGKA 1R00A 2MSYA 2MFZA 3W6VA 2NVQC 4B1RA 2BV6A 2LF8A 3MMYB 3NQOA 4E7KA 3ZMTA 1RU0A 3LSIA 4L5EA 3T02A 3L9FA 5C4XJ 3TO6A 4Y17A 4NC7A 2EIMH 1HF0A 2PJPA 1YJNI 2LVSA 1K4SA 3IC7A 3OIPA 3K69A 1GXQA 2KZVA 1DU6A 4C3IJ 4DYCA 3I53A 3CCEI 4OIRF 3O2PE 3VYRB 1K6OA 1G8XA 1R1VA 1APLC 3MD2A 4U7DA 2OTJI 3AD8C 4P5AA 3OS2A 4OIOF 4AYBD 2BW3B 3TO9A 4A2UA 4Y52C 1ISEA 1YITI 1ZHFA 1X3WB 2CS3A 2J5PA 1O25A 2PJRA 2OA4A 3HOVJ 2XV4S 3WG9A 2OQRA 5KCMA 4XRMA 1VQ4I 5E18F 3OL3A 4HF0A 3LAPA 3WTTC 1JI8A 1O27A 4C2MC 2VC0A 1I1GA 3CQZK 1UJ8A 1D5YA 1J2XA 5LGUA 4LLLA 1T56A 5LGTA 1ZARA 1F7VA 1T33A 2FQ4A 2TRTA 1TQPA 3BG6A 1D1CA 3K2AA 4OAZA 1B8IA 3L2RA 2R5YA 3HUGB 4KMUX 5IYBK 1I6HC 3S14C 1S3JA 1R1UA 1OR7A 2HDCA 3DF8A 4KJZA 4J19A 1YCLA 2LY9A 4P1WA 3ISPA 2IA1A 4MEYF 1PUEE 5FLVA 5GAGJ 2FU4A 2IW5A 2L01A 3BLYA 3DTEA 3DBLB 4IHYA 3S17J 4M6YA 4WJ4A 4HV6A 4O3MA 5FLMC 4A3DK 1A04A 1JJ8C 3I59B 5FFXA 5BNGA 1FWZA 5LD2C 1FTTA 3FOFA 1K83J 3D0SA 1JE8A 1QRYA 3ZMVA 5F0FA 1LFPA 1Z6RA 4KICA 2GXBA 2E2JK 4A3GK 2LH9A 2BY1A 1MNEA 4U0WA 5HS9A 4L9NA 1F43A 1A6QA 3IAM2 2BW3A 4IVNA 2DTRA 2HEOA 4KUMA 3O8HA 1WIHA 4BBRK 2WB1L 1FX7A 4BQQA 2H94A 3V4GA 1ZG3A 3VWBA 4A3LK 2DJIA 3GFJA 2RGRA 1R4NB 2WAQN 2K02A 4M6XA 4BL0B 1AU7A 2R7XA 3ELKA 1KQ8A 3DBHB 3S2HJ 5IP9K 2P4WA 1SD6A 1FNNA 1X4PA 2OQGA 2BGCA 3P7NA 2E71A 2K7LA 2ZKZA 2XIGA 1H8AC 2FSWA 4I76A 2A6EF 1RUOA 3CTAA 4FASD 4BE1A 2Z3YA 4QIWN 4F52A 4YFKF 5K5OA 4IQ4A 3ZP5A 3HUGA 1BL0A 1IRFA 3R6SA 1IN8A 3FISA 4YIFA 5K5RA 2D6FC 5TJ3A 2G0EA 3JTHA 4KMAA 1ENHA 3FBNB 4LGWA 2V6SA 4M3GA 1FIPA 3ABTA 1ON1A 3CDLA 3H9QA 4OU0A 1G4DA 3S16J 4GZYA 4UUSB 4LMYA 5J6XA 1I5ZA 4KN4X 3S3NA 1ODDA 1ZH5A 2WBMA 3KZYA 5EDNA 4X6AJ 1U6GA 5FO5A 3LAJA 1WPKA 2Y30A 3I59A 2WAQD 4G0UA 3LSRA 3RKWA 3ZXSA 1Z9CA 4N4OB 2YU9K 4M6VA 1P9QC 1ETWA 2A6HF 2KIFA 4BHBA 1WCMC 4ZYDA 2DAOA 3LSGA 1VQNI 3ULQB 2Y9ZA 1AB4A 4D5FA 4EM1A 5IYCC 1R1TA 3DPUA 3HSEA 1B4BA 4A3CK 3BJOA 5EEHA 1NK2P 2JA6C 3M8FA 1EK8A 1K61A 4NNJA 1BN5A 3OREA 3I5UA 5CVVA 1VNDA 3QWLA 1K83A 1MH3A 4PGGA 1SMYF 1JT6A 5DCFA 1AHDP 3GTJC 4ESBA 5L3FA 3GTLK 3ERMA 1Z3YA 4LB5A 4BY7C 3LQRA 4IQJA 1Y1VK 1I1SA 2BHYA 1D1AA 4RS8A 4KNYA 3CJTB 4H4KC 3IV5A 1CGPA 4A0XA 4B3AA 3COAC 2M7AA 1UHSA 1K79A 1WJEA 4YG2F 2MYSA 5KNLA 1IN5A 3BR2A 1KU7A 5DYMA 4EATA 2EFNA 2DFHA 1SFOK 2DK8A 1W1WE 1H89C 4X1EA 1VGXA 2L7FP 5D6FA 2R5ZB 4AIDA 1C0WA 2EK5A 1MKMA 1VQ7I 4V19K 4A93C 2R7DA 4KC6A 2ZXJA 2CFOA 3G2BA 3SEZA 1SANA 2OCCH 1ULYA 2LG4A 2WC2A 4L5IA 3JTGA 1YO5C 2LNBA 1TTYA 1MJAA 5CYVA 4P5OA 1F93A 3S1MK 1NHAA 2K4JA 5IP6A 1PP8F 2NS7A 5GADJ 2EFOA 1LDDA 3PQKA 1E3OC 3JSOA 1XS9A 1MNMC 2XSJC 5EZHA 5FKMA 1VTNC 1VQ8I 3BJAA 2R92J 1LEBA 