3EROA

Crystal structure of staphylococcal nuclease variant delta+phs i72e at cryogenic temperature
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKEEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal Structure of D+PHS I72E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 37
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3eroA00
2F0JA 3NP8A 4J6HA 3SXHA 4B9WA 5I9PA 5I9OA 2PYKA 1A3VA 2OEOA 1KAAA 5KRUA 2EYJA 1ENAA 4N9PA 4EQOA 4PMBA 2O4XA 2M00A 2F0LA 3DMUA 1EY7A 3ERQA 5CR3A 5HURA 3BDCA 5IGEA 2SNSA 4HMIA 4EQNA 4QB4A 4KJNA 4IZ8A 2PZTA 5IGCA 4KHVA 4PMCA 4K6DA 2F0IA 2F0GA 2EY6A 5E3FA 3D4DA 3OWFA 5C5MA 1KDCA 3MVVA 1F2MA 3SK8A 5JAVA 2WACA 5CV6A 1A3UA 2HQEA 5I6WA 3D8GA 5IGFA 2LKVA 3TP5A 1AEXA 1KABA 1JOOA 5CGKA 5KYLA 4WRDA 3QB3A 3D4WA 3MEHA 3EJIA 4K8JA 1SNMA 2PZWA 5KIXA 1EY4A 4MIUA 2PQEA 5KYIA 2EY1A 3U9OA 3MXPA 3TP7A 3MZ5A 4HMJA 4DGZA 1EZ6A 2RBMA 2EY5A 2PZUA 1STGA 2RKSA 5JOBA 4ZQ3A 3TP6A 1NSNS 2QDBA 4B9XA 2EY2A 2EXZA 2F0FA 4KJOA 1JOKA 5IOCA 4WORA 5C6AA 1IHZA 1SYEA 4F8MA 2SNMA 2EYHA 3DHQA 3E5SA 4KY5A 1STHA 3NXWA 5CV4A 5C5LA 1A2TA 1EY5A 1F2YA 3P1HA 3C1FA 1SYDA 5J39A 2F0KA 2ENBA 5IGDA 5ISRA 5EKKA 4ZUIA 2F0WA 4RKLA 5NUCA 1JORA 1F2ZA 5C3WA 3D6CA 3H6MA 3QOLA 1SNPA 4LAAA 2RDFA 1NUCA 4ZUJA 4K8IA 1SYGA 5KEEA 1TT2A 4G57A 5C4ZA 1TR5A 2F0NA 4I65A 1A2UA 4IUNA 4EVOA 3T13A 5C4HA 2F0OA 2F3WA 4ID6A 1STBA 3RUZA 4F7XA 3NQTA 1KDBA 1RKNA 2EYFA 2F3VA 2OF1A 2PW7A 1EYDA 2NUCA 2F0DA 4KTAA 4H7BA 5IODA 4NMZA 1STAA 4NKLA 2F0HA 4DF7A 1SNCA 4N9TA 1TQOA 4PNYA 1EY8A 3VA5A 3PMFA 4K2KA 4R8NA 1SNOA 5EGTA 4DFAA 1EYAA 4ODGA 3S9WA 5C3XA 3NUCA 2EYOA 3HZXA 2EYLA 3R3OA 4NDXA 3NK9A 2F0EA 1KDAA 4IALA 4K14A 3P75A 3TMEA 2KHSA 2F0SA 3OMCA 4KY7A 5I6YA 1SYFA 3SK6A 2OXPA 1STNA 5CV5A 1ENCA 4QMGA 4KV6A 4OL7A 4HTHA 4E6IA 1SNQA 5DEHA 4K5WA 5IIFA 1EZ8A 1EQVA 4S3SA 4YIJA 3ITPA 3C1EA 3SHLA 4K5XA 2F0QA 3NHHA 5EKLA 1II3A 5K5PA 4KY6A 4ME5A 4K2LA 5CC4A 5HGTA 3SK5A 3OMGA 3QOJA 5KGUA 5J1ZA 1JOQA 1EY0A 3EVQA 5CV9A 3LX0A 2PW5A 3TP8A 1SYBA 1U9RA 1EY9A 4QF4A 3SR1A 4EQPA 2EYPA 3HEJA 4RKBA 4TRDA 2F0MA 5M9OA 5J22A 1EYCA 4J1MA 1SYCA 5F2DA 4K5VA 2F0TA 2EYMA 3V2TA 4NP5A 1EY6A 1A3TA 3EROA 3SK4A 3BDLA 1SNDA 4DU9A 2KQ3A 5DAUA 4KD3A 3MHBA 5E1FA 5CV7A 3OSOA 2F0VA 4KD4A 5IGGA 2F0UA 1STYA 5IGBA 3T16A 2F0PA 5CV8A 2SOBA
chains in the Genus database with same CATH superfamily
3NBHA 1ZYRD 2PYKA 1F9SA 4IFDH 1RD9D 3UI2A 4DA2A 2XWJB 1JWMD 3PUWA 3VYRA 1WVLA 3TS2A 3RMHA 4DK1A 5FJ8G 2G9DA 1HH2P 3S16H 4DUZL 1TXYA 5IP9H 1KDCA 5M5XB 2DGYA 1I94L 1Z47A 1JOOA 4HIKA 2KBNA 4BBSB 4OWXB 4K8JA 1RDPD 5LL6S 3CPWA 1EY4A 3I7FA 1TS2A 4DR5Q 2A6HC 4X6AH 1PRTF 4H13C 4FYDA 4ALPA 1HR0Q 2K7VA 1H9RA 4CJ2C 2B2UA 4LJZC 3U4ZA 4FDBA 4ABNA 4A3BB 1L0YB 1SE3A 1NE3A 4HIDA 4JI8Q 5IGDA 5EKKA 1U5KA 1SAPA 3K7AH 2OCEA 1VQ9A 4BY7G 3A8JE 3D6CA 2EOTA 1M4VA 2MO1A 4M8AA 4YY3Q 2PPBC 4DR5L 1S3OA 1C48A 3BU2A 4DV3Q 3AYHB 2CVRA 1BCPF 2LSSA 1HR0L 3S1MB 4Q0FA 3FKIH 2YTXA 4UPAA 3HOYG 1ESFA 1CA6A 5T1GA 1X54A 3BVGA 4KI0A 3CCEA 4DF7A 5C44H 1L2FA 1VQLA 3PMFA 5EGTA 4RGOS 3F2UA 1PH5A 1SMYC 4NDXA 1YHQA 3ZYYX 3GTJB 1VQCA 4LFCL 1JQYD 3M4QA 4YY3L 3L9AX 4OONA 3STBC 1PYWD 4DV3L 1A63A 3RZOB 4UDUC 1N8RC 1HNWQ 1LUZA 2RHSB 1SSOA 4A3MH 1PTOC 3CMAA 3A0JA 5KGUA 1WCMH 4R4OA 2AMCB 4GNXA 5CV9A 4A3GG 2O2LD 1BBWA 4MTKA 3GO5A 3UE0A 1QVFA 5JJIA 5LHY1 4L5RC 5E4XA 1YBYA 1A62A 1O7IA 2N55A 4A3EH 1T9HA 2AWOA 1I3QH 2N49A 3MHBA 4J8QA 4KD4A 1XPRA 4N8FA 3GQBA 3J80c 2NVTB 1B7YB 5BN4A 1ENAA 1XNRL 1B2TA 2A1AA 3E0JA 2R3ZA 2E2JH 1C8CA 1LTSD 4K6DA 3OWFA 3MXNA 4BY1H 5EKIA 3OIQA 5CV6A 1A3UA 2Z4IA 2B2YC 2WAQB 3NWSA 1X9NA 1ILPA 3CCVA 1RHPA 4V0BA 4V190 2Y0SB 4A4IA 2JK8A 2D9UA 3MXUA 4L63B 4KJOA 3U4VA 4WORA 3H0GB 4GLVB 5EPKA 4ZAIA 5C6AA 4F8MA 1ZEQX 1VQ7A 1SN8A 1KHIA 2WV6D 1PA6A 4IFDJ 4NXNL 3A56A 4JPBW 2JA9A 2CWAA 3H6MA 1K83H 1PH7A 4LF5L 4LAAA 2RDFA 1CZWA 1NBWA 2N78A 1KD1C 1SR3A 4G57A 2OWOA 3KJOA 4P73A 1STBA 2WB1G 2G5DA 2IHEA 1G6PA 5C4JB 2QEXA 2VY3A 2XIWA 3V96A 2B39A 2QILA 3S2HB 5ELFA 3S9WA 2CW0D 1UUPA 2EYOA 3HZXA 1OXVA 3EFXD 3NK9A 1SXTA 4XYQA 3CU7A 1Q3LA 1EOVA 1P16A 4IJHA 4GN5A 2C5CA 2E2DC 4H02A 3VYTA 5IY0A 2IT1A 5C4XH 1Z7TA 3Q24A 4L5QA 4OO1H 5IIFA 2JA7B 3KDFB 3C1EA 4BBSG 4EGVA 3S17B 1VQ6A 2E76C 2ZXPA 4JC0A 4GN4B 2JSOA 5J22A 1LACA 2EQSA 2FHTA 2B29A 1YNND 3DEOA 2DN8A 4NPSA 1K0RA 1AZPA 1Q8IA 4LFAL 4A3BG 1NTGA 3KJPA 3TZUA 2E2HH 4PMBA 1VQ4A 3OW2A 2KUMA 3M4PA 4GKKQ 2Z0SA 3BDCA 2SNSA 4EQNA 1BNZA 1VMPA 1CQVA 2MGSA 1L1OC 1HUNA 1JB3A 3CC4A 5FLMH 4YCVA 4DR3L 3D8GA 1Y8NB 1JICA 1CKNA 2DJGC 3MEHA 2FMCA 4AIMA 3PF5A 3D31A 4A3FH 3URYA 3I4MB 1WTVA 1Y14B 1K8MA 2BDNA 4LWCA 1VQMA 2FFKB 4GKKL 3R2TA 3TP7A 1KC8C 5I4DA 2K1BA 1PH1A 3I4LA 2EYHA 5GAEC 4BA1I 1HFNA 3K5OA 1ASZA 2MUYA 1V1PA 3LWEA 2NN6I 1JORA 1EYGA 1IW7D 3QOLA 2B3GA 1R9TH 2GVBA 1GJXA 1H9SB 4DV4L 2JE6I 2E75C 3VR6A 3I3CA 1F2LA 2PW7A 4C3HG 1C7YA 1A6XA 4DR1L 2IL8A 4A93H 4F88A 1EYAA 2D5DA 3HOUB 4DV0Q 2QGQA 3W5OA 1G291 3RLFA 5JPMC 4A3JB 1Z6HA 3HOWB 2NZOA 1H95A 2QDLA 5G3LD 4LF6L 5M3MB 1XMQL 1SFOH 1GUWA 3CCRA 1IKMA 1TY2A 4IPCA 2B2VA 4A3LH 1ML0D 1D8LA 1B3QA 3HOZB 3L0OA 3ONAB 1VQGA 1SYCA 2E74C 3HKZB 2F0TA 4IQZA 4DV0L 3G6JB 1DCZA 3OYYA 5CV7A 4IUQA 3J81i 3NPPA 4A3DH 1BCPC 2KVMA 1L0XB 2K5DA 2WAQE 2ZXOA 5KRUA 4K0KL 4CJ1B 3S1QH 1WTOA 1BVSA 5A2QE 4EQOA 3CCJA 1DXMA 3GV6A 5CR3A 4BBRB 2I0QA 2EVBA 3M3YB 4HMIA 1FNVA 5IYCG 2B63H 2FMMA 4DR2Q 1GVPA 1MJCA 2Y0SE 1QZHA 2HQEA 5M5WH 3HS0C 5FO7B 4C3JB 2K5NA 4RHSA 4C3IH 1Q1EA 4NXMQ 4FNFA 4DGZA 3KBGA 1T5EA 1NSNS 1QG7A 2BDOA 2HDMA 2KEEA 4DN4M 2HT1A 1I4PA 3G6EA 1EIGA 1PMRA 2D0OA 1RCVD 2CH4A 2JA7G 4ZK9B 1SE2A 1F9RA 1W2BA 5NUCA 1G8ZD 1Y1VG 5C3WA 1JCKB 1YJWA 2KCNA 3GV3A 2RDGA 4K8IA 1MSGA 4NXML 1TWGB 2H4OA 4LUVA 3EN2A 3G71A 3KBXA 2MP1A 1BDOA 4QUCA 1TKWB 2RDHA 5BN3A 1YIJA 1QOHA 3NQTA 4P71A 3DM1A 1IL2A 4XDXA 1EU4A 