3EROA

Crystal structure of staphylococcal nuclease variant delta+phs i72e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of D+PHS I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3eroA00
1EY4A 2F0HA 2RDFA 4ID6A 4K5XA 3DHQA 5J39A 3D6CA 1SNCA 1EQVA 3TP6A 3ITPA 5E1FA 4EQNA 1NUCA 1TQOA 2EYMA 3T16A 5M9OA 3HZXA 4KTAA 4ZQ3A 5F2DA 5HURA 3NK9A 2F0JA 4RKLA 5K5PA 2EY5A 5DEHA 5C6AA 1JOQA 1IHZA 1A3VA 4YIJA 5JOBA 3V2TA 5CV6A 3NQTA 3PMFA 5IGDA 2F3VA 4S3SA 4TRDA 1EY5A 3OMGA 4MIUA 1AEXA 3TP8A 4K8JA 1ENAA 2F0DA 3C1EA 1STGA 3MHBA 3H6MA 1JOKA 3EJIA 5E3FA 4DFAA 2PZTA 5I6YA 4HTHA 4IUNA 3D4DA 5CGKA 1STHA 2F0WA 1SNOA 2F0QA 2PW7A 2EYPA 2KHSA 4EQPA 2RKSA 1KDBA 4KHVA 1SYEA 4HMJA 3TMEA 1U9RA 4QF4A 5IGFA 3SK5A 1F2MA 2F3WA 4WORA 5CV4A 5CV5A 5IGBA 1STNA 1SNQA 1STBA 5C3XA 2F0GA 2LKVA 2F0MA 1STAA 2O4XA 1RKNA 1A2UA 2EY6A 2SOBA 1EYCA 3D8GA 4PMBA 3TP7A 5KRUA 2EYLA 4KY6A 1SYBA 4KD4A 5CV7A 2EY2A 2EYFA 2F0KA 4K2LA 3EROA 1A2TA 2F0FA 2HQEA 3EVQA 3R3OA 4PNYA 3C1FA 3TP5A 3QOJA 4WRDA 3MXPA 3OSOA 2PZWA 5KEEA 4DGZA 1EY9A 5CC4A 2OXPA 3NXWA 3P75A 5JAVA 4EQOA 2EYHA 1ENCA 3LX0A 4ME5A 1KDCA 2KQ3A 4I65A 1SYDA 1KAAA 2F0PA 2EYJA 2M00A 2PZUA 1EYAA 2EY1A 2PW5A 1EZ8A 4IALA 4K14A 4NMZA 4QB4A 2PYKA 3QB3A 3BDCA 4NDXA 4LAAA 4E6IA 5C4HA 2OEOA 2F0NA 2WACA 3ERQA 4K5VA 4N9PA 3T13A 3HEJA 3NUCA 3U9OA 2EXZA 1SNMA 2F0LA 2F0OA 4NP5A 1EYDA 5CV8A 3MZ5A 3D4WA 4KD3A 5NUCA 5CV9A 5ISRA 5EKLA 5EGTA 4RKBA 3E5SA 1NSNS 2RBMA 3SHLA 4HMIA 2EYOA 3MEHA 4KV6A 1SNPA 4OL7A 4IZ8A 1EZ6A 2SNSA 4K6DA 3SXHA 4DU9A 5C3WA 5KGUA 1SYGA 2ENBA 5I9OA 5I9PA 5C4ZA 5CR3A 3S9WA 2F0VA 5IOCA 2QDBA 2SNMA 4R8NA 3MVVA 5KIXA 1SYFA 3SK4A 4PMCA 1SNDA 1A3UA 1EY0A 1A3TA 5J1ZA 4DF7A 5KYLA 1EY7A 2F0UA 5IGGA 1EY8A 4J1MA 5EKKA 4K8IA 1EY6A 3OMCA 4KY5A 3BDLA 2F0EA 1F2YA 4KJNA 4KY7A 4ODGA 1II3A 4NKLA 1F2ZA 5IIFA 5IGCA 5J22A 5IODA 4QMGA 4K2KA 4B9WA 2NUCA 4H7BA 4J6HA 4KJOA 5C5MA 4N9TA 3SK8A 4ZUIA 3SR1A 1KDAA 4F7XA 4F8MA 1JOOA 5KYIA 4K5WA 4EVOA 1JORA 5HGTA 3VA5A 1STYA 3P1HA 4ZUJA 4B9XA 5I6WA 2F0TA 1TT2A 3QOLA 3RUZA 2F0SA 3NHHA 3NP8A 1TR5A 3OWFA 4G57A 2F0IA 2OF1A 5DAUA 5C5LA 1SYCA 3SK6A 1KABA 3DMUA 2PQEA 5IGEA
chains in the Genus database with same CATH superfamily
1HFGA 3AEVA 1B44D 3E9IA 1BCPF 4O42A 2VUMB 4A3EG 4YCVA 5EAYA 3VR4A 3KJOA 1EIGA 3MTSA 2CH4W 4HJAA 1L1OA 2AUKA 5F2DA 5HURA 3PO2H 3NELA 3AU7A 2UUAL 4L8JA 1R9TH 3KF6A 1DGSA 1EY5A 4QCLA 4DV0L 2EJMA 3M4OB 4JK1C 1WFQA 3TP8A 2CWAA 5IP7G 3FKIB 4PZ7A 4A3JB 1X3GA 3HOWB 4BBRB 1KDBA 1SE2A 1HR0Q 1JJ2A 3TBIB 1AZPA 5FKAC 4R4IA 1O7LA 3CC7A 4LFCL 1L1OB 5LMUQ 2QDLA 4AYBE 4JI2L 2B63B 2EYFA 1E7ZA 2HD3A 2VZAA 1I4PA 3TP5A 1G291 3C1FA 4MTKA 1GUNA 3MXPA 3VYUA 5KEEA 3KF6B 5CC4A 3QIAA 4G4KA 4A3DH 1ILPA 3B6YA 4I65A 4QQBX 1QVGA 2M00A 1FR3A 3GTGB 4A3GG 1RTNA 3CP0A 1VQBA 2F0OA 2ICEC 5EBCA 2R6GA 2CCZA 1MKHA 3VDYA 1Q12A 3HGBA 4UP7A 5NUCA 1SEBD 5ISRA 2RCNA 2EYOA 3AFQA 1E2ZA 1S40A 1LLRD 3HOUB 1I4GA 3MVVA 5KIXA 3SK4A 1WTRA 4NW2A 3W2DA 3M9BA 1A3UA 1QCBD 2A1AA 4X3SA 4GN4B 4ODGA 1YJWA 1F2YA 2WINB 4LF6Q 1PRTF 4JBJA 1EIFA 3GV6A 2E74C 1IYJB 2NUCA 3NPPA 4DR7Q 3PO2G 4JW0A 4XDXA 1PH1A 4IPHA 2WKCA 4BXXH 1BOSA 3OW7A 1XYIA 3Q6SA 1TWCH 2EPBA 3FP9A 3VA7A 1N8RC 4G57A 3E0EA 4R1JA 1L0YB 1SROA 1XJVA 2H5XA 2SEBD 3P7JA 3D6CA 3S1MB 1PH4A 2K04A 3E6ZX 4C3HH 1DCZA 5K5PA 1BR9A 4F88A 5CMDA 3PO3G 3DEPA 2D0PA 2F3VA 2HUGA 4JV5Q 2R93B 3CCJA 2KEDA 4X66Q 4A3CG 3PUYA 3QWNA 4K6LA 5IGDA 1TWFB 5C3EH 2B2UC 4A3DG 2D0OA 1QVFA 3BYYB 4TKOB 3K58A 2F0WA 1VQ8A 3MAQA 1L2FA 4RH6A 1A8VA 4A3FH 2UXBQ 2F0GA 4NXNQ 1JWSD 1YVCA 4LUZA 4YY3L 2JA6H 4QIWB 2JA5G 5ELBA 3M7GA 4KKUA 1PV4A 4BY7B 1AE3A 1TWHH 1JWMD 4CGYB 1Q90A 1Y1VB 3HKZB 4IALA 4E6IA 1EIYB 1BNZA 2WACA 4PMWA 4L63B 4JBKA 5TSSA 3MXNA 2YTVA 2EXZA 2E2JB 4MN3A 1EFWA 5IYCH 1CA5A 3TZUA 4XYOA 3PF5A 1WYDA 3J81j 4LWCA 4BXXG 2OQ0A 1TKWB 1HRJA 5IOCA 1EWIA 5GQOA 1VQIA 1K28A 3N6RA 2IY5B 5T1GA 1GHJA 5LMNQ 1F2ZA 4DR4Q 4C1NK 4C3HG 5JPNC 3K5OA 4AQYQ 1J5EQ 3SGIA 1U4LA 4LF7Q 2B2VA 3T1YQ 2IT1A 1RF2D 1X56A 4B9XA 4KHPL 2I5MX 1WOCA 1PZID 4JI8Q 4RAUC 1ICFB 4FP5D 2B29A 2ICIA 1BBWA 1SNCA 1RL2A 2KOLA 3I55A 5C44B 4JI6L 1NUCA 5IP9H 3GTOB 2NBFA 4A3IH 4LFAQ 3MWYW 4A3FG 4Y7NB 1IHZA 3DM1A 1NMFA 3NQTA 3GTQH 3G7LA 5E4WC 2JA6G 1XXGA 4RGNA 3S2DB 1KAWA 1RODA 2WAQG 1E0BA 1SSOA 1RHPA 4DFAA 4P71A 1ZYRC 3EQLC 3J7AF 1X54A 5CGKA 5A35A 2KHSA 4IUVA 1FNVA 1MSGA 3D3RA 5G3LD 4JI4L 5CV5A 2VUMH 1N33L 5C3XA 3CQZH 1BVSA 3GD7A 3ZJYC 2DY8A 1SYBA 5IYCG 2WP8J 5IT9E 1A2TA 1H9RA 1V43A 3GTKB 1TS2A 5M3MB 2K5WA 1EY9A 4KN7C 5EBDA 4ZAIA 1PH5A 3M4OH 3G6EA 2I07B 2E2IH 3A8JE 4LF4Q 4OO1G 1EZ8A 4R4OA 3FKIH 1RCVD 4P2CB 5C4HA 3ERQA 1YBYA 2F0NA 4A3JH 1LTRD 4BBRH 3HOWH 4OX9Q 4DR6L 4IUUA 2NVXB 4RCOA 5EKLA 4GOPC 2RBMA 3M85A 5BN4A 1CZWA 1E1OA 2DNCA 5IWAQ 2B63H 4RHRA 2X6LA 1Q8IA 1JT8A 5FLXE 4ZKBB 4LF9Q 1TS3A 2TMPA 4RFBA 4HIMA 1FVIA 1NMGA 3L0OA 3RLOA 4A3GB 3EN2A 4FO2A 5IGGA 2F0UA 4J1MA 4CKCA 4K8IA 1HZAA 1YNJC 4RKBA 2BCOA 2JA8B 5IIFA 2EJFC 5IP9G 4F87A 1A0IA 3SE0A 4HCSA 4RG1A 4A3IG 1UE6A 1VQAA 2Q8RE 3GTGH 4DK6C 1FNWA 5C5MA 4F7XA 5KYIA 4CHTB 1MIUA 5I6WA 4XIGS 5IY0A 1PH2A 3GTLB 1XNQL 2XIWA 2GN5A 5BR8L 2L11A 1I50B 1O7IA 1R4PB 2K52A 1B7YB 4QB4A 1HNZQ 4JI6Q 1EY4A 2B2YA 2F0HA 3T4AC 1GUSA 3HOUH 2K5HA 4TSSA 1KLUD 4R4QA 3ULJA 4FF3A 2MO0A 2KCMA 3PO2B 2PNHA 5AJ3L 2IX0A 3HZXA 1WTQA 3L9AX 4OIKA 3S24A 2L15A 1YZ6A 2EY5A 2UXCL 2QW7A 1UE5A 2Z6BA 1C4QA 3BS1A 5CORA 2RF4A 3KDFA 2A69D 3AQQA 1VDZA 3U9SA 5COYA 1D5ZC 2Y0SE 1VQ5A 2JEAI 3OWEB 3KYHC 2GA4B 1WI5A 2LS01 1LYLA 3S1QB 1OXVA 5M3FH 2YU9B 4OWXB 1M4VA 2CQOA 4IUNA 3J80i 2Z9HA 4R8IA 2E2HB 4UPAA 3I90A 1J6QA 3BDOA 4DNTB 4LF5L 5JVG3 1D6EC 1BCPC 4A3JG 3PO3B 1H9KA 3S1MH 5KRUA 1IL2A 3CU7A 5IE8A 2HDMA 4I7AA 2KBNA 4JI7L 3EROA 2KCNA 2I5HA 3EVQA 3P20A 2A69C 3KDFB 3I7FA 3C3LA 1IBML 1GUTA 2N55A 5IYDH 2R93H 3PUVA 1NJIC 2RHQB 1QZHA 1EYAA 1TWFH 5AFWA 5FLXL 4DR6Q 2JK8A 4C1NI 3WWVA 2DNEA 4EQ5A 1FL0A 2ATWA 2OTJA 4XT1B 4OO1I 1YNXA 4GN3B 3A7AB 4NP5A 2F0LA 3CC2A 3KOJA 3MXGA 5H1SE 2JA5B 3RN5A 4A75A 2NN6I 3H94A 2VS1A 3SXHA 2ENBA 4POGA 3DWAA 2ZXPA 4DV6L 4R8NA 1YHQA 1SYFA 1IBLQ 3M4YA 4O0AA 3J80E 4PMCA 3RD4A 4JC0A 4FF1A 3I4OA 4BY7H 2YYZA 3G71A 4XQQA 1AN8A 2B2WA 2K5VA 3I91A 1Y1VH 2BDNA 1LACA 5GROA 1PRTD 1TWAH 5ELDA 2AKWB 5M5XB 3Q23A 2N49A 4N9TA 4ZUIA 4M1UB 4DR5Q 2JYOA 4NXMQ 2RSNA 1Y8OB 3JC66 1CUKA 1SYCA 2XRSD 5M3FG 3DEOA 2KUMA 2BOSA 3R8BA 1CQVA 3OTOQ 3JAML 5C6AA 1PVOA 3ZYYX 1NE3A 3TQYA 1PRTC 2OT2A 1GUOA 2DN8A 2PCFB 2QKIC 1Z6HA 2AMCB 2K03A 2OTLA 3CC4A 1EUJA 1AEXA 1PYBA 2ZTEA 3IKJA 1GKHA 5I2XA 1G91A 4PV1C 1JB7A 5IYDG 2IHEA 2AWNA 2K14A 2LSSA 4CKEA 2XRQD 3WOFA 1UE7A 1PFNA 2K33A 4XQNA 1NAPA 3EIVA 1XX8A 3L2PA 3ERSX 1Q7YC 4JCVE 2O5IC 1SFOB 2A6ED 4LW1A 3A54A 5C44H 3K8AA 2JA6B 3KLSX 1NTGA 4DAYA 2F1MA 4Y7NH 1UWVA 2WAQB 1LT6D 1QZGA 2ES2A 4B08A 5M5WB 1EOVA 1E2WA 4GLAC 4IQZA 3KLSA 3S2DH 2EYHA 4HIDA 1B4OA 5E4XA 1XTCD 1UNSA 4XTCS 4BY1G 4BY7G 1SN8A 1U4MA 1DONA 4DR1Q 4YHHQ 4IO9A 2OQKA 3PIOA 5FO7B 4IFDI 1Y1VG 2ZXOA 3HKZG 4RGOS 2IWHA 4DV5L 2NVYB 4K0KQ 1ONLA 5JJKA 5DM73 3MEHA 4DAYB 4IZ8A 3E9HA 4B3SL 2SNSA 2VQEL 2KA7A 2FMMA 5I9OA 4B3TQ 4GKJQ 3GTKH 5M3MH 3M4PA 3SVMA 2ZJQA 4JI5Q 4IURA 5E7NA 1LO5D 2VQFQ 4B3RQ 3C46A 4IN3A 2I5LX 2PMZB 1ESRA 4QMGA 3ULLA 3J7A5 3PQIA 4QUCA 1IBKL 1SE3A 1SMYD 1VQMA 3F1ZA 2VW9A 3ND8A 3HOYG 3S1RH 2NVXH 3CCLA 1OXSC 4B3ML 3S14B 1TT2A 4YWKA 2K32A 3MA2B 2FMCA 4IJHA 4P72A 4QY7A 2V1CC 2RDFA 4DV1Q 3RR5A 2QGQA 5M5YH 3CCQA 2EIFA 4A3GH 1NR2A 3Q0AA 4FXGC 5M9OA 4DAVA 3GTQB 2JA8H 1KRSA 1G8ZD 3J81i 1HJPA 1SMYC 4O1NA 1AZQA 1ASZA 2N78A 4A76A 3GTLH 2PZTA 3I4MB 1I50H 1IYUA 1HUNA 1HNXQ 1SNOA 3HKZE 2HIVA 1DZ1A 2EVBA 2K28A 2IW3A 3K5LA 3FDTA 1Q82C 3CQZB 2QEXA 1SNQA 3DUZA 2EY6A 3D8GA 3W1BA 1VQ6A 1EOTA 1EWCA 1I94Q 3BZCA 1NR4A 1GM5A 2F0FA 5CBAE 1YJNA 3EBEA 2ALYB 2PZWA 2JP1A 4P75A 1BF4A 3P75A 2E2IB 3FEWX 1PH6A 1K0SA 2O5JC 5M3MG 5D3DA 1SRUA 3S1QH 1QWYA 2YU9H 2YTYA 2HCIA 2UXDL 1KNEA 2E2HH 4IUPA 3TSSA 1EYDA 5FOBB 1KC8C 3PO3H 4LUOA 4V0BA 3SDZA 3T1HQ 2NVTH 3K7UC 1E3PA 4A3CH 2KVMA 3Q8DA 1BBUA 2K5QA 4A3MB 2MP1A 4LFBQ 1DOKA 4LF8Q 3K81C 4H13C 5ELNA 2KECA 4LUVA 1EY7A 4TVAB 2EQSA 3BDLA 5IGCA 5EPKA 1II3A 1U4PA 1JB3A 3OOCA 2CH4A 1QG7A 3BJUA 5KNBA 3F2CA 2B2VC 1ICWA 4ME3A 4OGQC 3SK8A 3CMAA 2JA8G 4F8MA 2JA5H 2LMCB 4UAIA 1STYA 2NTSA 2KENA 3TS2A 3H3VC 1K0RA 3A5UA 2Z6KA 1X3PA 3S2HB 1Y8PB 2H1EA 3MC0B 1HH2P 4JPBW 2R7ZG 4OWWB 5J39A 1ET6A 4RA8A 2A73B 3ER0A 3QJYA 4DV7L 4FXDA 2F0JA 1WCMB 4X65L 3FHWA 5M5XH 3OW2A 1CQFA 1V1PB 5M3FB 1F77A 1G2SA 1EQTA 1I5FA 2R61A 1C8CA 1UUPA 1VQGA 3TZDA 1NCVA 2PW7A 