3ERED

Crystal structure of the arginine repressor protein from mycobacterium tuberculosis in complex with the dna operator
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
156
structure length
156
Chain Sequence
AANRAGRQARIVAILSSAQVRSQNELAALLAAEGIEVTQATLSRDLEELGAVKLRGADGGTGIYVVPEDGSPVRGVSGGTDRMARLLGELLVSTDDSGNLAVLRTPPGAAHYLASAIDRAALPQVVGTIAGDDTILVVAREPTTGAQLAGMFENLR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the arginine repressor protein in complex with the DNA operator from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein/dna
molecule keywords Arginine repressor
total genus 45
structure length 156
sequence length 156
ec nomenclature
pdb deposition date 2008-10-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01316 Arg_repressor Arginine repressor, DNA binding domain
D PF02863 Arg_repressor_C Arginine repressor, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ereD01
3.30.1360.40 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Gyrase A; domain 2 3ereD02
4G0UA 2WV0A 1ZGJA 2MBFA 4KDPA 1XMAA 3BJ6A 1YW7A 2XRNA 2G7HA 1J0RA 3HIFA 3HSEA 5J6XA 1DPRA 3EQLF 4RAZA 2DTRA 1W7PB 2PMUA 4I98B 5AONA 2F5FA 1H9GA 1ZRDA 3R4KA 5L3EA 4OIPF 2DFIA 1LDJA 3K1NA 2W24A 2QQAA 1G3WA 5ILSA 3WE2A 3TGNA 4CDGA 1DDNA 2P5VA 3F72A 5FGMA 2DPUA 2VT2A 3N4MA 1H9TA 5FFXA 3OPFA 3KCCA 1USTA 1GHCA 1ON2A 2HKXA 3F6OA 1U5TA 1WI9A 3HRSA 1BM9A 2ADUA 2M1BA 3C18A 3K1PA 4EM2A 3PFIA 2FEZA 3I4PA 2L01A 2VC1A 3IWZA 3K69A 3FXQA 4EGZA 4I2OA 5K1YA 1TQIA 5LHGA 2EA4A 2EV0A 2HZTA 4BHBA 1R00A 2HS5A 2V1DA 2OU2A 3TO6A 2RDPA 3DP7A 4Q47A 2QBYA 5LEJA 1BIBA 2DT5A 5CLSA 2KKOA 1LDKB 2Q0OA 5D4SA 4LK1F 4RB2C 1XDSA 4Q48A 1VTNC 2K4JA 2KJBA 1DD5A 1HKQA 3CO7C 1XGOA 1R58A 3E6DA 1FT9A 2DQLA 3T8TA 3RIRA 5H20A 1Z6RA 2O0YA 5CJ9A 5IT3A 1I27A 4IHTA 1I6XA 3ZMVA 3RKXA 1FSHA 4KC6A 5D5UB 1F1ZA 4M9ZA 3WTVC 1FLIA 5L3GA 1T2KA 1KQ9A 2CFXA 4B8XA 1T38A 4MTEA 1D8KA 2QQ9A 1Z6TA 1MJAA 1K79A 3D0SA 1ZRFA 1LEBA 5LGUA 1FNNA 3MAJA 4ZZDA 5L3FA 1LNWA 2DBBA 2ACJA 3PQKA 4HX7A 3WU1B 2ZNYA 5TJJA 3T0YA 1UB9A 3WTXC 1ZVUA 2DQRA 5LLQA 4FX0A 4CHUA 2O6GE 5CVJA 5FD6A 3U1DA 1BJTA 5HLHA 1R5GA 5E8IA 3SZPA 2BV6A 4MQ9F 2PQ8A 2R7FA 4KMUX 3GO5A 5DV5A 4HW0A 1W4MA 1WQFA 2TDXA 2G7UA 3I5UA 1SD5A 2P7VB 5CVUA 1HKSA 4XBFA 1OYYA 3FX3A 2JZYA 5EEHA 1OKRA 4N9HA 5F64A 1CGPA 3M7GA 2YX4A 2HTSA 1BI3A 2BEOA 1P4XA 2XAQA 2L4MA 1KGSA 1WSUA 1Z05A 2UWMA 3J7AO 1O57A 3IKTA 2STTA 3LAJA 2KWAA 2VT3A 3CO6C 1RIOH 3TDZC 5FFZA 2FOKA 2FMYA 1WRJA 3WGGA 2HGCA 1PP7U 3ECHA 4P5OA 2LSOA 1B9NA 2W84A 1R36A 3H3UA 3BZ6A 3GFMA 4ASNA 2NAZA 1DP7P 2FNAA 2FBKA 2GXGA 4EJWA 4L9TA 5D6EA 4GCVA 3HUGA 1FP2A 4WX9A 4ZZLA 4LB5A 2RKHA 2P5KA 4CICA 2VE9A 3HHGA 5CYVA 2PFBA 1PUEE 2VBWA 3LSTA 2NNNA 4HQEA 2EFQA 1XGNA 2PLYA 4CZZA 3TO9A 1T39A 3K2ZA 1IXRC 4Z2YA 6PAXA 4A6EA 3OOPA 2V9VA 2ZFZA 3HTSB 1EV7A 3TO7A 5D5WB 1JHHA 1LB2A 4P9FA 4M74A 1XDUA 2XCOA 3GW2A 3CJNA 3GX4X 4E70A 4CXFA 2J5OA 3MCZA 2V6CA 3V7SA 4M72A 3KZZA 2K27A 2VOPA 2K4BA 4A12A 1V4RA 4I02A 2EV5A 3SHFA 2DU9A 4M73A 3M1EA 2BGCA 1TNSA 1KQ8A 5JHUA 2PHCB 3IC7A 2A3SA 2PN6A 5BS6A 1UHMA 3ULQB 3C3WA 1BI1A 3V8JA 3ZPLA 2M5WA 3QU3A 5J8CA 1FZPB 4G8XA 4ENMA 4FX4A 5A2QZ 2KIFA 2Y3PA 3CTAA 1UCRA 3DFGA 1FP1D 2XVCA 2IA0A 2LDUA 1XCBA 1S3JA 3KP6A 3KEQA 4PGGA 1S29A 2A61A 3R60A 3QX3A 2D2WA 1SD7A 2E7XA 2WC2A 2XCRB 2KJCA 5KK1A 5IT9Z 2Z99A 5F6FA 1TW2A 1D8JA 3U2RA 2E1CA 3RKYA 3QP5A 4Y15A 3V8LA 4JQFA 2MH9A 3KZYA 4HA8A 3FM5A 2ZMEA 1SD4A 3FMRA 1MDMA 4ENKA 2UZKA 3L00A 1EH1A 2YPRA 1QZZA 1BGWA 4G9YA 2DPDA 4HBLA 2CO5A 2FNPA 4LLGF 4LJZF 2XASA 3ZMSA 4U0WA 3GUDA 1HSJA 2QYOA 4A5NA 5BPDA 3NUHA 2H09A 1WKMA 3D5LA 5HOOA 3HSFA 3ABTA 1TW3A 2Q8KA 1XMKA 1K6OA 3ECOA 4HYEA 1HW2A 4AIHA 1XSDA 4KN4X 2DLLA 4ENNA 5ICCA 1B4AA 5E1WA 4MEYF 3GEZA 5CVIA 1REPC 3I59A 1C0WA 2OZ6A 2EWNA 2ETHA 4GGGA 4GYIA 1IN5A 5ILVA 3KEOA 3P9CA 4HX8A 3EETA 2YR2A 1OMIA 1BIAA 4M71A 2KIUA 4MQVA 2ISYA 3LWFA 5D6FA 3WGHA 2DK8A 4ESFA 5K5OA 5DEQA 2FXAA 1BJAA 1I1SA 4R1HA 1J7KA 1S7AA 3W6KB 2WTEA 2IA1A 4N0BA 3EYYA 2EFNA 3MMLB 3GVAA 1IS1A 3ZP5A 4HLYA 2OAZA 1USSA 3DXJF 4HV5A 4OINF 4IF4A 5ICGA 4DNCA 5HDGA 3TOAA 1IF1A 4HF2A 3KP3A 4G6QA 1QBJA 4O6JA 3VODA 3E3VA 5K5RA 2L02A 3J81Z 3LA2A 3F22A 3FOEA 2JRTA 3VEPA 4QWQA 2OA4A 2LNBA 4G6DA 3HOSA 1FC3A 2MD5A 4RGSA 2Z5UA 1FY7A 4KB2A 4L0ZB 2FA5A 3P9IA 3V7CA 1W7PA 4BNCA 2O8XA 3QPTA 3SXYA 5DDGA 4XSZF 1YIOA 3QU6A 1FBUA 4UV8A 2QM3A 5HDNA 1J9IA 4MNUA 5ILUA 3QAHA 2A68F 2A07F 1CF7B 1ZH5A 2HDCA 4L0YB 2L4AA 3B02A 5ICFA 1R1TA 2YX7A 1J75A 4G7OF 3E6CC 2STWA 4RGRA 5FO5A 3L9FA 2VBYA 4IRHA 5LHIA 2K86A 2HTJA 2P6SA 4CO8A 3L09A 4HQMA 5BPIA 1U2WA 3O6BB 3VB2A 5A2QK 4HF0A 2P4WA 5HLGA 1WQGA 4FT8A 2HOEA 1AB4A 3FXUA 1X3UA 4UHTA 5LGNA 1BI2A 1FBSA 5DUIA 2ISZA 1KU2A 1BI0A 4WXDA 4I01A 1B1BA 2HYFA 4R79A 2MLKA 4O3MA 3GFIA 1FWZA 1TQPA 1YO5C 1ZG3A 2A6HF 3JAMK 1IN4A 4ETSA 1OR7A 2LKPA 4U7BA 2ZBKA 1QO0D 1QNTA 1RNLA 4HLXA 4MTDA 3CUQA 3IRRA 1MD0A 3HSRA 5HVQC 4IRGA 4ESJA 2FSWA 1QZYA 1YW8A 2P7CB 4PDKA 4G7ZF 4EJUA 3BPXA 2EJRA 2YU3A 3WGIA 3OEPA 2V1UA 4LMYA 3MWMA 2F5CA 1HKTA 2VODA 3QPHA 2O03A 2QWWA 3IRQA 2AS5F 5HS9A 4EJOA 1SD6A 1WWXA 4RB0A 4CYDA 1G3SA 1NHAA 4L9NA 1MGTA 2AXLA 