2MABA 4C30A 2EFQA 3M07A 2KP6A 3VFZA 1LE8B 4A3MC 1FPQA 3H0GK 1ZVUA 4GTDA 1OYYA 3HOYJ 1N25A 1ZRDA 1XSVA 2KJCA 3B73A 2KJBA 3BTLA 4LD5A 3DLAA 2N8GA 4WWCA 5C4XC 1W7PB 1ETKA 2R7FA 4I2OA 1IW7A 4GTLA 2K9SA 3H0GA 2MLKA 3GEEA 2VE9A 3HTUA 3D5SC 1E3HA 4L5JA 5B66C 5LEKA 2R7ZK 1FP1D 2XF7A 3VB2A 4C3IC 3G1LA 1JJ6C 2ZJ2A 2VI6A 4O6JA 2R5ZA 3K70D 3KYLA 1JUMA 1IQ0A 2ZJRF 1HC8A 1H9GA 5K7HA 3L2UA 4UV9A 1FZPB 4E4HA 4M72A 4YFNF 4XLNA 5J3LA 1X19A 2DA2A 2BVLA 2JA2A 4KIBA 3WE3A 4JP0A 2Q8KA 3TP0A 2BHZA 3GTQJ 2ID3A 3WTZA 1MBFA 4ZH4A 1BI2A 1RESA 4ZZDA 4OIPA 3HOZK 3LA3A 3E0JB 4JBAA 2X6XA 3Q5FA 1R9TJ 1ZYRA 2Y3PA 1CQTA 4LQYA 2R93A 4NQWB 3QPHA 5JHFA 3G4CA 2JA5K 3CO7C 4XKVA 4BBSJ 5EGOB 3AKZA 1KGSA 1X31C 1OQYA 4FTHA 3S1NC 3AFHA 4RAFA 1I6VA 5HLGA 4EGYA 5DDGA 4FHTA 2P81A 2PHCB 3TTGA 5FJ8K 3IP4B 2JA5A 2CQQA 2RNJA 2HPMA 3HOXJ 2QENA 2VUMK 5D5XB 4DBRA 1LKXA 1J5YA 5HODA 2R92A 2DTZA 4WX9A 1WORA 4ON0A 2OJED 2NVQJ 1YW9A 2VJ4A 2RH6A 3E1SA 3E3VA 5IOTA 1GE9A 4MHGA 1XZPB 1Y0UA 5LLQA 2JRTA 3GSIA 3JRGA 4D0PA 1K83C 2GBYA 3OMYA 2VJ5A 1R4MB 1IG7A 4V2FA 1ORKA 4LJZA 2GSNA 2ECBA 4QIWL 1QBJA 1MW7A 1ON2A 5CQGA 2M87A 3AD9C 2Z1DA 3KYCB 1WQHA 2FJ1A 1TT0A 2DA4A 4U7BA 4FE4A 2M0MA 1WSUA 1DD5A 3ZCOA 3V8JA 4B43A 3RZDJ 3WODF 3S2HC 2VKDA 4EJVA 3ZQQA 4A3EJ 2DPDA 4NQWA 4Z2YA 2IRFG 4S04A 1XXBA 2Y69H 3FXUA 3W2AA 1R5HA 5EGOA 3GTQA 1R49A 3I4NJ 1XGMA 1SD7A 2BE5A 1S7AA 2DA6A 4BQOA 1ZREA 3T5XA 3PO3J 1R9TA 4FISA 1RUNA 2ME6A 2Q2EB 1RC9A 1VRQC 3CCQI 1HDPA 1W7PD 2V6EA 3GEZA 3IH3A 3ML6A 3FHZA 1ZTRA 2ZSIB 2XDVA 3QAHA 1T8IA 1WJCA 3E6MA 2AS5F 1MD0A 2QQ9A 3K10A 3VDXA 5E1ZB 3F22A 4UB8C 4IHXA 4KB4A 2LY1A 1S5LC 2ELJA 1U8RA 3KP2A 3MWMA 4W1UA 4OIRA 2H1KA 6PAXA 1XZPA 2M4GA 1BIBA 3QRFF 4G7HF 2Y0SA 3CUOA 5HS8A 3IL2A 1HKQA 3VYUB 3V42A 5FLXZ 2DT7B 1XMXA 3QX3A 4RA2A 2QVOA 2FQTA 1XG1A 2O9LA 1G2HA 1MSFC 4FX4A 2OC6A 4UXNA 3WTXC 1OCPA 3OYBA 4BKWA 4QPQA 4PK4A 2I5UA 2VKVA 1GXPA 4ZDOA 2MD5A 2Y0SN 1WSVA 2CUJA 3CDIA 3SFIA 3CJRB 5H2FC 2FQ3A 3BQZA 3WU2C 1ETOA 3K4BA 2L02A 2QKLB 3HBLA 5DM6F 2DFEA 1RIOH 1IXSB 5E1WA 4ZC3A 2Y31A 4G12A 2F4IA 1FC3A 1V5FA 2W4SA 1J6WA 3C1DA 4KMHA 3PJRA 5C44K 4YIRX 1ZQ3P 1KYZA 4XSZF 1YJ9I 1TWGK 2JTVA 5ILSA 3K4MA 2EA4A 1R5GA 3GTOJ 1WHUA 1JT0A 4J3NA 3H5NA 2XPWA 4C45A 2CQXA 2P6SA 4CUGA 4GO1A 4KASA 4QLCU 4IHWA 2NVYJ 1I3QK 4JX5A 4ABZA 2ESHA 1Z21A 2JPCA 4B09A 2VXZA 3RSNA 3ZRGA 4AIJA 3TGNA 3HRSA 4BQAA 5F27A 3E7LA 5EEGA 2VT2A 1R5ID 3J80K 2B7EA 2RDPA 5E3NA 5CLSA 5HLHA 1T98A 1VQ9I 4G7ZF 3TBIA 3PO2J 5CPRB 5CKTA 1KA8A 2WWYA 1IXCA 3U1DA 2R92C 1JVIA 1UAAA 2W48A 3LSPA 2LKXA 2ZC2A 5JVTA 2A05A 4JK1A 2VPRA 4Q4ZA 2J5OA 4A3BJ 3HOYC 4EEFG 2MC4A 1X3UA 3ZMSA 3GTPJ 4BXXJ 