2D9UA 4L5TA 5C0XJ 3T53B 2UUAQ 2WFWA 1IXRA 3NEMA 5JJLA 5FJ8H 4DN4M 2EYLA 4GKKL 4DV0Q 2PI2A 1VQKA 1GUGA 3PCOB 3R3OA 1O80A 1EQQA 4QJFA 4DV3L 4BA1I 1B1ZA 5JAVA 4DPGA 1EYGA 2L1BA 1G51A 1LTGD 4ME5A 1KDCA 2K1BA 4DA2A 1SYDA 5I4DA 2F0PA 1X65A 3PIPA 4WJ4A 2Z4IA 1HHVA 3OYYA 4YWMA 4LFCQ 2XN9C 3MFGA 5DLQE 4GLXA 3IAYA 4JI2Q 1P8LA 1X3EA 4ZRZA 3RZDB 2CWPA 2XGTA 3PSIA 4DXGA 3H15A 1KIXA 1SFOH 2UU9L 4Z9CB 2IL8A 3STBD 1PMRA 5D3IB 4DV4L 1K83B 4IPDA 4C2MH 4HJ9A 1PHJA 4RWSC 4BY1B 5M5WH 1SJHD 1WTXA 4JI0L 3UE1A 2ZM6L 1T9HA 2PNRC 3TS0A 4BBSB 1TWAB 4HAEA 3PUWA 2AQ3B 4X64L 2D62A 4B9WA 2HQLA 2A6HD 1KDAA 4EVOA 1N36L 3HG9A 1YEZA 1VQCA 2NVYH 3AYHB 3CKIB 3MEFA 2WB1G 3ICEA 2B2YC 1HFNA 4DR3L 4A3LH 1Q81C 1F2LA 4OELB 4OO1H 3BU2A 4WJ3M 4JI3L 2D5DA 3VR6A 4ZCKA 5EQ0A 4DV7Q 2UUCL 3DM3A 4ZK9B 1PFMA 4KMUC 4X3KA 3M3YB 2NN6H 4KTAA 3HOYB 5ELEA 4J8QA 3CXCA 2VY3A 4RCNA 4MNOA 2C5CA 1PTOH 5FJ8G 2A6HC 2R92H 1PYSB 1S5DD 3RLFA 1TY2A 4MIUA 1E1TA 4FYDA 1B9MA 4BA2I 3S14H 3MHBA 1JOKA 3S17H 1GD7A 1U0LA 3A7LA 3PIO3 2JSOA 3KBXA 1U9RA 4ULLA 4CJ2C 1PH7A 4GKKQ 1V8QA 5IGBA 4HCEA 2LKVA 2N3SA 3WOEA 3U4ZA 4OWTB 3K80C 4CJ0B 4DV3Q 3UDXA 1N32L 2F0KA 2XTIA 1UAPA 2KHJA 1T5EA 1VQPA 4DV2L 1I4RA 4DGZA 3QR8A 2NTTA 4MZ9A 5FLXc 5GAGC 3LX0A 5I2YA 2Z8LA 1XMOL 2JA7G 1B53A 2QA4A 3I4MH 1JC7A 1K8GA 3S16B 4JBMA 4YY3Q 4K5VA 2KCCA 1XPUA 1JMCA 1TWGB 1SNMA 1PDQA 4DK0A 4X62L 4POFA 4R4CA 3E5SA 1Y1WH 1XMQL 3W1GA 3IFDA 1SNPA 3NSWA 4DU9A 4DAMA 5KGUA 2PQAA 3S15B 2KHIA 3S9WA 2RSOA 2QDBA 4GNXC 3RNUA 2B2WC 3QG1A 1SNDA 4A3LG 1M1KC 1UEBA 4U673 1EY8A 1SDFA 3K5MA 4KJNA 1TVXA 2L5TA 5IODA 1K3RA 2NN6G 3S1RB 1AE2A 2R92G 2F0TA 3CCRA 1PH3A 2E2DC 5ELOA 3CCEA 1IKMA 1C9OA 2LY7A 2PQAB 4IFDH 2B2UA 3CRKC 4A3MH 5M5YB 3RZOB 1Q1BA 3JAMc 3TP6A 2NB0A 1GVPA 3T16A 3UI2A 2Q2HA 2E76C 5DEHA 1CHPD 2AUJD 4YIJA 5LL6S 4KHPQ 3UDIA 2WAQE 1ILQA 4TRDA 5C4JB 3URYA 3OMGA 4DKAC 3K57A 2R7ZB 3CCVA 3H6MA 1XNRL 1S3OA 3FRPB 4DUZL 2K7VA 1N34L 3S2HH 4G7HC 1Y8NB 2EYPA 2K4KA 1CSPA 4QF4A 2IPKD 3I4MG 1DXMA 2K75A 2Q2IA 2QF7A 4U68A 2SOBA 4OXPA 1NY4A 2G9HD 4UP9A 1W3SA 2VB2X 1VQLA 2K50A 1S5CD 2EY2A 3E3XA 1Y1WG 1WCMH 2HQEA 1SBBB 1VMPA 1WTVA 4MHEA 2L9HA 1VQHA 2FJ2A 1X6OA 5IT9L 4JI4Q 2EY1A 4XXEA 1I3QB 4JOIC 1N33Q 4RMFA 4QL5A 2OEOA 3O13A 4DNRB 2C35B 1LT4D 3DXJC 4GS3A 1EU4A 5EGTA 1NSNS 2NVTB 3AB9A 1L0WA 4K6DA 3CCSA 1S5BD 3FPUB 2NWGA 4LJZC 2BDOA 1GUWA 5JEAH 2QCPX 4JI1L 3F8TA 3TEHB 1D1IA 3HRZC 1A3TA 4IFDG 4A3MG 4XT3B 2Q2UA 1EY6A 1JQYD 1X32A 2CW0D 5CBEE 3CHBD 5FK9C 4J6HA 5EPLA 1JOOA 4HIOA 4K5WA 3RZDH 3VA5A 2E5LL 4H44C 2UUBL 1QUQA 1V1OA 3NHHA 1LABA 1I4XA 3SK6A 3DMUA 1K83H 1FGBD 2F4VL 3KK7A 4ID6A 4BY1H 3DLLA 3BVZA 1EQVA 1JR0D 1EWHA 4CBVA 1ZKOA 2EE1A 4V190 4EGVA 1HNWL 2XWJB 2QILA 4BBSH 4ILWA 1I6VC 5JOBA 4IUTA 4IUQA 1XNQQ 2WB1B 5BR8Q 3K7AB 1VQNA 4YCWA 2DUDA 1WCMG 3G6JB 3PIP3 2R7FA 1SJED 5I6YA 1CFMA 1QUQB 2IHFA 1DYQA 1EQRA 3D4DA 1TS4A 2A68D 1LV9A 3LWUA 2F3IA 4C3JB 1I4HA 3FPPA 5AJ3Q 1SYEA 1AP0A 1B3QA 1L1OC 3H0GB 1MBYA 2UXCQ 2F3WA 4FXKC 3K59A 1LT3D 4APVA 3KFUA 2JQOA 1VQOA 4P73A 3M3YH 2A8VA 3HOYH 4AIMA 3NE5B 4EX5A 1K8MA 1YIJA 4K2LA 5EPJA 1OTCA 4A93B 4PNYA 1HTLD 3NTKA 2HHHL 2EOTA 4CJ1B 2F4IA 2X6GA 1X55A 3NXWA 1F9QA 2KQ3A 4Q0FA 1K8AC 4KKSA 5JEAG 4JYAL 1ESFA 4LF5Q 1KRTA 3A74A 1LTBD 3LGJA 4X3UA 4NMZA 3QB3A 5JJZA 3BDCA 4NDXA 1Z7TA 2J0TD 4UDUC 4RGMA 3U58A 1CKNA 1F9SA 1PXUA 1CHQD 3D4WA 4JI7Q 1HZ9A 2VNUD 5GADC 1IBMQ 4C2MB 4HSPA 3DWQA 3CCUA 2HCCA 1FNUA 2Q2TA 2JA7B 5I9PA 1BQQT 3A8IE 4A3KB 4DR2L 2N8NA 1DOLA 2XSCA 4DF7A 3HS0C 3MFYA 5LHY1 3S16H 3J80L 2AQ2B 4CKBA 4BBSG 4H7BA 2EJGC 5KNCA 2L0CA 1CKNB 1TWGH 4O2DA 2A6EC 1IKLA 5LL6X 1SLJA 1PZKD 4L6TB 2Z6KC 4DV6Q 1RTOA 4JG2A 1G2TA 1GHKA 3TN2A 1LTLA 4QGUA 2F0IA 4RGTA 1KABA 1ML0D 5T1IA 4RHSA 1IW7D 3S15H 4P74A 2WIIB 2RA4A 2GVAA 1PH9A 4HJ7A 1OXUA 1E22A 1X3FA 5JPMC 2ID0A 2BH8A 1HR0L 2A19A 3H91A 1GO3E 1PTOB 2X69A 2R92B 2PO4A 1VF5C 2EDGA 2Y0SB 4XQJA 2ZJPA 4OEMB 5LMUL 4KLKA 3I73A 3IL8A 4C56C 5D65A 3TDQA 2L12A 1FD7D 3GTPB 3S17B 1STGA 2MUYA 2DJFC 4L5SA 1MJCA 2QEJC 1DJRD 1YI2A 3A56A 4NPSA 3Q22A 4HEDA 2HDLA 2YV5A 3IRBA 3GDEA 5BN3A 3MXUA 1I6HH 3RZOH 1KTKA 1RJTA 4ZKCB 2AHOB 1BCPB 4X6AH 5CV7A 3E0JA 3GP7A 4QIWE 1KD1C 1PZJD 2SDFA 1C48A 3D0FA 2PI2E 5C4JH 3T56B 1N9WA 1PTOF 1JJGA 2R7ZH 2DY7A 1KAAA 3RMHA 2PZUA 5D14A 1PFBA 3NWSA 1T5XD 5JJIA 1MHWC 2MPMA 3HEJA 2E75C 3D6WA 4M8AA 2JN4A 1Y1WB 5CV9A 4LF6L 3T51B 5C4XB 1Q46A 4KV6A 4DR7L 1EZ6A 5C3WA 1SYGA 5C4ZA 1ASYA 2OWOA 1H95A 4KI0A 2E8GA 1XPOA 2P5ZX 4DUYL 1JJCB 3J7YW 2MGSA 1PA6A 1A15A 2WV6D 2XWBB 2MJ8A 1E2VA 3X3NA 1VQ4A 5EKKA 3OMCA 2JEBI 4R9WA 1XPRA 1B9NA 4DV5Q 4LNQA 3A55A 1I3QH 5EJWA 1I4QA 1TU2B 4B3SQ 2NYZD 1CI3M 3H09A 2VQEQ 1Q3LA 1AFPA 3J81E 1BKBA 1UE1A 3BZKA 1YITA 3OWFA 4JV5L 1UEAB 2K5NA 2PQEA 2K6AA 5IYBG 4X66L 3HOVB 3LNNA 1EEID 1DOMA 3GTJB 1OXTA 1IBKQ 2H4OA 1W6JA 4L5QA 4RKLA 2KCTA 4HIKA 2MFIA 4B3MQ 3V2TA 1QB5D 1F9RA 2UXBL 4NXNL 3HP3A 1MD2D 1BXTA 2J7ZA 1V1PA 2J4XA 1BO0A 1CKOA 1PRTB 4WFN3 5FO8B 5C0XG 1IL8A 1Y69U 1J8IA 2D2CC 3AFPA 5CV4A 1MGSA 2I46A 4FNFA 4JVZA 1EYCA 4PMBA 1Z47A 2MO1A 1FJGL 1E24A 1JORA 3TRZA 3K7AH 2OXPA 5ELFA 1A63A 1H9SA 1WD1A 2FFKB 3KLWA 2PW5A 5KNDA 3RN2A 1P16A 2B8GA 4C3JH 1RIPA 3PGZA 1B2TA 3ONAB 1RDPD 2B2TA 3H0GH 3I4NH 1Q8KA 5CV8A 3HOZH 2WKDA 5LMNL 1ZXTA 4DR4L 2C9OA 4OIJA 3RLNA 2ZXRA 3SHLA 2Z4HA 4HMIA 4AQYL 1J5EL 3W5OA 1SE4A 4DUYQ 1MSHA 2KJXA 3CPWA 1EL0A 4LF7L 5LMNW 1VQJA 3T1YL 4GN5A 1TIID 4A93H 2K05A 1GXDC 3CD6A 5L37A 3J81L 1KHIA 2UXDQ 4JI8L 5KYLA 1VQ7A 4G7OC 1M90C 1H9SB 4KY5A 4KY7A 1TXYA 1RD9D 2NZHA 2BA1A 3H3VI 3ULPA 1KL9A 1QOHA 4LFAL 1FGUA 2Z0SA 4CDDC 3F2BA 5J3BA 1CT1D 2F0SA 5IGEA 1O78A 1V9PA 4HJ8A 2JA7H 1BBXC 1L0XB 1SR3A 2IX1A 3K5NA 1HUMA 4A3KH 1D2BA 5E1FA 1QILA 4CDCC 1WD0A 2EYMA 1WTWA 2ASBA 1WTOA 4H0LC 4LK1C 3BVMA 4KKTA 2ZTCA 1STEA 3PMFA 3CF5A 1D5MC 2NVQB 1CK1A 1IYVA 3GO5A 2ZT9C 1HTPA 4K8JA 3C1EA 3EJIA 3STBC 1QE6A 2LXJA 1G6PA 3GQBA 2JA9A 4KHVA 5C0XI 2L55A 2CFMA 3GTMH 1FJGQ 4LF4L 1F2MA 1HQRD 4C3JG 4A3BB 1STNA 1ET9A 2F0MA 2O4XA 1A2UA 4X65Q 3I4NG 3H0GG 1BDOA 5CYUA 2N88A 3HOZG 4OX9L 1EFID 4PZ8A 3FVQA 4WJWA 2MNAA 1AH9A 3I3CA 4WRDA 5IT9c 4Y52H 1H9JA 4EQOA 2R7DA 1ENCA 2LXKA 5IWAL 4A93G 3GTPH 4LF9L 5FO9B 4K14A 2PYKA 4DK3C 4UP8A 2OCEA 1Q86C 3S1NB 1HQMC 4IPGA 4N9PA 3U9OA 1LTAD 3A0JA 4DAPA 5FLMH 3MXNB 4C3IB 3NTIA 4AYBB 1WTHA 3OIQA 1WJJA 3I70A 4PG3A 1B3AA 1YJ9A 2VB3X 1ZYRD 4J15A 1PYWD 3CAMA 3J7ZC 1IZ6A 1TS5A 1KXLA 5C3EG 1X3QA 1A6XA 1EY0A 3PUXA 1HNZL 5DM63 4A3KG 3HOXB 4NKLA 2UU9Q 3D31A 4GLVB 2BA0A 2F03A 4DV4Q 4XYQA 4PQXA 3V96A 5GAHC 2WB1E 4HJ5A 1WVLA 5C4XH 1EU3A 4JI0Q 3M4QA 2ZM6Q 5DAUA 2OF1A 4A3EB 5J22A 1C0AA 3R93A 2B3GA 1H9MA 3G48A 3TREA 3I2ZA 5A2QE 4FVMA 4X3TA 1B8AA 1QVCA 4X64Q 3J7AV 3M7NA 5HGQA 3CPFA 4HSVA 1N36Q 4KN4C 1SXTA 1Z9FA 3X3MA 5CV6A 4I7ZC 2ZTDA 1QNUA 4DR3Q 1U5KA 3KJPA 3VYTA 2Y0SG 1ENAA 5E3FA 4JI3Q 3HKSA 2UUCQ 2TSSA 1YNJD 4DNIA 1I6HB 4YWLA 5GAEC 3HOVH 3N52A 3R2TA 3KUPA 3OHXC 4MTNA 3SEBA 1RKNA 3TP7A 3GTJH 1NNXA 1K8OA 5FLMG 1G6ZA 3I56A 2CVRA 4A4IA 1MJEA 2B8FA 2IJ0A 3EA6A 3QOJA 1DD2A 1SMXA 3FMCA 3VR3A 2EXDA 1ZEQX 1C7YA 4R4TA 1PTOD 3JAMi 3LWEA 2EYJA 4EQNA 1IBLL 2MQHA 4LAAA 4HN7A 2PPBC 2CHBD 2R3ZA 2RDGA 3L7ZC 1N32Q 1KNAA 3L3OC 4DV2Q 5DNFA 1VQEA 1LTSD 2JJQA 3HFZB 1VF7A 3PF4A 2FHTA 5C4XG 1XMOQ 4DR5L 5CR3A 2SNMA 4NXML 3U4VA 1QJOA 3W3AA 2NZ1D 3QO2A 3VR2A 2HT1A 1BCPD 3V05A 2F52A 2O2LD 1PTOC 3J80c 1TY0A 2VL6A 4X62Q 1KLGD 3GV3A 2EZVA 2VUMG 1XMQQ 5A2QL 2PMZE 1CM9A 1R9TB 1YNND 2G5DA 3BVGA 4KJOA 4OONA 4FF4A 4UY8C 3SR1A 3OTOL 4JBWA 1GOZA 5HGTA 4ZUJA 4IPCA 1VQFA 4PZ6A 1Y14B 3CRLC 1JCKB 2A74C 2RQXA 3BYTB 3JAME 4K5XA 1F9PA 3DHQA 3A8KE 3KBGA 2AWOA 3FKIG 3ITPA 5HY6A 2MHVA 3HOVG 1YHBA 3HOWG 4BBRG 1HCZA 4IOCA 1M8AA 1A3VA 3KF8A 3PUZA 4BWGB 1V1QA 1YNNC 2M9VA 2NZOA 1HA5A 2K01A 3I8ZA 4LMQD 4S3SA 3UDFA 2GVBA 4DXFA 3AMUA 4A3DB 2RCFA 1BUVT 2B63G 1O7ZA 3I4LA 2F0DA 4HTHA 4FF2A 4N8FA 3EFXD 1STHA 2LFNA 4EQPA 1VMCA 4OHJA 4HMJA 2YTXA 2DJGC 2Q8TA 5IGFA 1D7QA 4WORA 2XNAC 2Z1CA 2G9DA 1STAA 4DR1L 4YHHL 1O7YA 2CW0C 2BE5D 2CQAA 4KK7A 1W6KA 4H02A 4ZYSA 3F2UA 2JXMB 4KD4A 1B70B 1HPCA 3KF8B 4K0KL 1CZGA 3OSOA 1XNRQ 3K6OA 4DUZQ 3CMEA 1N34Q 1DM0B 2NVQH 2B39A 1K73C 1K9MC 4GNXA 2K5DA 3R2IA 4B3TL 4GKJL 3OPOA 3HOUG 1OO9B 2V4DA 3NWTA 4HR7B 4KHZA 3I4NB 4JI5L 3T13A 3HOZB 3NUCA 2AQ1B 1VS0A 3NBIA 2VQFL 1JE4A 4B3RL 4KD3A 4NB3A 4IFDJ 2E2JH 4A3BH 2L4NA 1TWCB 2BE5C 1PH8A 4GOPA 1OXXK 5EKIA 1LT5D 4CDFC 1S4ZA 3U50C 3NBHA 1A62A 1XTDA 3CCMA 1HZBA 4C3HB 5J1ZA 1ENFA 4GNXB 1PLFA 4CDEC 2A68C 2IX3A 3BG3A 2F0EA 4DV1L 1QNKA 4K2KA 3S1NH 1XWEA 3VR5A 1EEFD 4ZLTF 4C3IH 5C3EB 4JI1Q 2DGYA 3NP8A 4GOPB 1S72A 1GJXA 4IJLA 2R93G 1MI2A 4QUFA 3NBHB 2CKZB 4A3FB 1CSQA 1W2BA 1PFSA 3NTHA 1HA6A 1LM0A 1HNXL 1TQOA 1D1KA 3ND9A 1R4QB 4ZQ3A 2Q8IB 3GTOH 3NK9A 3HOXH 1B50A 1JOQA 1NBWA 2E5LQ 2UUBQ 1JE5A 3Q24A 1TWHB 3VYSA 1I94L 2F4VQ 5K36H 1JWUD 3G4SA 1LUZA 2F0QA 3CW2C 4A3EH 3GTMB 4IOAA 3KLRA 2RKSA 5G3LF 5BN5A 3UE0A 4UHVA 3H3VH 1HNWQ 3TMEA 4JOIA 3SK5A 4DK1A 1CKMA 1VQDA 1X9NA 1WTPA 1YHAA 1U4RA 1STBA 5JEAJ 1LTTD 3PV0A 1CTMA 1FYCA 4TQUS 4KY6A 5ELCA 2A5HA 4AH6A 4A3BG 1AW7A 1JICA 1HXYD 2RHSB 3BZDB 1HR0W 1SE8A 5IP7H 3UDGA 3T1HL 1SAPA 5IYBH 2FXQA 4GZYC 5JVH3 3OIPA 4FDBA 1KQSA 2XVSA 4Q5VA 4LFBL 4LF8L 1Q1EA 1J9OA 1HZCA 3K0XA 1IW7C 2B2TC 2FINB 2JE6I 3WDNA 1K3BC 3D4RA 4N8X1 2VXWA 4G7ZC 3MZ5A 3K0YA 2HHHQ 2M2LA 4OL7A 3I72A 1D8LA 2KEEA 4ALPA 1EIHA 4C3IG 3J81c 1LTID 4AYBG 4JYAQ 1VCIA 3A5ZB 2F0VA 5C0XH 1VQ9A 3C2PA 3NQIA 2RDHA 1S5ED 2ZJRA 4A3IB 3NENA 2I0QA 4ABNA 5C44G 3HOXG 1S5FD 4BS9A 3VYRA 3DWPA 3F2DA 2RVLA 3P1HA 3QOLA 3IFTA 4YCUA 4DR2Q 2BH2A 1D5XC 3RUZA 1TR5A 4L5RC 2HIXA 5K36G 5C5LA 1CA6A