2BE5F 5JFRA 3FOFA 4IPAA 2ESHA 2Z33A 3E5UA 2DO7A 3Q9SA 3S2WA 3CUQC 5EEGA 3K1MA 1E2XA 1R1UA 1BN5A 4XLPF 5D5XB 1YYVA 2RC4A 2PMHA 2CYYA 1TTYA 3TKYA 1FBQA 2NNYA 4M6YA 2JTVA 4YIFA 2H6CA 2F5EA 2Z9OA 2BYVE 3QRFF 1LDDA 4YFNF 4WXHA 1P92A 2FF4A 2O61A 3F8CA 2HEOA 3L2CA 3ZMUA 4O5VA 5FD5A 5E1ZB 1K78B 3M8FA 1YFHA 4JBAA 1GXQA 3FM3A 1XSVA 4P96A 2LF8A 4P9UA 4HV6A 4CGZA 2ZNZA 4LG0B 4WF2A 3G3ZA 4EGYA 2CG4A 4MGRA 1J2XA 3K0LA 2DI3A 1XGMA 2RQPA 3HHHA 3C1DA 3DEUA 1ZRCA 2CW0F 4U7DA 5K5QA 2A6EF 1FOKA 1KYWA 2M30A 3ELKA 4LB6B 2XAFA 1EH7A 1K7AA 1SFEA 4LLLA 4BYYA 1P2FA 4HZFA 1ZLKA 3DF8A 4UNOA 4AD9A 3BJOA 4DQ2A 3KLNA 3DQVC 2KIMA 3BOQA 4L5IA 4G0VA 3I71A 2HQNA 2WWYA 5D4RA 4LG0A 4I0AA 3H92A 3I58A 2M8EA 2ESNA 3ABUA 1AWCA 3BY6A 2OBPA 2OQGA 2ZO4A 4AIKA 2B0LA 4XLNF 2CGPA 3M8EA 3WTSC 2ZMEB 1XGSA 2A69F 3RDIA 1D5VA 1P4AA 5LRSA 3E6BA 1FSEA 1XD7A 1O3SA 3HRUA 4ZYGA 3VOEA 2Y75A 1P4WA 2XAHA 4EQQA 1BOAA 4HDUA 1IXSB 3F3XA 3OV8A 2H27A 1U6GA 5DD4A 1EH8A 3WODF 1QPMA 1UHWA 1RZ4A 2EFOA 2EK5A 3FF5A 5DCMA 4XSXF 2EFPA 2XGXA 1LQ1A 2BBYA 3WTWC 3LA7A 5AIPA 4WCGA 3RKWA 4LD5A 3ERED 4Q4ZF 1U5TB 4B09A 1IAWA 1R22A 3JSPA 1F9NA 1IN7A 2L54A 2EFWA 4ON0A 3EYIA 1KA8A 2O3FA 4AWXB 1R7JA 1JXSA 1TNTA 2IW5A 3GWZA 4GFQA 1U78A 4OMZA 3IWFA 4IXAA 2CSOA 1FPQA 1SMTA 2XKOA 3PQJA 3I64A 3SZTA 3HYIA 1XCVA 1WQ2A 1Z9CA 3C7JA 4WXCA 1YQAA 2FE3A 1KYZA 2RVCA 5ERIA 4WK8F 4PGHA 5JR3A 3E6MA 2VC0A 3RJPA 2W57A 2VOOA 2QVOA 5CVVA 4U88A 2JSCA 3IKVA 1S8NA 3ZQ7A 2IT0A 1H0MA 3MQ0A 3R0JA 1W5TA 4A0XA 1J59A 3FZVA 3P7NA 1LJ9A 2C6YA 4U0VA 3I0TA 1W5SA 3ZN1A 2IPQX 3MFKA 3LAPA 1P6RA 3JAMZ 3HRTA 3JW4A 2PI0A 2EA2A 2FBHA 2DW4A 3F8BA 1R1VA 4EJVA 3RPQA 4F7ZA 1ON1A 1T98A 2L3DA 1MZBA 4UV9A 4LFUA 4UUVA 1RUOA 3CAGA 1E17A 1O7FA 4L18B 5L3BA 3FHZA 2CWEA 1HBXG 2R7DA 2PEXA 1F5TA 2FU4A 4M9SA 3KFWX 1SFUA 2K02A 2UXNA 4KT5C 3TDUC 4GYGA 3RPUA 5JVTA 1ONVA 5D8KB 3OREA 4Y17A 1XB4A 2M45A 4EM1A 4G94A 1JE8A 3R61A 4I0BA 4KIBA 2GQQA 3E97A 1BC7C 3F8FA 3COAC 2K7LA 3T1BA 1F4KA 4Y13A 3F8NA 3FMQA 1U5TC 1CF7A 1HSTA 1KU3A 2HWVA 1L0OC 3U9GA 4KN7X 3K9TA 2Z3YA 1PP8F 2DK5A 4UVBA 1YTYA 2Q2EA 3RI4A 3V7RA 2IVMA 2X4HA 3BROA 2OZUA 3L4KA 1HW5A 3I54A 4RS8A 4PZJA 4IJAA 1Y0UA 2M87A 1R23A 3BDDA 1ZGAA 4ZH4F 4MEXF 4GO1A 3KLOA 3NEUA 4WWCA 1YS7A 2ELHA 4BHPA 1XXAA 3GFJA 4KFCA 4TV7A 5ED4A 2COMA 3WTTC 4OIQF 1IUYA 1BBYA 2V79A 1ZAOA 2R3SA 4UXNA 5D8LB 2QBYB 1XN7A 4RB1A 4KB4A 3P9KA 2D1HA 3BUEA 1LEAA 4ZYDA 4EVIA 4NB5A 4BXUA 4KNYA 1OYIA 2XUBA 2XAJA 1IRFA 5DCMB 4AVPA 4J3NA 5H6RA 1QGPA 3ROUA 1KU7A 3JSOA 3FMSA 2VBXA 3BP8A 2LF7A 2F2EA 2NS0A 2MA3A 2GZWA 3ZMZA 2DAOA 2PG4A 3B73A 2ZFWA 2CQKA 4R8HA 3VA7A 1MKMA 3JTHA 4IRIA 3GYHX 4P55A 4L9VA 4KIGA 2HFHA 2QZ8A 2P5MA 5DUKA 1JHFA 2XAGA 4UVAA 1PDNC 1STZA 4M9XA 3V8KA 4DDQA 3F8MA 1MDMB 2QLZA 3KP7A 1ZARA 3HRMA 5E18F 1UFMA 4YFXF 1V3FA 4KMFA 3EUHA 1TQMA 5DCFA 3NRVA 1IN6A 1FYLA 1ZN2A 2MC3A 1RUNA 3ML6A 2A5YB 1SFXA 4OOIA 3TOBA 1ZG5A 3H3ZA 3LA3A 2MH2A 3L4JA 1ISEA 4LLNA 1U3EM 5CVRA 2P6TA 2F5DA 1O3RA 1YW9A 1K78A 5D5VB 4A5MA 2ZXJA 1O3QA 3RYPA 1WQHA 2IJLA 2QUFA 3LFKA 4FHTA 4A0ZA 3BPVA 3Q9VA 2HR3A 3ZMTA 4OIRF 3LQQA 3V4GA 3N97A 2FBIA 2ZCWA 2UXXA 3SQNA 4LK0F 1YLFA 3W6JB 4BH9A 1I1GA 1W7PD 2IA2A 1YG2A 4KAWX 4AIJA 2VE8A 3NQOA 1ZLJA 2XROA 1GE9A 3WU0A 2PJPA 3AAFA 4NQWA 4UVCA 1B4BA 4IVNA 5HS7A 4D0PA 2MLGA 2PBIA 5LEKA 3WTUC 2VONA 3GFLA 2V1XA 3QOPA 3DPLC 3FWEA 2XHKA 4Q5SF 3GF2A 2Y0MA 2FRHA 4HX4A 5DD8A 3KP4A 4HAMA 3BWGA 4M6XA 1ZG1A 4G0WA 4GXOA 1D3YA 3O3KA 4KICA 3QP6A 1SAXA 5JI6A 1O3TA 4KYWA 1XSXA 1Z7UA 3REOA 1B59A 4A0YA 5J8FA 2ZJ2A 5AIQA 4EJTA 2RV8A 1YS6A 2OD5A 2JT1A 2VN2A 3F6VA 3IHUA 5E1XA 4ENJA 2VBZA 4S04A 2HKOA 3J80K 3TQNA 1KU9A 5FLXZ 5HDKA 4KA4A 4A6DA 1B6AA 1BC8C 1MJBA 2J5PA 5HLIA 4KDDA 5BOXA 3CUQB 4HDVA 3LPXA 3F21A 5E8GA 1GVJA 2D45A 2EB7A 3IL2A 3DV8A 3M9AA 3CUOA 3KP2A 2H6BA 2NRAC 3FXRA 2JPBA 1ULYA 1MJ9A 2E7WA 3R6SA 1HW1A 5LGTA 4JK1X 3WG9A 3DPTA 5LBQA 1Q1HA 1U8RA 3ZN0A 4BHCA 4S05A 2GIVA 4EV0A 2W25A 4YG2F 1DPUA 3GLXA 1I5ZA 3G73A 4QLCU 3MZYA 3GXOA 1ODDA 1ZREA 1G6NA 3LQRA 4ZYEA 2FMLA 1OYWA 4U0YA 4BQAA 1ZHFA 2Y48A 3T8RA 4OMYA 3VFZA 5HS8A 4N9IA 1T6SA 1Z1DA 3J80Z 1Z91A 5LHHA 4A2UA 2VXZA 1S6LA 2RGVA 2OQRA 1IZ1A 1WIHA 1B9MA 3BJAA 4BAYA 4XRFA 2GWRA 4L9JA 3L7WA 2IRFG 2KRFA 2HYGD 3KE2A 1EH6A 3J81K 3MEXA 1EK8A 5IT9K 1G4DA 3GZ6A 1XXCA 3RYRA 3E5XA 5BMZA 1O7LA 1IXCA 1DUXC 4NHJA 4FM9A 1IN8A 1AOYA 5F1RA 5DYMA 2XCQA 5FB2A 3HTUA 2W85A 3F23A 1LVAA 2GA2A 4I7HA 3SFZA 3WTZA 2RN7A 1G3YA 3O2PE 3I53A 3KETA 5FLXK 2GA1A 2RNJA 1A04A 1KQ0A 4OU0A 4PCQA 4YIIA 4IHSA 1R5HA 3JTGA 3RTRA 2XKPA 4KUMA 5L3CA 1RI7A 5L3DA 4KIFA 4LGWA 2RGRA 3ISPA 2JPCA 2YSRA 1GXPA 1HQCA 3ZMDA 4RGXA 2NYXA 4ESBA 3CLOA 2P5LC 3GZ5A 1L3LA 1IRGA 5H6QA 3DKWA 2P8TA 5E17F 1T0FA 4HF1A 2XIGA 2QQBA 3Q5FA 2D1VA 5E20A 3R0AA 5BQTA 1JGSA 3EDPA 3MZHA 4RGUA 1SMYF 3HOTA 4OIOF 4RB3C 4I09A 4G7HF 2X0LA 3WE3A 4H0EA 4ZYHA 2QENA 4YFKF 4L5JA 5JVOA 5KVRA 1HXDA 2H94A 4HOBA 4EMSA 1FYKA 5ICEA 1IW7F 1TBXA 2XV4S 2ZKZA 1S7OA 1QQIA 5LRRA 1J5YA 2GAUA 1TLHB 4K2EA 1ZYRF 1G3TA 3WTYC 3E5QA 2IP2A 2FQ3A 3KP5A 1XXBA 2HQRA 3CDHA 3T5XA 2G9WA 1FYMA 4RAYA 5TRDA 1OPCA 2GXBA 1FX7A 4EM0B 2E1NA 3I59B 4MHGA 2EV6A
chains in the Genus database with same CATH superfamily