4PFOA 1TWCJ 1BW5A 1JHFA 3FF5A 1HW2A 1A31A 3S2DJ 4AC0A 2WY7Q 2H09A 4U0YA 2Z9OA 3GIRA 4LLGA 1QA6A 3KYDB 3SZYA 3M3YJ 4R1HA 2HKOA 1K78B 1IV6A 3G4AA 3L4KA 1O3QA 4BE2A 3X2QH 1POGA 2XVCA 2JVHA 1J09A 5L3CA 3ZQCA 4NC6A 3Q0WA 4BHCA 1O4XA 5KK1A 1J6XA 3QU3A 1RI7A 2ZXIA 1MMSA 4RAZA 4DGWB 4ZTJA 2CMPA 2CSOA 2JK3A 4RB2C 3KEQA 2KMUA 4GXOA 4HNVA 5HDNA 2A6HA 2NVXK 2VONA 4XSXF 5JLXA 2WAEA 4Y7NK 2XC7A 5L3GA 1UG2A 3CLOA 3ZQFA 5E20A 3EQLA 2Z5UA 4S05A 5KHDA 3GTQC 3DKWA 3BTJA 4HG2A 2HOAA 3A0BC 4NHJA 3GTOA 3KZIC 3HOWK 4A3FK 1R9TC 5E79C 2GSOA 2ZNZA 2NVYA 2HVRA 4XR6A 3VEPA 2VN2A 1ETXA 2AO9A 3JSPA 1MNDA 2O6GE 5CVJA 1X1AA 4BBSC 2DMTA 4GYGA 1P2FA 4G6QA 2LTPA 2A68A 3GTGK 3SYTA 2O8KA 4HX4A 1X1DA 3EUHC 1WH5A 1AWCA 3HHHA 1T0FC 3T01A 3OR1C 2EV5A 2EFWA 5EGEA 3RPUA 2E7WA 4L9JA 4UNOA 1BR1A 2PBIA 3M1CA 3HOXC 1K7AA 2UV1A 1FBQA 1KU9A 4I09A 4E7HA 3TEDA 3H1CA 3KZZA 4KDPA 5EEAA 4IHSA 3A0HC 3AG3H 4HW0A 1N75A 1O7FA 3AL0C 3IHUA 4P55A 5H20A 2FD5A 2VC1A 4S0HB 1SFUA 4ASNA 2F6CA 3RQIA 3HZJA 4HA8A 3GTPA 4PDKA 3JAMK 2KL4A 4Q47A 3WGGA 1WRJA 3BWGA 5FKLA 4X0GA 1NK3P 3I4MK 1Y1WC 2V6CA 2L54A 2XGCA 2NVUB 1DGRM 1YS6A 1NH3A 2CYYA 2DT5A 2D1VA 1O57A 4JQFA 5JI6A 3GW2A 2XCQA 3FMQA 5IYDK 2A6TA 2EPFA 1MJBA 5AONA 4Q5SF 4EVIA 2XKOA 4XLEA 3RZDC 3K1PA 1U2WA 2KHMA 4A3KJ 4A3EC 3PUFA 2F5EA 2NNYA 1VQ6I 4MQ9A 4XM3A 4GTEA 1F9NA 1HKTA 1WSRA 3A8KA 3ZN0A 3OYIA 1JKPC 4EJTA 3JREA 2JA7K 4ZZLA 4ZDLA 3I4NC 3DKXA 1XX5A 3CMEI 2HZTA 3QP6A 4ESFA 3PO3C 2GAUA 1DCPA 2V1XA 3FKIJ 5EJCA 1Y56A 2DJNA 2EH3A 4U87A 3SXYA 5IOZA 4I02A 1JHHA 3DPTA 4A69C 5IP7K 3HYIA 5K5QA 1VFCA 5AIPA 2RQQA 4EJWA 5FRNA 1JQWA 2E1OA 4AUXA 2IS2A 2Y0SL 4A3IJ 3VSLA 3ZQ7A 2HGCA 5E3LA 2NOGA 2XF6A 4NBQA 2CU7A 3P9KA 3PNYA 2WV1A 5HOOA 1PUFB 4ANJA 5EGHA 5DUKA 3FXMA 1XTAA 1PJ7A 3GEIA 4MIMA 2X0LA 2CUEA 1INNA 4XN3A 2QEXI 4B3XA 2IGMA 2DDBA 5ERIA 3PIPF 4YEJA 5HDGA 2RC4A 3TFIA 3WHCA 3CF5F 2VPLA 1MGTA 2CW7A 2W00A 3EUAA 1JUSA 4JK1X 5B5EC 3CC2I 2JVGA 3K9TA 1SAUA 4D5CA 2FQOA 1AKHA 1DP7P 2DN0A 1KONA 1X2MA 2KT0A 4OMYA 4AYBA 2V6UA 3LMMA 1IRZA 4FCYA 3S1QK 2GA2A 2EB7A 4R79A 2DMPA 1ZLJA 2CRGA 1TWFC 3CQZJ 1J0RA 2E60A 1X58A 3P9CA 2B63K 3C2HA 4D7MA 3ZMUA 2JPBA 4BYYA 5J1RA 4O5VA 4F91B 3FXQA 3I3LA 5L3EA 3LA2A 1V54H 2LR8A 2DT6A 4AYBN 3GTOC 3M7GA 4XOPA 5IYBJ 4KB2A 4LLNA 4FM9A 5C3EK 1ZG1A 2F5VA 3QOEA 4PZJA 4CH7A 1K6YA 2GLOA 3LPXA 2NVYC 3GBGA 1R7JA 2K9MA 2QSHX 3FKIA 2QF7A 3S3MA 1TLHB 3OL4A 2CQNA 4HF2A 1MBEA 4M3FA 4UV8A 3I56I 3K7AJ 2A5WA 1RNLA 4L18B 4A3DJ 2JA6K 3BP8A 1R22A 2GXGA 5M5YK 3PO2C 4N9HA 3GTJK 1U5TB 4L9VA 3AQPA 2CWEA 2IVMA 3BCBA 2RAEA 4OWRB 2LD5A 1U78A 4KYWA 1RZ4A 2IXSA 4PJJA 5JFEA 2QYOA 4IL6C 2E2JJ 4CHUA 