chains in the Genus database with same CATH topology
1HFGA 1B44D 1BCPF 4O42A 2VUMB 3VR4A 1EIGA 3MTSA 2AUKA 5F2DA 5HURA 3AU7A 4L8JA 1EY5A 4QCLA 2EJMA 3M4OB 4JK1C 3TP8A 3FKIB 4A3JB 3HOWB 4BBRB 1KDBA 1SE2A 3TBIB 1AZPA 5FKAC 1O7LA 2B63B 2EYFA 1I4PA 3TP5A 1G291 3C1FA 1GUNA 3MXPA 3VYUA 5KEEA 5CC4A 3QIAA 4G4KA 1ILPA 4I65A 2M00A 1FR3A 3GTGB 1RTNA 2ICEC 2F0OA 5EBCA 2R6GA 1Q12A 3HGBA 5NUCA 1SEBD 5ISRA 2EYOA 1E2ZA 1LLRD 3HOUB 1I4GA 3MVVA 5KIXA 3SK4A 1WTRA 4NW2A 3W2DA 1A3UA 1QCBD 4X3SA 4ODGA 1F2YA 2WINB 1PRTF 3GV6A 2E74C 2NUCA 3NPPA 4XDXA 2WKCA 1BOSA 3OW7A 1XYIA 2EPBA 3Q6SA 3VA7A 4G57A 1L0YB 2SEBD 3P7JA 3D6CA 3S1MB 2K04A 3E6ZX 1DCZA 5K5PA 1BR9A 4F88A 5CMDA 3DEPA 2F3VA 2HUGA 2R93B 2KEDA 3PUYA 3QWNA 4K6LA 5IGDA 1TWFB 2B2UC 3BYYB 4TKOB 3K58A 2F0WA 3MAQA 4RH6A 2F0GA 1JWSD 4QIWB 5ELBA 3M7GA 4KKUA 4BY7B 1JWMD 4CGYB 1Q90A 1Y1VB 3HKZB 4IALA 4E6IA 1BNZA 2WACA 4PMWA 4L63B 5TSSA 3MXNA 2EXZA 2E2JB 4MN3A 1CA5A 3TZUA 4XYOA 1TKWB 1HRJA 5IOCA 3N6RA 5T1GA 1GHJA 1F2ZA 4C1NK 4C3HG 5JPNC 3K5OA 1U4LA 2B2VA 2IT1A 1RF2D 4B9XA 1PZID 4RAUC 4FP5D 2ICIA 1SNCA 2KOLA 5C44B 3GTOB 1NUCA 2NBFA 3MWYW 4Y7NB 1IHZA 3DM1A 3NQTA 3G7LA 5E4WC 1XXGA 4RGNA 3S2DB 1RODA 1E0BA 1SSOA 1RHPA 4DFAA 1ZYRC 3EQLC 3J7AF 5CGKA 5A35A 2KHSA 4IUVA 1FNVA 1MSGA 3D3RA 5G3LD 5CV5A 5C3XA 3GD7A 2DY8A 1SYBA 2WP8J 5IT9E 1A2TA 1H9RA 1V43A 3GTKB 1TS2A 5M3MB 2K5WA 1EY9A 4KN7C 5EBDA 4ZAIA 2I07B 3A8JE 4OO1G 1EZ8A 1RCVD 4P2CB 5C4HA 3ERQA 2F0NA 1LTRD 4IUUA 2NVXB 4RCOA 5EKLA 2RBMA 3M85A 5BN4A 1CZWA 2DNCA 4RHRA 2X6LA 1Q8IA 5FLXE 4ZKBB 1TS3A 2TMPA 4RFBA 4A3GB 4FO2A 5IGGA 2F0UA 4J1MA 4CKCA 4K8IA 1YNJC 4RKBA 2BCOA 2JA8B 5IIFA 2EJFC 4F87A 3SE0A 4HCSA 2Q8RE 1FNWA 5C5MA 4F7XA 5KYIA 4CHTB 5I6WA 4XIGS 3GTLB 2XIWA 2L11A 1I50B 1R4PB 4QB4A 1EY4A 2B2YA 2F0HA 3T4AC 1GUSA 4TSSA 1KLUD 4FF3A 3PO2B 2IX0A 3HZXA 1WTQA 3L9AX 4OIKA 2EY5A 1C4QA 3BS1A 5CORA 3U9SA 2A69D 1VDZA 2JEAI 5COYA 1D5ZC 3OWEB 2GA4B 2LS01 3S1QB 1OXVA 2YU9B 1M4VA 4IUNA 4R8IA 2E2HB 3I90A 3BDOA 4DNTB 5JVG3 1D6EC 1BCPC 3PO3B 1H9KA 5KRUA 3CU7A 2HDMA 3EROA 2KCNA 3EVQA 3P20A 2A69C 3C3LA 1GUTA 2N55A 3PUVA 1EYAA 5AFWA 5FLXL 4C1NI 2DNEA 4XT1B 4OO1I 3A7AB 4NP5A 2F0LA 2JA5B 3MXGA 2NN6I 3H94A 3SXHA 2ENBA 3DWAA 2ZXPA 4R8NA 1SYFA 3M4YA 3J80E 4PMCA 3RD4A 4FF1A 2YYZA 4XQQA 1AN8A 2B2WA 3I91A 2BDNA 1LACA 1PRTD 5ELDA 5M5XB 3Q23A 4N9TA 4ZUIA 4M1UB 2JYOA 2RSNA 1Y8OB 1SYCA 2XRSD 3DEOA 2KUMA 2BOSA 3R8BA 1CQVA 3JAML 5C6AA 3ZYYX 1PRTC 2OT2A 1GUOA 2DN8A 2PCFB 2QKIC 1Z6HA 2K03A 1AEXA 3IKJA 5I2XA 1G91A 4PV1C 2AWNA 4CKEA 2XRQD 3WOFA 1PFNA 2K33A 4XQNA 1NAPA 1XX8A 2O5IC 1SFOB 2A6ED 3A54A 2JA6B 3KLSX 4DAYA 2F1MA 2WAQB 1LT6D 4B08A 5M5WB 1E2WA 4IQZA 3KLSA 2EYHA 1B4OA 5E4XA 1XTCD 1UNSA 4XTCS 1U4MA 1DONA 5FO7B 4IFDI 2ZXOA 4RGOS 2IWHA 2NVYB 1ONLA 5DM73 3MEHA 4IZ8A 2SNSA 2KA7A 2FMMA 5I9OA 3SVMA 4IURA 1LO5D 3C46A 4IN3A 2PMZB 1ESRA 4QMGA 4QUCA 1SE3A 1SMYD 3ND8A 3S14B 1OXSC 1TT2A 2K32A 3MA2B 2FMCA 2RDFA 1NR2A 3Q0AA 4FXGC 5M9OA 4DAVA 3GTQB 1G8ZD 1SMYC 4O1NA 1AZQA 2PZTA 3I4MB 1IYUA 1HUNA 1SNOA 1DZ1A 2EVBA 2K28A 2IW3A 3K5LA 3FDTA 3CQZB 1SNQA 3DUZA 2EY6A 3D8GA 1EOTA 1EWCA 1NR4A 2F0FA 5CBAE 2PZWA 2JP1A 1BF4A 3P75A 2E2IB 3FEWX 2O5JC 5D3DA 1QWYA 2HCIA 1KNEA 4IUPA 3TSSA 1EYDA 5FOBB 4V0BA 3SDZA 2KVMA 2K5QA 4A3MB 2MP1A 1DOKA 4H13C 2KECA 1EY7A 3BDLA 5IGCA 5EPKA 1II3A 1U4PA 1JB3A 3OOCA 1QG7A 5KNBA 2B2VC 1ICWA 3SK8A 4OGQC 4F8MA 2LMCB 4UAIA 1STYA 2NTSA 3H3VC 1X3PA 3S2HB 1Y8PB 2H1EA 3MC0B 5J39A 1ET6A 4RA8A 2A73B 3QJYA 4FXDA 2F0JA 1WCMB 1CQFA 1V1PB 5M3FB 1F77A 1G2SA 1EQTA 2R61A 1C8CA 1UUPA 3TZDA 1NCVA 2PW7A 2D9UA 5C0XJ 3T53B 4DN4M 2EYLA 1GUGA 3R3OA 1O80A 4BA1I 1B1ZA 5JAVA 2L1BA 1LTGD 4ME5A 1KDCA 2K1BA 4DA2A 1SYDA 5I4DA 2F0PA 2Z4IA 1HHVA 2XN9C 3MFGA 3IAYA 4ZRZA 3RZDB 4DXGA 4Z9CB 2IL8A 1PMRA 5D3IB 1K83B 4RWSC 4BY1B 1SJHD 1WTXA 2PNRC 4BBSB 1TWAB 4HAEA 3PUWA 2AQ3B 2D62A 4B9WA 2A6HD 1KDAA 4EVOA 3HG9A 3CKIB 2B2YC 1HFNA 1F2LA 4OO1H 3VR6A 2D5DA 5EQ0A 4ZK9B 1PFMA 4KMUC 4X3KA 3M3YB 2NN6H 4KTAA 3HOYB 5ELEA 4J8QA 4RCNA 2C5CA 1PTOH 2A6HC 1S5DD 3RLFA 1TY2A 4MIUA 4FYDA 1B9MA 4BA2I 3MHBA 1JOKA 3A7LA 3PIO3 2JSOA 3KBXA 1U9RA 4ULLA 4CJ2C 1V8QA 5IGBA 4HCEA 2LKVA 3WOEA 4CJ0B 2F0KA 1UAPA 1T5EA 1I4RA 4DGZA 2NTTA 3LX0A 5I2YA 2Z8LA 1B53A 1JC7A 3S16B 4K5VA 2KCCA 1TWGB 1SNMA 1PDQA 4DK0A 3E5SA 3IFDA 1SNPA 3NSWA 4DU9A 5KGUA 3S15B 3S9WA 2RSOA 2QDBA 2B2WC 3QG1A 1SNDA 4U673 1EY8A 1SDFA 3K5MA 4KJNA 1TVXA 2L5TA 5IODA 2NN6G 3S1RB 2F0TA 2E2DC 1IKMA 2LY7A 4IFDH 2B2UA 3CRKC 5M5YB 3RZOB 1Q1BA 3TP6A 2NB0A 3T16A 3UI2A 2E76C 5DEHA 1CHPD 2AUJD 4YIJA 5LL6S 1ILQA 4TRDA 5C4JB 3URYA 3OMGA 2R7ZB 3K57A 3H6MA 3FRPB 2K7VA 4G7HC 1Y8NB 2EYPA 4QF4A 2IPKD 1DXMA 2QF7A 4U68A 2SOBA 2G9HD 2VB2X 1S5CD 2EY2A 2HQEA 1SBBB 1VMPA 1WTVA 4MHEA 2L9HA 2FJ2A 5IT9L 2EY1A 4XXEA 1I3QB 2OEOA 3O13A 4DNRB 1LT4D 3DXJC 1EU4A 5EGTA 1NSNS 2NVTB 3AB9A 4K6DA 1S5BD 3FPUB 2NWGA 4LJZC 2BDOA 1GUWA 5JEAH 2QCPX 1D1IA 3HRZC 1A3TA 4IFDG 4XT3B 1EY6A 1JQYD 1X32A 2CW0D 5CBEE 3CHBD 5FK9C 4J6HA 5EPLA 1JOOA 4K5WA 3VA5A 4H44C 1V1OA 3NHHA 1LABA 1I4XA 3SK6A 3DMUA 1FGBD 3KK7A 4ID6A 3BVZA 1EQVA 1JR0D 1EWHA 4CBVA 1ZKOA 2EE1A 4V190 4EGVA 2XWJB 2QILA 4ILWA 1I6VC 5JOBA 4IUTA 4IUQA 2WB1B 3K7AB 3G6JB 3PIP3 1SJED 5I6YA 1CFMA 1DYQA 1TS4A 2A68D 3D4DA 1LV9A 3LWUA 4C3JB 1I4HA 3FPPA 1SYEA 1AP0A 3H0GB 1MBYA 2F3WA 4FXKC 3K59A 1LT3D 3NE5B 1K8MA 4K2LA 5EPJA 4A93B 4PNYA 1HTLD 3NTKA 2EOTA 4CJ1B 2F4IA 2X6GA 3NXWA 1F9QA 2KQ3A 4Q0FA 4KKSA 5JEAG 1ESFA 4X3UA 1LTBD 4NMZA 3QB3A 5JJZA 3BDCA 4NDXA 1Z7TA 2J0TD 4UDUC 4RGMA 1F9SA 1PXUA 1CHQD 3D4WA 2VNUD 4C2MB 4HSPA 3DWQA 2HCCA 1FNUA 2JA7B 5I9PA 1BQQT 3A8IE 4A3KB 1DOLA 2XSCA 4DF7A 3HS0C 3MFYA 5LHY1 3J80L 2AQ2B 4CKBA 4H7BA 2EJGC 5KNCA 2L0CA 2A6EC 1IKLA 5LL6X 1PZKD 4L6TB 1RTOA 1G2TA 1GHKA 3TN2A 2F0IA 4RGTA 1KABA 1ML0D 5T1IA 4RHSA 1IW7D 2WIIB 2RA4A 1OXUA 5JPMC 2ID0A 3H91A 1PTOB 2X69A 2R92B 2PO4A 1VF5C 2EDGA 2Y0SB 4XQJA 3I73A 3IL8A 4C56C 5D65A 3TDQA 2L12A 1FD7D 3GTPB 3S17B 1STGA 2MUYA 2QEJC 1DJRD 3A56A 3Q22A 4HEDA 2HDLA 5BN3A 3MXUA 1KTKA 1RJTA 4ZKCB 1BCPB 5CV7A 3E0JA 3GP7A 1PZJD 2SDFA 1C48A 3T56B 1PTOF 2DY7A 1KAAA 3RMHA 2PZUA 5D14A 1PFBA 3NWSA 1T5XD 2MPMA 3HEJA 2E75C 3D6WA 4M8AA 1Y1WB 5CV9A 3T51B 5C4XB 4KV6A 1EZ6A 5C3WA 1SYGA 5C4ZA 4KI0A 3J7YW 2MGSA 1A15A 2WV6D 2XWBB 2MJ8A 1E2VA 3X3NA 5EKKA 3OMCA 2JEBI 4R9WA 1B9NA 3A55A 5EJWA 1I4QA 1TU2B 2NYZD 1CI3M 3H09A 1Q3LA 1AFPA 3J81E 3OWFA 1UEAB 2PQEA 2K6AA 3HOVB 3LNNA 1EEID 1DOMA 3GTJB 1OXTA 2H4OA 1W6JA 4RKLA 3V2TA 1QB5D 1F9RA 3HP3A 1MD2D 1BXTA 2J7ZA 1V1PA 2J4XA 1BO0A 1PRTB 4WFN3 5FO8B 5C0XG 1IL8A 1Y69U 1J8IA 2D2CC 5CV4A 1MGSA 2I46A 4FNFA 1EYCA 4PMBA 1Z47A 1JORA 2OXPA 5ELFA 1H9SA 1WD1A 2FFKB 2PW5A 5KNDA 2B8GA 1B2TA 1RDPD 3ONAB 2B2TA 5CV8A 2WKDA 1ZXTA 2C9OA 4OIJA 3SHLA 2ZXRA 2Z4HA 4HMIA 1SE4A 1MSHA 2KJXA 1EL0A 1TIID 2K05A 1GXDC 3J81L 5KYLA 4G7OC 1H9SB 4KY5A 4KY7A 1RD9D 2BA1A 1QOHA 1CT1D 2F0SA 5IGEA 1O78A 1BBXC 1L0XB 2IX1A 3K5NA 1HUMA 1D2BA 5E1FA 1QILA 1WD0A 2EYMA 1WTWA 1WTOA 4H0LC 4LK1C 3BVMA 4KKTA 1STEA 3PMFA 1D5MC 2NVQB 1CK1A 1IYVA 3GO5A 2ZT9C 1HTPA 4K8JA 3C1EA 3EJIA 1QE6A 3GQBA 4KHVA 5C0XI 2L55A 1F2MA 1HQRD 4C3JG 4A3BB 1STNA 1ET9A 2F0MA 2O4XA 1A2UA 1BDOA 5CYUA 2N88A 1EFID 3FVQA 4WJWA 3I3CA 4WRDA 1H9JA 4EQOA 1ENCA 5FO9B 4K14A 2PYKA 3S1NB 1HQMC 4N9PA 3U9OA 1LTAD 4DAPA 4C3IB 3NTIA 4AYBB 3OIQA 3I70A 1B3AA 2VB3X 1ZYRD 1PYWD 1TS5A 1X3QA 1A6XA 1EY0A 3PUXA 5DM63 3HOXB 4NKLA 3D31A 2BA0A 2F03A 4XYQA 4PQXA 3V96A 1WVLA 1EU3A 5DAUA 