4G0UA 2TRTA 2P0WA 4G6TB 3HXLA 2WV0A 1ZGJA 2R7UA 2O9LA 2MBFA 5E3LA 4KDPA 1XMAA 3BJ6A 4B3AA 2EQRA 2K9QA 1MMAA 1YW7A 2XRNA 2G7HA 1J0RA 3HIFA 3HSEA 2ZXHA 5J6XA 1DPRA 3EQLF 4BE1A 4RAZA 2V7FA 1DP3A 2DTRA 1W7PB 2PMUA 4I98B 4IHVA 1DCOA 5AONA 2F5FA 1H9GA 1ZRDA 3R4KA 2F48A 1J09A 4XIDA 5L3EA 2DYSH 5IPAA 4OIPF 4A3FK 4XMYA 1DU6A 2DFIA 1LDJA 4CCOA 3K1NA 2W24A 2QQAA 1G3WA 5ILSA 3WE2A 2E1OA 3TGNA 4CDGA 1DDNA 2P5VA 3HUGB 3F72A 4XN0A 5FGMA 2HDWA 4C3JJ 4XCHA 2LY2A 2F6CA 2DPUA 2VT2A 2GOMA 2GSNA 2VQHA 4A3BK 4PABA 3N4MA 3CMEI 1VH2A 4O2DA 1H9TA 4FZBA 1G51A 3K6GA 5FFXA 3L2RA 3IH3A 1IRXA 2NVTJ 3OPFA 2CMPA 2OC6A 1TWAA 2I8DA 2Y0SA 3KCCA 3CMYA 1USTA 1GHCA 1ON2A 4NC7A 1UG0A 2HKXA 2JJ7A 4PFOA 3F6OA 1U5TA 1VQNI 3BC8A 4V19K 4NUBA 1WI9A 2XB5A 3HRSA 3HPGA 1ETYA 1BM9A 2QQ8A 3OWTA 4BACA 3F0CA 4A3FC 2ADUA 2M1BA 3C18A 3K1PA 4EM2A 3PFIA 4QIWD 4DW6A 2PX9A 2YUSA 2FEZA 3I4PA 2L01A 2L9VA 2VC1A 3IWZA 3K69A 1IUFA 3FXQA 4Y52C 2GAHC 4EGZA 4I2OA 5K1YA 1V55H 4KMUA 5IYDC 1TQIA 2NVQC 5LHGA 3PIPF 2EA4A 2EV0A 1OQYA 2HZTA 4BHBA 5GAGJ 1R00A 1IV8A 2HS5A 2V1DA 4ITVA 2OU2A 3TO6A 3HG9A 2RDPA 3GTKJ 2JUGA 3CP2A 3DP7A 2OJED 4Q47A 3FKIJ 2R7ZJ 4MEXA 2QBYA 2BVMA 5LEJA 3OYBA 1BIBA 2DT5A 2NVXC 5CLSA 2KKOA 1LDKB 4BKXA 2Q0OA 5D4SA 3OOUA 5FRNA 4LK1F 1D1AA 1U9OA 2R92C 4D1QA 2R7VA 2KT0A 3H5AA 3MVPA 4RB2C 3HOYK 1XDSA 4Q48A 3I4NK 1VTNC 1MH4A 2K4JA 3ASOH 2KJBA 5K7ZA 2Y9YA 3HOXC 4M3EA 1DD5A 2JK3A 1HKQA 3CO7C 1XGOA 2L7FP 1R58A 3E6DA 3CESA 1FT9A 4GFBA 1ZK8A 1F43A 2DQLA 3OR2C 2KDOA 3RIRA 3T8TA 1GT0C 5H20A 4ZDPA 2F5VA 1Z6RA 3JR9A 1JKPC 2O0YA 5CJ9A 5IT3A 4A3KJ 1TWHC 1I27A 5LD2C 1WVRA 1WHUA 3ASNH 3EUKL 4ABZA 4IHTA 1I6XA 3ZMVA 1R71A 3RKXA 1FSHA 2XGDA 4KC6A 5M5WK 4DYRA 5D5UB 3DBHB 4IEJA 5CKTA 4DIQA 5HNFA 2DJIA 4A3DC 1A5JA 5C3EJ 1F1ZA 4D9JA 1O4XA 4M9ZA 4QPOA 3WTVC 4RMFA 2NVYA 2XGEA 1FLIA 3CCLI 1OCCH 2GIZA 5L3GA 1T2KA 1XX5A 1KQ9A 2HXIA 2CFXA 3HOUJ 5IOQA 4B8XA 2CUJA 4AIDA 3N0CA 1JUSA 2OCCH 3BTJA 1T38A 1H89C 4C3JK 1I39A 4UB8C 3AD9C 5DM7F 4MTEA 1RR7A 1D8KA 3O8HA 3OYLA 2QQ9A 1Z6TA 1IGNA 2KPMA 4M1XA 1VI0A 1MJAA 1K79A 3D0SA 5IYBC 3UR3C 4BLAA 4X0GA 1ZRFA 1LEBA 5LGUA 3JRDA 1FNNA 2QSHX 2A68A 3MAJA 3DWLE 4ZZDA 5B1AH 5L3FA 1LNWA 2DBBA 2ACJA 3PQKA 4HX7A 1HQMA 2KQRA 2QEXI 3WU1B 2ZNYA 5TJJA 3T0YA 3FKIA 4L5EA 1UB9A 3WTXC 1WSVA 1B72B 2ME0A 4FE4A 2E35A 2GBYA 1ZVUA 2DQRA 2Q2EB 3VYTB 2R92A 5LLQA 2X6YA 4HSRA 2E2HC 5C4XC 3TP0A 3WHCA 4FX0A 4Y7NK 2KLOA 4B48A 4CHUA 2O6GE 5CVJA 3OS2A 5FD6A 3AG1H 3U1DA 2R5ZA 1BJTA 2DYRH 1MMNA 3HOWC 3MKLA 4D5CA 5HLHA 1K83A 1R5GA 1FOXA 5E8IA 3S16K 2WAQN 3SZPA 3LSJA 5J3LA 2BV6A 4MQ9F 4BE0A 3DBRB 1WCMC 4C2TA 3IP4B 5KNLA 2PQ8A 2R7FA 4KMUX 3GO5A 5DV5A 4HW0A 2IGNA 5IYCK 1W4MA 5TISC 1WQFA 2TDXA 2G7UA 2LK2A 2K9SA 3I5UA 1SD5A 1VQPI 5GP9A 3BG3A 3TL4X 1OCZH 3GTGJ 3WODA 1O24A 2YU9K 1P7JA 2XSJC 2BXYA 4MFEA 1JKOC 2P7VB 3S3NA 3M07A 5CVUA 3ERMA 1HKSA 4XBFA 1OYYA 2DCEA 2PMZL 1KQ4A 3FX3A 2JZYA 5EEHA 1OKRA 3AQOA 2LBFB 4N9HA 3HOXJ 5F64A 1CGPA 3M7GA 2YX4A 3HOUK 1MBFA 3BG7A 3A4CA 1UAAA 4Q4ZA 1TWCC 1TWAC 3G4AA 2HTSA 3FKIK 2D6FC 1BI3A 2JQ7A 2DJNA 1F93A 3S1QC 3BTIA 3S1NK 1Y1VJ 2BEOA 1P4XA 4ZTJA 2XAQA 2V9PA 2CUEA 1X3ZB 2L4MA 5EEAA 3CCVI 1KGSA 1YITI 1Z05A 1WSUA 2UWMA 1X1CA 2LMDA 3J7AO 2R5YA 1O57A 3IKTA 3UKGA 1BDFA 5EG0A 1Z7LA 3SFIA 2STTA 5HODA 3LAJA 2KWAA 2VT3A 4G12A 3CO6C 1RIOH 5FJ8K 3TDZC 1IDZA 1VZ0A 5FFZA 5C3EC 1VQ8I 2FOKA 2R7TA 4A3IC 2FMYA 3BG5A 2V6TA 2DDBA 1ZR4A 4IQJA 3S2HC 1WRJA 4MEYA 3WGGA 2WAQA 1DGWY 2XC7A 2HGCA 3ONQA 4LK0A 5JVGF 1PP7U 3ECHA 2X9DA 3B6CA 2X6WA 3IH2A 3PO2J 4P5OA 1RPWA 2LSOA 1B9NA 2W84A 3QOEA 1G8XA 1I3AA 3MMYB 1R36A 1J6WA 3H3UA 2L7ZA 3VYRB 5E3NA 4GTEA 3BZ6A 3GFMA 4HSTA 4ASNA 2NAZA 1DP7P 2FNAA 5FJ8J 2FBKA 5GAEJ 2GXGA 5EF6A 4XLEA 4L9TA 4EJWA 4I76A 5D6EA 4A3GK 1BR1A 3J7ZI 4GCVA 1MMGA 3HUGA 1FP2A 2PA8L 4WX9A 4KN4A 5C4XJ 4ZZLA 4A3JK 4LB5A 3U21A 2RKHA 5FROA 2P5KA 4CICA 3KZIC 2VE9A 3HHGA 2ZFUA 3TFHA 5CYVA 2PFBA 1PUEE 3QPLA 3FXJA 3CZ6A 1W1WE 2VBWA 3LSTA 4NNJA 5KCMA 4BEHA 4F55A 2NNNA 4HQEA 1OCOH 3HGYA 2EFQA 1GUUA 3J7YJ 1XGNA 2PLYA 4D7MA 4CZZA 3TO9A 4RBOA 1T39A 3C2GA 3K2ZA 4BUPA 1IXRC 3DTKA 3S93A 4XLNA 1RR8C 5CQEA 4Z2YA 6PAXA 2KRHA 2L9RA 3OOPA 4A6EA 1VQ9I 3GTGK 2IAIA 2EBIA 1Z67A 4Z6YA 3HOZJ 3GTJK 2V9VA 3L2WA 5FKMA 1B8IA 4BY7K 1IC8A 2ZFZA 3QYFA 3HTSB 3HOVC 1EV7A 3TO7A 1OFCX 2L5QA 5D5WB 2R0QC 3TTGA 1JHHA 1Y1VA 1LB2A 4DYQA 3E1SA 4P9FA 4M74A 1XDUA 4PFPA 2HQ5A 2K3FA 3GW2A 4PJNA 5IYCJ 4A3BJ 2XCOA 2RAEA 1Y1VK 4E7LA 2L0KA 3CJNA 3K2AA 2E34A 3Q0WA 4P9SA 3I3LA 5GADJ 3GX4X 4E70A 2QA4I 1Z3XA 4CXFA 2E2IC 2J5OA 3MCZA 2V6CA 3V7SA 3S1QJ 3FBIB 4M72A 2IBDA 2R4GA 3KZZA 3GSIA 2K27A 1F7UA 2VOPA 4FTHA 2K4BA 4A12A 4A3FJ 1TWFK 3HKZA 5M3MJ 4CUGA 2AQEA 2VL8A 2OPTA 1V4RA 5EGOB 2V6SA 5CQGA 3ZQIA 3H5NA 4I02A 3EPZA 4LJZA 3S2DJ 2EV5A 1JKRC 3SHFA 2DU9A 4M73A 2JRMA 3M1EA 2BGCA 1TNSA 2MW8A 1KQ8A 4XKBA 5JHUA 2PHCB 3IH4A 3IC7A 2A3SA 2PN6A 3JRIA 1UHMA 5BS6A 3KX2A 3ULQB 4LK1A 3C3WA 1BI1A 1K6YA 2XPWA 2ZB9A 1Y8QB 3V8JA 4C3HK 4RLFA 3ZPLA 2M5WA 3QU3A 4IQ4A 5J8CA 1FZPB 2OTJI 3FHNA 4C30A 1I6HK 4G8XA 4ENMA 1X4PA 3H35A 5IY5H 2ZUEA 4FX4A 3RZOC 5A2QZ 2M0CA 1RRJA 2GOXB 2KIFA 2Y3PA 3W2VA 3GTQC 3CTAA 4XM3A 1UCRA 