4A3GJ 4A6DA 3G73A 4PJMA 4XRFA 4MFDA 3K1MA 5GTIC 1P4XA 4A3BC 1D0XA 4UHTA 2E1MC 2Q0OA 1SFEA 3GTPC 1TWCC 3S2DC 4CCKA 2QSGX 3KP6A 1ZGJA 3M3YC 3E6DA 3ABKH 3BT9A 1S6LA 1VQPI 1Z67A 1ZK8A 2PQ8A 2JSPA 3NARA 3E5QA 2PX9A 2LBFB 2YR2A 3TMOA 4HQEA 3PSFA 2FBHA 5IP9J 4BEHB 3A4CA 1TZLA 2ID6A 3ECOA 2X85A 3HHGA 3GXOA 3K4LA 3OR2C 5CVUA 4CICA 3DLLF 2P5LC 1MMAA 2OCEA 2JQ7A 4HF1A 4IJAA 1XN7A 5GP9A 1D3YA 2L5QA 2NNNA 4CZCA 4A93K 3HGYA 3I4PA 2X6YA 4UUTA 1FOWA 2ISZA 3RYPA 4G7HA 4DIQA 1J59A 5K7FA 3CQZA 2ZBKA 2DW4A 3MAJA 3I54A 2W57A 3GEHA 2L0KA 2QKMB 3LFUA 1I3AA 3OPFA 3TFJA 1YW8A 3ADAC 1HLVA 2QUFA 3C2GA 5IOQA 5IOSA 5HL8A 2M5WA 3FXLA 2W7VA 4A0YA 3QPSA 4XLPF 1I27A 3F8FA 4LK1A 2E34A 3KIOA 2MGQA 1F1ZA 3ZR8X 5C4JK 2YU9J 1U5TA 2RN7A 2UXNA 2XPUA 3H5AA 3L09A 2WAQA 2O7OA 2Q1ZB 3D5LA 5F6FA 3ZOBA 5A2QZ 5AIQA 1G51A 1MSEC 9ANTA 3A02A 1GVDA 3LSKA 3TP3A 1T2KA 2ZXHA 2NS0A 4OMZA 4XORA 2DA1A 3DEWA 4A3CJ 1KZHA 4HYEA 1R36A 1ZELA 2IAIA 3VSKA 1J75A 5M5WK 4ZYHA 3CUQB 3JCUC 3LSTA 4J00A 4RBOA 1QU3A 3CZ6A 2R7TA 5E8IA 3GTLJ 3ABMH 5KVRA 5M3FJ 1F4KA 3ESWB 1ZGWA 1ZRFA 5DD4A 4FQGA 1VQ5I 5L3BA 3G3ZA 1Y1VJ 4HPQA 2XCOA 5FD5A 1USOA 4PFPA 2F2EA 2JWTA 1EFWA 1DPRA 3HIFA 2ADUA 1I39A 5HDKA 2ZJQF 4OAYA 2ACJA 1B6AA 5JR3A 4QPOA 4B8XA 1P4AA 2DYRH 2PMHA 2VASA 3DPLC 3SZTA 4BXFA 1IO2A 3MZYA 1SFOJ 3S15K 4QJVB 3GTKK 4IEJA 2PA8L 1OMIA 3NRVA 2FOKA 1WI3A 1VF9A 2BEOA 3K0LA 4DOZA 4OOIA 5B3SH 3L2VA 1D8JA 2W1OA 4A3KC 4UVAA 4I98B 2TDXA 3N97A 1Y39A 3AG4H 5LRRA 4C3JJ 3S1NK 2E19A 3RCOA 2JUGA 3S1MJ 5LHHA 3H3VL 1DCOA 1L0OC 2K9NA 4XLFA 3JRIA 4EMSA 2AXTC 4AU7A 5HVQC 2DA3A 3WTWC 3FKIC 3OOPA 2PFBA 4LOWA 2JA8C 3CUQA 3D5RC 4MEXA 2YU9A 2XSDC 3PNVA 3QQAA 3BJ6A 1PP7U 3NAUA 1IN6A 4BACA 3H0GJ 3QPTA 5IT9K 4P9SA 2KRCA 4A3IC 3S16C 1QZYA 3BP8C 1X3ZB 4A0ZA 3LSJA 3BTIA 4XSXA 2STWA 2ELHA 2YSRA 3JRFA 3KPHA 1Y8QB 1B4AA 2DI3A 5CQEA 3GTLA 5JFRA 2CW8A 3QOPA 2IBDA 1MBHA 4HOBA 1Y1VA 4MQVA 1MH4A 3FX3A 1Q1VA 2QBYB 2R7ZJ 2FA5A 2DOFA 3F23A 4WXHA 2IPQX 1IUFA 5J1YA 3RTRA 1HSJA 4UUSA 4AYBL 2X1DA 2EZIA 3DU5A 3I55I 1KU2A 2R93J 2ICWG 1OPCA 3HM5A 1MBGA 4KT6A 2K4BA 2BBYA 2VODA 5E17F 1SFOA 4G9YA 4ZYAA 1XXAA 5F1RA 1O3SA 2BVMA 4KITB 4GGGA 3HOZJ 3R61A 2MW8A 2VIXA 1HOMA 3CQZC 1OR7C 4XMYA 5DCMB 4LK0A 1B9MA 1TT5B 1V5EA 1OJLA 1IS1A 4BE0A 2JA5J 1G6NA 3CCUI 2IS4A 3P5JA 1E0EA 1YOVB 3L00A 5ED4A 2OTLI 5IYBC 1QHGA 2V79A 2L9VA 1JTXA 2E36A 2QWWA 3TL4X 4DZPA 3RDIA 4HLYA 2R7QA 5FJ8J 1ETVA 1IUYA 1U5TC 3CCJI 2KRFA 3H0DA 4QSHA 1XGOA 1ZQ1C 2DCEA 1QQIA 5F64A 4I01A 3K7AC 4A3DC 4AH6A 1TP4A 2JN6A 1X2NA 1BJZA 4MLOA 3F8BA 5LHIA 1WJAA 4AWXB 4BXUA 1ZKGA 2HQNA 2HFHA 2ZMEB 4BLBA 2V7FA 2E2JC 1NG7A 4P9FA 3ZQLA 3SZGA 