1SDFA 1VQBA 3HRZC 1MD2D 2I5LX 4OWTB 2JA8G 1YEZA 3NQIA 2NTSA 3VR2A 1WD0A 1KDAA 1HRJA 1NJIC 4K14A 1XNQQ 4GOPB 3DEPA 2ATWA 4DV2L 3I4NH 3SK6A 4DR4L 3PQIA 2OXPA 1WD1A 4QMGA 1NCVA 3CCLA 1F9QA 4E6IA 5DEHA 4B3TQ 5DM73 2YTYA 4QIWB 1PH8A 3I4MG 2PW5A 5FK9C 2LXJA 1EYCA 2HDLA 3KF6A 1U4PA 4NP5A 1MHWC 1QUQB 1K3RA 3RZDH 4P72A 3DWPA 1QE6A 4A3CH 1H9KA 4DV6L 1WI5A 1Y1WB 1N34Q 4OX9Q 1ASYA 4K6LA 4R8NA 1F9PA 2JN4A 4JG2A 1XPUA 5E7NA 4N9PA 4RFBA 5HURA 1ESRA 3SEBA 4JI2Q 3N6RA 5IGCA 3CPFA 4BY7B 2I07B 4TKOB 4L6TB 2C9OA 3M85A 2AUJD 3MVVA 1I4HA 4L8JA 1I6HB 2NZ1D 2XRQD 1X3GA 3NSWA 3HOVH 2LKVA 1DM0B 1MJEA 5CGKA 3HKSA 4JYAL 1S40A 2ZT9C 4PZ6A 4OX9L 2EXDA 3R93A 2JQOA 3KLRA 1IBMQ 4N8X1 5ELEA 1RTNA 2BE5D 4G7ZC 3H09A 2PQAA 1O7ZA 2WKCA 3HOXG 1STGA 2RKSA 3GTOH 1PXUA 4B9XA 4JI2L 4A3JG 1RIPA 1GUSA 1HUMA 1TWAH 1IXRA 5M3MG 1PH4A 1GHKA 2LFNA 1S5CD 4QY7A 3RD4A 4IPHA 2B2WC 1YITA 1VS0A 1D5XC 2ZTDA 1FJGQ 2EIFA 3K0XA 3JAML 2LS01 3HOZG 3S16B 5G3LF 2K32A 1VQFA 1DYQA 2DNEA 4ID6A 3L2PA 2ZJQA 1JC7A 1KDBA 1RKNA 2F3VA 2L9HA 1N36L 5ELNA 1STEA 4R4CA 4HJ8A 4AQYQ 2V1CC 4JI5Q 2A69D 3S1NH 5IYBH 1KLUD 4WFN3 4DFAA 2NN6G 3NUCA 2AQ3B 1PFBA 2JYOA 3CC7A 4IPDA 1AZQA 5CORA 2JA6H 1FJGL 2XWBB 4KY7A 5I6YA 1FGBD 1MGSA 5LMNW 4BA2I 1VQHA 3HKZE 1SNQA 2PMZB 4YIJA 1I50H 2UXCQ 5K5PA 3K7AB 3ULJA 4C3JG 1CZGA 4K2LA 2HIVA 2R6GA 5H1SE 5COYA 5IT9E 1K3BC 4DXGA 5M9OA 1D1KA 3Q22A 2ICIA 3EROA 3FKIB 4I7ZC 4UP8A 2ES2A 3U9SA 1W3SA 3PSIA 3UDGA 2IPKD 2B2TC 1B50A 2F0UA 3CP0A 3CCUA 3NP8A 4EX5A 4B9WA 4PV1C 2UXCL 3M7GA 4RWSC 1EIFA 2O4XA 3A5UA 2F0LA 3EQLC 1U4MA 3FRPB 4X3UA 3QR8A 2UUAL 3LWUA 4LF4Q 4DNIA 1X3QA 1HNZQ 1DOKA 3KLSA 4DR6L 5M5YH 1I94Q 5AJ3Q 1WCMB 3F2BA 2J4XA 3Q8DA 4MIUA 5EBCA 4JBJA 4OELB 3DWQA 3PO3H 1DONA 3DXJC 1MSHA 4A3EB 4JI0L 2QDBA 3OHXC 4LF4L 1IHZA 1HNZL 4CDDC 1YNJC 3BYYB 3F2DA 3S24A 1NAPA 3P1HA 4JI4L 4QJFA 5JEAG 4B3SQ 4B3MQ 1FNWA 4CBVA 2KEDA 4JI3Q 5AJ3L 3K80C 4LMQD 4X3TA 2B2YA 1XTDA 4HEDA 3J81E 3TS0A 1QB5D 1BF4A 1TWCH 3L3OC 3MEFA 1TS3A 1LTLA 1OTCA 4R9WA 4OO1I 4ME3A 2TMPA 5IODA 1Y1WG 3D4RA 4HIMA 4NW2A 3F2CA 3PGZA 2K03A 3OOCA 2K5HA 3VR3A 4B3SL 4HIOA 3VDYA 4B3ML 3J80i 3G4SA 4JI3L 3NTHA 1PYSB 2UXBL 1B44D 3P75A 2R93H 4LFCQ 1IYJB 4KV6A 5DLQE 4NB3A 3PO2B 2RA4A 4POFA 4JK1C 1CT1D 2CKZB 2WIIB 2R92H 2WINB 5CC4A 1VQIA 3QOJA 1EY0A 1XMOL 2CW0C 1HTLD 1JB7A 4PZ7A 2NVXH 3GTMH 3TDQA 1G91A 4J1MA 3S2DB 2P5ZX 4APVA 3RLNA 1QZGA 1LV9A 5KNCA 3KFUA 4KKTA 2F0VA 3BYTB 4A3KH 4RGNA 3T16A 4C2MH 2YYZA 3VR4A 5FOBB 4IFDG 1D1IA 1HR0W 5JEAJ 3DMUA 1I4XA 1TWHH 4DV5L 1XNRQ 4L5TA 2PZTA 1GXDC 3SE0A 2JEBI 5IP9G 2F0IA 2K75A 4QL5A 2HCIA 5C5MA 3ZJYC 5C4XB 1EEFD 1JWUD 1HJPA 1PYBA 1WTWA 1VF7A 4C3HB 3QWNA 5T1IA 5KIXA 4IOAA 5KYIA 2PQEA 3BZDB 1X3PA 2FJ2A 1O80A 2KCCA 1Q81C 2EY2A 5J3BA 1Q82C 5C5LA 4DV7L 4YWMA 3W3AA 5J39A 1L1OA 3DM3A 4RKLA 4NXNQ 3IFDA 1S5BD 3I2ZA 1UE7A 1TU2B 5EAYA 2L0CA 1SNPA 3K81C 1XWEA 2Z6KA 4LF5Q 1L0WA 4RG1A 4EVOA 3JAMc 1G2SA 3FKIG 4QQBX 1YJNA 4WJ4A 5I2YA 1B53A 4NKLA 1PFSA 5C44G 3SVMA 2I5MX 1SE8A 1EWIA 2CFMA 3BZCA 3S1RH 3IRBA 5IYDH 2PMZE 1WTRA 1IW7C 5LMUL 1SROA 3W2DA 1UE5A 5FLXL 1E7ZA 1C4QA 2AWNA 1KQSA 3H94A 2MHVA 1E1OA 3T1YL 3GTGH 3GTPB 1BBXC 4IUPA 2IJ0A 4IPGA 5C0XH 1VQOA 4A3MG 1SBBB 4O2DA 1WCMG 3A7AB 1R4QB 3GTKB 3NENA 3W1BA 1P8LA 2BCOA 2KCTA 3CC2A 1WFQA 5F2DA 3S1MH 3HG9A 1AN8A 3LGJA 3ERSX 4DAMA 4A3EG 2QKIC 4OIKA 4DXFA 5DAUA 3S15H 4DV1L 2K01A 2RSNA 1KXLA 2HCCA 5IGGA 2VZAA 4LFAQ 3GTLB 3I8ZA 3SXHA 5I9PA 1QVCA 2NYZD 3GTJH 5BR8Q 1B9NA 1KAAA 2WB1E 2HIXA 2VUMH 3H15A 5C3EH 5GQOA 2OTLA 1OXTA 2M00A 1PVOA 3ERQA 2B8GA 3TEHB 5EJWA 2PCFB 4HN7A 4UHVA 2GN5A 1Y1VB 4BY1G 1NNXA 1PH2A 3KOJA 5JVG3 5I2XA 4FF3A 2EPBA 1SFOB 3E9HA 4GOPC 1V8QA 4DPGA 2OT2A 3TBIB 1H9MA 3CW2C 4DR3Q 4WRDA 4OGQC 5ELOA 1CQFA 1LYLA 3NE5B 2F4IA 4ILWA 4XQQA 3KF8A 5BR8L 1M1KC 5E4WC 2IHFA 2JA8B 3VYSA 4G4KA 1J6QA 2F4VL 2MO0A 1BUVT 2EXZA 2NVTH 1NMGA 3K6OA 1OXUA 3DHQA 1AFPA 3PO2G 2YV5A 1FR3A 2N88A 1B9MA 2F0WA 4YWKA 3FPPA 2B63B 5CMDA 4DK0A 3CF5A 1B70B 1TR5A 3HFZB 4I65A 1A2UA 3WOEA 4DV4Q 2Q2IA 2OF1A 1LT4D 1RL2A 3FVQA 3SGIA 1TQOA 4DR1Q 3CD6A 3PUYA 1R4PB 4IUVA 3J7ZC 5C3XA 1PFNA 3H3VH 4RGTA 1WTPA 3PIO3 3BS1A 4IUUA 1XPOA 3OMCA 3H0GH 4QUFA 2M9VA 5CV5A 5C4XG 3G48A 3DUZA 4OO1G 2KJXA 1A0IA 1LT3D 4JOIC 4LF6Q 3SHLA 4HJ9A 4K5XA 2E2IH 1XMQQ 3PCOB 1VQAA 2D2CC 4WJ3M 5J1ZA 1KIXA 2DY7A 2K52A 3M9BA 4EQPA 1J9OA 1GUOA 2E5LQ 1GUTA 2NVYB 4FF4A 4UY8C 2HHHL 1G6ZA 5GAGC 3BDLA 5C4JH 1HCZA 1ONLA 3J7A5 3HOXB 5IGBA 4YCWA 1I4GA 4IOCA 1U4RA 5CV8A 2F0JA 4JI6L 5JJLA 1EWHA 2NWGA 2JA5H 4K0KQ 3R8BA 5IGEA 5D3DA 1EY7A 2NVQB 2XGTA 2J7ZA 4X3SA 2F03A 2CQOA 4RHRA 2VNUD 2E5LL 3WOFA 2EZVA 1OO9B 1F2MA 5FLMG 3MXGA 3J80E 2LMCB 3PUXA 3S17H 4CDEC 1SJHD 3S14H 4A3FG 5IP7H 4XT3B 1FL0A 4DAPA 4AH6A 4DAYB 1FD7D 3NBHB 4HSVA 3X3MA 5D3IB 2PI2E 2R7ZH 4RA8A 4PZ8A 1MKHA 3Q23A 3NXWA 4A3IH 1EOTA 2Q2UA 1WJJA 3C1FA 2X6LA 2ENBA 3Q0AA 1JJGA 4LFBQ 4BXXH 2UU9Q 1GD7A 4LK1C 4CHTB 1SYGA 1WOCA 2RCNA 1OXSC 2QCPX 2EJFC 2F0OA 2QEJC 4UAIA 3RUZA 4F7XA 4O42A 1X3EA 4H44C 1EYDA 4FVMA 4JI1L 4A93G 5IWAL 1EQRA 1TS5A 2K28A 4PNYA 2VL6A 3DWAA 3PIOA 1HTPA 2M2LA 3R3OA 2L1BA 4LFBL 4IALA 3GTOB 3I91A 2UU9L 2B2WA 4YWLA 3J7AF 1SYFA 5FLXc 5ELCA 5ELDA 1TWAB 4DV2Q 4DR4Q 2KA7A 4CJ0B 3NEMA 4HCSA 1JE4A 3GD7A 3K8AA 4S3SA 5K36H 2A69C 4YHHQ 3ITPA 1TWFB 1O7LA 1JOQA 4A3LG 2NBFA 1VMCA 3LNNA 1YZ6A 1YHAA 1K0SA 1WYDA 4EQ5A 1EY6A 1A3TA 2PI2A 2Z6BA 4C1NK 2BH2A 4A3DG 2F1MA 1LT5D 2I46A 1PTOH 4DV6Q 3RN5A 5DNFA 3HOUH 1E2WA 4YHHL 3GTQH 2O5JC 1EUJA 4CKCA 4IUTA 3HOWH 2B63G 1QNKA 4LF7Q 4GNXB 1QWYA 2KENA 3FHWA 3OWEB 2XVSA 5JAVA 1FGUA 4L5SA 1I50B 4O1NA 1N33L 1D7QA 4LF9Q 2PZWA 4XQNA 4JYAQ 2A19A 2B2TA 4C3IG 1EWCA 2JXMB 1X65A 1JT8A 4G7HC 2RVLA 1PRTD 1PDQA 1GUNA 1HZBA 1IBLL 1EQTA 4LF7L 1F77A 2F0FA 1U0LA 2A6EC 4CDCC 1QILA 1STHA 1HFGA 1KRSA 3MXNB 4JW0A 1PZID 2Q8TA 3P7JA 4BBRH 4LF9L 