4A3LJ 4B43A 4OIOA 4KJZA 3DFGA 1FP1D 2HI3A 2XVCA 2Z1DA 2LDUA 2IA0A 1XCBA 4XR6A 2P81A 4FCYA 4AYBL 1S3JA 2COBA 1FEXA 3KP6A 4MFDA 1H88C 2VUMK 3LSIA 3KEQA 4BLBA 3L2UA 4YFKA 3S14J 4PGGA 3W2WA 1VQLI 1S29A 3G6EI 4YELA 4RA2A 2A61A 2MFZA 1FTZA 1O26A 3FXKA 2CQXA 2YS9A 3R60A 2LKXA 1VQ5I 1INNA 1YX2A 3QX3A 2DA6A 2D2WA 3O8GA 1SD7A 3NWSA 2E7XA 2WC2A 5EJCA 3RZOK 3F9KA 2NS7A 1MMSA 2XCRB 1P7IA 2KJCA 5KK1A 4A93J 5IT9Z 2Z99A 1A31A 4OIPA 1V5VA 2QSGX 5IP9J 1TW2A 5F6FA 1D8JA 1F36A 1MBKA 3U2RA 3BTLA 1NK3P 2E1CA 2B63J 3RKYA 3HOUC 2O5JA 3QP5A 1WORA 1Q1VA 4Y15A 3V8LA 2CW8A 4GTFA 4JQFA 2MH9A 3KIOA 4X6AJ 2E2JJ 3KZYA 1MW7A 2X51A 4HA8A 3ZR8X 2W7NA 3S16C 3FM5A 3L1PA 3OYMA 2ZMEA 1T33A 1SD4A 3FMRA 4XKWA 1MDMA 4CA0A 2LVSA 4XLFA 5CPRB 4UY8I 3S0XA 1Z21A 3AL0C 4ENKA 3S17J 1W36D 5B66C 2UZKA 1B72A 3K4MA 3L00A 3VSKA 3JCUC 2HDDA 1EH1A 2YPRA 1QU3A 1QZZA 5IP9K 4OAZA 4E6KG 4QIWL 1KONA 4PAAA 3MKYB 1BGWA 4I6ZA 4G9YA 1TWCA 2DPDA 2LY9A 3Q0VA 4HBLA 4NQWB 2CO5A 2FNPA 4LLGF 5TMCA 4LJZF 2JA6K 2XASA 3ZMSA 2CUFA 3HOWK 2XPUA 3CC4I 4U0WA 4BL0B 4GTLA 2OUMA 3GUDA 1HSJA 3BP8C 4CCKA 2VJ4A 3A0BC 2QYOA 2R7QA 3S15C 2V9KA 3D5RC 4A5NA 5BPDA 3S2DC 1TT0A 3HBLA 3NUHA 4C3JC 2H09A 4AVZA 1WKMA 3D5LA 5HOOA 2I5UA 4A3KK 1ETOA 3DKYA 3HSFA 3ABTA 2VLAA 2YU9J 1TW3A 1OJLA 4AYBD 2Q8KA 3AG4H 4JK1A 1XMKA 3G71I 4DOZA 3GEHA 4LOCA 3NAUA 3S17C 3K4BA 1K6OA 3ECOA 4HYEA 4NC6A 4AIHA 1HW2A 1XSDA 4KN4X 4CCJA 2DLLA 4ENNA 3K4JA 5ICCA 1B4AA 1EFWA 5E1WA 4MEYF 3SYTA 3GEZA 5CVIA 3GBGA 2M4GA 1O2AA 1V5GA 2M34A 3QWLA 1EA3A 1REPC 1V5FA 3I59A 5K7HA 4N4OB 1C0WA 2OZ6A 3LSRA 5HNHA 5M5XK 2EWNA 1OCTC 1YJNI 2ETHA 4GGGA 1EQRA 3JSTA 1TWCJ 2VJJA 4GYIA 3HOYC 5IOZA 2MABA 1IN5A 5ILVA 4ZDOA 3GTOC 2R7ZA 3KEOA 2ELJA 3P9CA 3EETA 2YR2A 1IO2A 4HX8A 4B4CA 1OMIA 1ZKGA 1AHDP 1T0FC 4IOCF 4YRVA 1BIAA 4HPQA 4M71A 2HPIA 2KIUA 2RREA 3NARA 4MQVA 2ISYA 3LWFA 5D6FA 2E5NA 3WGHA 2DK8A 4ESFA 5K5OA 5DEQA 4PUSA 2K40A 3HM5A 2KISA 1S5LC 5FKOA 2FXAA 1BJAA 1I1SA 4R1HA 1J7KA 1S7AA 4RMNA 3W6KB 2B63C 4ZJZA 5C3EK 1I3QJ 5IP6A 5TJ3A 2WTEA 3A0HC 2IA1A 4N0BA 1VRQC 1MNEA 4X6AC 3RSNA 1VF9A 3EYYA 3TW7A 2EFNA 1QHHD 3MMLB 1SMYA 2IS4A 3GVAA 2VQCA 2WA0A 3RZDJ 3HEFA 2VUMC 3PO2C 3RQIA 1MSFC 3MKZA 1IS1A 2WB1N 2GSUA 4A3GJ 3ZP5A 2WBMA 4BE2A 4HLYA 1WOPA 2Y31A 3CF2A 2OAZA 3KYDB 1USSA 4QJVA 4GDFA 1TWHA 1VQ7I 1TWCK 2DT7B 3PFYA 4QIWN 1TWGK 1J98A 3DXJF 4HV5A 4V2GA 5F04A 4ZYAA 4OINF 1U0JA 4IF4A 2HU9A 3S1MC 5H2FC 3A1YA 4NOIA 3CCSI 5ICGA 4DNCA 5HDGA 4DBRA 3TMOA 3TOAA 4KASA 3GTLC 2LD5A 1I50K 1IF1A 4HF2A 4KMHA 3KP3A 4G6QA 3S1MK 2AQFA 1QBJA 3K4LA 1VQMI 1K83J 4O6JA 3VODA 3E3VA 5K5RA 2L02A 1C0AA 4PJJA 2GAGC 5M5YJ 2LP0A 3OYCA 3J81Z 3LA2A 3F22A 2OF7A 3FOEA 2KIQA 2MGQA 4UUTA 3HXAA 3DEWA 1DCHA 2JRTA 2CUZA 3VEPA 4LIVA 4QWQA 2K85A 2VQGA 4KM9A 2OA4A 4ZH4A 2WY8Q 2LNBA 1XMXA 4G6DA 1PVEA 1Y39A 5J47A 3HOSA 1R9TA 4II3A 1FC3A 2FOWA 2MD5A 3G1MA 4RGSA 3PO2K 2VPRA 5KAIC 2Z5UA 3OSFA 1FY7A 2R93A 4KB2A 4L0ZB 2FA5A 1O29A 3HOZC 3P9IA 3V7CA 1RKTA 2O7OA 1W7PA 3PIOF 3PUFA 4RM2A 4BNCA 2O8XA 3QPTA 2CRGA 1HDDC 4C2MJ 2DXIA 1XZQA 4U87A 3SXYA 5DDGA 4XSZF 1YIOA 3QU6A 1FBUA 2JN6A 3KYLA 4UV8A 3PNTA 2EZIA 3BR5A 2QM3A 1WH5A 3CMMA 3EUHC 3K4NA 1HLVA 5HDNA 1J9IA 3DKXA 1GV2A 2LKSA 1LFPA 4MNUA 3I4NJ 2JWTA 3ZQHA 5ILUA 4FISA 5EGOA 1XG1A 3QAHA 2BXZA 4E4HA 2A68F 4GZYA 4FETA 3DTIA 1CF7B 2A07F 1BR2A 1ZH5A 4ZTFA 1WOSA 2HZDA 2HDCA 3OYHA 3GTPC 4L0YB 3LSGA 1WH7A 2K9MA 2L4AA 3B02A 5ICFA 5IYDJ 5KAFC 1PJ6A 5B1BH 1S7EA 1R1TA 5J4YA 1S72I 4GTDA 4Q5SA 4MIMA 4CSWA 2DN0A 4D7NA 2YX7A 2R7ZC 3GTKC 3GTGC 1J75A 3Q3QA 4G7OF 4A3JC 4B47A 3E6CC 5TMFA 2STWA 4RGRA 2DFEA 3RZOJ 1WFXA 5FO5A 2X1CA 3L9FA 4IHWA 2VBYA 4IRHA 1TWHK 5LHIA 4E7SA 1TWGJ 2WV1A 2K86A 4Y33A 3CC2I 4GTCA 2HTJA 1HDPA 1LPQA 3OYEA 2HVQA 2P6SA 4CO8A 3L09A 3OSGA 4DZJA 3TP3A 4HQMA 2HOTA 3Q0UA 5BPIA 2VB6A 1U2WA 3O6BB 3PNVA 3VB2A 4AC0A 4KITB 5A2QK 4BY1C 4HF0A 2A5WA 3BG6A 3S1MJ 4PJMA 4A3LK 2P4WA 3HZJA 1XC5A 2FQOA 5F0FA 5HLGA 1WQGA 3JRBA 4G7HA 4FT8A 3BG9A 2HOEA 3M3YJ 1NTCA 3GZNB 2WB1A 1AB4A 3NWTA 3FXUA 1X3UA 5IP9C 1MNMC 4UHTA 2JMWA 5LGNA 1BI2A 1FBSA 5DUIA 1PUFA 4HNTA 3ZOBA 1ETQA 2ISZA 1KU2A 2NVQK 1BI0A 4WXDA 2X48A 4I01A 1B1BA 2RQQA 2HYFA 2XGCA 4R79A 2MLKA 1YCLA 1VQ4I 2E2JC 3KPHA 1CQTA 4Y52K 5C44C 4O3MA 3GFIA 1EI6A 1WOOA 1IJWC 1FWZA 1TQPA 1YO5C 1IBAA 1ZG3A 4XLPA 3ABLH 2A6HF 1X2NA 4HEA2 3U1KA 3JAMK 1IN4A 1J6XA 2MG4A 1ZQ1C 1ZYRA 5GTIC 2JA6A 4LLGA 5E3MA 5IOSA 1I3QA 1F7VA 2UUZA 3M8JA 1MMDA 1RETA 4ETSA 2WB1D 5J1YA 1WJ5A 1R49A 1OR7A 4KMDA 2LKPA 4U7BA 2E2HJ 2ZBKA 2Z2SB 1XZPA 1QO0D 2CFOA 1QNTA 1RNLA 4HLXA 1U8BA 2JA8J 4MTDA 3CUQA 4Y3OA 2ZUFA 2O8KA 3IRRA 1TWHJ 3GTPA 2JA7K 2JVGA 1Y1WA 1BR4A 1MD0A 4X6AK 1ZELA 3HSRA 3S3MA 3S15J 5HVQC 1USMA 4IRGA 1ACIA 1W0UA 3I55I 3CCUI 1IE0A 5FKKA 4ESJA 4RDUA 2FSWA 1QZYA 1PJRA 1YW8A 4XRSG 3OMYA 2P7CB 4PDKA 4HNUA 3SZGA 4G7ZF 3GTGA 3OR1C 3LFUA 5F0HA 4EJUA 1EJ9A 3OS0A 2VUMA 2D5VA 2R5ZB 2E2HK 2A05A 3BPXA 2EJRA 1SC7A 2YU3A 2XDVA 3WGIA 3OEPA 2V1UA 3VYUB 3HKZL 5E68A 4LMYA 5FRMA 3MWMA 2KL4A 5IYCC 2ZJQF 2F5CA 4WJ4A 1ETWA 2R93C 3OYKA 1HKTA 2A6EA 2DA7A 2M7AA 2VODA 3QPHA 2O03A 2QCOA 3G1OA 1BA5A 1QHGA 2QWWA 3SJMA 3TFIA 4M3DA 5IYBK 2DA1A 2W4SA 3GTJC 1ZQ3P 3IRQA 2B9SA 