2OF1A 4A3EB 5J22A 3R93A 1H9MA 5A2QE 4FVMA 4X3TA 3J7AV 3M7NA 4HSVA 4KN4C 1SXTA 3X3MA 5CV6A 4I7ZC 1QNUA 3VYTA 1ENAA 5E3FA 2TSSA 1YNJD 1I6HB 3N52A 3R2TA 3KUPA 3OHXC 3SEBA 1RKNA 3TP7A 1K8OA 1G6ZA 2CVRA 2B8FA 2IJ0A 3EA6A 3QOJA 1DD2A 3FMCA 3VR3A 1ZEQX 1PTOD 3LWEA 2EYJA 4EQNA 4LAAA 4HN7A 2PPBC 2CHBD 2R3ZA 2RDGA 3L7ZC 1KNAA 3L3OC 5DNFA 1LTSD 1VF7A 2FHTA 5CR3A 2SNMA 1QJOA 3W3AA 2NZ1D 3QO2A 3VR2A 1BCPD 3V05A 2O2LD 1PTOC 1TY0A 1KLGD 3GV3A 2EZVA 5A2QL 1CM9A 1R9TB 1YNND 3BVGA 4KJOA 4FF4A 3SR1A 4JBWA 1GOZA 5HGTA 4ZUJA 3CRLC 1JCKB 2A74C 2RQXA 3BYTB 3JAME 4K5XA 1F9PA 3DHQA 3A8KE 2AWOA 3KBGA 3ITPA 2MHVA 1HCZA 1M8AA 1A3VA 3KF8A 3PUZA 4BWGB 1YNNC 4LMQD 2M9VA 3I8ZA 1HA5A 2K01A 4S3SA 4DXFA 3AMUA 4A3DB 1BUVT 1O7ZA 3I4LA 2F0DA 4HTHA 4FF2A 3EFXD 1STHA 2LFNA 4EQPA 1VMCA 4OHJA 4HMJA 2Q8TA 5IGFA 4WORA 2XNAC 2Z1CA 2G9DA 1STAA 1O7YA 2CW0C 2BE5D 2CQAA 4KK7A 1W6KA 4ZYSA 3F2UA 2JXMB 4KD4A 1HPCA 1CZGA 3OSOA 3K6OA 1DM0B 2B39A 2K5DA 3R2IA 3OPOA 1OO9B 2V4DA 3NWTA 4HR7B 4KHZA 3I4NB 3T13A 3HOZB 3NUCA 2AQ1B 3NBIA 1JE4A 4KD3A 4IFDJ 2L4NA 1TWCB 2BE5C 1OXXK 5EKIA 1LT5D 1S4ZA 3NBHA 4C3HB 5J1ZA 1ENFA 1PLFA 2A68C 2IX3A 3BG3A 2F0EA 1QNKA 4K2KA 1XWEA 3VR5A 1EEFD 4ZLTF 5C3EB 3NP8A 1GJXA 1MI2A 4QUFA 4A3FB 3NTHA 1HA6A 1TQOA 1D1KA 4ZQ3A 2Q8IB 1R4QB 3ND9A 3NK9A 1B50A 1JOQA 3Q24A 1TWHB 3VYSA 5K36H 1JWUD 2F0QA 3GTMB 3KLRA 2RKSA 5G3LF 5BN5A 3TMEA 3SK5A 4DK1A 1WTPA 1U4RA 1STBA 5JEAJ 1LTTD 3PV0A 1CTMA 1FYCA 4TQUS 4KY6A 5ELCA 2A5HA 1AW7A 1JICA 1HXYD 3BZDB 1SAPA 4GZYC 5JVH3 3OIPA 2XVSA 4Q5VA 1Q1EA 1J9OA 1IW7C 2B2TC 2FINB 2JE6I 3WDNA 3D4RA 2VXWA 4G7ZC 3MZ5A 3K0YA 2M2LA 4OL7A 3I72A 2KEEA 1EIHA 4C3IG 1LTID 1VCIA 2F0VA 5C0XH 3C2PA 3NQIA 2RDHA 1S5ED 4A3IB 4ABNA 1S5FD 4BS9A 3VYRA 3DWPA 2RVLA 3P1HA 3QOLA 3IFTA 1D5XC 3RUZA 1TR5A 5K36G 5C5LA 1CA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY4 A;  2F0H A;  2RDF A;  4ID6 A;  4K5X A;  3DHQ A;  5J39 A;  3D6C A;  1SNC A;  1EQV A;  3TP6 A;  3ITP A;  5E1F A;  4EQN A;  1NUC A;  1TQO A;  2EYM A;  3T16 A;  5M9O A;  3HZX A;  4KTA A;  4ZQ3 A;  5F2D A;  5HUR A;  3NK9 A;  2F0J A;  4RKL A;  5K5P A;  2EY5 A;  5DEH A;  5C6A A;  1JOQ A;  1IHZ A;  1A3V A;  4YIJ A;  5JOB A;  3V2T A;  5CV6 A;  3NQT A;  3PMF A;  5IGD A;  2F3V A;  4S3S A;  4TRD A;  1EY5 A;  3OMG A;  4MIU A;  1AEX A;  3TP8 A;  4K8J A;  1ENA A;  2F0D A;  3C1E A;  1STG A;  3MHB A;  3H6M A;  1JOK A;  3EJI A;  5E3F A;  4DFA A;  2PZT A;  5I6Y A;  4HTH A;  4IUN A;  3D4D A;  5CGK A;  1STH A;  2F0W A;  1SNO A;  2F0Q A;  2PW7 A;  2EYP A;  2KHS A;  4EQP A;  2RKS A;  1KDB A;  4KHV A;  1SYE A;  4HMJ A;  3TME A;  1U9R A;  4QF4 A;  5IGF A;  3SK5 A;  1F2M A;  2F3W A;  4WOR A;  5CV4 A;  5CV5 A;  5IGB A;  1STN A;  1SNQ A;  1STB A;  5C3X A;  2F0G A;  2LKV A;  2F0M A;  1STA A;  2O4X A;  1RKN A;  1A2U A;  2EY6 A;  2SOB A;  1EYC A;  3D8G A;  4PMB A;  3TP7 A;  5KRU A;  2EYL A;  4KY6 A;  1SYB A;  4KD4 A;  5CV7 A;  2EY2 A;  2EYF A;  2F0K A;  4K2L A;  3ERO A;  1A2T A;  2F0F A;  2HQE A;  3EVQ A;  3R3O A;  4PNY A;  3C1F A;  3TP5 A;  3QOJ A;  4WRD A;  3MXP A;  3OSO A;  2PZW A;  5KEE A;  4DGZ A;  1EY9 A;  5CC4 A;  2OXP A;  3NXW A;  3P75 A;  5JAV A;  4EQO A;  2EYH A;  1ENC A;  3LX0 A;  4ME5 A;  1KDC A;  2KQ3 A;  4I65 A;  1SYD A;  1KAA A;  2F0P A;  2EYJ A;  2M00 A;  2PZU A;  1EYA A;  2EY1 A;  2PW5 A;  1EZ8 A;  4IAL A;  4K14 A;  4NMZ A;  4QB4 A;  2PYK A;  3QB3 A;  3BDC A;  4NDX A;  4LAA A;  4E6I A;  5C4H A;  2OEO A;  2F0N A;  2WAC A;  3ERQ A;  4K5V A;  4N9P A;  3T13 A;  3HEJ A;  3NUC A;  3U9O A;  2EXZ A;  1SNM A;  2F0L A;  2F0O A;  4NP5 A;  1EYD A;  5CV8 A;  3MZ5 A;  3D4W A;  4KD3 A;  5NUC A;  5CV9 A;  5ISR A;  5EKL A;  5EGT A;  4RKB A;  3E5S A;  1NSN S;  2RBM A;  3SHL A;  4HMI A;  2EYO A;  3MEH A;  4KV6 A;  1SNP A;  4OL7 A;  4IZ8 A;  1EZ6 A;  2SNS A;  4K6D A;  3SXH A;  4DU9 A;  5C3W A;  5KGU A;  1SYG A;  2ENB A;  5I9O A;  5I9P A;  5C4Z A;  5CR3 A;  3S9W A;  2F0V A;  5IOC A;  2QDB A;  2SNM A;  4R8N A;  3MVV A;  5KIX A;  1SYF A;  3SK4 A;  4PMC A;  1SND A;  1A3U A;  1EY0 A;  1A3T A;  5J1Z A;  4DF7 A;  5KYL A;  1EY7 A;  2F0U A;  5IGG A;  1EY8 A;  4J1M A;  5EKK A;  4K8I A;  1EY6 A;  3OMC A;  4KY5 A;  3BDL A;  2F0E A;  1F2Y A;  4KJN A;  4KY7 A;  4ODG A;  1II3 A;  4NKL A;  1F2Z A;  5IIF A;  5IGC A;  5J22 A;  5IOD A;  4QMG A;  4K2K A;  4B9W A;  2NUC A;  4H7B A;  4J6H A;  4KJO A;  5C5M A;  4N9T A;  3SK8 A;  4ZUI A;  3SR1 A;  1KDA A;  4F7X A;  4F8M A;  1JOO A;  5KYI A;  4K5W A;  4EVO A;  1JOR A;  5HGT A;  3VA5 A;  1STY A;  3P1H A;  4ZUJ A;  4B9X A;  5I6W A;  2F0T A;  1TT2 A;  3QOL A;  3RUZ A;  2F0S A;  3NHH A;  3NP8 A;  1TR5 A;  3OWF A;  4G57 A;  2F0I A;  2OF1 A;  5DAU A;  5C5L A;  1SYC A;  3SK6 A;  1KAB A;  3DMU A;  2PQE A;  5IGE A; 
#chains in the Genus database with same CATH topology
 1HFG A;  3AEV A;  1B44 D;  3E9I A;  1BCP F;  4O42 A;  2VUM B;  4A3E G;  4YCV A;  5EAY A;  3VR4 A;  3KJO A;  1EIG A;  3MTS A;  2CH4 W;  4HJA A;  1L1O A;  2AUK A;  5F2D A;  5HUR A;  3PO2 H;  3NEL A;  3AU7 A;  2UUA L;  4L8J A;  1R9T H;  3KF6 A;  1DGS A;  1EY5 A;  4QCL A;  4DV0 L;  2EJM A;  3M4O B;  4JK1 C;  1WFQ A;  3TP8 A;  2CWA A;  5IP7 G;  3FKI B;  4PZ7 A;  4A3J B;  1X3G A;  3HOW B;  4BBR B;  1KDB A;  1SE2 A;  1HR0 Q;  1JJ2 A;  3TBI B;  1AZP A;  5FKA C;  4R4I A;  1O7L A;  3CC7 A;  4LFC L;  1L1O B;  5LMU Q;  2QDL A;  4AYB E;  4JI2 L;  2B63 B;  2EYF A;  1E7Z A;  2HD3 A;  2VZA A;  1I4P A;  3TP5 A;  1G29 1;  3C1F A;  4MTK A;  1GUN A;  3MXP A;  3VYU A;  5KEE A;  3KF6 B;  5CC4 A;  3QIA A;  4G4K A;  4A3D H;  1ILP A;  3B6Y A;  4I65 A;  4QQB X;  1QVG A;  2M00 A;  1FR3 A;  3GTG B;  4A3G G;  1RTN A;  3CP0 A;  1VQB A;  2F0O A;  2ICE C;  5EBC A;  2R6G A;  2CCZ A;  1MKH A;  3VDY A;  1Q12 A;  3HGB A;  4UP7 A;  5NUC A;  1SEB D;  5ISR A;  2RCN A;  2EYO A;  3AFQ A;  1E2Z A;  1S40 A;  1LLR D;  3HOU B;  1I4G A;  3MVV A;  5KIX A;  3SK4 A;  1WTR A;  4NW2 A;  3W2D A;  3M9B A;  1A3U A;  1QCB D;  2A1A A;  4X3S A;  4GN4 B;  4ODG A;  1YJW A;  1F2Y A;  2WIN B;  4LF6 Q;  1PRT F;  4JBJ A;  1EIF A;  3GV6 A;  2E74 C;  1IYJ B;  2NUC A;  3NPP A;  4DR7 Q;  3PO2 G;  4JW0 A;  4XDX A;  1PH1 A;  4IPH A;  2WKC A;  4BXX H;  1BOS A;  3OW7 A;  1XYI A;  3Q6S A;  1TWC H;  2EPB A;  3FP9 A;  3VA7 A;  1N8R C;  4G57 A;  3E0E A;  4R1J A;  1L0Y B;  1SRO A;  1XJV A;  2H5X A;  2SEB D;  3P7J A;  3D6C A;  3S1M B;  1PH4 A;  2K04 A;  3E6Z X;  4C3H H;  1DCZ A;  5K5P A;  1BR9 A;  4F88 A;  5CMD A;  3PO3 G;  3DEP A;  2D0P A;  2F3V A;  2HUG A;  4JV5 Q;  2R93 B;  3CCJ A;  2KED A;  4X66 Q;  4A3C G;  3PUY A;  3QWN A;  4K6L A;  5IGD A;  1TWF B;  5C3E H;  2B2U C;  4A3D G;  2D0O A;  1QVF A;  3BYY B;  4TKO B;  3K58 A;  2F0W A;  1VQ8 A;  3MAQ A;  1L2F A;  4RH6 A;  1A8V A;  4A3F H;  2UXB Q;  2F0G A;  4NXN Q;  1JWS D;  1YVC A;  4LUZ A;  4YY3 L;  2JA6 H;  4QIW B;  2JA5 G;  5ELB A;  3M7G A;  4KKU A;  1PV4 A;  4BY7 B;  1AE3 A;  1TWH H;  1JWM D;  4CGY B;  1Q90 A;  1Y1V B;  3HKZ B;  4IAL A;  4E6I A;  1EIY B;  1BNZ A;  2WAC A;  4PMW A;  4L63 B;  4JBK A;  5TSS A;  3MXN A;  2YTV A;  2EXZ A;  2E2J B;  4MN3 A;  1EFW A;  5IYC H;  1CA5 A;  3TZU A;  4XYO A;  3PF5 A;  1WYD A;  3J81 j;  4LWC A;  4BXX G;  2OQ0 A;  1TKW B;  1HRJ A;  5IOC A;  1EWI A;  5GQO A;  1VQI A;  1K28 A;  3N6R A;  2IY5 B;  5T1G A;  1GHJ A;  5LMN Q;  1F2Z A;  4DR4 Q;  4C1N K;  4C3H G;  5JPN C;  3K5O A;  4AQY Q;  1J5E Q;  3SGI A;  1U4L A;  4LF7 Q;  2B2V A;  3T1Y Q;  2IT1 A;  1RF2 D;  1X56 A;  4B9X A;  4KHP L;  2I5M X;  1WOC A;  1PZI D;  4JI8 Q;  4RAU C;  1ICF B;  4FP5 D;  2B29 A;  2ICI A;  1BBW A;  1SNC A;  1RL2 A;  2KOL A;  3I55 A;  5C44 B;  4JI6 L;  1NUC A;  5IP9 H;  3GTO B;  2NBF A;  4A3I H;  4LFA Q;  3MWY W;  4A3F G;  4Y7N B;  1IHZ A;  3DM1 A;  1NMF A;  3NQT A;  3GTQ H;  3G7L A;  5E4W C;  2JA6 G;  1XXG A;  4RGN A;  3S2D B;  1KAW A;  1ROD A;  2WAQ G;  1E0B A;  1SSO A;  1RHP A;  4DFA A;  4P71 A;  1ZYR C;  3EQL C;  3J7A F;  1X54 A;  5CGK A;  5A35 A;  2KHS A;  4IUV A;  1FNV A;  1MSG A;  3D3R A;  5G3L D;  4JI4 L;  5CV5 A;  2VUM H;  1N33 L;  5C3X A;  3CQZ H;  1BVS A;  3GD7 A;  3ZJY C;  2DY8 A;  1SYB A;  5IYC G;  2WP8 J;  5IT9 E;  1A2T A;  1H9R A;  1V43 A;  3GTK B;  1TS2 A;  5M3M B;  2K5W A;  1EY9 A;  4KN7 C;  5EBD A;  4ZAI A;  1PH5 A;  3M4O H;  3G6E A;  2I07 B;  2E2I H;  3A8J E;  4LF4 Q;  4OO1 G;  1EZ8 A;  4R4O A;  3FKI H;  1RCV D;  4P2C B;  5C4H A;  3ERQ A;  1YBY A;  2F0N A;  4A3J H;  1LTR D;  4BBR H;  3HOW H;  4OX9 Q;  4DR6 L;  