3CCLI 1MMDA 3Q0UA 2CFXA 5DTDA 3HOVC 2F5CA 2R7ZA 3K1NA 3F8NA 1DU0A 1WH7A 3V7SA 3GZ6A 4U88A 3HJEA 4E7IA 1BJTA 4MNUA 5IP9C 4LIUA 5JHUA 2K27A 3ZMDA 1R6RA 5LHGA 1QPIA 3R0JA 4RDUA 1MJ9A 2GSUA 3FBIB 2DBBA 3JRAA 4N9IA 4OINA 2CW0F 1XCVA 3CJQB 1LE8A 2NS8A 4IHVA 1WGXA 1E17A 1LQ1A 1ONVA 3DXJA 3CCMI 2V6TA 4BKXA 1U3EM 1IDZA 4YFXF 3J7YJ 2WV0A 3DBRB 4XONA 3W3CA 1V3FA 4Y3OA 3FXRA 1W7PA 2GA1A 3BTCA 4CCJA 3DFGA 2M9HA 1L0WA 1LNWA 3OYCA 2WAQL 1XB4A 2R4GA 2YUSA 3LWFA 3J7ZI 1FYKA 2EBBA 3TOAA 1ZXOA 3W2WA 3CUQC 4IZZA 2YU9C 4XLHA 4KATA 2XGEA 3BDDA 2VUMA 4IHTA 4QWQA 4BNCA 2ZB9A 3HPHA 4WILA 1ETQA 3ASOH 5DM7F 1H0MA 2LOOA 4C9YA 2D2WA 3ZQGA 4A3CC 4DQ2A 2OF7A 1EH1A 3NWSA 4KMFA 4UVCA 1H9TA 3GZ5A 2HOSA 2KWAA 4CXFA 4ZYGA 4OIQA 1DPUA 3KP7A 3JRDA 2EZKA 3GTLC 2E2HK 5D6EA 3GYHX 3OIOA 1VZ0A 4KIFA 1MDMB 2KIMA 4M9SA 3E6CC 3H92A 1Z0XA 3S1RK 1AA7A 1Y1VC 4AVZA 3F0CA 2XB5A 5DS9A 2FEZA 2EV6A 1QO0D 4G0WA 4WJ3M 2O5RA 3Q0VA 4KFCA 1KQ4A 4M73A 3EPZA 2XHKA 4AVPA 2CJJA 4KISA 1IRGA 1BOBA 2DLLA 2DOEA 4C3HJ 5ICEA 4CGZA 3V7RA 5C44J 2GOXB 5D8LB 1XD7A 3CJNA 3BPXA 3KP3A 3JRCA 3F72A 1TWGJ 2W7NA 1SFOC 1IE0A 1UB9A 1UELB 2E35A 2DK5A 3GF2A 3HGGA 2HVSA 3GTMK 2W82A 3HOUK 1TL8A 2ZFWA 2NOJB 1I3QJ 1MBKA 2NVTK 1J98A 4ENNA 4X6AC 4RGRA 3OS0A 1O28A 1FOYA 3DWLE 4ZYEA 4B44A 2XASA 2EZHA 2MG4A 4OIOA 4C3JC 4XOTA 3GTMA 1GUUA 4BDZA 3PQJA 4IRHA 3S1MC 2IGNA 4HAMA 4F92B 3WGIA 3A01B 1REPC 2WAFA 1WOPA 2G7HA 4A12A 1JTYA 1S9HA 2ZCWA 4PCQA 5DUIA 4BS9A 3HOXK 3KP5A 5HNHA 5TISC 1WWXA 1XPXA 3H0GC 1MDMA 1WFXA 2LKSA 4XLAA 3FMSA 5TJJA 3S3OA 3I9V2 1XSDA 2H6CA 3EDPA 3GFIA 2IA2A 3U1KA 3H35A 1WJ5A 1UFMA 1PVEA 4BLAA 2B0LA 1Y1WK 4EV0A 3M4OK 2CV0A 2GAGC 4M3BA 4A3JJ 2G7UA 1HW1A 2M7BA 3G4SI 1A5JA 3LOCA 1BS2A 3GFLA 1O24A 1VI0A 3B02A 4MEYA 2WY8Q 2M30A 3SDBA 2LFBA 1Z05A 3BZCA 3LQQA 5D5UB 3HB9A 5FKKA 2E5NA 2Q2EA 2K5CA 2XF5A 3WTYC 2R7ZC 3HSRA 2V9PA 2ECCA 1SVOA 2RV8A 3E97A 4HSRA 4RGXA 3MKZA 4XKBA 3G71I 3BG7A 2NVXJ 2R93C 5FRMA 5F04A 3TFHA 4Y7NJ 3J7AY 4MTEA 1SVMA 3RPQA 1TWGA 2BXYA 2E2IK 2COMA 2VB6A 4E6KG 1RRJA 2K9QA 5KAIC 2MH2A 4BUPA 1T39A 3A01A 1B72B 4XRSG 3HXAA 3F8MA 2JJ7A 5BOXA 1I3QA 3G1OA 2LMDA 2JA5C 1B9NA 4PSXA 1HW5A 4FETA 3NUHA 2KFDA 1O3TA 3RZOJ 2DODA 3GCMA 3WTSC
chains in the Genus database with same CATH topology