3OYGA 2AS5F 1IG7A 1HOMA 2WB1L 5HS9A 4EJOA 1SD6A 1WWXA 4RB0A 2QSFX 1OCPA 4CYDA 4A3EK 1G3SA 2WAEA 1NHAA 2KHMA 4BXXC 4PSXA 4L9NA 1MGTA 2AXLA 2BE5F 5JFRA 3C2BA 3FOFA 4BQQA 4IPAA 2E2IK 2ESHA 3E5UA 2Z33A 3H9JA 2DO7A 3Q9SA 1A35A 3S2WA 3CUQC 3TFJA 3OYJA 1R5ID 4A3CC 5EEGA 1TT5B 3S1RK 2ZSIB 3K1MA 2O5RA 1E2XA 2JA5C 1R1UA 1WCMJ 2BZTA 1BN5A 1Y1WJ 4XLPF 5D5XB 1YYVA 2RC4A 2PMHA 2IEKA 2CQ7A 2CYYA 4BY7C 1TTYA 3TKYA 1ETVA 2JA2A 1FBQA 2EH3A 2WAQL 2NNYA 4M6YA 3DCFA 2HVRA 2JTVA 4YIFA 2H6CA 2F5EA 2E5ZA 3DLLF 2R93J 5EZHA 3DXJA 5M3FJ 2Z9OA 4CH7A 2BYVE 3DEEA 1LDDA 3QRFF 4YFNF 5GAHJ 1I50A 4WXHA 1P92A 2FF4A 4CYCB 1BJZA 2O61A 3F8CA 2HEOA 3S14C 4EATA 3GTKA 3L2CA 2QKMB 3ZMUA 4O5VA 5FD5A 4A3KC 5E1ZB 1K78B 4AH6A 5DM6F 3M8FA 2EIMH 2V4JC 4JBAA 1YFHA 2OV7A 1GXQA 3FM3A 1XSVA 4P96A 4XSZA 3S15K 2LF8A 1SVLA 2L9NA 4P9UA 5LFAA 4HV6A 1N77A 3GTLJ 2RH6A 4BKWA 4CGZA 2ZNZA 3CC7I 5JFEA 5F27A 3VWBA 4WF2A 4LG0B 1O25A 3G3ZA 3PO3C 4EGYA 1N25A 2CG4A 4MGRA 3FXLA 4FQGA 2Y9ZA 1K83C 2E36A 1J2XA 3PSIA 1E3HA 3K0LA 1KZHA 3ADAC 2B7EA 1SFOJ 2DI3A 1JJ8C 2NVQJ 3FDYA 1X58A 2ECCA 1XPPA 1XGMA 5F1JA 2RQPA 5EYRA 3HHHA 3C1DA 1VNDA 2HQAA 2H8RA 3DEUA 1ZRCA 4LIUA 3M3YK 3ZQLA 1UJ8A 2CW0F 4I99C 3S2HJ 1NG6A 2LC2A 4CYCA 2AXTC 4U7DA 3K10A 5K5QA 1R9TC 2A6EF 2NXNB 4M3BA 5JLWA 2X6OA 1FOKA 1AA7A 1YRNA 4QPQA 3M4OC 1KYWA 2M30A 2CQNA 2W1OA 2VKDA 3ELKA 5IYDK 3EUAA 2DMQA 2DDAA 2NOJB 1TWGA 2XPVA 2DA4A 4LB6B 1Y56A 1ZBSA 4M3GA 2KZVA 5EGHA 2LREA 2MC4A 2XAFA 1EH7A 1K7AA 1MIJA 1SFEA 4LLLA 4BYYA 1P2FA 4RM3A 4HZFA 5C44K 1ZLKA 9ANTA 4XONA 2FQ4A 3DF8A 4UNOA 3PO3J 5J40A 4BEHB 3BLYA 4AD9A 3BJOA 4DQ2A 3S3OA 3KLNA 1ITYA 3DQVC 3LL7A 2KIMA 3BOQA 2ID3A 1MBEA 4L5IA 2DMNA 5GTHC 5M5YK 4KMAA 2ZJRF 4G0VA 3I71A 2HQNA 1WCMK 1R6RA 3FXMA 2WWYA 3CJTB 1ORKA 5D4RA 3P5JA 4OWRB 4LG0A 1BL0A 4I0AA 2M7BA 3QODA 4LITA 1M1EB 2DOFA 4DJAA 3K4KA 3AG3H 3H92A 3I58A 2M8EA 2ESNA 3MKWB 3ABUA 1AWCA 1JTYA 2CH0A 3BY6A 3AL0B 1W36C 2EBBA 3GCMA 3SZYA 2OBPA 2OQGA 1USOA 2ZO4A 2M0MA 2WY7Q 4AIKA 3A8IA 2B0LA 4IOAF 2NVYK 1ENHA 3IUOA 1T08B 4XLNF 1WJFA 2CGPA 3M8EA 3BP3A 4KM8A 1TWAJ 3WTSC 2ZMEB 2PJRB 1VQOI 1XGSA 2A69F 3RDIA 1Y1VC 1D5VA 1P4AA 4XOTA 3FKJA 3H5RA 4BBRJ 4PSWA 3ZRGA 2G0EA 5LRSA 3E6BA 2EPFA 1FSEA 1UV7A 1XD7A 1X1DA 1JGGA 3LSPA 3QPSA 1O2BA 3PO3K 1YHQI 2VKVA 1O3SA 3HRUA 4ZYGA 2R7SA 3OL4A 1AKHB 3VOEA 1MBHA 2Y75A 1P4WA 2ZXIA 2XAHA 4EQQA 1BOAA 1RU0A 4HDUA 2ZSHB 1IXSB 3F3XA 1E3PA 3OV8A 2H27A 1U6GA 5DD4A 4CZCA 1EH8A 1FTTA 4A3IJ 4A93C 5C4XK 4H4KC 3WODF 3JRAA 4KISA 1NH3A 1QPMA 1DU0A 2HPMA 1WGXA 2ECBA 1UHWA 1RZ4A 2EFOA 2EK5A 3FF5A 4XKVA 4E7JA 3BZKA 5DCMA 4XSXF 1QVUA 1XPXA 3FIWA 2EFPA 2XGXA 3CF5F 4C45A 3L2QA 1LQ1A 2BBYA 3WTWC 3HB9A 3LA7A 5AIPA 4WCGA 3VSLA 4EEFG 5D4DA 3S17K 1D0YA 2K9NA 3RKWA 3I4MJ 4LD5A 4BBRK 3RZDC 3ERED 2WAFA 4LG3A 2PMZN 4JYKA 2Y30A 4Q4ZF 1U5TB 4CCLA 5FKLA 2L7MP 1UG2A 4B09A 1IAWA 2JUCA 1R22A 1R9TJ 3JSPA 2NVYJ 1F9NA 1IN7A 3A02A 4PJ0C 2BHYA 3CMAI 2XF5A 4FASD 2L54A 2EFWA 4ON0A 3EYIA 1KA8A 3L2VA 2O3FA 4IHXA 3S1RC 4AWXB 2H8WA 1R7JA 3GTPK 4IL6C 4B3XA 1JXSA 1TNTA 2V6EA 3SDGA 2IW5A 3GWZA 3GDZA 3AH5A 1OISA 4GFQA 1U78A 3H3VD 4OMZA 3IWFA 2JA7J 3OIQA 4IXAA 4HRIA 1YIJI 5HL8A 2ZC2A 2CSOA 1FPQA 1SMTA 2XKOA 3PQJA 3CD6I 3KYCB 3I64A 3SZTA 4QTRA 3HYIA 4W1UA 1XCVA 1WQ2A 1MBJA 1OLTA 4V2FA 1V54H 3K70D 1Z9CA 2F4IA 2I10A 2IS6A 3C7JA 1ZXOA 4WXCA 4ANJA 1O2FB 1YQAA 3HOXK 2FE3A 3GTLK 4LOWA 1KYZA 2RVCA 1YI2I 5ERIA 2GSOA 1YX5A 2HNHA 1FOWA 4WK8F 3GIRA 4DBQA 3MZ8A 2M9HA 2R92K 4PGHA 2LLKA 3E6MA 5JR3A 3CDIA 2VC0A 1A6QA 1LE8B 3RJPA 2W57A 2VOOA 2QVOA 4P5BA 5CVVA 3DLAA 4G7OA 4U88A 4F91B 1XTAA 4JX4A 2JSCA 1A6IA 2Y69H 3IKVA 4C2MC 2LR8A 1S8NA 5C4JK 2DMTA 3ZQ7A 3GEIA 3TBIA 2IT0A 2M2EA 1H0MA 2EINH 3MQ0A 4BJ5C 5GPAA 4E7HA 3S2HK 2PMZA 3R0JA 1W5TA 2GLOA 4A0XA 1J59A 3FBNB 3SDBA 2HOSA 3FZVA 3P7NA 1LJ9A 2C6YA 4U0VA 4A3MJ 3I0TA 3RCOA 1W5SA 3ZN1A 2IPQX 3MFKA 2HVSA 3VPRA 5IOTA 4HNVA 3LAPA 1T56A 1RESA 1P6RA 1Y6IA 3JAMZ 2PPBA 3HRTA 2F4OB 3BCAA 1FOYA 3I56I 1JVIA 3T00A 3D1NI 4KATA 2MSYA 3H36A 1WJCA 3JW4A 3AQPA 2PI0A 1QA6A 2EA2A 2K3PA 1FIPA 2FBHA 5C4JC 2KZGA 1WCMA 1PJ5A 1JQWA 4D5FA 3F8BA 2DW4A 4A3CJ 1R1VA 1YOVB 4EJVA 3RPQA 5IP7C 4F7ZA 2NOGA 3GTMC 1ON1A 1Y1WC 2JA5A 1T98A 2L3DA 1MZBA 4UV9A 4LFUA 1TL8A 1MSEC 4UUVA 2OCEA 1RUOA 3CAGA 1Z0XA 1E17A 1O7FA 1ETXA 3CCQI 4L18B 3TEDA 5IYBJ 5L3BA 4RLQA 1LKXA 3FHZA 1ETKA 2CWEA 5F08A 4Y7NC 2RNGA 4IHYA 1GLNA 3SEQA 2FD5A 2LTPA 4NDLA 2NVXJ 1XZPB 4A3EJ 1HBXG 1HCRA 2CV0A 3LMMA 2A6HA 4YG2A 1UHSA 2R7DA 2PEXA 1F5TA 1BS2A 2CFAB 2FU4A 2KP6A 4M9SA 3KFWX 4MLOA 1SFUA 1O27A 2K02A 2UXNA 4B1RA 1SFKA 2AHQA 4KT5C 4CCNA 3TDUC 4GYGA 5BNGA 3RPUA 5JVTA 2E19A 1ONVA 5D8KB 3OREA 2QKLB 4Y17A 1XB4A 3EQLA 2E1MB 2M45A 4EM1A 2E1MC 4G94A 5JHFA 5C4JJ 1JE8A 3R61A 3I9V2 3ABKH 3HJEA 4I0BA 1Y8RB 4KIBA 5EZGA 3S2DK 1YJWI 1LFBA 2GQQA 4GTBA 4F52A 3E97A 1A36A 3HOVK 2FX0A 1BC7C 3F8FA 3COAC 2Q1ZB 2F4MB 4A3DJ 2K7LA 1ERDA 3T1BA 1F4KA 1B8IB 1VQ6I 1Z77A 3ABMH 4Y13A 5C44J 1WZ2A 3F8NA 4LQYA 3AFHA 4QSHA 3FMQA 1U5TC 4E7KA 1CF7A 2Y0SD 1HSTA 2LBFA 1KU3A 2HWVA 4Y7NJ 3D5SC 1L0OC 1J6VA 2NVTK 2LY1A 3U9GA 3RPUD 3CQZA 4KN7X 4MQ9A 3K9TA 1HI9A 2Z3YA 3ZQFA 3S32A 1PP8F 3GTQJ 1S9HA 3CQZK 2DK5A 4UVBA 