4IUU A;  2NVX B;  4RCO A;  5EKL A;  4GOP C;  2RBM A;  3M85 A;  5BN4 A;  1CZW A;  1E1O A;  2DNC A;  5IWA Q;  2B63 H;  4RHR A;  2X6L A;  1Q8I A;  1JT8 A;  5FLX E;  4ZKB B;  4LF9 Q;  1TS3 A;  2TMP A;  4RFB A;  4HIM A;  1FVI A;  1NMG A;  3L0O A;  3RLO A;  4A3G B;  3EN2 A;  4FO2 A;  5IGG A;  2F0U A;  4J1M A;  4CKC A;  4K8I A;  1HZA A;  1YNJ C;  4RKB A;  2BCO A;  2JA8 B;  5IIF A;  2EJF C;  5IP9 G;  4F87 A;  1A0I A;  3SE0 A;  4HCS A;  4RG1 A;  4A3I G;  1UE6 A;  1VQA A;  2Q8R E;  3GTG H;  4DK6 C;  1FNW A;  5C5M A;  4F7X A;  5KYI A;  4CHT B;  1MIU A;  5I6W A;  4XIG S;  5IY0 A;  1PH2 A;  3GTL B;  1XNQ L;  2XIW A;  2GN5 A;  5BR8 L;  2L11 A;  1I50 B;  1O7I A;  1R4P B;  2K52 A;  1B7Y B;  4QB4 A;  1HNZ Q;  4JI6 Q;  1EY4 A;  2B2Y A;  2F0H A;  3T4A C;  1GUS A;  3HOU H;  2K5H A;  4TSS A;  1KLU D;  4R4Q A;  3ULJ A;  4FF3 A;  2MO0 A;  2KCM A;  3PO2 B;  2PNH A;  5AJ3 L;  2IX0 A;  3HZX A;  1WTQ A;  3L9A X;  4OIK A;  3S24 A;  2L15 A;  1YZ6 A;  2EY5 A;  2UXC L;  2QW7 A;  1UE5 A;  2Z6B A;  1C4Q A;  3BS1 A;  5COR A;  2RF4 A;  3KDF A;  2A69 D;  3AQQ A;  1VDZ A;  3U9S A;  5COY A;  1D5Z C;  2Y0S E;  1VQ5 A;  2JEA I;  3OWE B;  3KYH C;  2GA4 B;  1WI5 A;  2LS0 1;  1LYL A;  3S1Q B;  1OXV A;  5M3F H;  2YU9 B;  4OWX B;  1M4V A;  2CQO A;  4IUN A;  3J80 i;  2Z9H A;  4R8I A;  2E2H B;  4UPA A;  3I90 A;  1J6Q A;  3BDO A;  4DNT B;  4LF5 L;  5JVG 3;  1D6E C;  1BCP C;  4A3J G;  3PO3 B;  1H9K A;  3S1M H;  5KRU A;  1IL2 A;  3CU7 A;  5IE8 A;  2HDM A;  4I7A A;  2KBN A;  4JI7 L;  3ERO A;  2KCN A;  2I5H A;  3EVQ A;  3P20 A;  2A69 C;  3KDF B;  3I7F A;  3C3L A;  1IBM L;  1GUT A;  2N55 A;  5IYD H;  2R93 H;  3PUV A;  1NJI C;  2RHQ B;  1QZH A;  1EYA A;  1TWF H;  5AFW A;  5FLX L;  4DR6 Q;  2JK8 A;  4C1N I;  3WWV A;  2DNE A;  4EQ5 A;  1FL0 A;  2ATW A;  2OTJ A;  4XT1 B;  4OO1 I;  1YNX A;  4GN3 B;  3A7A B;  4NP5 A;  2F0L A;  3CC2 A;  3KOJ A;  3MXG A;  5H1S E;  2JA5 B;  3RN5 A;  4A75 A;  2NN6 I;  3H94 A;  2VS1 A;  3SXH A;  2ENB A;  4POG A;  3DWA A;  2ZXP A;  4DV6 L;  4R8N A;  1YHQ A;  1SYF A;  1IBL Q;  3M4Y A;  4O0A A;  3J80 E;  4PMC A;  3RD4 A;  4JC0 A;  4FF1 A;  3I4O A;  4BY7 H;  2YYZ A;  3G71 A;  4XQQ A;  1AN8 A;  2B2W A;  2K5V A;  3I91 A;  1Y1V H;  2BDN A;  1LAC A;  5GRO A;  1PRT D;  1TWA H;  5ELD A;  2AKW B;  5M5X B;  3Q23 A;  2N49 A;  4N9T A;  4ZUI A;  4M1U B;  4DR5 Q;  2JYO A;  4NXM Q;  2RSN A;  1Y8O B;  3JC6 6;  1CUK A;  1SYC A;  2XRS D;  5M3F G;  3DEO A;  2KUM A;  2BOS A;  3R8B A;  1CQV A;  3OTO Q;  3JAM L;  5C6A A;  1PVO A;  3ZYY X;  1NE3 A;  3TQY A;  1PRT C;  2OT2 A;  1GUO A;  2DN8 A;  2PCF B;  2QKI C;  1Z6H A;  2AMC B;  2K03 A;  2OTL A;  3CC4 A;  1EUJ A;  1AEX A;  1PYB A;  2ZTE A;  3IKJ A;  1GKH A;  5I2X A;  1G91 A;  4PV1 C;  1JB7 A;  5IYD G;  2IHE A;  2AWN A;  2K14 A;  2LSS A;  4CKE A;  2XRQ D;  3WOF A;  1UE7 A;  1PFN A;  2K33 A;  4XQN A;  1NAP A;  3EIV A;  1XX8 A;  3L2P A;  3ERS X;  1Q7Y C;  4JCV E;  2O5I C;  1SFO B;  2A6E D;  4LW1 A;  3A54 A;  5C44 H;  3K8A A;  2JA6 B;  3KLS X;  1NTG A;  4DAY A;  2F1M A;  4Y7N H;  1UWV A;  2WAQ B;  1LT6 D;  1QZG A;  2ES2 A;  4B08 A;  5M5W B;  1EOV A;  1E2W A;  4GLA C;  4IQZ A;  3KLS A;  3S2D H;  2EYH A;  4HID A;  1B4O A;  5E4X A;  1XTC D;  1UNS A;  4XTC S;  4BY1 G;  4BY7 G;  1SN8 A;  1U4M A;  1DON A;  4DR1 Q;  4YHH Q;  4IO9 A;  2OQK A;  3PIO A;  5FO7 B;  4IFD I;  1Y1V G;  2ZXO A;  3HKZ G;  4RGO S;  2IWH A;  4DV5 L;  2NVY B;  4K0K Q;  1ONL A;  5JJK A;  5DM7 3;  3MEH A;  4DAY B;  4IZ8 A;  3E9H A;  4B3S L;  2SNS A;  2VQE L;  2KA7 A;  2FMM A;  5I9O A;  4B3T Q;  4GKJ Q;  3GTK H;  5M3M H;  3M4P A;  3SVM A;  2ZJQ A;  4JI5 Q;  4IUR A;  5E7N A;  1LO5 D;  2VQF Q;  4B3R Q;  3C46 A;  4IN3 A;  2I5L X;  2PMZ B;  1ESR A;  4QMG A;  3ULL A;  3J7A 5;  3PQI A;  4QUC A;  1IBK L;  1SE3 A;  1SMY D;  1VQM A;  3F1Z A;  2VW9 A;  3ND8 A;  3HOY G;  3S1R H;  2NVX H;  3CCL A;  1OXS C;  4B3M L;  3S14 B;  1TT2 A;  4YWK A;  2K32 A;  3MA2 B;  2FMC A;  4IJH A;  4P72 A;  4QY7 A;  2V1C C;  2RDF A;  4DV1 Q;  3RR5 A;  2QGQ A;  5M5Y H;  3CCQ A;  2EIF A;  4A3G H;  1NR2 A;  3Q0A A;  4FXG C;  5M9O A;  4DAV A;  3GTQ B;  2JA8 H;  1KRS A;  1G8Z D;  3J81 i;  1HJP A;  1SMY C;  4O1N A;  1AZQ A;  1ASZ A;  2N78 A;  4A76 A;  3GTL H;  2PZT A;  3I4M B;  1I50 H;  1IYU A;  1HUN A;  1HNX Q;  1SNO A;  3HKZ E;  2HIV A;  1DZ1 A;  2EVB A;  2K28 A;  2IW3 A;  3K5L A;  3FDT A;  1Q82 C;  3CQZ B;  2QEX A;  1SNQ A;  3DUZ A;  2EY6 A;  3D8G A;  3W1B A;  1VQ6 A;  1EOT A;  1EWC A;  1I94 Q;  3BZC A;  1NR4 A;  1GM5 A;  2F0F A;  5CBA E;  1YJN A;  3EBE A;  2ALY B;  2PZW A;  2JP1 A;  4P75 A;  1BF4 A;  3P75 A;  2E2I B;  3FEW X;  1PH6 A;  1K0S A;  2O5J C;  5M3M G;  5D3D A;  1SRU A;  3S1Q H;  1QWY A;  2YU9 H;  2YTY A;  2HCI A;  2UXD L;  1KNE A;  2E2H H;  4IUP A;  3TSS A;  1EYD A;  5FOB B;  1KC8 C;  3PO3 H;  4LUO A;  4V0B A;  3SDZ A;  3T1H Q;  2NVT H;  3K7U C;  1E3P A;  4A3C H;  2KVM A;  3Q8D A;  1BBU A;  2K5Q A;  4A3M B;  2MP1 A;  4LFB Q;  1DOK A;  4LF8 Q;  3K81 C;  4H13 C;  5ELN A;  2KEC A;  4LUV A;  1EY7 A;  4TVA B;  2EQS A;  3BDL A;  5IGC A;  5EPK A;  1II3 A;  1U4P A;  1JB3 A;  3OOC A;  2CH4 A;  1QG7 A;  3BJU A;  5KNB A;  3F2C A;  2B2V C;  1ICW A;  4ME3 A;  4OGQ C;  3SK8 A;  3CMA A;  2JA8 G;  4F8M A;  2JA5 H;  2LMC B;  4UAI A;  1STY A;  2NTS A;  2KEN A;  3TS2 A;  3H3V C;  1K0R A;  3A5U A;  2Z6K A;  1X3P A;  3S2H B;  1Y8P B;  2H1E A;  3MC0 B;  1HH2 P;  4JPB W;  2R7Z G;  4OWW B;  5J39 A;  1ET6 A;  4RA8 A;  2A73 B;  3ER0 A;  3QJY A;  4DV7 L;  4FXD A;  2F0J A;  1WCM B;  4X65 L;  3FHW A;  5M5X H;  3OW2 A;  1CQF A;  1V1P B;  5M3F B;  1F77 A;  1G2S A;  1EQT A;  1I5F A;  2R61 A;  1C8C A;  1UUP A;  1VQG A;  3TZD A;  1NCV A;  2PW7 A;  2D9U A;  4L5T A;  5C0X J;  3T53 B;  2UUA Q;  2WFW A;  1IXR A;  3NEM A;  5JJL A;  5FJ8 H;  4DN4 M;  2EYL A;  4GKK L;  4DV0 Q;  2PI2 A;  1VQK A;  1GUG A;  3PCO B;  3R3O A;  1O80 A;  1EQQ A;  4QJF A;  4DV3 L;  4BA1 I;  1B1Z A;  5JAV A;  4DPG A;  1EYG A;  2L1B A;  1G51 A;  1LTG D;  4ME5 A;  1KDC A;  2K1B A;  4DA2 A;  1SYD A;  5I4D A;  2F0P A;  1X65 A;  3PIP A;  4WJ4 A;  2Z4I A;  1HHV A;  3OYY A;  4YWM A;  4LFC Q;  2XN9 C;  3MFG A;  5DLQ E;  4GLX A;  3IAY A;  4JI2 Q;  1P8L A;  1X3E A;  4ZRZ A;  3RZD B;  2CWP A;  2XGT A;  3PSI A;  4DXG A;  3H15 A;  1KIX A;  1SFO H;  2UU9 L;  4Z9C B;  2IL8 A;  3STB D;  1PMR A;  5D3I B;  4DV4 L;  1K83 B;  4IPD A;  4C2M H;  4HJ9 A;  1PHJ A;  4RWS C;  4BY1 B;  5M5W H;  1SJH D;  1WTX A;  4JI0 L;  3UE1 A;  2ZM6 L;  1T9H A;  2PNR C;  3TS0 A;  4BBS B;  1TWA B;  4HAE A;  3PUW A;  2AQ3 B;  4X64 L;  2D62 A;  4B9W A;  2HQL A;  2A6H D;  1KDA A;  4EVO A;  1N36 L;  3HG9 A;  1YEZ A;  1VQC A;  2NVY H;  3AYH B;  3CKI B;  3MEF A;  2WB1 G;  3ICE A;  2B2Y C;  1HFN A;  4DR3 L;  4A3L H;  1Q81 C;  1F2L A;  4OEL B;  4OO1 H;  3BU2 A;  4WJ3 M;  4JI3 L;  2D5D A;  3VR6 A;  4ZCK A;  5EQ0 A;  4DV7 Q;  2UUC L;  3DM3 A;  4ZK9 B;  1PFM A;  4KMU C;  4X3K A;  3M3Y B;  2NN6 H;  4KTA A;  3HOY B;  5ELE A;  4J8Q A;  3CXC A;  2VY3 A;  4RCN A;  4MNO A;  2C5C A;  1PTO H;  5FJ8 G;  2A6H C;  2R92 H;  1PYS B;  1S5D D;  3RLF A;  1TY2 A;  4MIU A;  1E1T A;  4FYD A;  1B9M A;  4BA2 I;  3S14 H;  3MHB A;  1JOK A;  3S17 H;  1GD7 A;  1U0L A;  3A7L A;  3PIO 3;  2JSO A;  3KBX A;  1U9R A;  4ULL A;  4CJ2 C;  1PH7 A;  4GKK Q;  1V8Q A;  5IGB A;  4HCE A;  2LKV A;  2N3S A;  3WOE A;  3U4Z A;  4OWT B;  3K80 C;  4CJ0 B;  4DV3 Q;  3UDX A;  1N32 L;  2F0K A;  2XTI A;  1UAP A;  2KHJ A;  1T5E A;  1VQP A;  4DV2 L;  1I4R A;  4DGZ A;  3QR8 A;  2NTT A;  4MZ9 A;  5FLX c;  5GAG C;  3LX0 A;  5I2Y A;  2Z8L A;  1XMO L;  2JA7 G;  1B53 A;  2QA4 A;  3I4M H;  1JC7 A;  1K8G A;  3S16 B;  4JBM A;  4YY3 Q;  4K5V A;  2KCC A;  1XPU A;  1JMC A;  1TWG B;  1SNM A;  1PDQ A;  4DK0 A;  4X62 L;  4POF A;  4R4C A;  3E5S A;  1Y1W H;  1XMQ L;  3W1G A;  3IFD A;  1SNP A;  3NSW A;  4DU9 A;  4DAM A;  5KGU A;  2PQA A;  3S15 B;  2KHI A;  3S9W A;  2RSO A;  2QDB A;  4GNX C;  3RNU A;  2B2W C;  3QG1 A;  1SND A;  4A3L G;  1M1K C;  1UEB A;  4U67 3;  1EY8 A;  1SDF A;  3K5M A;  4KJN A;  1TVX A;  2L5T A;  5IOD A;  1K3R A;  2NN6 G;  3S1R B;  1AE2 A;  2R92 G;  2F0T A;  3CCR A;  1PH3 A;  2E2D C;  5ELO A;  3CCE A;  1IKM A;  1C9O A;  2LY7 A;  2PQA B;  4IFD H;  2B2U A;  3CRK C;  4A3M H;  5M5Y B;  3RZO B;  1Q1B A;  3JAM c;  3TP6 A;  2NB0 A;  1GVP A;  3T16 A;  3UI2 A;  2Q2H A;  2E76 C;  5DEH A;  1CHP D;  2AUJ D;  4YIJ A;  5LL6 S;  4KHP Q;  