3VA7A 3I71A 5D4SA 4FZBA 1BGWA 2L3DA 3ROUA 1ZN2A 1Z91A 5BPDA 3TDZC 1ZRCA 4KAWX 4HV5A 5IT3A 3J7AO 2FMLA 5JVOA 1STZA 5K1YA 4GFQA 3GO5A 2YX4A 2VT3A 1V4RA 1YTYA 4WXDA 1XMKA 1CF7B 1Z7UA 4CO8A 3MEXA 4UUVA 4HZFA 3U9GA 1P4WA 4HDVA 4DDQA 1YFHA 3W6JB 3HRTA 5CVIA 3V8LA 2NVXA 3SHFA 2X4HA 4EM2A 2WTEA 1IN7A 3F8CA 1XDSA 2GZWA 2FMYA 2XAFA 2HTSA 1USTA 1HBXG 3BOQA 2FXAA 3O3KA 2EA2A 1DDNA 2LDUA 4WXCA 1PDNC 1TBXA 2CFAB 3RKXA 4G7OF 3IRRA 3N3YA 2XROA 3GTGA 2YX7A 4IXAA 1K78A 1S29A 3KP4A 1AOYA 3BUEA 2VBXA 4UVBA 5E1XA 3R4KA 4Y15A 4M9XA 2L4MA 3H3ZA 1CF7A 2A69F 1FSHA 1I6XA 3QP5A 4RGUA 4A5NA 3FZVA 3S0XA 2F5FA 2ZO4A 2P6TA 4CDGA 2VBZA 4C3HC 2OZ6A 1LEAA 1IW7F 4M71A 2GWRA 3N4MA 2UWMA 2JA7A 3IWZA 2CFAA 4ETSA 3I58A 2DFIA 3K2ZA 3HOTA 2JSCA 4A5MA 1XSXA 2FNPA 2Y0MA 3DV8A 3TKYA 1F5TA 1KYWA 4XLNF 1KU3A 2DPUA 2XAHA 1SFXA 4ZH4F 1WI9A 4OIPF 4KMDA 2VE8A 5LGNA 2W25A 1ZYRF 2E7XA 1XDUA 3E5XA 3JW4A 3OV8A 3CO6C 2ETHA 5HS7A 2W24A 2XAQA 2MH9A 3CDHA 2FRHA 2YPRA 3FWEA 1HKSA 4IF4A 1E2XA 1TNTA 2ZNYA 2B63A 4FX0A 4Q48A 4AIHA 5IORA 5BPIA 1O2BA 1LDKB 3EETA 3ABUA 1BOAA 4G94A 4LG0B 3RJPA 4I7HA 1YS7A 3GWZA 2IP2A 3REOA 1O2AA 5FLXK 1DUXC 1D5VA 1YYVA 4EQQA 2JA6A 2QZ8A 2BE5F 3GVAA 4KM8A 3ZN1A 4LR2A 3GTJA 1QGPA 2XUBA 5BQTA 1FT9A 2XGXA 4RB0A 2CQKA 3T1BA 1T38A 1JGSA 2KKOA 3NEUA 4ILDA 3SQNA 2P8TA 4HQMA 2P7VB 1UCRA 1IAWA 1FBUA 2C6YA 2HOEA 3QU6A 2VBYA 5D4RA 2FBKA 1SAXA 4LG0A 3GX4X 2IJLA 2Y48A 2QLZA 4M9ZA 1HSTA 1XGSA 5FB2A 1SD5A 3F6VA 1BC8C 4E70A 3Q9SA 5LBQA 2M8EA 3VODA 2UZKA 5ICFA 4AIKA 1HQCA 4Y13A 4IRIA 1GVJA 2DU9A 4BH9A 1BI0A 2CGPA 2XKPA 5FFZA 5FD6A 2UXXA 3MQ0A 1G3WA 1OYWA 1W5TA 4BHPA 4GT9A 1S7OA 2H27A 5D8KB 3HSFA 4F7ZA 2R3SA 2LKPA 3IRQA 3Q3QA 1BBYA 4Q4ZF 3GTKA 3WGHA 2P5KA 1YG2A 1P92A 2V1DA 4LLGF 2IT0A 1FP2A 1T6SA 4EM0B 3DEUA 4IPAA 3IKVA 2YU3A 3J81Z 3J80Z 2O61A 2P5VA 4NB5A 4HDUA 4CZZA 1IN4A 1O29A 3F6OA 5TRDA 2E1NA 1XXCA 3EQLF 5H6RA 5L3DA 3ZPLA 2Z33A 4GTBA 5H6QA 2QQAA 2P7CB 2HYGD 2DQLA 3BY6A 4YIIA 4I0BA 4KDDA 1WQGA 4ENKA 2XRNA 3H3UA 2PN6A 2RKHA 2A68F 2KIUA 2PMUA 2VBWA 3S2WA 1WKMA 3RYRA 4L9TA 3MMLB 5ILVA 3SZPA 4M74A 3BPVA 3C18A 2H6BA 3DQVC 3L2CA 2HS5A 2EFPA 3KLOA 4LB6B 3CAGA 2EJRA 4WK8F 2D1HA 1QZZA 2D45A 2RGVA 2V1UA 2A5YB 4MQ9F 1TW3A 2QBYA 3M9AA 5LRSA 4KT5C 3EYYA 3JAMZ 4WCGA 1YQAA 4RB3C 3M8EA 4KIGA 2FF4A 1LVAA 5ICCA 2EWNA 2F5DA 2IA0A 4G6DA 4M1XA 5DCMA 2XAGA 3V7CA 5CHPA 1O7LA 3P9IA 1EH8A 2PEXA 3RI4A 1BC7C 3C3WA 3WE2A 2OBPA 2PI0A 3BZ6A 1XGNA 3AAFA 4EJUA 1LB2A 2FE3A 1IF1A 2PLYA 1EV7A 2RVCA 4U0VA 1TNSA 4ENJA 2VOPA 1ZAOA 2MA3A 3O6BB 1USSA 3N0CA 3E6BA 5BS6A 3MZHA 1L3LA 3TOBA 2ZMEA 3C7JA 3L7WA 2CO5A 4L0ZB 3N0BA 1SMTA 4GTAA 2JZYA 4WF2A 2M1BA 3HTSB 3KEOA 1XCBA 1BIAA 3F3XA 4AD9A 4MGRA 1QNTA 2K86A 3T8RA 2HWVA 2NRAC 1FYLA 2E2HA 1UHMA 2P5MA 1YIOA 4G0VA 4H0EA 1EH6A 4HBLA 3EYIA 1IZ1A 1IXRC 4PGHA 2BYVE 3MCZA 2NAZA 2MLGA 4P96A 2L4AA 5LEJA 3Q9VA 3OEPA 1O3RA 1FSEA 2HYFA 3LFKA 5J8FA 2O0YA 2GIVA 3ECHA 2XCRB 1UHWA 1J7KA 4MTDA 1FY7A 3EUHA 1T0FA 3KLNA 5HLIA 1WQ2A 5A2QK 5D5VB 2OAZA 2XAJA 1G3SA 2M45A 