3QQAA 4A3LC 2PMZD 5KHDA 5E79C 3ZGKA 3WU2C 1K61A 2BW3B 1QRYA 1YTYA 4ILDA 2Q2EA 1D1BA 2VKHA 3N05A 4KT6A 3B6AA 3RI4A 2FUG2 3V7RA 2IVMA 2X4HA 3BROA 1T8IA 5FKNA 3I4NC 2GXAA 2OZUA 4A3MC 3L4KA 1HW5A 4RAGA 2M3AA 3I54A 4RS8A 2NVXA 3CJQB 4PZJA 1D0ZA 4IJAA 2LG4A 2LRDA 1Y0UA 4F93B 4B44A 4IKFA 2ME6A 4AYBN 2M87A 1R23A 1K4TA 3BDDA 4C9YA 1VGXA 3GTJA 1ZGAA 2Y0SN 4ZH4F 4GO1A 3KLOA 3NEUA 4MEXF 5FLVA 4WWCA 3LSMA 3OIOA 1YNJA 1YS7A 2ELHA 4BHPA 1XXAA 3GFJA 3X2QH 4KFCA 3CCJI 2KMUA 4TV7A 2BOLA 5J1UA 5ED4A 2NS8A 4A3JJ 2COMA 3WTTC 4OIQF 1IUYA 1BBYA 2V79A 2V1NA 4XSXA 2L9SA 5FLMC 1ZAOA 2R3SA 4UXNA 3ZXSA 5D8LB 2QBYB 1FMVA 3H1CA 3FISA 2NVTC 4MO7A 2O5IA 4A3IK 4IO9F 1WPKA 1XN7A 4RB1A 3M1CA 4PJLA 1YJ9I 4KB4A 3Q3SA 2JA8K 4YEJA 4WILA 3P9KA 3TW6A 5J4VA 3CCEI 4IX7A 1SVMA 2D1HA 3BUEA 2WADA 3BCBA 2ZXWH 3ESWB 2CV1A 1LEAA 4BBSJ 3T01A 3GTOA 4ZYDA 3BQZA 4N4NB 1N75A 3PSFA 4EVIA 4NB5A 3CCYA 4BXUA 2PA8D 4KNYA 1OYIA 2XUBA 3BTCA 2DA2A 2XAJA 1IRFA 2DOEA 5DCMB 4AVPA 2XF6A 1LE8A 4J3NA 4BQOA 1T95A 5H6RA 1QGPA 3LSHA 3ROUA 4BXXJ 1EF4A 2K9LA 1HC8A 1KU7A 2JA7A 3S1QK 3JSOA 2KDZA 3FMSA 1I50C 2VBXA 3A8KA 4II2A 1TWAK 3BR0A 3IAS2 2W82A 3A01A 2IS1A 5M3MK 1W5CC 2UV1A 3BP8A 2LF7A 2F2EA 2NS0A 2ICWG 2MA3A 1IV6A 2GZWA 3ZMZA 3HC7A 2VKEA 4UUSB 2DAOA 4Y52J 3GTPJ 2PG4A 3B73A 2CJJA 3W3CA 2ZFWA 2BY3A 2CQKA 4R8HA 2GM4A 3VA7A 1MKMA 2K5CA 1SFOA 2YU9C 3JTHA 4IRIA 3GTQA 1JKQC 4J19A 3GYHX 4P55A 1I6HC 2IS2A 4E7ZA 1NK2P 4L9VA 1DGRM 1QZEA 4KIGA 2HFHA 2QZ8A 2TCTA 3A2KA 2P5MA 4C3HC 5DUKA 4XKCA 4IZZA 1QVTA 1JHFA 2XAGA 4UVAA 1MNDA 4J01A 1PDNC 3W6VA 3H0GA 2DMPA 1STZA 2DMUA 2MYSA 3FK7A 3HOVJ 1HF0A 1BW6A 2B63A 3C2HA 3H3VK 4M9XA 2IGOA 4AYBA 1IRZA 1YNNA 3H0GK 2VJIA 3V8KA 4DDQA 3F8MA 3DTEA 4A3BC 1Y1WK 1MDMB 3JRCA 2QLZA 4BDYA 1TWGC 3KP7A 3M4OK 2XB0X 1ZARA 3HRMA 5E18F 2E2IJ 1UFMA 3IV5A 4YFXF 1R9TK 1V3FA 3MD2A 4KMFA 3EUHA 4C2MK 2JA8C 3PM1A 5E3OA 2CV2A 1TQMA 5DCFA 3HOWJ 4C3IJ 3OS1A 1SEUA 1E0EA 2Y2ZA 3J7AY 3NRVA 1IN6A 4OAYA 1FYLA 1ZN2A 3SZZA 2MC3A 1RUNA 3MN2A 3ML6A 2A5YB 2R5YB 1SFXA 1PUFB 4OOIA 3TOBA 3ZQQA 1ZG5A 3H3ZA 2ZMEC 3LA3A 1K83K 2MH2A 2VIXA 3L4JA 2BY2A 3ZCOA 5JLXA 3K70C 3PJRA 1ISEA 4LLNA 3VYSB 1U3EM 4ZDLA 4C3HJ 5HLTA 1H8AC 5CVRA 1FMWA 2M4KA 1JT0A 2EIKH 2P6TA 3K4CA 2LOOA 2R7OA 4NBQA 2PJRA 5FLMJ 4XN3A 2KRCA 1RKWA 4OINA 2F5DA 1O3RA 1WSRA 1YW9A 1K78A 5D5VB 5L46A 2MD0A 4A3MK 4A5MA 2VI6A 2ZXJA 1R4MB 3BR1A 1O3QA 3G1LA 3RYPA 1WQHA 1HA8A 1VJEA 4BXXK 2X6XA 2KFDA 2IJLA 1G59A 2CW0A 4P5AA 2QUFA 4YIRX 3LFKA 4FHTA 4A0ZA 1LUJB 3BPVA 4XLHA 4KN7A 1GDTA 3Q9VA 2FJ1A 2HR3A 3ZMTA 5EDNA 4OIRF 3LQQA 3LOCA 3V4GA 3N97A 3HPHA 2JA6C 2FBIA 2ZCWA 3RZDK 2EZLA 2R93K 2UXXA 3SQNA 4XQFA 4LK0F 2N8GA 1YLFA 2QF7A 3LNQA 2X85A 3W6JB 4Y4RA 2JA5J 4BH9A 1I1GA 1W7PD 5IP7J 3V42A 1UZCA 3H3VL 2IA2A 3QYBA 1YG2A 4KAWX 4AIJA 2VE8A 3NQOA 2E71A 3LSKA 3S1NC 1ZLJA 2XROA 1GE9A 3WU0A 1IDYA 3OIPA 3FKIC 2PJPA 2H1LA 4F3QA 3RQ4A 3AAFA 1Y0NA 2NVUB 4JP0A 3RKQA 2HOAA 2CFAA 2IGMA 4NQWA 1P9QC 1TZLA 4UVCA 1TC3C 1B4BA 1X31C 4IVNA 2EIJH 5HS7A 2R92J 4BBRC 4YFXA 4BU2A 4D0PA 2MLGA 1NG7A 2PBIA 5LEKA 2H1KA 3WTUC 3G2BA 4JOMA 1UELB 1G2HA 2EZHA 2VONA 1LVKA 4BQNA 3GFLA 5M5XJ 2BE5A 2V1XA 3QOPA 3DPLC 5F0CA 3FWEA 3K7AC 2XHKA 4XL9A 2ELKA 2JA6J 4Q5SF 3GF2A 2BHZA 2Y0MA 2FRHA 3W2AA 4HX4A 4W97A 5DD8A 1JOEA 2CS3A 3KP4A 4HAMA 1DCPA 3BWGA 4M6XA 4DGWB 1ZG1A 1MBGA 3OYAA 4G0WA 4GXOA 2A69A 1D3YA 3AD8C 4KARA 3O3KA 2DT6A 4KICA 3QP6A 4S0HB 1SAXA 5JI6A 3GTMK 1VFCA 1O3TA 4KYWA 1IL2A 5IP7K 1XSXA 3GMEA 3I4MC 2WAQD 1Z7UA 3REOA 3S1NJ 3BR3A 1B59A 4A0YA 1ZGWA 4ZC3A 1SFOK 4DYCA 5J8FA 2ZJ2A 5AIQA 3CQZJ 3ZQCA 3FK6A 4EJTA 3GTQK 2DFFA 3BT9A 4YFNA 3K7AK 2L2OA 1YS6A 2RV8A 2OD5A 3HKZN 3VDXA 2NVYC 3DPUA 2BW3A 2JT1A 1IW7A 2VN2A 1O28A 1GVDA 1D1CA 3F6VA 2VPLA 3AKZA 4XOPA 3IHUA 4AM3A 1OR7C 5E1XA 4ENJA 2Y0SL 5DS9A 5K7FA 5J1RA 2VBZA 1JUMA 3I4MK 3CDLA 4JX6A 4S04A 2HKOA 4OIRA 1X1PA 2DOAA 3J80K 3TQNA 1KU9A 3HOYJ 5FLXZ 3UNGC 5HDKA 2W00A 4KA4A 4A6DA 3E7LA 1ZTRA 1B6AA 1BC8C 1LFUP 1MJBA 4HG2A 2J5PA 5HLIA 1MH3A 4KDDA 4BJ6C 3G4CA 2IGKA 5BOXA 3CUQB 4HDVA 3LPXA 3F21A 1AU7A 3T02A 5E8GA 4OIQA 1GVJA 4XORA 1IQ0A 2EZKA 2D45A 1TP4A 2EB7A 3QYEA 3DV8A 2XSDC 1RC9A 3IL2A 1XS9A 3M9AA 2DODA 3CUOA 2H6BA 3IAM2 3KP2A 1AKHA 1V5EA 1U9NA 3GTMA 2LYCA 2NRAC 4WJ3M 3OYDA 3FXRA 4QJVB 3IPJA 1D5YA 2JPBA 5FLMK 1ULYA 1MJ9A 1D0XA 5DTDA 3GTKK 2R7ZK 2E7WA 3R6SA 4BY1K 1JTXA 3OYNA 1HW1A 2R7RA 5LGTA 4JK1X 3PNYA 1W0TA 3WG9A 3DPTA 5LBQA 3JRFA 1Q1HA 1DQUA 1ZR2A 2DFHA 1U8RA 1TWFC 3ZN0A 1E3OC 4BDZA 1BW5A 4BHCA 3WG7H 2OTLI 4S05A 2W7VA 4BBSC 3E0JB 2BY1A 2DA3A 2GIVA 3S14K 2NVXK 4EV0A 2W25A 4YG2F 1DPUA 3GLXA 3SEZA 1I5ZA 3G73A 2R7WA 3BZCA 4QLCU 3MZYA 1SVOA 5B5EC 1X2MA 3GXOA 1ODDA 1ZREA 3H9QA 1G6NA 3DU6A 3LQRA 5GPCA 1I50J 1WJAA 3GLLA 4ZYEA 4G7ZA 2FMLA 4UUSA 2LFBA 1X19A 2QGUA 5B3SH 2ZJPF 3A03A 1OYWA 3KEYA 5M5WJ 4U0YA 4BQAA 1K4SA 2HXOA 1ZHFA 2Y48A 3T8RA 4OMYA 2JA5K 3VFZA 3H0DA 3HL2A 1VLOA 3GTMJ 5HS8A 4N9IA 2JVHA 1FJLA 1T6SA 5TGTA 3S16J 1Z1DA 3CLQA 3J80Z 1APLC 5IOYA 1Z91A 4BY7J 1JI8A 2A6TA 4BXFA 5LHHA 1PJ7A 1TWFA 3G4SI 4A2UA 2VXZA 1X1AA 1UMQA 1S6LA 2RGVA 2OQRA 4A93K 1IZ1A 3H0GJ 1WIHA 2IXSA 1I3QC 1B9MA 3PUBA 4P1WA 3WHBA 4A3EC 3BJAA 4BAYA 3BR2A 4XRFA 