2L55A 2PNRC 1UE1A 1RTOA 2VQEL 3I72A 3A5ZB 1ZYRC 3H91A 4X62Q 1NUCA 4Z9CB 5KNBA 1B3AA 1X56A 3U58A 3SDZA 1H9JA 1O7YA 2NTTA 3KDFA 2AQ1B 5M5YB 1N36Q 4NMZA 4QCLA 1ICFB 3EA6A 3FMCA 2MPMA 2BA0A 4LUOA 3K5MA 1AH9A 3TRZA 5M3FH 1TS4A 1PH3A 3PO3B 2C35B 4DUYL 3K0YA 4KHPL 2NZHA 4I7AA 3KLWA 4RCOA 3I4NG 1ENFA 1TY0A 4X62L 2MFIA 5CBEE 4IN3A 2Q2HA 3EBEA 1SJED 1STNA 4U68A 2QA4A 4DR7Q 3O13A 5EKLA 3CMEA 1DOMA 1RJTA 2WP8J 5HGTA 1B4OA 3OMGA 5A2QL 3EVQA 3NTIA 2KHJA 1EY9A 2L11A 2KCMA 3UDIA 1KAWA 3E6ZX 1M8AA 4K5VA 1XX8A 4X66L 4DU9A 2KHIA 4A3CG 2NB0A 1YI2A 2EDGA 4OEMB 3CCQA 1DD2A 2F0PA 1E2ZA 1JMCA 4DR7L 4KKUA 1PRTB 2DJFC 3MFYA 4MHEA 1FVIA 2LXKA 4HCEA 3J7YW 3I90A 5HY6A 2K5WA 4XXEA 5FJ8H 2R93B 1EIYB 3PUZA 1CKMA 5LL6X 4U673 1JE5A 2UUAQ 3TSSA 3RR5A 2O5IC 3A8IE 5JVH3 5I6WA 3FEWX 1K73C 4RGMA 4HJ5A 1QVGA 4DR6Q 2ZTCA 3TQYA 1H9SA 3B6YA 5C44B 2QF7A 2A74C 4CDFC 3BDOA 2OQ0A 3QO2A 4ZRZA 3BG3A 4B3RL 2GA4B 3TP6A 4JCVE 1JOKA 5IOCA 4JI0Q 4C2MB 1SE4A 1EY5A 3IFTA 2IX0A 3T56B 4JI4Q 2MQHA 4Y7NH 1YJ9A 1MIUA 1UE6A 4A3MB 4BY7H 1GKHA 2F3IA 1CKNB 4JVZA 2Z1CA 2K6AA 2RF4A 4HAEA 1I6HH 4Y52H 3T13A 1BKBA 1W6KA 2NUCA 5C0XI 3HOYH 1VQNA 1E1TA 5IYBG 1I3QB 1A8VA 4N9TA 3IL8A 4K2KA 4JV5L 2F0EA 1VQEA 3MAQA 5D14A 2JA6G 1V1PB 3M7NA 1HA6A 1QNUA 1S5ED 3JC66 3I73A 2E2JB 2UXBQ 2R61A 3GDEA 3W1GA 4DKAC 1I5FA 1MBYA 2VW9A 1BBUA 2H5XA 4BY1B 1PH6A 3K5LA 1VCIA 3A7LA 4UP7A 3IAYA 2XN9C 1VDZA 4LUZA 4A3GH 1SYBA 1SRUA 1XMOQ 3OIPA 3SR1A 4JI7Q 1K8GA 2BA1A 1WTHA 2CQAA 4QIWE 4JBKA 3ND9A 2V4DA 3S1RB 1UAPA 2SOBA 4J6HA 2RSOA 1V43A 3T1HQ 1A3VA 2EYJA 1LTRD 1GOZA 4HR7B 2YU9H 1E2VA 4QB4A 4IZ8A 1K83B 4KHVA 4PMCA 4DV5Q 4JI7L 3GTGB 4AYBB 4TSSA 4UP9A 3OW7A 2RQXA 4KKSA 1S5DD 5IGFA 4Q5VA 1UNSA 3JAMi 1ZKOA 2Z8LA 3M4OH 1AP0A 3EJIA 2ALYB 1S5FD 3AMUA 1X3FA 1YHBA 4PQXA 3T1HL 2IW3A 1PZJD 3D6WA 3PO3G 4MTNA 2A73B 3MZ5A 1EZ6A 2RBMA 2EY5A 3E3XA 2IX3A 1SMXA 1VQ8A 3S15B 2CHBD 2X6GA 4HSPA 1LT6D 4P74A 2SNMA 3E5SA 1X55A 4JI8L 3X3NA 1YNNC 3CQZH 1F2YA 1SYDA 2XNAC 5FO9B 4DV7Q 1SEBD 2VUMB 5C3EB 3H3VI 4DNRB 3M4YA 4GOPA 2K50A 1JJCB 4P75A 4RAUC 2Q8IB 1CM9A 1HZCA 1TT2A 5AFWA 2F0NA 4OWWB 4J15A 2ASBA 3A55A 4H0LC 2EE1A 3ICEA 2ZXRA 3I55A 2F0DA 5D65A 1PH9A 3WDNA 1SNCA 4XYOA 4HJAA 4M1UB 1RODA 2E2HB 1XXGA 1E0BA 1QUQA 2A68D 1EQQA 2EYLA 5IT9L 4MN3A 2G9HD 1RF2D 2R93G 5LMUQ 2KHSA 1J5EQ 1XYIA 5DM63 1LTBD 4IJLA 1HNWL 2TSSA 1MI2A 4OL7A 4GN3B 4HTHA 3C46A 3T1YQ 5M5XH 4K5WA 4DNTB 1EZ8A 4R8IA 2R92G 1HXYD 4KMUC 1EIHA 2AKWB 2VS1A 5EBDA 4BBSH 1K8AC 2H1EA 3FDTA 3PIP3 3TP8A 1U9RA 3BVZA 3QIAA 4A3FB 2Q8RE 3CCMA 1YNJD 1K8OA 1BO0A 4HJ7A 3FPUB 1J5EL 5HGQA 2KQ3A 1V1QA 5E1FA 3NBIA 1B8AA 3T53B 3F8TA 4A3KG 4A3BH 3I4OA 4DV1Q 1E22A 1E3PA 1XTCD 1YVCA 2A6HD 2B2UC 4RH6A 4JOIA 1KLGD 1DOLA 3D3RA 2R7FA 4O0AA 2LY7A 1R9TB 3PO2H 4A75A 1N9WA 1Q12A 3KF6B 4XQJA 1LTGD 2E2IB 1AEXA 3PUVA 2AHOB 1J8IA 2OQKA 1G51A 3CKIB 4TQUS 2Q2TA 1NR4A 3J81L 2SEBD 4A93B 3S2DH 4ZYSA 4X64Q 4FO2A 2Z9HA 4IO9A 2PZUA 5JOBA 1CSPA 3L7ZC 3NELA 4XIGS 1DZ1A 1DGSA 2VB2X 2F4VQ 5FO8B 3R2IA 3RZOH 1I4QA 4IURA 3RNUA 4LNQA 2XTIA 5EPJA 3PF4A 2JA5B 4DK6C 1F2ZA 1SMYD 2PNHA 3HGBA 4ZUJA 2I5HA 3AU7A 1ILQA 4X64L 5C4ZA 2X69A 2PQAB 5CBAE 1KNEA 5KEEA 2F3WA 3TREA 3STBD 4FF2A 2EYFA 4R4IA 4C3HH 4GNXC 1NY4A 1STAA 1PLFA 1EFWA 1IBKQ 4LF8Q 3S14B 5IYDG 3DLLA 3D0FA 1PTOD 4A3DB 2DNCA 3J81j 1S72A 3TN2A 1UEAB 2L15A 4GZYC 2K04A 1VQKA 2K5QA 3AFQA 3T51B 3S1QB 5EPLA 4PMWA 4OHJA 2R7ZB 5BN5A 3V05A 1BXTA 1CHPD 2ID0A 4AYBG 1ENCA 3BVMA 3TZDA 1IZ6A 3I70A 4BWGB 2VQFQ 2IY5B 4A3IB 1UWVA 5C0XG 2Z4HA 3PIPA 5M5WB 1IBKL 4LF8L 1T5XD 2L4NA 3LX0A 3HP3A 4QF4A 2UUBQ 2ZJRA 1CSQA 4OIJA 3KLSX 4C3IB 2EYMA 3FP9A 1LLRD 3I56A 2Z6KC 2HHHQ 4P2CB 4AYBE 1X6OA 2VQFL 1V1OA 4ZKBB 2VUMG 1C9OA 5C3EG 1SLJA 2EJMA 4JI6Q 3MA2B 4RCNA 4A76A 4KJNA 3N52A 3GTPH 1Q8KA 5IYCH 2UUBL 5E3FA 2RHQB 2F0GA 3D4DA 2SDFA 2HUGA 2YTVA 1QCBD 3GTKH 1KABA 3UE1A 1AW7A 4GS3A 2N8NA 1SNMA 2B8FA 3UDXA 2DUDA 3K57A 3S2HH 1CTMA 1ICWA 2EY1A 3U9OA 3MXPA 4KN7C 1BR9A 3RLOA 2MNAA 1ET6A 1K28A 4ZQ3A 1Q90A 3GTLH 4JBWA 4X65Q 1PTOB 2ZTEA 3I4NB 3ND8A 2JEAI 5IE8A 4KHZA 2JA7H 3CCSA 2HD3A 1WTXA 3GTQB 5C0XJ 4CGYB 2CCZA 1Y1VH 1CUKA 1U4LA 2OTJA 1PRTC 4ZKCB 1PV4A 1FNUA 3KYHC 3NWTA 3OPOA 5C4HA 2WAQG 3F1ZA 5I9OA 1KNAA 1IYVA 4GLXA 1BQQT 1Q46A 3RZDB 4KTAA 4H7BA 3G7LA 4KLKA 4C56C 4X65L 4JI1Q 3VA5A 1VQ5A 5IWAQ 3KK7A 2Y0SG 2JA8H 5GADC 1CI3M 3JAME 3H0GG 5IT9c 2F0SA 2BE5C 3K5NA 4GKJQ 4WJWA 3MWYW 2JJQA 1DJRD 2XRSD 2EJGC 5TSSA 4LW1A 3BZKA 3K7UC 3NHHA 2ICEC 3HOVB 1EU3A 1JR0D 5L37A 4R1JA 2JP1A 1TIID 3I4MH 3RN2A 4RKBA 4TRDA 2F0MA 1AE2A 4FXGC 2XSCA 2D62A 1TVXA 1VQJA 5JJZA 2IWHA 5KNDA 3OSOA 4GKJL 2A5HA 2AQ2B 3C3LA 3AEVA 1VF5C 2VB3X 5M3FB 4OXPA 4TVAB 2JA5G 4R4TA 1JWSD 5EQ0A 3Q6SA 4DR2L 2K05A 3VYUA 1C0AA 1N32Q 2IX1A 4GLAC 1LO5D 5JPNC 2WACA 1Q86C 1AE3A 3WWVA 3PV0A 3TP5A 2K4KA 3A8KE 1N33Q 5KYLA 1V9PA 4PG3A 5IP7G 4FP5D 3S1NB 2NVYH 3UDFA 1CA5A 1WTQA 3J81c 5JJKA 2ZM6Q 2R7ZG 2K14A 4DK3C 3T4AC 3HOXH 1BOSA 2AUKA 2JA6B 4A3JH 4BS9A 1IBLQ 1N32L 1EL0A 1PTOF 1SYEA 1X32A 4MNOA 5CYUA 1HZAA 5CV4A 4A3IG 1A2TA 5M3MH 4QGUA 4XTCS 5ISRA 1HNXQ 4ZUIA 2NVQH 2CWPA 1K9MC 4BXXG 1QJOA 3BJUA 3CXCA 2UUCQ 2VQEQ 1KRTA 4CKBA 1EEID 3ULPA 3HOZH 3VR5A 3ER0A 2ZM6L 1XJVA 4IFDI 2BOSA 2QW7A 2B2VC 1Z9FA 3ULLA 1LTID 1ZXTA 3AQQA 1EY8A 2K5VA 3CAMA 2VXWA 2DY8A 4ODGA 1HZ9A 4F87A 3OTOQ 1HNXL 2NN6H 1XNQL 3CRKC 1L1OB 3MTSA 1A15A 3NTKA 2UUCL 3U50C 2WFWA 4DUYQ 3M3YH 4FXDA 4KHPQ 2F52A 1Y69U 3CRLC 4B3TL 5K36G 1BCPD 2KOLA 3VA7A 1EQVA 1D5MC 4G7OC 2D0PA 4Y7NB 5A35A 2PO4A 3IKJA 4C3JH 3QG1A 1VQPA 3QJYA 3AB9A 2RCFA 1M90C 3OTOL 4YCUA 4FF1A 4JBMA 3SK4A 1SNDA 5FKAC 4ULLA 3J80L 1PFMA 1N34L 1IYUA 4KN4C 4X66Q 3HOYB 1KL9A 5GAHC 5LMNQ 1CKOA 1UEBA 3HOUG 3KUPA 2N3SA 2OEOA 1VQDA 1LTTD 2WKDA 1S4ZA 2CH4W 3HOWG 3K59A 1HA5A 1Q1BA 3E9IA 5GROA 1TWGH 3AFPA 2EY6A 1OXXK 2ZJPA 1TWCB 3SK8A 2L12A 1NR2A 4R4QA 1TWFH 1O78A 2E8GA 1IBML 5LMNL 3QB3A 3D4WA 4C1NI 1HQMC 3HKZG 4B08A 4A3GB 2UXDQ 1LABA 2L5TA 3C2PA 1D2BA 4HMJA 3A54A 2FINB 1D5ZC 3GP7A 1HHVA 4B3RQ 3MFGA 2K33A 4KY5A 1YNXA 3J7AV 4BBRG 2F0KA 5JEAH 3HOVG 1EFID 4RMFA 1E24A 2R92B 2YU9B 1D6EC 1GUGA 1GO3E 2BH8A 1NMFA 1LTAD 1FYCA 4X3KA 1CHQD 4XT1B 3CHBD 3H3VC 2UXDL 3MC0B 2NVXB 3GTMB 3A74A 4IUNA 2HQLA 1BCPB 3E0EA 3KF8B 4AQYL 2MJ8A 4JI5L 1KTKA 1IKLA 1Y8PB 1I6VC 3M4OB 2F0HA 1Y1WH 1Q7YC 1HQRD 1GM5A 1SNOA 4ZCKA 5M3FG 4A3KB 1I4RA 1W6JA 3P20A 2KECA 4JV5Q 1IL8A 5ELBA 2FXQA 1PHJA 4POGA 3TMEA 2A8VA 1LM0A 1ET9A 1TWHB 2GVAA 1JJ2A 3K58A 4KK7A 1PZKD 3CQZB 1G2TA 2J0TD 4CKEA 2F0QA 1II3A 1B1ZA 4KY6A 4ME5A 3SK5A 4ZLTF 2A68C 4DUZQ 2A6ED 2EYPA 3HEJA 5FLXE 2R7DA 3V2TA 4FXKC 2WB1B 4MZ9A 1CFMA 1CK1A 3EIVA 4DAVA 4KD3A 1Y8OB 1HPCA 1GHJA 1STYA 4DAYA