2RQPA 2W85A 1R23A 4L0YB 4FT8A 2OZUA 3WU1B 3GUDA 4XBFA 5CVRA 2G9WA 1YLFA 4ESJA 4EJOA 3GLXA 3GFMA 1Y1WA 4LK1F 1ZGAA 3E5UA 5ICGA 4KN7X 3KCCA 2O03A 1MZBA 1HXDA 4GTCA 4IRGA 3U2RA 1XMAA 1OKRA 5DD8A 2E2IA 2LF7A 2W84A 1Z1DA 4KA4A 3J81K 4ENMA 1FBSA 3R60A 2MC3A 1OYIA 5FGMA 3V8KA 3AH5A 4A6EA 2STTA 2DQRA 2EV0A 2HR3A 4RGSA 3FOEA 3ZMZA 4I0AA 1ZG5A 5E8GA 1TWHA 1TWAA 1JXSA 4MEXF 5D5WB 1I50A 4P9UA 3KETA 3I64A 4HX8A 5CJ9A 3HRMA 1Z6TA 4LFUA 1G3YA 2JT1A 1BM9A 3FM5A 1TWFA 1TW2A 1BJAA 5J8CA 1FYMA 3MFKA 3I0TA 2Y75A 1G3TA 5BMZA 2QQBA 3WTUC 3DP7A 3IWFA 3ERED 2Z99A 3LA7A 5ILUA 2V9VA 1WQFA 1QPMA 2VOOA 3M1EA 4P5BA 5IT9Z 4HLXA 4BAYA 1S8NA 3SFZA 4TV7A 4LK0F 4RAYA 1W4MA 2ISYA 3TQNA 1GHCA 2AXLA 2FNAA 2E1CA 3HRUA 2FBIA 1TWCA 1P6RA 2O3FA 4GCVA 1FOKA 3T0YA 2QM3A 2A61A 3KE2A 1J9IA 3WTVC 3W6KB 2ZFZA 1R58A 4KM9A 2MBFA 1ZLKA 2HKXA 3FM3A 3T8TA 3HOSA 1LJ9A 2OU2A 2ESNA 1TQIA 1EH7A 3KFWX 3BROA 1BI1A 4RB1A 4HX7A 4R8HA 2OD5A 1BI3A 3RIRA 3PFIA 3TO7A 1B59A 2HQRA 2JH3A 5DEQA 4OINF 2GQQA 1FLIA 3DXJF 2HTJA 4CYDA 1W5SA 1B1BA 4KARA 2DO7A 4N0BA 1LDJA 4DNCA 3VOEA 3RKYA 3TDUC 4K2EA 3F21A 1KQ9A 4GTFA 3WU0A 4GYIA 4LJZF 2PG4A 1TQMA 2LSOA 1SD4A 1YW7A 4EGZA 3AQOA 2A07F 3FMRA 4G8XA 5DV5A 2NYXA 1Q1HA 4OIQF 2CG4A 3IKTA 3R0AA 2O8XA 1WCMA 1KQ0A 2A3SA 1D8KA 1R00A 2BV6A 2LF8A 3NQOA 3ZMTA 3L9FA 3TO6A 4Y17A 2PJPA 3IC7A 3K69A 1GXQA 3I53A 4OIRF 3O2PE 1K6OA 1R1VA 4U7DA 4P5AA 4OIOF 3TO9A 4A2UA 1ISEA 1ZHFA 1O25A 2J5PA 2OA4A 2XV4S 3WG9A 2OQRA 5E18F 4HF0A 3LAPA 1O27A 3WTTC 4C2MC 2VC0A 1I1GA 1J2XA 5LGUA 4LLLA 5LGTA 1ZARA 1TQPA 4KMUX 1S3JA 1R1UA 1OR7A 2HDCA 3DF8A 3ISPA 2IA1A 4MEYF 1PUEE 2FU4A 2IW5A 2L01A 4M6YA 4HV6A 4O3MA 1A04A 3I59B 5FFXA 1FWZA 3FOFA 3D0SA 1JE8A 3ZMVA 4KICA 1Z6RA 2GXBA 4U0WA 5HS9A 4L9NA 4IVNA 2DTRA 2HEOA 4KUMA 1WIHA 1FX7A 2H94A 3V4GA 1ZG3A 3GFJA 2RGRA 2K02A 4M6XA 3ELKA 1KQ8A 2P4WA 1SD6A 1FNNA 2OQGA 2BGCA 3P7NA 2K7LA 2ZKZA 2XIGA 2FSWA 2A6EF 1RUOA 3CTAA 2Z3YA 4YFKF 3ZP5A 5K5OA 3HUGA 1IRFA 3R6SA 1IN8A 4YIFA 5K5RA 5TJ3A 3JTHA 4KMAA 4LGWA 3ABTA 1ON1A 4OU0A 1G4DA 4LMYA 5J6XA 1I5ZA 4KN4X 1ODDA 1ZH5A 3KZYA 1U6GA 5FO5A 3LAJA 3I59A 4G0UA 3RKWA 1Z9CA 4BHBA 2A6HF 2KIFA 4ZYDA 2DAOA 1AB4A 3ULQB 4EM1A 1R1TA 3HSEA 1B4BA 3BJOA 5EEHA 3M8FA 1EK8A 3OREA 1BN5A 3I5UA 5CVVA 1K83A 4PGGA 1SMYF 5DCFA 4ESBA 5L3FA 4LB5A 3LQRA 1I1SA 4RS8A 4KNYA 1CGPA 4A0XA 3COAC 1K79A 4YG2F 1IN5A 1KU7A 5DYMA 2EFNA 2DK8A 5D6FA 1C0WA 2EK5A 1MKMA 2R7DA 4KC6A 2ZXJA 1ULYA 2WC2A 4L5IA 3JTGA 1YO5C 2LNBA 1TTYA 1MJAA 5CYVA 4P5OA 1NHAA 2K4JA 1PP8F 2EFOA 1LDDA 3PQKA 3JSOA 1VTNC 3BJAA 1LEBA 2EFQA 3VFZA 1FPQA 1ZVUA 4GTDA 1OYYA 1ZRDA 1XSVA 2KJCA 3B73A 2KJBA 4LD5A 4WWCA 1W7PB 2R7FA 