3CCMI 3OL3A 2GWRA 3BR6A 4L9JA 2V6UA 4A3GC 3L7WA 2IRFG 5EG0B 2E2HA 3GTJJ 3HOZK 2KRFA 2HYGD 3JRGA 3KE2A 1EH6A 3GTLA 2CQQA 3J81K 4C3IC 3MEXA 1EK8A 5IT9K 1G4DA 3GZ6A 1XXCA 3RYRA 1YE9A 3E5XA 5BMZA 4GT9A 1O7LA 1IXCA 1DUXC 4NHJA 1SFOC 4FE7A 3OYFA 4FM9A 1IN8A 3OYIA 1AOYA 4JX5A 5F1RA 5DYMA 2XCQA 5FB2A 1JJ6C 4DZPA 3HTUA 3PL8A 4XRSA 4BGDA 1PYVA 2W85A 3F23A 4XRMA 2VXDA 2Z16A 1LVAA 3A01B 2GA2A 2BY0A 2XAUA 4I7HA 2XF7A 3SFZA 3WTZA 2RN7A 3HDDA 3H0GC 2M8GX 2V26A 1G3YA 4UB6C 4XLAA 3O2PE 3I53A 4BJTA 3KETA 3OY9A 2GA1A 5FLXK 2RNJA 2VJ5A 3BQYA 4E7IA 1A04A 1SAUA 4M6VA 1KQ0A 4OU0A 3M4OJ 4PCQA 4YIIA 4IHSA 4J00A 1R5HA 3JTGA 2B63K 3RTRA 2XKPA 4KUMA 4BS9A 5L3CA 1RI7A 2YU9A 4GRIA 1TWFJ 5L3DA 4KIFA 3HKZD 4LGWA 5CHPA 2RGRA 2VQLA 3ISPA 3S8PA 2JPCA 2YSRA 1GXPA 1HQCA 3ZMDA 4RGXA 1X3WB 2NYXA 4ESBA 3CLOA 4A69C 2LH9A 2P5LC 3GZ5A 2FQTA 1JT6A 1WJEA 1L3LA 3S1RJ 3JRHA 3GTOJ 1WI3A 2ID6A 5H6QA 1IRGA 4C3IK 3DKWA 2P8TA 4BY1J 5E17F 1YRNB 1T0FA 4HF1A 2XRLA 3CCRI 1Z3YA 2XIGA 1FIAA 2JA7C 4AUXA 4CCMA 3AD7C 4XK4A 1X1BA 2QQBA 4NC8A 3Q5FA 1JUPA 1VQKI 2D1VA 5E20A 3R0AA 5BQTA 1JGSA 1WJBA 3EDPA 3MZHA 2R7XA 3M3YC 4RGUA 1SMYF 3HOTA 4OIOF 4GTAA 4RB3C 4AU7A 2CW7A 4C2UA 3ZQGA 3GEEA 1SANA 1I3QK 4I09A 4RAFA 4XNFA 2X0LA 3WE3A 4G7HF 4H0EA 4ZYHA 2QENA 3JREA 2L7KA 4YFKF 5IORA 4XICA 4L5JA 2VUMJ 5JVOA 1OCRH 3GTOK 4X1EA 5M3FK 3CJRB 5KVRA 1HXDA 1L0WA 2H94A 3N3YA 3A8JA 2E2IA 4HOBA 4EMSA 1XZQB 3HGGA 2EILH 2JSPA 2E2JK 1FYKA 5ICEA 4XLCA 1IW7F 2CU7A 3FXOA 1TBXA 2JH3A 5EGEA 2XV4S 2ZKZA 1S7OA 1QQIA 1YX3A 2VASA 4A3DK 5LRRA 1J5YA 2E60A 2GAUA 2X1DA 3K7AJ 1TLHB 2HYJA 1GV5A 4K2EA 1I6VA 3H9GA 1ZYRF 1QPIA 1G3TA 3WTYC 3E5QA 2DTZA 2IP2A 2FQ3A 2AO9A 4BBSK 2X1EA 3KP5A 1XXBA 4F92B 3AG2H 2HQRA 1N78A 3CDHA 3T5XA 2G9WA 3N0BA 1FYMA 2W48A 4RAYA 5TRDA 1OPCA 1R4NB 4A3CK 2GXBA 1I6HJ 1FX7A 3DU5A 1BOBA 2DA5A 1POGA 4EM0B 4PK4A 3CQZC 2BVLA 2E1NA 4M3FA 4LR2A 1EKEA 3I59B 4MHGA 2EV6A 3CP8A 1X4OA 1WJDA 3DBLB
chains in the Genus database with same CATH topology
4G0UA 2WV0A 1ZGJA 2MBFA 4KDPA 1XMAA 3BJ6A 1YW7A 2XRNA 2G7HA 1J0RA 3HIFA 3HSEA 5J6XA 1DPRA 3EQLF 4RAZA 2DTRA 1W7PB 2PMUA 4I98B 5AONA 2F5FA 1H9GA 1ZRDA 3R4KA 5L3EA 4OIPF 2DFIA 1LDJA 3K1NA 2W24A 2QQAA 1G3WA 5ILSA 3WE2A 3TGNA 4CDGA 1DDNA 2P5VA 3F72A 5FGMA 2DPUA 2VT2A 2GSNA 3N4MA 1H9TA 4FZBA 5FFXA 3OPFA 1TWAA 3KCCA 1USTA 1GHCA 1ON2A 2HKXA 3F6OA 1U5TA 1WI9A 3HRSA 1BM9A 2ADUA 2M1BA 3C18A 3K1PA 4EM2A 3PFIA 2FEZA 3I4PA 2L01A 2VC1A 3IWZA 3K69A 3FXQA 4EGZA 4I2OA 5K1YA 1TQIA 5LHGA 2EA4A 2EV0A 2HZTA 4BHBA 1R00A 2HS5A 2V1DA 2OU2A 3TO6A 2RDPA 3DP7A 4Q47A 2QBYA 5LEJA 1BIBA 2DT5A 5CLSA 2KKOA 1LDKB 2Q0OA 5D4SA 4LK1F 4RB2C 1XDSA 4Q48A 1VTNC 2K4JA 2KJBA 1DD5A 1HKQA 3CO7C 1XGOA 1R58A 3E6DA 1FT9A 2DQLA 3T8TA 3RIRA 5H20A 1Z6RA 2O0YA 5CJ9A 5IT3A 1I27A 4IHTA 1I6XA 3ZMVA 3RKXA 1FSHA 4KC6A 5D5UB 1F1ZA 4M9ZA 3WTVC 2NVYA 1FLIA 5L3GA 5IOQA 1T2KA 1KQ9A 2CFXA 4B8XA 3N0CA 1T38A 4MTEA 1D8KA 2QQ9A 1Z6TA 4M1XA 1MJAA 1K79A 3D0SA 4BLAA 1ZRFA 1LEBA 5LGUA 1FNNA 3MAJA 4ZZDA 5L3FA 1LNWA 2DBBA 2ACJA 3PQKA 4HX7A 3WU1B 2ZNYA 5TJJA 3T0YA 3FKIA 1UB9A 3WTXC 1ZVUA 2DQRA 2R92A 5LLQA 4FX0A 4CHUA 2O6GE 5CVJA 5FD6A 3U1DA 1BJTA 1K83A 5HLHA 1R5GA 5E8IA 3SZPA 2BV6A 4MQ9F 2PQ8A 2R7FA 4KMUX 3GO5A 5DV5A 4HW0A 1W4MA 1WQFA 2TDXA 2G7UA 3I5UA 1SD5A 1O24A 2P7VB 5CVUA 1HKSA 4XBFA 1OYYA 1KQ4A 3FX3A 2JZYA 5EEHA 1OKRA 3AQOA 4N9HA 5F64A 1CGPA 3M7GA 2YX4A 3G4AA 2HTSA 1BI3A 2BEOA 1P4XA 2XAQA 2L4MA 1KGSA 1WSUA 1Z05A 2UWMA 3J7AO 1O57A 3IKTA 2STTA 3LAJA 2KWAA 2VT3A 3CO6C 1RIOH 3TDZC 5FFZA 2FOKA 2FMYA 1WRJA 3WGGA 2HGCA 1PP7U 3ECHA 4P5OA 2LSOA 1B9NA 2W84A 1R36A 3H3UA 4GTEA 3BZ6A 3GFMA 4ASNA 2NAZA 1DP7P 2FNAA 2FBKA 2GXGA 4EJWA 4L9TA 5D6EA 4GCVA 3HUGA 1FP2A 4WX9A 4ZZLA 4LB5A 2RKHA 2P5KA 4CICA 2VE9A 3HHGA 5CYVA 2PFBA 1PUEE 2VBWA 3LSTA 2NNNA 4HQEA 2EFQA 1XGNA 2PLYA 4CZZA 3TO9A 1T39A 3K2ZA 1IXRC 4Z2YA 6PAXA 4A6EA 3OOPA 2V9VA 2ZFZA 3HTSB 1EV7A 3TO7A 5D5WB 1JHHA 1Y1VA 1LB2A 4P9FA 4M74A 1XDUA 2XCOA 3GW2A 3CJNA 3GX4X 4E70A 4CXFA 2J5OA 3MCZA 2V6CA 3V7SA 4M72A 3KZZA 2K27A 2VOPA 2K4BA 4A12A 1V4RA 4I02A 2EV5A 3SHFA 2DU9A 4M73A 3M1EA 2BGCA 1TNSA 1KQ8A 5JHUA 2PHCB 3IC7A 2A3SA 2PN6A 5BS6A 1UHMA 3ULQB 3C3WA 1BI1A 3V8JA 3ZPLA 2M5WA 3QU3A 5J8CA 1FZPB 4G8XA 4ENMA 4FX4A 5A2QZ 2KIFA 2Y3PA 3CTAA 1UCRA 3DFGA 1FP1D 2XVCA 2IA0A 2LDUA 1XCBA 1S3JA 3KP6A 3KEQA 4BLBA 4PGGA 1S29A 2A61A 1O26A 3R60A 3QX3A 2D2WA 1SD7A 2E7XA 2WC2A 2XCRB 2KJCA 5KK1A 5IT9Z 2Z99A 5F6FA 1TW2A 1D8JA 3U2RA 2E1CA 3RKYA 3QP5A 4Y15A 3V8LA 4GTFA 4JQFA 2MH9A 3KZYA 4HA8A 3FM5A 2ZMEA 1SD4A 3FMRA 1MDMA 3S0XA 4ENKA 2UZKA 3L00A 1EH1A 2YPRA 1QZZA 1BGWA 4G9YA 1TWCA 2DPDA 4HBLA 2CO5A 2FNPA 4LLGF 4LJZF 2XASA 3ZMSA 4GTLA 4U0WA 3GUDA 1HSJA 2QYOA 4A5NA 5BPDA 3NUHA 4C3JC 2H09A 1WKMA 3D5LA 5HOOA 3HSFA 3ABTA 1TW3A 2Q8KA 1XMKA 1K6OA 3ECOA 4HYEA 1HW2A 4AIHA 1XSDA 4KN4X 2DLLA 4ENNA 5ICCA 1B4AA 5E1WA 4MEYF 3GEZA 5CVIA 1O2AA 1REPC 3I59A 1C0WA 2OZ6A 2EWNA 2ETHA 4GGGA 4GYIA 1IN5A 5ILVA 3KEOA 3P9CA 4HX8A 3EETA 2YR2A 1OMIA 1BIAA 4M71A 2KIUA 4MQVA 2ISYA 3LWFA 5D6FA 3WGHA 2DK8A 4ESFA 5K5OA 5DEQA 2FXAA 1BJAA 1I1SA 4R1HA 1J7KA 1S7AA 3W6KB 5TJ3A 2WTEA 2IA1A 4N0BA 3EYYA 2EFNA 3MMLB 3GVAA 1IS1A 2GSUA 3ZP5A 