chains in the Genus database with same CATH topology
3NBHA 1ZYRD 2PYKA 1F9SA 4IFDH 1RD9D 3UI2A 4DA2A 2XWJB 1JWMD 3PUWA 3VYRA 1WVLA 3RMHA 4DK1A 2G9DA 1KDCA 5M5XB 1Z47A 1JOOA 4BBSB 4K8JA 1RDPD 5LL6S 1EY4A 1TS2A 2A6HC 1PRTF 4H13C 4FYDA 2K7VA 1H9RA 4CJ2C 2B2UA 4LJZC 4ABNA 4A3BB 1L0YB 1SE3A 5IGDA 5EKKA 1SAPA 3A8JE 3D6CA 2EOTA 1M4VA 4M8AA 2PPBC 1C48A 2CVRA 1BCPF 3S1MB 4Q0FA 1ESFA 1CA6A 5T1GA 3BVGA 4KI0A 4DF7A 3PMFA 5EGTA 4RGOS 3F2UA 1SMYC 4NDXA 3ZYYX 3GTJB 1JQYD 3L9AX 1PYWD 3RZOB 4UDUC 1SSOA 1PTOC 5KGUA 5CV9A 2O2LD 3GO5A 5LHY1 5E4XA 2N55A 2AWOA 3MHBA 4J8QA 4KD4A 3GQBA 2NVTB 5BN4A 1ENAA 1B2TA 3E0JA 2R3ZA 1C8CA 1LTSD 4K6DA 3OWFA 3MXNA 5EKIA 3OIQA 5CV6A 1A3UA 2Z4IA 2B2YC 2WAQB 3NWSA 1ILPA 1RHPA 4V0BA 4V190 2Y0SB 2D9UA 3MXUA 4L63B 4KJOA 4WORA 3H0GB 5EPKA 4ZAIA 5C6AA 4F8MA 1ZEQX 2WV6D 4IFDJ 3A56A 3H6MA 4LAAA 2RDFA 1CZWA 4G57A 1STBA 5C4JB 2XIWA 3V96A 2B39A 2QILA 3S2HB 5ELFA 3S9WA 2CW0D 1UUPA 2EYOA 3HZXA 1OXVA 3EFXD 3NK9A 1SXTA 4XYQA 3CU7A 1Q3LA 2C5CA 2E2DC 3VYTA 2IT1A 1Z7TA 3Q24A 4OO1H 5IIFA 2JA7B 3C1EA 4EGVA 3S17B 2E76C 2ZXPA 2JSOA 5J22A 1LACA 2FHTA 1YNND 3DEOA 2DN8A 1AZPA 1Q8IA 3TZUA 4PMBA 2KUMA 3BDCA 2SNSA 4EQNA 1BNZA 1VMPA 1CQVA 2MGSA 1HUNA 1JB3A 3D8GA 1Y8NB 1JICA 3MEHA 2FMCA 3D31A 3URYA 3I4MB 1WTVA 1K8MA 2BDNA 2FFKB 3R2TA 3TP7A 5I4DA 2K1BA 3I4LA 2EYHA 4BA1I 1HFNA 3K5OA 2MUYA 1V1PA 3LWEA 2NN6I 1JORA 1IW7D 3QOLA 1GJXA 1H9SB 2JE6I 2E75C 3VR6A 3I3CA 1F2LA 2PW7A 4C3HG 1A6XA 2IL8A 4F88A 1EYAA 2D5DA 3HOUB 1G291 3RLFA 5JPMC 4A3JB 1Z6HA 3HOWB 5G3LD 5M3MB 1GUWA 1IKMA 1TY2A 2B2VA 1ML0D 3HOZB 3HKZB 3ONAB 1SYCA 2E74C 4IQZA 2F0TA 3G6JB 1DCZA 5CV7A 4IUQA 3NPPA 1BCPC 2KVMA 1L0XB 2K5DA 2ZXOA 5KRUA 4CJ1B 1WTOA 5A2QE 4EQOA 1DXMA 3GV6A 5CR3A 4BBRB 2EVBA 3M3YB 4HMIA 1FNVA 2FMMA 2HQEA 3HS0C 5FO7B 4C3JB 4RHSA 1Q1EA 4FNFA 4DGZA 3KBGA 1T5EA 1NSNS 4DN4M 1QG7A 2BDOA 2HDMA 2KEEA 1I4PA 1EIGA 1PMRA 1RCVD 4ZK9B 1SE2A 1F9RA 5NUCA 1G8ZD 5C3WA 1JCKB 2KCNA 3GV3A 2RDGA 4K8IA 1MSGA 1TWGB 2H4OA 2MP1A 3KBXA 1BDOA 5BN3A 1TKWB 2RDHA 4QUCA 1QOHA 3NQTA 3DM1A 4XDXA 1EU4A 1SDFA 3HRZC 1MD2D 3NQIA 2NTSA 3VR2A 1WD0A 1KDAA 1HRJA 4K14A 3DEPA 3SK6A 2OXPA 1WD1A 4QMGA 1NCVA 1F9QA 4E6IA 5DEHA 5DM73 4QIWB 2PW5A 5FK9C 1EYCA 2HDLA 1U4PA 4NP5A 3DWPA 1QE6A 1H9KA 1Y1WB 4K6LA 4R8NA 1F9PA 4N9PA 4RFBA 5HURA 1ESRA 3SEBA 3N6RA 5IGCA 4BY7B 2I07B 4TKOB 4L6TB 2C9OA 3M85A 2AUJD 3MVVA 1I4HA 4L8JA 1I6HB 2NZ1D 2XRQD 3NSWA 2LKVA 1DM0B 5CGKA 2ZT9C 3R93A 3KLRA 5ELEA 1RTNA 2BE5D 4G7ZC 3H09A 1O7ZA 2WKCA 1STGA 2RKSA 1PXUA 4B9XA 1GUSA 1HUMA 1GHKA 2LFNA 1S5CD 3RD4A 2B2WC 1D5XC 3JAML 2LS01 3S16B 5G3LF 2K32A 1DYQA 2DNEA 4ID6A 1JC7A 1KDBA 1RKNA 2F3VA 2L9HA 1STEA 2A69D 1KLUD 4WFN3 4DFAA 2NN6G 3NUCA 2AQ3B 1PFBA 2JYOA 1AZQA 5CORA 2XWBB 4KY7A 5I6YA 1FGBD 1MGSA 4BA2I 1SNQA 2PMZB 4YIJA 5K5PA 3K7AB 4C3JG 1CZGA 4K2LA 2R6GA 5COYA 5IT9E 4DXGA 5M9OA 1D1KA 3Q22A 2ICIA 3EROA 3FKIB 4I7ZC 3U9SA 2IPKD 2B2TC 1B50A 2F0UA 3NP8A 4B9WA 4PV1C 3M7GA 4RWSC 2O4XA 2F0LA 3EQLC 1U4MA 3FRPB 4X3UA 3LWUA 1X3QA 1DOKA 3KLSA 1WCMB 2J4XA 4MIUA 5EBCA 3DWQA 1DONA 3DXJC 1MSHA 4A3EB 2QDBA 3OHXC 1IHZA 1YNJC 3BYYB 1NAPA 3P1HA 5JEAG 1FNWA 4CBVA 2KEDA 4LMQD 4X3TA 2B2YA 4HEDA 3J81E 1QB5D 1BF4A 3L3OC 1TS3A 4R9WA 4OO1I 2TMPA 5IODA 3D4RA 4NW2A 2K03A 3OOCA 3VR3A 3NTHA 1B44D 3P75A 4KV6A 3PO2B 2RA4A 4JK1C 1CT1D 2WIIB 2WINB 5CC4A 3QOJA 1EY0A 2CW0C 1HTLD 3TDQA 1G91A 4J1MA 3S2DB 1LV9A 5KNCA 4KKTA 2F0VA 3BYTB 4RGNA 3T16A 2YYZA 3VR4A 5FOBB 4IFDG 1D1IA 5JEAJ 3DMUA 1I4XA 2PZTA 1GXDC 3SE0A 2JEBI 2F0IA 2HCIA 5C5MA 5C4XB 1EEFD 1JWUD 1WTWA 1VF7A 4C3HB 3QWNA 5T1IA 5KIXA 5KYIA 2PQEA 3BZDB 1X3PA 2FJ2A 1O80A 2KCCA 2EY2A 5C5LA 3W3AA 5J39A 4RKLA 3IFDA 1S5BD 1TU2B 2L0CA 1SNPA 1XWEA 4EVOA 1G2SA 5I2YA 1B53A 4NKLA 3SVMA 1WTRA 1IW7C 3W2DA 5FLXL 1C4QA 2AWNA 3H94A 2MHVA 3GTPB 1BBXC 4IUPA 2IJ0A 5C0XH 1SBBB 3A7AB 1R4QB 3GTKB 2BCOA 5F2DA 3HG9A 1AN8A 2QKIC 4OIKA 4DXFA 5DAUA 2K01A 2RSNA 2HCCA 5IGGA 3GTLB 3I8ZA 3SXHA 5I9PA 2NYZD 1B9NA 1KAAA 1OXTA 2M00A 3ERQA 2B8GA 5EJWA 2PCFB 4HN7A 1Y1VB 5JVG3 5I2XA 4FF3A 2EPBA 1SFOB 1V8QA 2OT2A 3TBIB 1H9MA 4WRDA 4OGQC 1CQFA 3NE5B 2F4IA 4ILWA 4XQQA 3KF8A 5E4WC 2JA8B 3VYSA 4G4KA 1BUVT 2EXZA 3K6OA 1OXUA 3DHQA 1AFPA 1FR3A 2N88A 1B9MA 2F0WA 3FPPA 2B63B 5CMDA 4DK0A 1TR5A 3WOEA 4I65A 1A2UA 2OF1A 1LT4D 3FVQA 1TQOA 3PUYA 1R4PB 4IUVA 5C3XA 1PFNA 4RGTA 1WTPA 3PIO3 3BS1A 4IUUA 3OMCA 4QUFA 2M9VA 5CV5A 3DUZA 4OO1G 2KJXA 1LT3D 3SHLA 4K5XA 2D2CC 5J1ZA 2DY7A 4EQPA 1J9OA 1GUOA 1GUTA 2NVYB 4FF4A 1G6ZA 3BDLA 1HCZA 1ONLA 3HOXB 5IGBA 1I4GA 5CV8A 1U4RA 2F0JA 1EWHA 2NWGA 3R8BA 5IGEA 5D3DA 1EY7A 2NVQB 2J7ZA 4X3SA 2F03A 4RHRA 2VNUD 3WOFA 2EZVA 1OO9B 1F2MA 3MXGA 3J80E 2LMCB 3PUXA 1SJHD 4XT3B 4DAPA 1FD7D 4HSVA 3X3MA 5D3IB 4RA8A 3Q23A 3NXWA 1EOTA 3C1FA 2X6LA 2ENBA 3Q0AA 4LK1C 4CHTB 1SYGA 1OXSC 2QCPX 2EJFC 2F0OA 4UAIA 2QEJC 4F7XA 3RUZA 4O42A 4H44C 1EYDA 4FVMA 1TS5A 2K28A 4PNYA 3DWAA 1HTPA 2M2LA 3R3OA 2L1BA 4IALA 3GTOB 3I91A 2B2WA 3J7AF 1SYFA 5ELCA 5ELDA 1TWAB 2KA7A 4CJ0B 4HCSA 