3UDI A;  2WAQ E;  1ILQ A;  4TRD A;  5C4J B;  3URY A;  3OMG A;  4DKA C;  3K57 A;  2R7Z B;  3CCV A;  3H6M A;  1XNR L;  1S3O A;  3FRP B;  4DUZ L;  2K7V A;  1N34 L;  3S2H H;  4G7H C;  1Y8N B;  2EYP A;  2K4K A;  1CSP A;  4QF4 A;  2IPK D;  3I4M G;  1DXM A;  2K75 A;  2Q2I A;  2QF7 A;  4U68 A;  2SOB A;  4OXP A;  1NY4 A;  2G9H D;  4UP9 A;  1W3S A;  2VB2 X;  1VQL A;  2K50 A;  1S5C D;  2EY2 A;  3E3X A;  1Y1W G;  1WCM H;  2HQE A;  1SBB B;  1VMP A;  1WTV A;  4MHE A;  2L9H A;  1VQH A;  2FJ2 A;  1X6O A;  5IT9 L;  4JI4 Q;  2EY1 A;  4XXE A;  1I3Q B;  4JOI C;  1N33 Q;  4RMF A;  4QL5 A;  2OEO A;  3O13 A;  4DNR B;  2C35 B;  1LT4 D;  3DXJ C;  4GS3 A;  1EU4 A;  5EGT A;  1NSN S;  2NVT B;  3AB9 A;  1L0W A;  4K6D A;  3CCS A;  1S5B D;  3FPU B;  2NWG A;  4LJZ C;  2BDO A;  1GUW A;  5JEA H;  2QCP X;  4JI1 L;  3F8T A;  3TEH B;  1D1I A;  3HRZ C;  1A3T A;  4IFD G;  4A3M G;  4XT3 B;  2Q2U A;  1EY6 A;  1JQY D;  1X32 A;  2CW0 D;  5CBE E;  3CHB D;  5FK9 C;  4J6H A;  5EPL A;  1JOO A;  4HIO A;  4K5W A;  3RZD H;  3VA5 A;  2E5L L;  4H44 C;  2UUB L;  1QUQ A;  1V1O A;  3NHH A;  1LAB A;  1I4X A;  3SK6 A;  3DMU A;  1K83 H;  1FGB D;  2F4V L;  3KK7 A;  4ID6 A;  4BY1 H;  3DLL A;  3BVZ A;  1EQV A;  1JR0 D;  1EWH A;  4CBV A;  1ZKO A;  2EE1 A;  4V19 0;  4EGV A;  1HNW L;  2XWJ B;  2QIL A;  4BBS H;  4ILW A;  1I6V C;  5JOB A;  4IUT A;  4IUQ A;  1XNQ Q;  2WB1 B;  5BR8 Q;  3K7A B;  1VQN A;  4YCW A;  2DUD A;  1WCM G;  3G6J B;  3PIP 3;  2R7F A;  1SJE D;  5I6Y A;  1CFM A;  1QUQ B;  2IHF A;  1DYQ A;  1EQR A;  3D4D A;  1TS4 A;  2A68 D;  1LV9 A;  3LWU A;  2F3I A;  4C3J B;  1I4H A;  3FPP A;  5AJ3 Q;  1SYE A;  1AP0 A;  1B3Q A;  1L1O C;  3H0G B;  1MBY A;  2UXC Q;  2F3W A;  4FXK C;  3K59 A;  1LT3 D;  4APV A;  3KFU A;  2JQO A;  1VQO A;  4P73 A;  3M3Y H;  2A8V A;  3HOY H;  4AIM A;  3NE5 B;  4EX5 A;  1K8M A;  1YIJ A;  4K2L A;  5EPJ A;  1OTC A;  4A93 B;  4PNY A;  1HTL D;  3NTK A;  2HHH L;  2EOT A;  4CJ1 B;  2F4I A;  2X6G A;  1X55 A;  3NXW A;  1F9Q A;  2KQ3 A;  4Q0F A;  1K8A C;  4KKS A;  5JEA G;  4JYA L;  1ESF A;  4LF5 Q;  1KRT A;  3A74 A;  1LTB D;  3LGJ A;  4X3U A;  4NMZ A;  3QB3 A;  5JJZ A;  3BDC A;  4NDX A;  1Z7T A;  2J0T D;  4UDU C;  4RGM A;  3U58 A;  1CKN A;  1F9S A;  1PXU A;  1CHQ D;  3D4W A;  4JI7 Q;  1HZ9 A;  2VNU D;  5GAD C;  1IBM Q;  4C2M B;  4HSP A;  3DWQ A;  3CCU A;  2HCC A;  1FNU A;  2Q2T A;  2JA7 B;  5I9P A;  1BQQ T;  3A8I E;  4A3K B;  4DR2 L;  2N8N A;  1DOL A;  2XSC A;  4DF7 A;  3HS0 C;  3MFY A;  5LHY 1;  3S16 H;  3J80 L;  2AQ2 B;  4CKB A;  4BBS G;  4H7B A;  2EJG C;  5KNC A;  2L0C A;  1CKN B;  1TWG H;  4O2D A;  2A6E C;  1IKL A;  5LL6 X;  1SLJ A;  1PZK D;  4L6T B;  2Z6K C;  4DV6 Q;  1RTO A;  4JG2 A;  1G2T A;  1GHK A;  3TN2 A;  1LTL A;  4QGU A;  2F0I A;  4RGT A;  1KAB A;  1ML0 D;  5T1I A;  4RHS A;  1IW7 D;  3S15 H;  4P74 A;  2WII B;  2RA4 A;  2GVA A;  1PH9 A;  4HJ7 A;  1OXU A;  1E22 A;  1X3F A;  5JPM C;  2ID0 A;  2BH8 A;  1HR0 L;  2A19 A;  3H91 A;  1GO3 E;  1PTO B;  2X69 A;  2R92 B;  2PO4 A;  1VF5 C;  2EDG A;  2Y0S B;  4XQJ A;  2ZJP A;  4OEM B;  5LMU L;  4KLK A;  3I73 A;  3IL8 A;  4C56 C;  5D65 A;  3TDQ A;  2L12 A;  1FD7 D;  3GTP B;  3S17 B;  1STG A;  2MUY A;  2DJF C;  4L5S A;  1MJC A;  2QEJ C;  1DJR D;  1YI2 A;  3A56 A;  4NPS A;  3Q22 A;  4HED A;  2HDL A;  2YV5 A;  3IRB A;  3GDE A;  5BN3 A;  3MXU A;  1I6H H;  3RZO H;  1KTK A;  1RJT A;  4ZKC B;  2AHO B;  1BCP B;  4X6A H;  5CV7 A;  3E0J A;  3GP7 A;  4QIW E;  1KD1 C;  1PZJ D;  2SDF A;  1C48 A;  3D0F A;  2PI2 E;  5C4J H;  3T56 B;  1N9W A;  1PTO F;  1JJG A;  2R7Z H;  2DY7 A;  1KAA A;  3RMH A;  2PZU A;  5D14 A;  1PFB A;  3NWS A;  1T5X D;  5JJI A;  1MHW C;  2MPM A;  3HEJ A;  2E75 C;  3D6W A;  4M8A A;  2JN4 A;  1Y1W B;  5CV9 A;  4LF6 L;  3T51 B;  5C4X B;  1Q46 A;  4KV6 A;  4DR7 L;  1EZ6 A;  5C3W A;  1SYG A;  5C4Z A;  1ASY A;  2OWO A;  1H95 A;  4KI0 A;  2E8G A;  1XPO A;  2P5Z X;  4DUY L;  1JJC B;  3J7Y W;  2MGS A;  1PA6 A;  1A15 A;  2WV6 D;  2XWB B;  2MJ8 A;  1E2V A;  3X3N A;  1VQ4 A;  5EKK A;  3OMC A;  2JEB I;  4R9W A;  1XPR A;  1B9N A;  4DV5 Q;  4LNQ A;  3A55 A;  1I3Q H;  5EJW A;  1I4Q A;  1TU2 B;  4B3S Q;  2NYZ D;  1CI3 M;  3H09 A;  2VQE Q;  1Q3L A;  1AFP A;  3J81 E;  1BKB A;  1UE1 A;  3BZK A;  1YIT A;  3OWF A;  4JV5 L;  1UEA B;  2K5N A;  2PQE A;  2K6A A;  5IYB G;  4X66 L;  3HOV B;  3LNN A;  1EEI D;  1DOM A;  3GTJ B;  1OXT A;  1IBK Q;  2H4O A;  1W6J A;  4L5Q A;  4RKL A;  2KCT A;  4HIK A;  2MFI A;  4B3M Q;  3V2T A;  1QB5 D;  1F9R A;  2UXB L;  4NXN L;  3HP3 A;  1MD2 D;  1BXT A;  2J7Z A;  1V1P A;  2J4X A;  1BO0 A;  1CKO A;  1PRT B;  4WFN 3;  5FO8 B;  5C0X G;  1IL8 A;  1Y69 U;  1J8I A;  2D2C C;  3AFP A;  5CV4 A;  1MGS A;  2I46 A;  4FNF A;  4JVZ A;  1EYC A;  4PMB A;  1Z47 A;  2MO1 A;  1FJG L;  1E24 A;  1JOR A;  3TRZ A;  3K7A H;  2OXP A;  5ELF A;  1A63 A;  1H9S A;  1WD1 A;  2FFK B;  3KLW A;  2PW5 A;  5KND A;  3RN2 A;  1P16 A;  2B8G A;  4C3J H;  1RIP A;  3PGZ A;  1B2T A;  3ONA B;  1RDP D;  2B2T A;  3H0G H;  3I4N H;  1Q8K A;  5CV8 A;  3HOZ H;  2WKD A;  5LMN L;  1ZXT A;  4DR4 L;  2C9O A;  4OIJ A;  3RLN A;  2ZXR A;  3SHL A;  2Z4H A;  4HMI A;  4AQY L;  1J5E L;  3W5O A;  1SE4 A;  4DUY Q;  1MSH A;  2KJX A;  3CPW A;  1EL0 A;  4LF7 L;  5LMN W;  1VQJ A;  3T1Y L;  4GN5 A;  1TII D;  4A93 H;  2K05 A;  1GXD C;  3CD6 A;  5L37 A;  3J81 L;  1KHI A;  2UXD Q;  4JI8 L;  5KYL A;  1VQ7 A;  4G7O C;  1M90 C;  1H9S B;  4KY5 A;  4KY7 A;  1TXY A;  1RD9 D;  2NZH A;  2BA1 A;  3H3V I;  3ULP A;  1KL9 A;  1QOH A;  4LFA L;  1FGU A;  2Z0S A;  4CDD C;  3F2B A;  5J3B A;  1CT1 D;  2F0S A;  5IGE A;  1O78 A;  1V9P A;  4HJ8 A;  2JA7 H;  1BBX C;  1L0X B;  1SR3 A;  2IX1 A;  3K5N A;  1HUM A;  4A3K H;  1D2B A;  5E1F A;  1QIL A;  4CDC C;  1WD0 A;  2EYM A;  1WTW A;  2ASB A;  1WTO A;  4H0L C;  4LK1 C;  3BVM A;  4KKT A;  2ZTC A;  1STE A;  3PMF A;  3CF5 A;  1D5M C;  2NVQ B;  1CK1 A;  1IYV A;  3GO5 A;  2ZT9 C;  1HTP A;  4K8J A;  3C1E A;  3EJI A;  3STB C;  1QE6 A;  2LXJ A;  1G6P A;  3GQB A;  2JA9 A;  4KHV A;  5C0X I;  2L55 A;  2CFM A;  3GTM H;  1FJG Q;  4LF4 L;  1F2M A;  1HQR D;  4C3J G;  4A3B B;  1STN A;  1ET9 A;  2F0M A;  2O4X A;  1A2U A;  4X65 Q;  3I4N G;  3H0G G;  1BDO A;  5CYU A;  2N88 A;  3HOZ G;  4OX9 L;  1EFI D;  4PZ8 A;  3FVQ A;  4WJW A;  2MNA A;  1AH9 A;  3I3C A;  4WRD A;  5IT9 c;  4Y52 H;  1H9J A;  4EQO A;  2R7D A;  1ENC A;  2LXK A;  5IWA L;  4A93 G;  3GTP H;  4LF9 L;  5FO9 B;  4K14 A;  2PYK A;  4DK3 C;  4UP8 A;  2OCE A;  1Q86 C;  3S1N B;  1HQM C;  4IPG A;  4N9P A;  3U9O A;  1LTA D;  3A0J A;  4DAP A;  5FLM H;  3MXN B;  4C3I B;  3NTI A;  4AYB B;  1WTH A;  3OIQ A;  1WJJ A;  3I70 A;  4PG3 A;  1B3A A;  1YJ9 A;  2VB3 X;  1ZYR D;  4J15 A;  1PYW D;  3CAM A;  3J7Z C;  1IZ6 A;  1TS5 A;  1KXL A;  5C3E G;  1X3Q A;  1A6X A;  1EY0 A;  3PUX A;  1HNZ L;  5DM6 3;  4A3K G;  3HOX B;  4NKL A;  2UU9 Q;  3D31 A;  4GLV B;  2BA0 A;  2F03 A;  4DV4 Q;  4XYQ A;  4PQX A;  3V96 A;  5GAH C;  2WB1 E;  4HJ5 A;  1WVL A;  5C4X H;  1EU3 A;  4JI0 Q;  3M4Q A;  2ZM6 Q;  5DAU A;  2OF1 A;  4A3E B;  5J22 A;  1C0A A;  3R93 A;  2B3G A;  1H9M A;  3G48 A;  3TRE A;  3I2Z A;  5A2Q E;  4FVM A;  4X3T A;  1B8A A;  1QVC A;  4X64 Q;  3J7A V;  3M7N A;  5HGQ A;  3CPF A;  4HSV A;  1N36 Q;  4KN4 C;  1SXT A;  1Z9F A;  3X3M A;  5CV6 A;  4I7Z C;  2ZTD A;  1QNU A;  4DR3 Q;  1U5K A;  3KJP A;  3VYT A;  2Y0S G;  1ENA A;  5E3F A;  4JI3 Q;  3HKS A;  2UUC Q;  2TSS A;  1YNJ D;  4DNI A;  1I6H B;  4YWL A;  5GAE C;  3HOV H;  3N52 A;  3R2T A;  3KUP A;  3OHX C;  4MTN A;  3SEB A;  1RKN A;  3TP7 A;  3GTJ H;  1NNX A;  1K8O A;  5FLM G;  1G6Z A;  3I56 A;  2CVR A;  4A4I A;  1MJE A;  2B8F A;  2IJ0 A;  3EA6 A;  3QOJ A;  1DD2 A;  1SMX A;  3FMC A;  3VR3 A;  2EXD A;  1ZEQ X;  1C7Y A;  4R4T A;  1PTO D;  3JAM i;  3LWE A;  2EYJ A;  4EQN A;  1IBL L;  2MQH A;  4LAA A;  4HN7 A;  2PPB C;  2CHB D;  2R3Z A;  2RDG A;  3L7Z C;  1N32 Q;  1KNA A;  3L3O C;  4DV2 Q;  5DNF A;  1VQE A;  1LTS D;  2JJQ A;  3HFZ B;  1VF7 A;  3PF4 A;  2FHT A;  5C4X G;  1XMO Q;  4DR5 L;  5CR3 A;  2SNM A;  4NXM L;  3U4V A;  1QJO A;  3W3A A;  2NZ1 D;  3QO2 A;  3VR2 A;  2HT1 A;  1BCP D;  3V05 A;  2F52 A;  2O2L D;  1PTO C;  3J80 c;  1TY0 A;  2VL6 A;  4X62 Q;  1KLG D;  3GV3 A;  2EZV A;  2VUM G;  1XMQ Q;  5A2Q L;  2PMZ E;  1CM9 A;  1R9T B;  1YNN D;  2G5D A;  3BVG A;  4KJO A;  4OON A;  4FF4 A;  4UY8 C;  3SR1 A;  3OTO L;  4JBW A;  1GOZ A;  5HGT A;  4ZUJ A;  4IPC A;  