4HLYA 2OAZA 1USSA 1TWHA 3DXJF 4HV5A 4OINF 4IF4A 5ICGA 4DNCA 5HDGA 3TOAA 4KASA 1IF1A 4HF2A 4KMHA 3KP3A 4G6QA 1QBJA 4O6JA 3VODA 3E3VA 5K5RA 2L02A 3J81Z 3LA2A 3F22A 3FOEA 2JRTA 3VEPA 4QWQA 4KM9A 2OA4A 2LNBA 4G6DA 3HOSA 1R9TA 1FC3A 2MD5A 4RGSA 2Z5UA 1FY7A 2R93A 4KB2A 4L0ZB 2FA5A 1O29A 3P9IA 3V7CA 1W7PA 4BNCA 2O8XA 3QPTA 3SXYA 5DDGA 4XSZF 1YIOA 3QU6A 1FBUA 4UV8A 2QM3A 5HDNA 1J9IA 4MNUA 5ILUA 3QAHA 2A68F 2A07F 1CF7B 1ZH5A 2HDCA 4L0YB 2L4AA 3B02A 5ICFA 1R1TA 4GTDA 2YX7A 1J75A 3Q3QA 4G7OF 3E6CC 2STWA 4RGRA 5FO5A 3L9FA 2VBYA 4IRHA 5LHIA 2K86A 4GTCA 2HTJA 2P6SA 4CO8A 3L09A 4HQMA 5BPIA 1U2WA 3O6BB 3VB2A 5A2QK 4HF0A 2P4WA 5HLGA 1WQGA 4FT8A 2HOEA 1AB4A 3FXUA 1X3UA 4UHTA 5LGNA 1BI2A 1FBSA 5DUIA 2ISZA 1KU2A 1BI0A 4WXDA 4I01A 1B1BA 2HYFA 4R79A 2MLKA 4O3MA 3GFIA 1FWZA 1TQPA 1YO5C 1ZG3A 2A6HF 3JAMK 1IN4A 2JA6A 1I3QA 5IOSA 4ETSA 1OR7A 4KMDA 2LKPA 4U7BA 2ZBKA 1QO0D 1QNTA 1RNLA 4HLXA 4MTDA 3CUQA 3IRRA 3GTPA 1Y1WA 1MD0A 3HSRA 5HVQC 4IRGA 4ESJA 2FSWA 1QZYA 1YW8A 2P7CB 4PDKA 4G7ZF 3GTGA 4EJUA 2VUMA 3BPXA 2EJRA 2YU3A 3WGIA 3OEPA 2V1UA 4LMYA 3MWMA 2F5CA 1HKTA 2VODA 3QPHA 2O03A 2QWWA 3IRQA 2AS5F 5HS9A 4EJOA 1SD6A 1WWXA 4RB0A 4CYDA 1G3SA 1NHAA 4L9NA 1MGTA 2AXLA 2BE5F 5JFRA 3FOFA 4IPAA 2ESHA 2Z33A 3E5UA 2DO7A 3Q9SA 3S2WA 3CUQC 5EEGA 3K1MA 1E2XA 1R1UA 1BN5A 4XLPF 5D5XB 1YYVA 2RC4A 2PMHA 2CYYA 1TTYA 3TKYA 1FBQA 2NNYA 4M6YA 2JTVA 4YIFA 2H6CA 2F5EA 2Z9OA 2BYVE 3QRFF 1LDDA 4YFNF 1I50A 4WXHA 1P92A 2FF4A 2O61A 3F8CA 2HEOA 3L2CA 3ZMUA 4O5VA 5FD5A 5E1ZB 1K78B 3M8FA 1YFHA 4JBAA 1GXQA 3FM3A 1XSVA 4P96A 2LF8A 4P9UA 2RH6A 4HV6A 4BKWA 4CGZA 2ZNZA 5JFEA 4LG0B 4WF2A 1O25A 3G3ZA 4EGYA 2CG4A 4MGRA 1J2XA 3K0LA 2DI3A 1XGMA 2RQPA 3HHHA 3C1DA 3DEUA 1ZRCA 2CW0F 4U7DA 5K5QA 2A6EF 1FOKA 1KYWA 2M30A 3ELKA 1TWGA 4LB6B 1ZBSA 5EGHA 2XAFA 1EH7A 1K7AA 1SFEA 4LLLA 4BYYA 1P2FA 4HZFA 1ZLKA 3DF8A 4UNOA 4AD9A 3BJOA 4DQ2A 3KLNA 3DQVC 2KIMA 3BOQA 4L5IA 4KMAA 4G0VA 3I71A 2HQNA 2WWYA 5D4RA 4LG0A 4I0AA 3H92A 3I58A 2M8EA 2ESNA 3ABUA 1AWCA 3BY6A 2OBPA 2OQGA 2ZO4A 4AIKA 2B0LA 4XLNF 2CGPA 4KM8A 3M8EA 3WTSC 2ZMEB 1XGSA 2A69F 3RDIA 1D5VA 1P4AA 5LRSA 3E6BA 1FSEA 1XD7A 1O2BA 1O3SA 3HRUA 4ZYGA 3VOEA 2Y75A 1P4WA 2XAHA 4EQQA 1BOAA 4HDUA 1IXSB 3F3XA 3OV8A 2H27A 1U6GA 5DD4A 1EH8A 3WODF 1QPMA 1UHWA 1RZ4A 2EFOA 2EK5A 3FF5A 5DCMA 4XSXF 2EFPA 2XGXA 1LQ1A 2BBYA 3WTWC 3LA7A 5AIPA 4WCGA 3RKWA 4LD5A 3ERED 4Q4ZF 1U5TB 4B09A 1IAWA 1R22A 3JSPA 1F9NA 1IN7A 2L54A 2EFWA 4ON0A 3EYIA 1KA8A 2O3FA 4AWXB 1R7JA 1JXSA 1TNTA 2IW5A 3GWZA 3AH5A 4GFQA 1U78A 4OMZA 3IWFA 4IXAA 2CSOA 1FPQA 1SMTA 2XKOA 3PQJA 3I64A 3SZTA 3HYIA 1XCVA 1WQ2A 1Z9CA 3C7JA 1ZXOA 4WXCA 1YQAA 2FE3A 1KYZA 2RVCA 5ERIA 2GSOA 4WK8F 4PGHA 5JR3A 3E6MA 2VC0A 3RJPA 2W57A 2VOOA 2QVOA 4P5BA 5CVVA 4U88A 2JSCA 3IKVA 4C2MC 1S8NA 3ZQ7A 2IT0A 1H0MA 3MQ0A 3R0JA 1W5TA 4A0XA 1J59A 3FZVA 3P7NA 1LJ9A 2C6YA 4U0VA 3I0TA 1W5SA 3ZN1A 2IPQX 3MFKA 5IOTA 3LAPA 1P6RA 3JAMZ 3HRTA 4KATA 3JW4A 3AQPA 2PI0A 2EA2A 2FBHA 1WCMA 2DW4A 3F8BA 1R1VA 4EJVA 3RPQA 4F7ZA 1ON1A 2JA5A 1T98A 2L3DA 1MZBA 4UV9A 4LFUA 4UUVA 1RUOA 3CAGA 1E17A 1O7FA 4L18B 5L3BA 3FHZA 2CWEA 1HBXG 2R7DA 2PEXA 1F5TA 2CFAB 2FU4A 4M9SA 3KFWX 1SFUA 1O27A 2K02A 2UXNA 4KT5C 3TDUC 4GYGA 3RPUA 5JVTA 1ONVA 5D8KB 3OREA 4Y17A 1XB4A 2M45A 4EM1A 4G94A 1JE8A 3R61A 4I0BA 4KIBA 2GQQA 4GTBA 3E97A 1BC7C 3F8FA 3COAC 2K7LA 3T1BA 1F4KA 4Y13A 4LQYA 3F8NA 3FMQA 1U5TC 1CF7A 1HSTA 1KU3A 2HWVA 1L0OC 3U9GA 3CQZA 4KN7X 3K9TA 2Z3YA 1PP8F 2DK5A 4UVBA 1YTYA 4ILDA 2Q2EA 3RI4A 3V7RA 2IVMA 2X4HA 3BROA 2OZUA 3L4KA 1HW5A 3I54A 4RS8A 2NVXA 4PZJA 4IJAA 1Y0UA 2M87A 1R23A 3BDDA 3GTJA 1ZGAA 4ZH4F 4MEXF 4GO1A 3KLOA 3NEUA 4WWCA 1YS7A 2ELHA 4BHPA 1XXAA 3GFJA 4KFCA 4TV7A 5ED4A 2COMA 3WTTC 4OIQF 1IUYA 1BBYA 2V79A 1ZAOA 2R3SA 4UXNA 5D8LB 2QBYB 1XN7A 4RB1A 4KB4A 3P9KA 2D1HA 3BUEA 1LEAA 3GTOA 4ZYDA 4EVIA 4NB5A 4BXUA 4KNYA 1OYIA 2XUBA 2XAJA 1IRFA 5DCMB 4AVPA 4J3NA 5H6RA 1QGPA 3ROUA 2JA7A 1KU7A 3JSOA 3FMSA 2VBXA 3BP8A 2LF7A 2F2EA 2NS0A 2MA3A 2GZWA 3ZMZA 2DAOA 2PG4A 3B73A 2ZFWA 2CQKA 4R8HA 3VA7A 1MKMA 1SFOA 3JTHA 4IRIA 3GTQA 3GYHX 4P55A 4L9VA 4KIGA 2HFHA 2QZ8A 4C3HC 2P5MA 5DUKA 1JHFA 2XAGA 4UVAA 1PDNC 3H0GA 1STZA 2B63A 4M9XA 3V8KA 4DDQA 3F8MA 1MDMB 2QLZA 3KP7A 1ZARA 3HRMA 5E18F 1UFMA 4YFXF 1V3FA 4KMFA 3EUHA 1TQMA 5DCFA 3NRVA 1IN6A 1FYLA 1ZN2A 2MC3A 1RUNA 3ML6A 2A5YB 1SFXA 4OOIA 3TOBA 1ZG5A 3H3ZA 3LA3A 2MH2A 3L4JA 1ISEA 4LLNA 1U3EM 5CVRA 2P6TA 2F5DA 1O3RA 1YW9A 1K78A 5D5VB 4A5MA 2ZXJA 1O3QA 3RYPA 1WQHA 2IJLA 4P5AA 2QUFA 3LFKA 4FHTA 4A0ZA 3BPVA 3Q9VA 2HR3A 3ZMTA 4OIRF 3LQQA 3V4GA 3N97A 2FBIA 2ZCWA 2UXXA 3SQNA 4LK0F 1YLFA 3W6JB 4BH9A 1I1GA 1W7PD 2IA2A 1YG2A 4KAWX 4AIJA 2VE8A 3NQOA 1ZLJA 2XROA 1GE9A 3WU0A 2PJPA 3AAFA 2CFAA 4NQWA 4UVCA 1B4BA 4IVNA 5HS7A 4D0PA 2MLGA 2PBIA 5LEKA 3WTUC 2VONA 3GFLA 2V1XA 3QOPA 3DPLC 3FWEA 2XHKA 4Q5SF 3GF2A 2Y0MA 2FRHA 4HX4A 5DD8A 3KP4A 4HAMA 3BWGA 4M6XA 1ZG1A 4G0WA 4GXOA 1D3YA 4KARA 3O3KA 4KICA 3QP6A 1SAXA 5JI6A 1O3TA 4KYWA 1XSXA 1Z7UA 3REOA 1B59A 4A0YA 5J8FA 2ZJ2A 5AIQA 4EJTA 2RV8A 1YS6A 2OD5A 2JT1A 2VN2A 1O28A 3F6VA 3IHUA 5E1XA 4ENJA 2VBZA 4S04A 2HKOA 3J80K 3TQNA 1KU9A 5FLXZ 5HDKA 4KA4A 4A6DA 1B6AA 1BC8C 1MJBA 2J5P