1JE4A 3GD7A 5K36H 4S3SA 2A69C 3ITPA 1TWFB 1O7LA 1JOQA 2NBFA 1VMCA 3LNNA 1EY6A 1A3TA 4C1NK 2F1MA 1LT5D 2I46A 1PTOH 5DNFA 1E2WA 2O5JC 4CKCA 4IUTA 1QNKA 1QWYA 3OWEB 2XVSA 5JAVA 1I50B 4O1NA 2PZWA 4XQNA 2B2TA 4C3IG 1EWCA 2JXMB 4G7HC 2RVLA 1PRTD 1PDQA 1GUNA 1EQTA 1F77A 2F0FA 2A6EC 1QILA 1STHA 1HFGA 1PZID 2Q8TA 3P7JA 2L55A 2PNRC 1RTOA 3I72A 1ZYRC 3H91A 1NUCA 4Z9CB 5KNBA 1B3AA 3SDZA 1H9JA 1O7YA 2NTTA 2AQ1B 5M5YB 4QCLA 4NMZA 3EA6A 3FMCA 2MPMA 2BA0A 3K5MA 1TS4A 3PO3B 3K0YA 4RCOA 1ENFA 1TY0A 5CBEE 4IN3A 1SJED 1STNA 4U68A 3O13A 5EKLA 1DOMA 1RJTA 2WP8J 5HGTA 1B4OA 3OMGA 5A2QL 3EVQA 3NTIA 1EY9A 2L11A 3E6ZX 1M8AA 4K5VA 1XX8A 4DU9A 2NB0A 2EDGA 1DD2A 2F0PA 1E2ZA 4KKUA 1PRTB 3MFYA 4MHEA 4HCEA 3J7YW 3I90A 2K5WA 4XXEA 2R93B 3PUZA 5LL6X 4U673 3TSSA 2O5IC 3A8IE 5JVH3 5I6WA 3FEWX 4RGMA 1H9SA 5C44B 2QF7A 2A74C 3BDOA 3QO2A 4ZRZA 3BG3A 2GA4B 3TP6A 1JOKA 5IOCA 4C2MB 1SE4A 1EY5A 3IFTA 2IX0A 3T56B 4A3MB 2Z1CA 2K6AA 4HAEA 3T13A 1W6KA 2NUCA 5C0XI 1I3QB 4N9TA 3IL8A 4K2KA 2F0EA 3MAQA 5D14A 1V1PB 3M7NA 1HA6A 1QNUA 1S5ED 3I73A 2E2JB 2R61A 1MBYA 4BY1B 3K5LA 1VCIA 3A7LA 3IAYA 2XN9C 1VDZA 1SYBA 3OIPA 3SR1A 2BA1A 2CQAA 3ND9A 2V4DA 3S1RB 1UAPA 2SOBA 4J6HA 2RSOA 1V43A 1A3VA 2EYJA 1LTRD 1GOZA 4HR7B 1E2VA 4QB4A 4IZ8A 1K83B 4KHVA 4PMCA 3GTGB 4AYBB 4TSSA 3OW7A 2RQXA 4KKSA 1S5DD 5IGFA 4Q5VA 1UNSA 1ZKOA 2Z8LA 1AP0A 3EJIA 1S5FD 3AMUA 4PQXA 2IW3A 1PZJD 3D6WA 2A73B 3MZ5A 1EZ6A 2RBMA 2EY5A 2IX3A 3S15B 2CHBD 2X6GA 4HSPA 1LT6D 2SNMA 3E5SA 3X3NA 1YNNC 1F2YA 1SYDA 2XNAC 5FO9B 1SEBD 2VUMB 5C3EB 4DNRB 3M4YA 4RAUC 2Q8IB 1CM9A 1TT2A 5AFWA 2F0NA 3A55A 4H0LC 2EE1A 2ZXRA 2F0DA 5D65A 3WDNA 1SNCA 4XYOA 4M1UB 1RODA 2E2HB 1XXGA 1E0BA 2A68D 2EYLA 5IT9L 4MN3A 2G9HD 1RF2D 2KHSA 1XYIA 5DM63 1LTBD 2TSSA 1MI2A 4OL7A 4HTHA 3C46A 4K5WA 4DNTB 1EZ8A 4R8IA 1HXYD 4KMUC 1EIHA 5EBDA 2H1EA 3FDTA 3PIP3 3TP8A 1U9RA 3BVZA 3QIAA 4A3FB 2Q8RE 1YNJD 1K8OA 1BO0A 3FPUB 2KQ3A 5E1FA 3NBIA 3T53B 1XTCD 2A6HD 2B2UC 4RH6A 1KLGD 1DOLA 3D3RA 2LY7A 1R9TB 1Q12A 4XQJA 1LTGD 2E2IB 1AEXA 3PUVA 1J8IA 3CKIB 4TQUS 4A93B 1NR4A 3J81L 2SEBD 4ZYSA 4FO2A 2PZUA 5JOBA 3L7ZC 4XIGS 1DZ1A 2VB2X 5FO8B 3R2IA 1I4QA 4IURA 5EPJA 2JA5B 1F2ZA 1SMYD 3HGBA 4ZUJA 3AU7A 1ILQA 5C4ZA 2X69A 5CBAE 5KEEA 1KNEA 2F3WA 4FF2A 2EYFA 1STAA 1PLFA 3S14B 1PTOD 4A3DB 2DNCA 3TN2A 1UEAB 4GZYC 2K04A 2K5QA 3T51B 3S1QB 5EPLA 4PMWA 4OHJA 2R7ZB 5BN5A 3V05A 1BXTA 1CHPD 2ID0A 1ENCA 3BVMA 3TZDA 3I70A 4BWGB 4A3IB 5C0XG 2Z4HA 5M5WB 1T5XD 2L4NA 3LX0A 3HP3A 4QF4A 4OIJA 3KLSX 4C3IB 2EYMA 1LLRD 4P2CB 1V1OA 4ZKBB 2EJMA 3MA2B 4RCNA 4KJNA 3N52A 5E3FA 2F0GA 3D4DA 2SDFA 2HUGA 1QCBD 1KABA 1AW7A 1SNMA 2B8FA 3K57A 1CTMA 1ICWA 2EY1A 3U9OA 3MXPA 4KN7C 1BR9A 1ET6A 4ZQ3A 1Q90A 4JBWA 1PTOB 3I4NB 3ND8A 2JEAI 4KHZA 1WTXA 3GTQB 5C0XJ 4CGYB 1U4LA 1PRTC 4ZKCB 1FNUA 3NWTA 3OPOA 5C4HA 5I9OA 1KNAA 1IYVA 1BQQT 3RZDB 4KTAA 4H7BA 3G7LA 4C56C 3VA5A 3KK7A 1CI3M 3JAME 2F0SA 2BE5C 3K5NA 4WJWA 3MWYW 1DJRD 2XRSD 2EJGC 5TSSA 3NHHA 2ICEC 3HOVB 1EU3A 1JR0D 2JP1A 1TIID 4RKBA 4TRDA 2F0MA 4FXGC 2XSCA 2D62A 1TVXA 5JJZA 2IWHA 5KNDA 3OSOA 2A5HA 2AQ2B 3C3LA 1VF5C 2VB3X 5M3FB 1JWSD 5EQ0A 3Q6SA 2K05A 3VYUA 2IX1A 1LO5D 5JPNC 2WACA 3PV0A 3TP5A 3A8KE 5KYLA 4FP5D 3S1NB 1CA5A 1WTQA 3T4AC 1BOSA 2AUKA 2JA6B 4BS9A 1EL0A 1PTOF 1SYEA 1X32A 5CYUA 5CV4A 1A2TA 4XTCS 5ISRA 4ZUIA 1QJOA 4CKBA 1EEID 3VR5A 4IFDI 2BOSA 2B2VC 1LTID 1ZXTA 1EY8A 2VXWA 2DY8A 4ODGA 4F87A 2NN6H 3CRKC 3MTSA 1A15A 3NTKA 4FXDA 1Y69U 3CRLC 5K36G 1BCPD 2KOLA 3VA7A 1EQVA 1D5MC 4G7OC 4Y7NB 5A35A 2PO4A 3IKJA 3QG1A 3QJYA 3AB9A 4FF1A 3SK4A 1SNDA 5FKAC 4ULLA 3J80L 1PFMA 1IYUA 4KN4C 3HOYB 3KUPA 2OEOA 1LTTD 2WKDA 1S4ZA 3K59A 1HA5A 1Q1BA 2EY6A 1OXXK 1TWCB 3SK8A 2L12A 1NR2A 1O78A 3QB3A 3D4WA 4C1NI 1HQMC 4B08A 4A3GB 1LABA 2L5TA 3C2PA 1D2BA 4HMJA 3A54A 2FINB 1D5ZC 3GP7A 1HHVA 3MFGA 2K33A 4KY5A 3J7AV 2F0KA 5JEAH 1EFID 2R92B 2YU9B 1D6EC 1GUGA 1LTAD 1FYCA 4X3KA 1CHQD 4XT1B 3CHBD 3H3VC 3MC0B 2NVXB 3GTMB 4IUNA 1BCPB 2MJ8A 1KTKA 1IKLA 1Y8PB 1I6VC 3M4OB 2F0HA 1HQRD 1SNOA 4A3KB 1I4RA 1W6JA 3P20A 2KECA 1IL8A 5ELBA 3TMEA 1ET9A 1TWHB 3K58A 4KK7A 1PZKD 3CQZB 1G2TA 2J0TD 4CKEA 2F0QA 1II3A 1B1ZA 4KY6A 4ME5A 3SK5A 4ZLTF 2A68C 2A6ED 2EYPA 3HEJA 5FLXE 3V2TA 4FXKC 2WB1B 1CFMA 1CK1A 4DAVA 4KD3A 1Y8OB 1HPCA 1GHJA 1STYA 4DAYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0J A;  3NP8 A;  4J6H A;  3SXH A;  4B9W A;  5I9P A;  5I9O A;  2PYK A;  1A3V A;  2OEO A;  1KAA A;  5KRU A;  2EYJ A;  1ENA A;  4N9P A;  4EQO A;  4PMB A;  2O4X A;  2M00 A;  2F0L A;  3DMU A;  1EY7 A;  3ERQ A;  5CR3 A;  5HUR A;  3BDC A;  5IGE A;  2SNS A;  4HMI A;  4EQN A;  4QB4 A;  4KJN A;  4IZ8 A;  2PZT A;  5IGC A;  4KHV A;  4PMC A;  4K6D A;  2F0I A;  2F0G A;  2EY6 A;  5E3F A;  3D4D A;  3OWF A;  5C5M A;  1KDC A;  3MVV A;  1F2M A;  3SK8 A;  5JAV A;  2WAC A;  5CV6 A;  1A3U A;  2HQE A;  5I6W A;  3D8G A;  5IGF A;  2LKV A;  3TP5 A;  1AEX A;  1KAB A;  1JOO A;  5CGK A;  5KYL A;  4WRD A;  3QB3 A;  3D4W A;  3MEH A;  3EJI A;  4K8J A;  1SNM A;  2PZW A;  5KIX A;  1EY4 A;  4MIU A;  2PQE A;  5KYI A;  2EY1 A;  3U9O A;  3MXP A;  3TP7 A;  3MZ5 A;  4HMJ A;  4DGZ A;  1EZ6 A;  2RBM A;  2EY5 A;  2PZU A;  1STG A;  2RKS A;  5JOB A;  4ZQ3 A;  3TP6 A;  1NSN S;  2QDB A;  4B9X A;  2EY2 A;  2EXZ A;  2F0F A;  4KJO A;  1JOK A;  5IOC A;  4WOR A;  5C6A A;  1IHZ A;  1SYE A;  4F8M A;  2SNM A;  2EYH A;  3DHQ A;  3E5S A;  4KY5 A;  1STH A;  3NXW A;  5CV4 A;  5C5L A;  1A2T A;  1EY5 A;  1F2Y A;  3P1H A;  3C1F A;  1SYD A;  5J39 A;  2F0K A;  2ENB A;  5IGD A;  5ISR A;  5EKK A;  4ZUI A;  2F0W A;  4RKL A;  5NUC A;  1JOR A;  1F2Z A;  5C3W A;  3D6C A;  3H6M A;  3QOL A;  1SNP A;  4LAA A;  2RDF A;  1NUC A;  4ZUJ A;  4K8I A;  1SYG A;  5KEE A;  1TT2 A;  4G57 A;  5C4Z A;  1TR5 A;  2F0N A;  4I65 A;  1A2U A;  4IUN A;  4EVO A;  3T13 A;  5C4H A;  2F0O