1VQF A;  4PZ6 A;  1Y14 B;  3CRL C;  1JCK B;  2A74 C;  2RQX A;  3BYT B;  3JAM E;  4K5X A;  1F9P A;  3DHQ A;  3A8K E;  3KBG A;  2AWO A;  3FKI G;  3ITP A;  5HY6 A;  2MHV A;  3HOV G;  1YHB A;  3HOW G;  4BBR G;  1HCZ A;  4IOC A;  1M8A A;  1A3V A;  3KF8 A;  3PUZ A;  4BWG B;  1V1Q A;  1YNN C;  2M9V A;  2NZO A;  1HA5 A;  2K01 A;  3I8Z A;  4LMQ D;  4S3S A;  3UDF A;  2GVB A;  4DXF A;  3AMU A;  4A3D B;  2RCF A;  1BUV T;  2B63 G;  1O7Z A;  3I4L A;  2F0D A;  4HTH A;  4FF2 A;  4N8F A;  3EFX D;  1STH A;  2LFN A;  4EQP A;  1VMC A;  4OHJ A;  4HMJ A;  2YTX A;  2DJG C;  2Q8T A;  5IGF A;  1D7Q A;  4WOR A;  2XNA C;  2Z1C A;  2G9D A;  1STA A;  4DR1 L;  4YHH L;  1O7Y A;  2CW0 C;  2BE5 D;  2CQA A;  4KK7 A;  1W6K A;  4H02 A;  4ZYS A;  3F2U A;  2JXM B;  4KD4 A;  1B70 B;  1HPC A;  3KF8 B;  4K0K L;  1CZG A;  3OSO A;  1XNR Q;  3K6O A;  4DUZ Q;  3CME A;  1N34 Q;  1DM0 B;  2NVQ H;  2B39 A;  1K73 C;  1K9M C;  4GNX A;  2K5D A;  3R2I A;  4B3T L;  4GKJ L;  3OPO A;  3HOU G;  1OO9 B;  2V4D A;  3NWT A;  4HR7 B;  4KHZ A;  3I4N B;  4JI5 L;  3T13 A;  3HOZ B;  3NUC A;  2AQ1 B;  1VS0 A;  3NBI A;  2VQF L;  1JE4 A;  4B3R L;  4KD3 A;  4NB3 A;  4IFD J;  2E2J H;  4A3B H;  2L4N A;  1TWC B;  2BE5 C;  1PH8 A;  4GOP A;  1OXX K;  5EKI A;  1LT5 D;  4CDF C;  1S4Z A;  3U50 C;  3NBH A;  1A62 A;  1XTD A;  3CCM A;  1HZB A;  4C3H B;  5J1Z A;  1ENF A;  4GNX B;  1PLF A;  4CDE C;  2A68 C;  2IX3 A;  3BG3 A;  2F0E A;  4DV1 L;  1QNK A;  4K2K A;  3S1N H;  1XWE A;  3VR5 A;  1EEF D;  4ZLT F;  4C3I H;  5C3E B;  4JI1 Q;  2DGY A;  3NP8 A;  4GOP B;  1S72 A;  1GJX A;  4IJL A;  2R93 G;  1MI2 A;  4QUF A;  3NBH B;  2CKZ B;  4A3F B;  1CSQ A;  1W2B A;  1PFS A;  3NTH A;  1HA6 A;  1LM0 A;  1HNX L;  1TQO A;  1D1K A;  3ND9 A;  1R4Q B;  4ZQ3 A;  2Q8I B;  3GTO H;  3NK9 A;  3HOX H;  1B50 A;  1JOQ A;  1NBW A;  2E5L Q;  2UUB Q;  1JE5 A;  3Q24 A;  1TWH B;  3VYS A;  1I94 L;  2F4V Q;  5K36 H;  1JWU D;  3G4S A;  1LUZ A;  2F0Q A;  3CW2 C;  4A3E H;  3GTM B;  4IOA A;  3KLR A;  2RKS A;  5G3L F;  5BN5 A;  3UE0 A;  4UHV A;  3H3V H;  1HNW Q;  3TME A;  4JOI A;  3SK5 A;  4DK1 A;  1CKM A;  1VQD A;  1X9N A;  1WTP A;  1YHA A;  1U4R A;  1STB A;  5JEA J;  1LTT D;  3PV0 A;  1CTM A;  1FYC A;  4TQU S;  4KY6 A;  5ELC A;  2A5H A;  4AH6 A;  4A3B G;  1AW7 A;  1JIC A;  1HXY D;  2RHS B;  3BZD B;  1HR0 W;  1SE8 A;  5IP7 H;  3UDG A;  3T1H L;  1SAP A;  5IYB H;  2FXQ A;  4GZY C;  5JVH 3;  3OIP A;  4FDB A;  1KQS A;  2XVS A;  4Q5V A;  4LFB L;  4LF8 L;  1Q1E A;  1J9O A;  1HZC A;  3K0X A;  1IW7 C;  2B2T C;  2FIN B;  2JE6 I;  3WDN A;  1K3B C;  3D4R A;  4N8X 1;  2VXW A;  4G7Z C;  3MZ5 A;  3K0Y A;  2HHH Q;  2M2L A;  4OL7 A;  3I72 A;  1D8L A;  2KEE A;  4ALP A;  1EIH A;  4C3I G;  3J81 c;  1LTI D;  4AYB G;  4JYA Q;  1VCI A;  3A5Z B;  2F0V A;  5C0X H;  1VQ9 A;  3C2P A;  3NQI A;  2RDH A;  1S5E D;  2ZJR A;  4A3I B;  3NEN A;  2I0Q A;  4ABN A;  5C44 G;  3HOX G;  1S5F D;  4BS9 A;  3VYR A;  3DWP A;  3F2D A;  2RVL A;  3P1H A;  3QOL A;  3IFT A;  4YCU A;  4DR2 Q;  2BH2 A;  1D5X C;  3RUZ A;  1TR5 A;  4L5R C;  2HIX A;  5K36 G;  5C5L A;  1CA6 A; 
#chains in the Genus database with same CATH homology
 1HFG A;  1B44 D;  1BCP F;  4O42 A;  2VUM B;  3VR4 A;  1EIG A;  3MTS A;  2AUK A;  5F2D A;  5HUR A;  3AU7 A;  4L8J A;  1EY5 A;  4QCL A;  2EJM A;  3M4O B;  4JK1 C;  3TP8 A;  3FKI B;  4A3J B;  3HOW B;  4BBR B;  1KDB A;  1SE2 A;  3TBI B;  1AZP A;  5FKA C;  1O7L A;  2B63 B;  2EYF A;  1I4P A;  3TP5 A;  1G29 1;  3C1F A;  1GUN A;  3MXP A;  3VYU A;  5KEE A;  5CC4 A;  3QIA A;  4G4K A;  1ILP A;  4I65 A;  2M00 A;  1FR3 A;  3GTG B;  1RTN A;  2ICE C;  2F0O A;  5EBC A;  2R6G A;  1Q12 A;  3HGB A;  5NUC A;  1SEB D;  5ISR A;  2EYO A;  1E2Z A;  1LLR D;  3HOU B;  1I4G A;  3MVV A;  5KIX A;  3SK4 A;  1WTR A;  4NW2 A;  3W2D A;  1A3U A;  1QCB D;  4X3S A;  4ODG A;  1F2Y A;  2WIN B;  1PRT F;  3GV6 A;  2E74 C;  2NUC A;  3NPP A;  4XDX A;  2WKC A;  1BOS A;  3OW7 A;  1XYI A;  2EPB A;  3Q6S A;  3VA7 A;  4G57 A;  1L0Y B;  2SEB D;  3P7J A;  3D6C A;  3S1M B;  2K04 A;  3E6Z X;  1DCZ A;  5K5P A;  1BR9 A;  4F88 A;  5CMD A;  3DEP A;  2F3V A;  2HUG A;  2R93 B;  2KED A;  3PUY A;  3QWN A;  4K6L A;  5IGD A;  1TWF B;  2B2U C;  3BYY B;  4TKO B;  3K58 A;  2F0W A;  3MAQ A;  4RH6 A;  2F0G A;  1JWS D;  4QIW B;  5ELB A;  3M7G A;  4KKU A;  4BY7 B;  1JWM D;  4CGY B;  1Q90 A;  1Y1V B;  3HKZ B;  4IAL A;  4E6I A;  1BNZ A;  2WAC A;  4PMW A;  4L63 B;  5TSS A;  3MXN A;  2EXZ A;  2E2J B;  4MN3 A;  1CA5 A;  3TZU A;  4XYO A;  1TKW B;  1HRJ A;  5IOC A;  3N6R A;  5T1G A;  1GHJ A;  1F2Z A;  4C1N K;  4C3H G;  5JPN C;  3K5O A;  1U4L A;  2B2V A;  2IT1 A;  1RF2 D;  4B9X A;  1PZI D;  4RAU C;  4FP5 D;  2ICI A;  1SNC A;  2KOL A;  5C44 B;  3GTO B;  1NUC A;  2NBF A;  3MWY W;  4Y7N B;  1IHZ A;  3DM1 A;  3NQT A;  3G7L A;  5E4W C;  1XXG A;  4RGN A;  3S2D B;  1ROD A;  1E0B A;  1SSO A;  1RHP A;  4DFA A;  1ZYR C;  3EQL C;  3J7A F;  5CGK A;  5A35 A;  2KHS A;  4IUV A;  1FNV A;  1MSG A;  3D3R A;  5G3L D;  5CV5 A;  5C3X A;  3GD7 A;  2DY8 A;  1SYB A;  2WP8 J;  5IT9 E;  1A2T A;  1H9R A;  1V43 A;  3GTK B;  1TS2 A;  5M3M B;  2K5W A;  1EY9 A;  4KN7 C;  5EBD A;  4ZAI A;  2I07 B;  3A8J E;  4OO1 G;  1EZ8 A;  1RCV D;  4P2C B;  5C4H A;  3ERQ A;  2F0N A;  1LTR D;  4IUU A;  2NVX B;  4RCO A;  5EKL A;  2RBM A;  3M85 A;  5BN4 A;  1CZW A;  2DNC A;  4RHR A;  2X6L A;  1Q8I A;  5FLX E;  4ZKB B;  1TS3 A;  2TMP A;  4RFB A;  4A3G B;  4FO2 A;  5IGG A;  2F0U A;  4J1M A;  4CKC A;  4K8I A;  1YNJ C;  4RKB A;  2BCO A;  2JA8 B;  5IIF A;  2EJF C;  4F87 A;  3SE0 A;  4HCS A;  2Q8R E;  1FNW A;  5C5M A;  4F7X A;  5KYI A;  4CHT B;  5I6W A;  4XIG S;  3GTL B;  2XIW A;  2L11 A;  1I50 B;  1R4P B;  4QB4 A;  1EY4 A;  2B2Y A;  2F0H A;  3T4A C;  1GUS A;  4TSS A;  1KLU D;  4FF3 A;  3PO2 B;  2IX0 A;  3HZX A;  1WTQ A;  3L9A X;  4OIK A;  2EY5 A;  1C4Q A;  3BS1 A;  5COR A;  3U9S A;  2A69 D;  1VDZ A;  2JEA I;  5COY A;  1D5Z C;  3OWE B;  2GA4 B;  2LS0 1;  3S1Q B;  1OXV A;  2YU9 B;  1M4V A;  4IUN A;  4R8I A;  2E2H B;  3I90 A;  3BDO A;  4DNT B;  5JVG 3;  1D6E C;  1BCP C;  3PO3 B;  1H9K A;  5KRU A;  3CU7 A;  2HDM A;  3ERO A;  2KCN A;  3EVQ A;  3P20 A;  2A69 C;  3C3L A;  1GUT A;  2N55 A;  3PUV A;  1EYA A;  5AFW A;  5FLX L;  4C1N I;  2DNE A;  4XT1 B;  4OO1 I;  3A7A B;  4NP5 A;  2F0L A;  2JA5 B;  3MXG A;  2NN6 I;  3H94 A;  3SXH A;  2ENB A;  3DWA A;  2ZXP A;  4R8N A;  1SYF A;  3M4Y A;  3J80 E;  4PMC A;  3RD4 A;  4FF1 A;  2YYZ A;  4XQQ A;  1AN8 A;  2B2W A;  3I91 A;  2BDN A;  1LAC A;  1PRT D;  5ELD A;  5M5X B;  3Q23 A;  4N9T A;  4ZUI A;  4M1U B;  2JYO A;  2RSN A;  1Y8O B;  1SYC A;  2XRS D;  3DEO A;  2KUM A;  2BOS A;  3R8B A;  1CQV A;  3JAM L;  5C6A A;  3ZYY X;  1PRT C;  2OT2 A;  1GUO A;  2DN8 A;  2PCF B;  2QKI C;  1Z6H A;  2K03 A;  1AEX A;  3IKJ A;  5I2X A;  1G91 A;  4PV1 C;  2AWN A;  4CKE A;  2XRQ D;  3WOF A;  1PFN A;  2K33 A;  4XQN A;  1NAP A;  1XX8 A;  2O5I C;  1SFO B;  2A6E D;  3A54 A;  2JA6 B;  3KLS X;  4DAY A;  2F1M A;  2WAQ B;  1LT6 D;  4B08 A;  5M5W B;  1E2W A;  4IQZ A;  3KLS A;  2EYH A;  1B4O A;  5E4X A;  1XTC D;  1UNS A;  4XTC S;  1U4M A;  1DON A;  5FO7 B;  4IFD I;  2ZXO A;  4RGO S;  2IWH A;  2NVY B;  1ONL A;  5DM7 3;  3MEH A;  4IZ8 A;  2SNS A;  2KA7 A;  2FMM A;  5I9O A;  3SVM A;  4IUR A;  1LO5 D;  3C46 A;  4IN3 A;  2PMZ B;  1ESR A;  4QMG A;  4QUC A;  1SE3 A;  1SMY D;  3ND8 A;  3S14 B;  1OXS C;  1TT2 A;  2K32 A;  3MA2 B;  2FMC A;  2RDF A;  1NR2 A;  3Q0A A;  4FXG C;  5M9O A;  4DAV A;  3GTQ B;  1G8Z D;  1SMY C;  4O1N A;  1AZQ A;  2PZT A;  3I4M B;  1IYU A;  1HUN A;  1SNO A;  1DZ1 A;  2EVB A;  2K28 A;  2IW3 A;  3K5L A;  3FDT A;  3CQZ B;  1SNQ A;  3DUZ A;  2EY6 A;  3D8G A;  1EOT A;  1EWC A;  1NR4 A;  2F0F A;  5CBA E;  2PZW A;  2JP1 A;  1BF4 A;  3P75 A;  2E2I B;  3FEW X;  2O5J C;  5D3D A;  1QWY A;  2HCI A;  1KNE A;  4IUP A;  3TSS A;  1EYD A;  5FOB B;  4V0B A;  3SDZ A;  2KVM A;  2K5Q A;  4A3M B;  2MP1 A;  1DOK A;  4H13 C;  2KEC A;  1EY7 A;  3BDL A;  5IGC A;  5EPK A;  1II3 A;  1U4P A;  1JB3 A;  3OOC A;  1QG7 A;  5KNB A;  2B2V C;  1ICW A;  3SK8 A;  4OGQ C;  4F8M A;  2LMC B;  4UAI A;  1STY A;  2NTS A;  3H3V C;  1X3P A;  3S2H B;  1Y8P B;  2H1E A;  3MC0 B;  5J39 A;  1ET6 A;  4RA8 A;  2A73 B;  3QJY A;  4FXD A;  2F0J A;  1WCM B;  1CQF A;  1V1P B;  5M3F B;  1F77 A;  1G2S A;  1EQT A;  2R61 A;  1C8C A;  1UUP A;  3TZD A;  1NCV A;  2PW7 A;  2D9U A;  5C0X J;  3T53 B;  4DN4 M;  2EYL