4I2OA 4GTLA 3H0GA 2MLKA 2VE9A 3HTUA 4L5JA 5LEKA 1FP1D 4C3IC 3VB2A 2ZJ2A 4O6JA 1H9GA 4UV9A 1FZPB 4M72A 4YFNF 4KIBA 3WE3A 2Q8KA 3WTZA 1BI2A 4ZZDA 3LA3A 4JBAA 3Q5FA 2Y3PA 4LQYA 2R93A 3QPHA 3G4CA 3CO7C 1KGSA 5HLGA 4EGYA 5DDGA 4FHTA 2PHCB 2JA5A 2RNJA 2QENA 5D5XB 1J5YA 2R92A 4WX9A 4ON0A 1YW9A 2RH6A 3E3VA 5IOTA 1GE9A 4MHGA 1Y0UA 5LLQA 2JRTA 4D0PA 2GSNA 1QBJA 1ON2A 2M87A 1WQHA 4U7BA 1WSUA 1DD5A 3V8JA 3WODF 4EJVA 2DPDA 4NQWA 4Z2YA 2IRFG 4S04A 1XXBA 3FXUA 1R5HA 3GTQA 1XGMA 1SD7A 1S7AA 1ZREA 3T5XA 1R9TA 1RUNA 1W7PD 3GEZA 1O26A 3ML6A 3FHZA 2AS5F 3QAHA 1E17A 3L4JA 3E6MA 1MD0A 2QQ9A 3F22A 5E1ZB 4KB4A 1U8RA 3KP2A 3MWMA 6PAXA 1BIBA 3QRFF 4G7HF 3CUOA 5HS8A 3IL2A 1HKQA 5FLXZ 3QX3A 2QVOA 4FX4A 4UXNA 3WTXC 4BKWA 1GXPA 2MD5A 2FQ3A 2L02A 1RIOH 1IXSB 5E1WA 1FC3A 3C1DA 4KMHA 1KYZA 4XSZF 2JTVA 5ILSA 2EA4A 1R5GA 4J3NA 2P6SA 4GO1A 4KASA 4QLCU 2ESHA 2JPCA 4B09A 2VXZA 4AIJA 3TGNA 3HRSA 4BQAA 5EEGA 2VT2A 3J80K 2RDPA 5CLSA 5HLHA 1T98A 4G7ZF 1KA8A 2WWYA 1IXCA 3U1DA 5JVTA 2J5OA 1X3UA 3ZMSA 1JHFA 3FF5A 1HW2A 2H09A 4U0YA 2Z9OA 4R1HA 2HKOA 1K78B 3G4AA 3L4KA 1O3QA 2XVCA 5L3CA 4BHCA 5KK1A 3QU3A 1RI7A 4RAZA 2CSOA 4RB2C 3KEQA 4GXOA 5HDNA 2VONA 4XSXF 5L3GA 3CLOA 5E20A 2Z5UA 4S05A 3DKWA 4NHJA 3GTOA 2GSOA 2ZNZA 2NVYA 3VEPA 2VN2A 3JSPA 2O6GE 5CVJA 4GYGA 1P2FA 4G6QA 4HX4A 1AWCA 3HHHA 2EV5A 2EFWA 5EGEA 3RPUA 2E7WA 4L9JA 4UNOA 2PBIA 1K7AA 1FBQA 1KU9A 4I09A 4KDPA 3KZZA 4IHSA 4HW0A 1O7FA 3IHUA 4P55A 5H20A 1SFUA 2VC1A 4ASNA 4HA8A 3GTPA 4PDKA 3JAMK 4Q47A 3WGGA 1WRJA 3BWGA 2V6CA 2L54A 1YS6A 2CYYA 2DT5A 2D1VA 1O57A 4JQFA 5JI6A 3GW2A 2XCQA 3FMQA 1MJBA 5AONA 4Q5SF 4EVIA 2XKOA 3K1PA 1U2WA 2F5EA 2NNYA 4GTEA 1F9NA 1HKTA 3ZN0A 4EJTA 4ZZLA 2HZTA 3QP6A 4ESFA 2GAUA 2V1XA 3SXYA 4I02A 1JHHA 3DPTA 3HYIA 5K5QA 5AIPA 4EJWA 3ZQ7A 2HGCA 3P9KA 5HOOA 5EGHA 5DUKA 2X0LA 5ERIA 5HDGA 2RC4A 1MGTA 4JK1X 3K9TA 1DP7P 4OMYA 2GA2A 2EB7A 4R79A 1ZLJA 1J0RA 3P9CA 3ZMUA 2JPBA 4BYYA 4O5VA 3FXQA 5L3EA 3LA2A 3M7GA 4KB2A 4FM9A 4LLNA 1ZG1A 4PZJA 3LPXA 1R7JA 3FKIA 1TLHB 4HF2A 4UV8A 1RNLA 4L18B 3BP8A 1R22A 2GXGA 4N9HA 1U5TB 4L9VA 3AQPA 2CWEA 2IVMA 1U78A 4KYWA 5JFEA 1RZ4A 2QYOA 4CHUA 4A6DA 3G73A 4XRFA 3K1MA 1P4XA 4UHTA 2Q0OA 1SFEA 3KP6A 1ZGJA 3E6DA 1S6LA 2PQ8A 3E5QA 2YR2A 4HQEA 2FBHA 3ECOA 3HHGA 3GXOA 4CICA 5CVUA 2P5LC 4HF1A 1ZBSA 4IJAA 1XN7A 1D3YA 2NNNA 3I4PA 2ISZA 3RYPA 1J59A 3CQZA 2ZBKA 2DW4A 3MAJA 3I54A 2W57A 3OPFA 1YW8A 2QUFA 5IOQA 5IOSA 2M5WA 4A0YA 4XLPF 1I27A 3F8FA 1F1ZA 1U5TA 2RN7A 2UXNA 3L09A 3D5LA 5F6FA 5A2QZ 5AIQA 1T2KA 2NS0A 4OMZA 4HYEA 1R36A 1J75A 4ZYHA 3CUQB 3LSTA 5E8IA 5KVRA 1F4KA 1ZRFA 5DD4A 5L3BA 3G3ZA 2XCOA 5FD5A 2F2EA 1DPRA 3HIFA