A;  2F3W A;  4ID6 A;  1STB A;  3RUZ A;  4F7X A;  3NQT A;  1KDB A;  1RKN A;  2EYF A;  2F3V A;  2OF1 A;  2PW7 A;  1EYD A;  2NUC A;  2F0D A;  4KTA A;  4H7B A;  5IOD A;  4NMZ A;  1STA A;  4NKL A;  2F0H A;  4DF7 A;  1SNC A;  4N9T A;  1TQO A;  4PNY A;  1EY8 A;  3VA5 A;  3PMF A;  4K2K A;  4R8N A;  1SNO A;  5EGT A;  4DFA A;  1EYA A;  4ODG A;  3S9W A;  5C3X A;  3NUC A;  2EYO A;  3HZX A;  2EYL A;  3R3O A;  4NDX A;  3NK9 A;  2F0E A;  1KDA A;  4IAL A;  4K14 A;  3P75 A;  3TME A;  2KHS A;  2F0S A;  3OMC A;  4KY7 A;  5I6Y A;  1SYF A;  3SK6 A;  2OXP A;  1STN A;  5CV5 A;  1ENC A;  4QMG A;  4KV6 A;  4OL7 A;  4HTH A;  4E6I A;  1SNQ A;  5DEH A;  4K5W A;  5IIF A;  1EZ8 A;  1EQV A;  4S3S A;  4YIJ A;  3ITP A;  3C1E A;  3SHL A;  4K5X A;  2F0Q A;  3NHH A;  5EKL A;  1II3 A;  5K5P A;  4KY6 A;  4ME5 A;  4K2L A;  5CC4 A;  5HGT A;  3SK5 A;  3OMG A;  3QOJ A;  5KGU A;  5J1Z A;  1JOQ A;  1EY0 A;  3EVQ A;  5CV9 A;  3LX0 A;  2PW5 A;  3TP8 A;  1SYB A;  1U9R A;  1EY9 A;  4QF4 A;  3SR1 A;  4EQP A;  2EYP A;  3HEJ A;  4RKB A;  4TRD A;  2F0M A;  5M9O A;  5J22 A;  1EYC A;  4J1M A;  1SYC A;  5F2D A;  4K5V A;  2F0T A;  2EYM A;  3V2T A;  4NP5 A;  1EY6 A;  1A3T A;  3ERO A;  3SK4 A;  3BDL A;  1SND A;  4DU9 A;  2KQ3 A;  5DAU A;  4KD3 A;  3MHB A;  5E1F A;  5CV7 A;  3OSO A;  2F0V A;  4KD4 A;  5IGG A;  2F0U A;  1STY A;  5IGB A;  3T16 A;  2F0P A;  5CV8 A;  2SOB A; 
#chains in the Genus database with same CATH topology
 3NBH A;  1ZYR D;  2PYK A;  1F9S A;  4IFD H;  1RD9 D;  3UI2 A;  4DA2 A;  2XWJ B;  1JWM D;  3PUW A;  3VYR A;  1WVL A;  3TS2 A;  3RMH A;  4DK1 A;  5FJ8 G;  2G9D A;  1HH2 P;  3S16 H;  4DUZ L;  1TXY A;  5IP9 H;  1KDC A;  5M5X B;  2DGY A;  1I94 L;  1Z47 A;  1JOO A;  4HIK A;  2KBN A;  4BBS B;  4OWX B;  4K8J A;  1RDP D;  5LL6 S;  3CPW A;  1EY4 A;  3I7F A;  1TS2 A;  4DR5 Q;  2A6H C;  4X6A H;  1PRT F;  4H13 C;  4FYD A;  4ALP A;  1HR0 Q;  2K7V A;  1H9R A;  4CJ2 C;  2B2U A;  4LJZ C;  3U4Z A;  4FDB A;  4ABN A;  4A3B B;  1L0Y B;  1SE3 A;  1NE3 A;  4HID A;  4JI8 Q;  5IGD A;  5EKK A;  1U5K A;  1SAP A;  3K7A H;  2OCE A;  1VQ9 A;  4BY7 G;  3A8J E;  3D6C A;  2EOT A;  1M4V A;  2MO1 A;  4M8A A;  4YY3 Q;  2PPB C;  4DR5 L;  1S3O A;  1C48 A;  3BU2 A;  4DV3 Q;  3AYH B;  2CVR A;  1BCP F;  2LSS A;  1HR0 L;  3S1M B;  4Q0F A;  3FKI H;  2YTX A;  4UPA A;  3HOY G;  1ESF A;  1CA6 A;  5T1G A;  1X54 A;  3BVG A;  4KI0 A;  3CCE A;  4DF7 A;  5C44 H;  1L2F A;  1VQL A;  3PMF A;  5EGT A;  4RGO S;  3F2U A;  1PH5 A;  1SMY C;  4NDX A;  1YHQ A;  3ZYY X;  3GTJ B;  1VQC A;  4LFC L;  1JQY D;  3M4Q A;  4YY3 L;  3L9A X;  4OON A;  3STB C;  1PYW D;  4DV3 L;  1A63 A;  3RZO B;  4UDU C;  1N8R C;  1HNW Q;  1LUZ A;  2RHS B;  1SSO A;  4A3M H;  1PTO C;  3CMA A;  3A0J A;  5KGU A;  1WCM H;  4R4O A;  2AMC B;  4GNX A;  5CV9 A;  4A3G G;  2O2L D;  1BBW A;  4MTK A;  3GO5 A;  3UE0 A;  1QVF A;  5JJI A;  5LHY 1;  4L5R C;  5E4X A;  1YBY A;  1A62 A;  1O7I A;  2N55 A;  4A3E H;  1T9H A;  2AWO A;  1I3Q H;  2N49 A;  3MHB A;  4J8Q A;  4KD4 A;  1XPR A;  4N8F A;  3GQB A;  3J80 c;  2NVT B;  1B7Y B;  5BN4 A;  1ENA A;  1XNR L;  1B2T A;  2A1A A;  3E0J A;  2R3Z A;  2E2J H;  1C8C A;  1LTS D;  4K6D A;  3OWF A;  3MXN A;  4BY1 H;  5EKI A;  3OIQ A;  5CV6 A;  1A3U A;  2Z4I A;  2B2Y C;  2WAQ B;  3NWS A;  1X9N A;  1ILP A;  3CCV A;  1RHP A;  4V0B A;  4V19 0;  2Y0S B;  4A4I A;  2JK8 A;  2D9U A;  3MXU A;  4L63 B;  4KJO A;  3U4V A;  4WOR A;  3H0G B;  4GLV B;  5EPK A;  4ZAI A;  5C6A A;  4F8M A;  1ZEQ X;  1VQ7 A;  1SN8 A;  1KHI A;  2WV6 D;  1PA6 A;  4IFD J;  4NXN L;  3A56 A;  4JPB W;  2JA9 A;  2CWA A;  3H6M A;  1K83 H;  1PH7 A;  4LF5 L;  4LAA A;  2RDF A;  1CZW A;  1NBW A;  2N78 A;  1KD1 C;  1SR3 A;  4G57 A;  2OWO A;  3KJO A;  4P73 A;  1STB A;  2WB1 G;  2G5D A;  2IHE A;  1G6P A;  5C4J B;  2QEX A;  2VY3 A;  2XIW A;  3V96 A;  2B39 A;  2QIL A;  3S2H B;  5ELF A;  3S9W A;  2CW0 D;  1UUP A;  2EYO A;  3HZX A;  1OXV A;  3EFX D;  3NK9 A;  1SXT A;  4XYQ A;  3CU7 A;  1Q3L A;  1EOV A;  1P16 A;  4IJH A;  4GN5 A;  2C5C A;  2E2D C;  4H02 A;  3VYT A;  5IY0 A;  2IT1 A;  5C4X H;  1Z7T A;  3Q24 A;  4L5Q A;  4OO1 H;  5IIF A;  2JA7 B;  3KDF B;  3C1E A;  4BBS G;  4EGV A;  3S17 B;  1VQ6 A;  2E76 C;  2ZXP A;  4JC0 A;  4GN4 B;  2JSO A;  5J22 A;  1LAC A;  2EQS A;  2FHT A;  2B29 A;  1YNN D;  3DEO A;  2DN8 A;  4NPS A;  1K0R A;  1AZP A;  1Q8I A;  4LFA L;  4A3B G;  1NTG A;  3KJP A;  3TZU A;  2E2H H;  4PMB A;  1VQ4 A;  3OW2 A;  2KUM A;  3M4P A;  4GKK Q;  2Z0S A;  3BDC A;  2SNS A;  4EQN A;  1BNZ A;  1VMP A;  1CQV A;  2MGS A;  1L1O C;  1HUN A;  1JB3 A;  3CC4 A;  5FLM H;  4YCV A;  4DR3 L;  3D8G A;  1Y8N B;  1JIC A;  1CKN A;  2DJG C;  3MEH A;  2FMC A;  4AIM A;  3PF5 A;  3D31 A;  4A3F H;  3URY A;  3I4M B;  1WTV A;  1Y14 B;  1K8M A;  2BDN A;  4LWC A;  1VQM A;  2FFK B;  4GKK L;  3R2T A;  3TP7 A;  1KC8 C;  5I4D A;  2K1B A;  1PH1 A;  3I4L A;  2EYH A;  5GAE C;  4BA1 I;  1HFN A;  3K5O A;  1ASZ A;  2MUY A;  1V1P A;  3LWE A;  2NN6 I;  1JOR A;  1EYG A;  1IW7 D;  3QOL A;  2B3G A;  1R9T H;  2GVB A;  1GJX A;  1H9S B;  4DV4 L;  2JE6 I;  2E75 C;  3VR6 A;  3I3C A;  1F2L A;  2PW7 A;  4C3H G;  1C7Y A;  1A6X A;  4DR1 L;  2IL8 A;  4A93 H;  4F88 A;  1EYA A;  2D5D A;  3HOU B;  4DV0 Q;  2QGQ A;  3W5O A;  1G29 1;  3RLF A;  5JPM C;  4A3J B;  1Z6H A;  3HOW B;  2NZO A;  1H95 A;  2QDL A;  5G3L D;  4LF6 L;  5M3M B;  1XMQ L;  1SFO H;  1GUW A;  3CCR A;  1IKM A;  1TY2 A;  4IPC A;  2B2V A;  4A3L H;  1ML0 D;  1D8L A;  1B3Q A;  3HOZ B;  3L0O A;  3ONA B;  1VQG A;  1SYC A;  2E74 C;  3HKZ B;  2F0T A;  4IQZ A;  4DV0 L;  3G6J B;  1DCZ A;  3OYY A;  5CV7 A;  4IUQ A;  3J81 i;  3NPP A;  4A3D H;  1BCP C;  2KVM A;  1L0X B;  2K5D A;  2WAQ E;  2ZXO A;  5KRU A;  4K0K L;  4CJ1 B;  3S1Q H;  1WTO A;  