A;  1GUG A;  3R3O A;  1O80 A;  4BA1 I;  1B1Z A;  5JAV A;  2L1B A;  1LTG D;  4ME5 A;  1KDC A;  2K1B A;  4DA2 A;  1SYD A;  5I4D A;  2F0P A;  2Z4I A;  1HHV A;  2XN9 C;  3MFG A;  3IAY A;  4ZRZ A;  3RZD B;  4DXG A;  4Z9C B;  2IL8 A;  1PMR A;  5D3I B;  1K83 B;  4RWS C;  4BY1 B;  1SJH D;  1WTX A;  2PNR C;  4BBS B;  1TWA B;  4HAE A;  3PUW A;  2AQ3 B;  2D62 A;  4B9W A;  2A6H D;  1KDA A;  4EVO A;  3HG9 A;  3CKI B;  2B2Y C;  1HFN A;  1F2L A;  4OO1 H;  3VR6 A;  2D5D A;  5EQ0 A;  4ZK9 B;  1PFM A;  4KMU C;  4X3K A;  3M3Y B;  2NN6 H;  4KTA A;  3HOY B;  5ELE A;  4J8Q A;  4RCN A;  2C5C A;  1PTO H;  2A6H C;  1S5D D;  3RLF A;  1TY2 A;  4MIU A;  4FYD A;  1B9M A;  4BA2 I;  3MHB A;  1JOK A;  3A7L A;  3PIO 3;  2JSO A;  3KBX A;  1U9R A;  4ULL A;  4CJ2 C;  1V8Q A;  5IGB A;  4HCE A;  2LKV A;  3WOE A;  4CJ0 B;  2F0K A;  1UAP A;  1T5E A;  1I4R A;  4DGZ A;  2NTT A;  3LX0 A;  5I2Y A;  2Z8L A;  1B53 A;  1JC7 A;  3S16 B;  4K5V A;  2KCC A;  1TWG B;  1SNM A;  1PDQ A;  4DK0 A;  3E5S A;  3IFD A;  1SNP A;  3NSW A;  4DU9 A;  5KGU A;  3S15 B;  3S9W A;  2RSO A;  2QDB A;  2B2W C;  3QG1 A;  1SND A;  4U67 3;  1EY8 A;  1SDF A;  3K5M A;  4KJN A;  1TVX A;  2L5T A;  5IOD A;  2NN6 G;  3S1R B;  2F0T A;  2E2D C;  1IKM A;  2LY7 A;  4IFD H;  2B2U A;  3CRK C;  5M5Y B;  3RZO B;  1Q1B A;  3TP6 A;  2NB0 A;  3T16 A;  3UI2 A;  2E76 C;  5DEH A;  1CHP D;  2AUJ D;  4YIJ A;  5LL6 S;  1ILQ A;  4TRD A;  5C4J B;  3URY A;  3OMG A;  2R7Z B;  3K57 A;  3H6M A;  3FRP B;  2K7V A;  4G7H C;  1Y8N B;  2EYP A;  4QF4 A;  2IPK D;  1DXM A;  2QF7 A;  4U68 A;  2SOB A;  2G9H D;  2VB2 X;  1S5C D;  2EY2 A;  2HQE A;  1SBB B;  1VMP A;  1WTV A;  4MHE A;  2L9H A;  2FJ2 A;  5IT9 L;  2EY1 A;  4XXE A;  1I3Q B;  2OEO A;  3O13 A;  4DNR B;  1LT4 D;  3DXJ C;  1EU4 A;  5EGT A;  1NSN S;  2NVT B;  3AB9 A;  4K6D A;  1S5B D;  3FPU B;  2NWG A;  4LJZ C;  2BDO A;  1GUW A;  5JEA H;  2QCP X;  1D1I A;  3HRZ C;  1A3T A;  4IFD G;  4XT3 B;  1EY6 A;  1JQY D;  1X32 A;  2CW0 D;  5CBE E;  3CHB D;  5FK9 C;  4J6H A;  5EPL A;  1JOO A;  4K5W A;  3VA5 A;  4H44 C;  1V1O A;  3NHH A;  1LAB A;  1I4X A;  3SK6 A;  3DMU A;  1FGB D;  3KK7 A;  4ID6 A;  3BVZ A;  1EQV A;  1JR0 D;  1EWH A;  4CBV A;  1ZKO A;  2EE1 A;  4V19 0;  4EGV A;  2XWJ B;  2QIL A;  4ILW A;  1I6V C;  5JOB A;  4IUT A;  4IUQ A;  2WB1 B;  3K7A B;  3G6J B;  3PIP 3;  1SJE D;  5I6Y A;  1CFM A;  1DYQ A;  1TS4 A;  2A68 D;  3D4D A;  1LV9 A;  3LWU A;  4C3J B;  1I4H A;  3FPP A;  1SYE A;  1AP0 A;  3H0G B;  1MBY A;  2F3W A;  4FXK C;  3K59 A;  1LT3 D;  3NE5 B;  1K8M A;  4K2L A;  5EPJ A;  4A93 B;  4PNY A;  1HTL D;  3NTK A;  2EOT A;  4CJ1 B;  2F4I A;  2X6G A;  3NXW A;  1F9Q A;  2KQ3 A;  4Q0F A;  4KKS A;  5JEA G;  1ESF A;  4X3U A;  1LTB D;  4NMZ A;  3QB3 A;  5JJZ A;  3BDC A;  4NDX A;  1Z7T A;  2J0T D;  4UDU C;  4RGM A;  1F9S A;  1PXU A;  1CHQ D;  3D4W A;  2VNU D;  4C2M B;  4HSP A;  3DWQ A;  2HCC A;  1FNU A;  2JA7 B;  5I9P A;  1BQQ T;  3A8I E;  4A3K B;  1DOL A;  2XSC A;  4DF7 A;  3HS0 C;  3MFY A;  5LHY 1;  3J80 L;  2AQ2 B;  4CKB A;  4H7B A;  2EJG C;  5KNC A;  2L0C A;  2A6E C;  1IKL A;  5LL6 X;  1PZK D;  4L6T B;  1RTO A;  1G2T A;  1GHK A;  3TN2 A;  2F0I A;  4RGT A;  1KAB A;  1ML0 D;  5T1I A;  4RHS A;  1IW7 D;  2WII B;  2RA4 A;  1OXU A;  5JPM C;  2ID0 A;  3H91 A;  1PTO B;  2X69 A;  2R92 B;  2PO4 A;  1VF5 C;  2EDG A;  2Y0S B;  4XQJ A;  3I73 A;  3IL8 A;  4C56 C;  5D65 A;  3TDQ A;  2L12 A;  1FD7 D;  3GTP B;  3S17 B;  1STG A;  2MUY A;  2QEJ C;  1DJR D;  3A56 A;  3Q22 A;  4HED A;  2HDL A;  5BN3 A;  3MXU A;  1KTK A;  1RJT A;  4ZKC B;  1BCP B;  5CV7 A;  3E0J A;  3GP7 A;  1PZJ D;  2SDF A;  1C48 A;  3T56 B;  1PTO F;  2DY7 A;  1KAA A;  3RMH A;  2PZU A;  5D14 A;  1PFB A;  3NWS A;  1T5X D;  2MPM A;  3HEJ A;  2E75 C;  3D6W A;  4M8A A;  1Y1W B;  5CV9 A;  3T51 B;  5C4X B;  4KV6 A;  1EZ6 A;  5C3W A;  1SYG A;  5C4Z A;  4KI0 A;  3J7Y W;  2MGS A;  1A15 A;  2WV6 D;  2XWB B;  2MJ8 A;  1E2V A;  3X3N A;  5EKK A;  3OMC A;  2JEB I;  4R9W A;  1B9N A;  3A55 A;  5EJW A;  1I4Q A;  1TU2 B;  2NYZ D;  1CI3 M;  3H09 A;  1Q3L A;  1AFP A;  3J81 E;  3OWF A;  1UEA B;  2PQE A;  2K6A A;  3HOV B;  3LNN A;  1EEI D;  1DOM A;  3GTJ B;  1OXT A;  2H4O A;  1W6J A;  4RKL A;  3V2T A;  1QB5 D;  1F9R A;  3HP3 A;  1MD2 D;  1BXT A;  2J7Z A;  1V1P A;  2J4X A;  1BO0 A;  1PRT B;  4WFN 3;  5FO8 B;  5C0X G;  1IL8 A;  1Y69 U;  1J8I A;  2D2C C;  5CV4 A;  1MGS A;  2I46 A;  4FNF A;  1EYC A;  4PMB A;  1Z47 A;  1JOR A;  2OXP A;  5ELF A;  1H9S A;  1WD1 A;  2FFK B;  2PW5 A;  5KND A;  2B8G A;  1B2T A;  1RDP D;  3ONA B;  2B2T A;  5CV8 A;  2WKD A;  1ZXT A;  2C9O A;  4OIJ A;  3SHL A;  2ZXR A;  2Z4H A;  4HMI A;  1SE4 A;  1MSH A;  2KJX A;  1EL0 A;  1TII D;  2K05 A;  1GXD C;  3J81 L;  5KYL A;  4G7O C;  1H9S B;  4KY5 A;  4KY7 A;  1RD9 D;  2BA1 A;  1QOH A;  1CT1 D;  2F0S A;  5IGE A;  1O78 A;  1BBX C;  1L0X B;  2IX1 A;  3K5N A;  1HUM A;  1D2B A;  5E1F A;  1QIL A;  1WD0 A;  2EYM A;  1WTW A;  1WTO A;  4H0L C;  4LK1 C;  3BVM A;  4KKT A;  1STE A;  3PMF A;  1D5M C;  2NVQ B;  1CK1 A;  1IYV A;  3GO5 A;  2ZT9 C;  1HTP A;  4K8J A;  3C1E A;  3EJI A;  1QE6 A;  3GQB A;  4KHV A;  5C0X I;  2L55 A;  1F2M A;  1HQR D;  4C3J G;  4A3B B;  1STN A;  1ET9 A;  2F0M A;  2O4X A;  1A2U A;  1BDO A;  5CYU A;  2N88 A;  1EFI D;  3FVQ A;  4WJW A;  3I3C A;  4WRD A;  1H9J A;  4EQO A;  1ENC A;  5FO9 B;  4K14 A;  2PYK A;  3S1N B;  1HQM C;  4N9P A;  3U9O A;  1LTA D;  4DAP A;  4C3I B;  3NTI A;  4AYB B;  3OIQ A;  3I70 A;  1B3A A;  2VB3 X;  1ZYR D;  1PYW D;  1TS5 A;  1X3Q A;  1A6X A;  1EY0 A;  3PUX A;  5DM6 3;  3HOX B;  4NKL A;  3D31 A;  2BA0 A;  2F03 A;  4XYQ A;  4PQX A;  3V96 A;  1WVL A;  1EU3 A;  5DAU A;  2OF1 A;  4A3E B;  5J22 A;  3R93 A;  1H9M A;  5A2Q E;  4FVM A;  4X3T A;  3J7A V;  3M7N A;  4HSV A;  4KN4 C;  1SXT A;  3X3M A;  5CV6 A;  4I7Z C;  1QNU A;  3VYT A;  1ENA A;  5E3F A;  2TSS A;  1YNJ D;  1I6H B;  3N52 A;  3R2T A;  3KUP A;  3OHX C;  3SEB A;  1RKN A;  3TP7 A;  1K8O A;  1G6Z A;  2CVR A;  2B8F A;  2IJ0 A;  3EA6 A;  3QOJ A;  1DD2 A;  3FMC A;  3VR3 A;  1ZEQ X;  1PTO D;  3LWE A;  2EYJ A;  4EQN A;  4LAA A;  4HN7 A;  2PPB C;  2CHB D;  2R3Z A;  2RDG A;  3L7Z C;  1KNA A;  3L3O C;  5DNF A;  1LTS D;  1VF7 A;  2FHT A;  5CR3 A;  2SNM A;  1QJO A;  3W3A A;  2NZ1 D;  3QO2 A;  3VR2 A;  1BCP D;  3V05 A;  2O2L D;  1PTO C;  1TY0 A;  1KLG D;  3GV3 A;  2EZV A;  5A2Q L;  1CM9 A;  1R9T B;  1YNN D;  3BVG A;  4KJO A;  4FF4 A;  3SR1 A;  4JBW A;  1GOZ A;  5HGT A;  4ZUJ A;  3CRL C;  1JCK B;  2A74 C;  2RQX A;  3BYT B;  3JAM E;  4K5X A;  1F9P A;  3DHQ A;  3A8K E;  2AWO A;  3KBG A;  3ITP A;  2MHV A;  1HCZ A;  1M8A A;  1A3V A;  3KF8 A;  3PUZ A;  4BWG B;  1YNN C;  4LMQ D;  2M9V A;  3I8Z A;  1HA5 A;  2K01 A;  4S3S A;  4DXF A;  3AMU A;  4A3D B;  1BUV T;  1O7Z A;  3I4L A;  2F0D A;  4HTH A;  4FF2 A;  3EFX D;  1STH A;  2LFN A;  4EQP A;  1VMC A;  4OHJ A;  4HMJ A;  2Q8T A;  5IGF A;  4WOR A;  2XNA C;  2Z1C A;  2G9D A;  1STA A;  1O7Y A;  2CW0 C;  2BE5 D;  2CQA A;  4KK7 A;  1W6K A;  4ZYS A;  3F2U A;  2JXM B;  4KD4 A;  1HPC A;  1CZG A;  3OSO A;  3K6O A;  1DM0 B;  2B39 A;  2K5D A;  3R2I A;  3OPO A;  1OO9 B;  2V4D A;  3NWT A;  4HR7 B;  4KHZ A;  3I4N B;  3T13 A;  3HOZ B;  3NUC A;  2AQ1 B;  3NBI A;  1JE4 A;  4KD3 A;  4IFD J;  2L4N A;  1TWC B;  2BE5 C;  1OXX K;  5EKI A;  1LT5 D;  1S4Z A;  3NBH A;  4C3H B;  5J1Z A;  1ENF A;  1PLF A;  2A68 C;  2IX3 A;  3BG3 A;  2F0E A;  1QNK A;  4K2K A;  1XWE A;  3VR5 A;  1EEF D;  4ZLT F;  5C3E B;  3NP8 A;  1GJX A;  1MI2 A;  4QUF A;  4A3F B;  3NTH A;  1HA6 A;  1TQO A;  1D1K A;  4ZQ3 A;  2Q8I B;  1R4Q B;  3ND9 A;  3NK9 A;  1B50 A;  1JOQ A;  3Q24 A;  1TWH B;  3VYS A;  5K36 H;  1JWU D;  2F0Q A;  3GTM B;  3KLR A;  2RKS A;  5G3L F;  5BN5 A;  3TME A;  3SK5 A;  4DK1 A;  1WTP A;  1U4R A;  1STB A;  5JEA J;  1LTT D;  3PV0 A;  1CTM A;  1FYC A;  4TQU S;  4KY6 A;  5ELC A;  2A5H A;  1AW7 A;  1JIC A;  1HXY D;  3BZD B;  1SAP A;  4GZY C;  5JVH 3;  3OIP A;  2XVS A;  4Q5V A;  1Q1E A;  1J9O A;  1IW7 C;  2B2T C;  2FIN B;  2JE6 I;  3WDN A;  3D4R A;  2VXW A;  4G7Z C;  3MZ5 A;  3K0Y A;  2M2L A;  4OL7 A;  3I72 A;  2KEE A;  1EIH A;  4C3I G;  1LTI D;  1VCI A;  2F0V A;  5C0X H;  3C2P A;  3NQI A;  2RDH A;  1S5E D;  4A3I B;  4ABN A;  1S5F D;  4BS9 A;  3VYR A;  3DWP A;  2RVL A;  3P1H A;  3QOL A;  3IFT A;  1D5X C;  3RUZ A;  1TR5 A;  5K36 G;  5C5L A;  1CA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...