1BVS A;  5A2Q E;  4EQO A;  3CCJ A;  1DXM A;  3GV6 A;  5CR3 A;  4BBR B;  2I0Q A;  2EVB A;  3M3Y B;  4HMI A;  1FNV A;  5IYC G;  2B63 H;  2FMM A;  4DR2 Q;  1GVP A;  1MJC A;  2Y0S E;  1QZH A;  2HQE A;  5M5W H;  3HS0 C;  5FO7 B;  4C3J B;  2K5N A;  4RHS A;  4C3I H;  1Q1E A;  4NXM Q;  4FNF A;  4DGZ A;  3KBG A;  1T5E A;  1NSN S;  1QG7 A;  2BDO A;  2HDM A;  2KEE A;  4DN4 M;  2HT1 A;  1I4P A;  3G6E A;  1EIG A;  1PMR A;  2D0O A;  1RCV D;  2CH4 A;  2JA7 G;  4ZK9 B;  1SE2 A;  1F9R A;  1W2B A;  5NUC A;  1G8Z D;  1Y1V G;  5C3W A;  1JCK B;  1YJW A;  2KCN A;  3GV3 A;  2RDG A;  4K8I A;  1MSG A;  4NXM L;  1TWG B;  2H4O A;  4LUV A;  3EN2 A;  3G71 A;  3KBX A;  2MP1 A;  1BDO A;  4QUC A;  1TKW B;  2RDH A;  5BN3 A;  1YIJ A;  1QOH A;  3NQT A;  4P71 A;  3DM1 A;  1IL2 A;  4XDX A;  1EU4 A;  1SDF A;  1VQB A;  3HRZ C;  1MD2 D;  2I5L X;  4OWT B;  2JA8 G;  1YEZ A;  3NQI A;  2NTS A;  3VR2 A;  1WD0 A;  1KDA A;  1HRJ A;  1NJI C;  4K14 A;  1XNQ Q;  4GOP B;  3DEP A;  2ATW A;  4DV2 L;  3I4N H;  3SK6 A;  4DR4 L;  3PQI A;  2OXP A;  1WD1 A;  4QMG A;  1NCV A;  3CCL A;  1F9Q A;  4E6I A;  5DEH A;  4B3T Q;  5DM7 3;  2YTY A;  4QIW B;  1PH8 A;  3I4M G;  2PW5 A;  5FK9 C;  2LXJ A;  1EYC A;  2HDL A;  3KF6 A;  1U4P A;  4NP5 A;  1MHW C;  1QUQ B;  1K3R A;  3RZD H;  4P72 A;  3DWP A;  1QE6 A;  4A3C H;  1H9K A;  4DV6 L;  1WI5 A;  1Y1W B;  1N34 Q;  4OX9 Q;  1ASY A;  4K6L A;  4R8N A;  1F9P A;  2JN4 A;  4JG2 A;  1XPU A;  5E7N A;  4N9P A;  4RFB A;  5HUR A;  1ESR A;  3SEB A;  4JI2 Q;  3N6R A;  5IGC A;  3CPF A;  4BY7 B;  2I07 B;  4TKO B;  4L6T B;  2C9O A;  3M85 A;  2AUJ D;  3MVV A;  1I4H A;  4L8J A;  1I6H B;  2NZ1 D;  2XRQ D;  1X3G A;  3NSW A;  3HOV H;  2LKV A;  1DM0 B;  1MJE A;  5CGK A;  3HKS A;  4JYA L;  1S40 A;  2ZT9 C;  4PZ6 A;  4OX9 L;  2EXD A;  3R93 A;  2JQO A;  3KLR A;  1IBM Q;  4N8X 1;  5ELE A;  1RTN A;  2BE5 D;  4G7Z C;  3H09 A;  2PQA A;  1O7Z A;  2WKC A;  3HOX G;  1STG A;  2RKS A;  3GTO H;  1PXU A;  4B9X A;  4JI2 L;  4A3J G;  1RIP A;  1GUS A;  1HUM A;  1TWA H;  1IXR A;  5M3M G;  1PH4 A;  1GHK A;  2LFN A;  1S5C D;  4QY7 A;  3RD4 A;  4IPH A;  2B2W C;  1YIT A;  1VS0 A;  1D5X C;  2ZTD A;  1FJG Q;  2EIF A;  3K0X A;  3JAM L;  2LS0 1;  3HOZ G;  3S16 B;  5G3L F;  2K32 A;  1VQF A;  1DYQ A;  2DNE A;  4ID6 A;  3L2P A;  2ZJQ A;  1JC7 A;  1KDB A;  1RKN A;  2F3V A;  2L9H A;  1N36 L;  5ELN A;  1STE A;  4R4C A;  4HJ8 A;  4AQY Q;  2V1C C;  4JI5 Q;  2A69 D;  3S1N H;  5IYB H;  1KLU D;  4WFN 3;  4DFA A;  2NN6 G;  3NUC A;  2AQ3 B;  1PFB A;  2JYO A;  3CC7 A;  4IPD A;  1AZQ A;  5COR A;  2JA6 H;  1FJG L;  2XWB B;  4KY7 A;  5I6Y A;  1FGB D;  1MGS A;  5LMN W;  4BA2 I;  1VQH A;  3HKZ E;  1SNQ A;  2PMZ B;  4YIJ A;  1I50 H;  2UXC Q;  5K5P A;  3K7A B;  3ULJ A;  4C3J G;  1CZG A;  4K2L A;  2HIV A;  2R6G A;  5H1S E;  5COY A;  5IT9 E;  1K3B C;  4DXG A;  5M9O A;  1D1K A;  3Q22 A;  2ICI A;  3ERO A;  3FKI B;  4I7Z C;  4UP8 A;  2ES2 A;  3U9S A;  1W3S A;  3PSI A;  3UDG A;  2IPK D;  2B2T C;  1B50 A;  2F0U A;  3CP0 A;  3CCU A;  3NP8 A;  4EX5 A;  4B9W A;  4PV1 C;  2UXC L;  3M7G A;  4RWS C;  1EIF A;  2O4X A;  3A5U A;  2F0L A;  3EQL C;  1U4M A;  3FRP B;  4X3U A;  3QR8 A;  2UUA L;  3LWU A;  4LF4 Q;  4DNI A;  1X3Q A;  1HNZ Q;  1DOK A;  3KLS A;  4DR6 L;  5M5Y H;  1I94 Q;  5AJ3 Q;  1WCM B;  3F2B A;  2J4X A;  3Q8D A;  4MIU A;  5EBC A;  4JBJ A;  4OEL B;  3DWQ A;  3PO3 H;  1DON A;  3DXJ C;  1MSH A;  4A3E B;  4JI0 L;  2QDB A;  3OHX C;  4LF4 L;  1IHZ A;  1HNZ L;  4CDD C;  1YNJ C;  3BYY B;  3F2D A;  3S24 A;  1NAP A;  3P1H A;  4JI4 L;  4QJF A;  5JEA G;  4B3S Q;  4B3M Q;  1FNW A;  4CBV A;  2KED A;  4JI3 Q;  5AJ3 L;  3K80 C;  4LMQ D;  4X3T A;  2B2Y A;  1XTD A;  4HED A;  3J81 E;  3TS0 A;  1QB5 D;  1BF4 A;  1TWC H;  3L3O C;  3MEF A;  1TS3 A;  1LTL A;  1OTC A;  4R9W A;  4OO1 I;  4ME3 A;  2TMP A;  5IOD A;  1Y1W G;  3D4R A;  4HIM A;  4NW2 A;  3F2C A;  3PGZ A;  2K03 A;  3OOC A;  2K5H A;  3VR3 A;  4B3S L;  4HIO A;  3VDY A;  4B3M L;  3J80 i;  3G4S A;  4JI3 L;  3NTH A;  1PYS B;  2UXB L;  1B44 D;  3P75 A;  2R93 H;  4LFC Q;  1IYJ B;  4KV6 A;  5DLQ E;  4NB3 A;  3PO2 B;  2RA4 A;  4POF A;  4JK1 C;  1CT1 D;  2CKZ B;  2WII B;  2R92 H;  2WIN B;  5CC4 A;  1VQI A;  3QOJ A;  1EY0 A;  1XMO L;  2CW0 C;  1HTL D;  1JB7 A;  4PZ7 A;  2NVX H;  3GTM H;  3TDQ A;  1G91 A;  4J1M A;  3S2D B;  2P5Z X;  4APV A;  3RLN A;  1QZG A;  1LV9 A;  5KNC A;  3KFU A;  4KKT A;  2F0V A;  3BYT B;  4A3K H;  4RGN A;  3T16 A;  4C2M H;  2YYZ A;  3VR4 A;  5FOB B;  4IFD G;  1D1I A;  1HR0 W;  5JEA J;  3DMU A;  1I4X A;  1TWH H;  4DV5 L;  1XNR Q;  4L5T A;  2PZT A;  1GXD C;  3SE0 A;  2JEB I;  5IP9 G;  2F0I A;  2K75 A;  4QL5 A;  2HCI A;  5C5M A;  3ZJY C;  5C4X B;  1EEF D;  1JWU D;  1HJP A;  1PYB A;  1WTW A;  1VF7 A;  4C3H B;  3QWN A;  5T1I A;  5KIX A;  4IOA A;  5KYI A;  2PQE A;  3BZD B;  1X3P A;  2FJ2 A;  1O80 A;  2KCC A;  1Q81 C;  2EY2 A;  5J3B A;  1Q82 C;  5C5L A;  4DV7 L;  4YWM A;  3W3A A;  5J39 A;  1L1O A;  3DM3 A;  4RKL A;  4NXN Q;  3IFD A;  1S5B D;  3I2Z A;  1UE7 A;  1TU2 B;  5EAY A;  2L0C A;  1SNP A;  3K81 C;  1XWE A;  2Z6K A;  4LF5 Q;  1L0W A;  4RG1 A;  4EVO A;  3JAM c;  1G2S A;  3FKI G;  4QQB X;  1YJN A;  4WJ4 A;  5I2Y A;  1B53 A;  4NKL A;  1PFS A;  5C44 G;  3SVM A;  2I5M X;  1SE8 A;  1EWI A;  2CFM A;  3BZC A;  3S1R H;  3IRB A;  5IYD H;  2PMZ E;  1WTR A;  1IW7 C;  5LMU L;  1SRO A;  3W2D A;  1UE5 A;  5FLX L;  1E7Z A;  1C4Q A;  2AWN A;  1KQS A;  3H94 A;  2MHV A;  1E1O A;  3T1Y L;  3GTG H;  3GTP B;  1BBX C;  4IUP A;  2IJ0 A;  4IPG A;  5C0X H;  1VQO A;  4A3M G;  1SBB B;  4O2D A;  1WCM G;  3A7A B;  1R4Q B;  3GTK B;  3NEN A;  3W1B A;  1P8L A;  2BCO A;  2KCT A;  3CC2 A;  1WFQ A;  5F2D A;  3S1M H;  3HG9 A;  1AN8 A;  3LGJ A;  3ERS X;  4DAM A;  4A3E G;  2QKI C;  4OIK A;  4DXF A;  5DAU A;  3S15 H;  4DV1 L;  2K01 A;  2RSN A;  1KXL A;  2HCC A;  5IGG A;  2VZA A;  4LFA Q;  3GTL B;  3I8Z A;  3SXH A;  5I9P A;  1QVC A;  2NYZ D;  3GTJ H;  5BR8 Q;  1B9N A;  1KAA A;  2WB1 E;  2HIX A;  2VUM H;  3H15 A;  5C3E H;  5GQO A;  2OTL A;  1OXT A;  2M00 A;  1PVO A;  3ERQ A;  2B8G A;  3TEH B;  5EJW A;  2PCF B;  4HN7 A;  4UHV A;  2GN5 A;  1Y1V B;  4BY1 G;  1NNX A;  1PH2 A;  3KOJ A;  5JVG 3;  5I2X A;  4FF3 A;  2EPB A;  1SFO B;  3E9H A;  4GOP C;  1V8Q A;  4DPG A;  2OT2 A;  3TBI B;  1H9M A;  3CW2 C;  4DR3 Q;  4WRD A;  4OGQ C;  5ELO A;  1CQF A;  1LYL A;  3NE5 B;  2F4I A;  4ILW A;  4XQQ A;  3KF8 A;  5BR8 L;  1M1K C;  5E4W C;  2IHF A;  2JA8 B;  3VYS A;  4G4K A;  1J6Q A;  2F4V L;  2MO0 A;  1BUV T;  2EXZ A;  2NVT H;  1NMG A;  3K6O A;  1OXU A;  3DHQ A;  1AFP A;  3PO2 G;  2YV5 A;  1FR3 A;  2N88 A;  1B9M A;  2F0W A;  4YWK A;  3FPP A;  2B63 B;  5CMD A;  4DK0 A;  3CF5 A;  1B70 B;  1TR5 A;  3HFZ B;  4I65 A;  1A2U A;  3WOE A;  4DV4 Q;  2Q2I A;  2OF1 A;  1LT4 D;  1RL2 A;  3FVQ A;  3SGI A;  1TQO A;  4DR1 Q;  3CD6 A;  3PUY A;  1R4P B;  4IUV A;  3J7Z C;  5C3X A;  1PFN A;  3H3V H;  4RGT A;  1WTP A;  3PIO 3;  3BS1 A;  4IUU A;  1XPO A;  3OMC A;  3H0G H;  4QUF A;  2M9V A;  5CV5 A;  5C4X G;  3G48 A;  3DUZ A;  4OO1 G;  2KJX A;  1A0I A;  1LT3 D;  4JOI C;  4LF6 Q;  3SHL A;  4HJ9 A;  4K5X A;  2E2I H;  1XMQ Q;  3PCO B;  1VQA A;  2D2C C;  4WJ3 M;  5J1Z A;  1KIX A;  2DY7 A;  2K52 A;  3M9B A;  4EQP A;  1J9O A;  1GUO A;  2E5L Q;  1GUT A;  2NVY B;  4FF4 A;  4UY8 C;  2HHH L;  1G6Z A;  5GAG C;  3BDL A;  5C4J H;  1HCZ A;  1ONL A;  3J7A 5;  3HOX B;  5IGB A;  4YCW A;  1I4G A;  4IOC A;  1U4R A;  5CV8 A;  2F0J A;  4JI6 L;  5JJL A;  1EWH A;  2NWG A;  2JA5 H;  4K0K Q;  3R8B A;  5IGE A;  5D3D A;  1EY7 A;  2NVQ B;  2XGT A;  2J7Z A;  4X3S A;  2F03 A;  2CQO A;  4RHR A;  2VNU D;  2E5L L;  3WOF A;  2EZV A;  1OO9 B;  1F2M A;  5FLM G;  3MXG A;  3J80 E;  2LMC B;  3PUX A;  3S17 H;  4CDE C;  1SJH D;  3S14 H;  4A3F G;  5IP7 H;  4XT3 B;  1FL0 A;  4DAP A;  4AH6 A;  4DAY B;  1FD7 D;  3NBH B;  4HSV A;  3X3M A;  5D3I B;  2PI2 E;  2R7Z H;  4RA8 A;  4PZ8 A;  1MKH A;  3Q23 A;  3NXW A;  4A3I H;  1EOT A;  2Q2U A;  1WJJ A;  3C1F A;  2X6L A;  2ENB A;  3Q0A A;  1JJG A;  4LFB Q;  4BXX H;  2UU9 Q;  1GD7 A;  4LK1 C;  4CHT B;  1SYG A;  1WOC A;  2RCN A;  1OXS C;  2QCP X;  2EJF C;  2F0O A;  2QEJ C;  4UAI A;  3RUZ A;  4F7X A;  4O42 A;  1X3E A;  4H44 C;  1EYD A;  4FVM A;  4JI1 L;  4A93 G;  5IWA L;  1EQR A;  1TS5 A;  2K28 A;  4PNY A;  2VL6 A;  3DWA A;  3PIO A;  1HTP A;  2M2L A;  3R3O A;  2L1B A;  4LFB L;  4IAL A;  3GTO B;  3I91 A;  2UU9 L;  2B2W A;  4YWL A;  3J7A F;  1SYF A;  5FLX c;  5ELC A;  5ELD A;  1TWA B;  4DV2 Q;  4DR4 Q;  2KA7 A;  4CJ0 B;  3NEM A;  4HCS A;  1JE4 A;  3GD7 A;  3K8A A;  4S3S A;  5K36 H;  2A69 C;  4YHH Q;  3ITP A;  1TWF B;  1O7L A;  1JOQ A;  4A3L G;  2NBF A;  1VMC A;  3LNN A;  1YZ6 A;  1YHA A;  1K0S A;  1WYD A;  4EQ5 A;  1EY6 A;  1A3T A;  2PI2 A;  2Z6B A;  4C1N K;  2BH2 A;  4A3D G;  2F1M A;  1LT5 D;  2I46 A;  1PTO H;  4DV6 Q;  3RN5 A;  5DNF A;  3HOU H;  1E2W A;  4YHH L;  3GTQ H;  2O5J C;  1EUJ A;  4CKC A;  4IUT A;  3HOW H;  2B63 G;  1QNK A;  4LF7 Q;  4GNX B;  1QWY A;  2KEN A;  3FHW A;  3OWE B;  2XVS A;  5JAV A;  1FGU A;  4L5S A;  1I50 B;  4O1N A;  1N33 L;  1D7Q A;  4LF9 Q;  2PZW A;  4XQN A;  4JYA Q;  2A19 A;  2B2T A;  4C3I G;  1EWC A;  2JXM B;  1X65 A;  1JT8 A;  4G7H C;  2RVL A;  1PRT D;  1PDQ A;  1GUN A;  1HZB A;  1IBL L;  1EQT A;  4LF7 L;  1F77 A;  2F0F A;  1U0L A;  2A6E C;  4CDC C;  1QIL A;  1STH A;  1HFG A;  1KRS A;  3MXN B;  4JW0 A;  1PZI D;  2Q8T A;  3P7J A;  4BBR H;  4LF9 L;  2L55 A;  2PNR C;  1UE1 A;  1RTO A;  2VQE L;  3I72 A;  3A5Z B;  1ZYR C;  3H91 A;  4X62 Q;  1NUC A;  4Z9C B;  5KNB A;  1B3A A;  1X56 A;  3U58 A;  3SDZ A;  1H9J A;  1O7Y A;  2NTT A;  3KDF A;  2AQ1 B;  5M5Y B;  1N36 Q;  4NMZ A;  4QCL A;  1ICF B;  3EA6 A;  3FMC A;  2MPM A;  2BA0 A;  4LUO A;  3K5M A;  1AH9 A;  3TRZ A;  5M3F H;  1TS4 A;  1PH3 A;  3PO3 B;  2C35 B;  4DUY L;  3K0Y A;  4KHP L;  2NZH A;  4I7A A;  3KLW A;  4RCO A;  3I4N G;  1ENF A;  1TY0 A;  4X62 L;  2MFI A;  5CBE E;  4IN3 A;  2Q2H A;  3EBE A;  1SJE D;  1STN A;  4U68 A;  2QA4 A;  4DR7 Q;  3O13 A;  5EKL A;  3CME A;  1DOM A;  1RJT A;  2WP8 J;  5HGT A;  1B4O A;  3OMG A;  5A2Q L;  3EVQ A;  3NTI A;  2KHJ A;  1EY9 A;  2L11 A;  2KCM A;  3UDI A;  1KAW A;  3E6Z X;  1M8A A;  4K5V A;  1XX8 A;  4X66 L;  4DU9 A;  2KHI A;  4A3C G;  2NB0 A;  1YI2 A;  2EDG A;  4OEM B;  3CCQ A;  1DD2 A;  2F0P A;  1E2Z A;  1JMC A;  4DR7 L;  4KKU A;  1PRT B;  2DJF C;  3MFY A;  4MHE A;  1FVI A;  2LXK A;  4HCE A;  3J7Y W;  3I90 A;  5HY6 A;  2K5W A;  4XXE A;  5FJ8 H;  2R93 B;  1EIY B;  3PUZ A;  1CKM A;  5LL6 X;  4U67 3;  1JE5 A;  2UUA Q;  3TSS A;  3RR5 A;  2O5I C;  3A8I E;  5JVH 3;  5I6W A;  3FEW X;  1K73 C;  4RGM A;  4HJ5 A;  1QVG A;  4DR6 Q;  2ZTC A;  3TQY A;  1H9S A;  3B6Y A;  5C44 B;  2QF7 A;  2A74 C;  4CDF C;  3BDO A;  2OQ0 A;  3QO2 A;  4ZRZ A;  3BG3 A;  4B3R L;  2GA4 B;  3TP6 A;  4JCV E;  1JOK A;  5IOC A;  4JI0 Q;  4C2M B;  1SE4 A;  1EY5 A;  3IFT A;  2IX0 A;  3T56 B;  4JI4 Q;  2MQH A;  4Y7N H;  1YJ9 A;  1MIU A;  1UE6 A;  4A3M B;  4BY7 H;  1GKH A;  2F3I A;  1CKN B;  4JVZ A;  2Z1C A;  2K6A A;  2RF4 A;  4HAE A;  1I6H H;  4Y52 H;  3T13 A;  1BKB A;  1W6K A;  2NUC A;  5C0X I;  3HOY H;  1VQN A;  1E1T A;  5IYB G;  1I3Q B;  1A8V A;  4N9T A;  3IL8 A;  4K2K A;  4JV5 L;  2F0E A;  1VQE A;  3MAQ A;  5D14 A;  2JA6 G;  1V1P B;  3M7N A;  1HA6 A;  1QNU A;  1S5E D;  3JC6 6;  3I73 A;  2E2J B;  2UXB Q;  2R61 A;  3GDE A;  3W1G A;  4DKA C;  1I5F A;  1MBY A;  2VW9 A;  1BBU A;  2H5X A;  4BY1 B;  1PH6 A;  3K5L A;  1VCI A;  3A7L A;  4UP7 A;  3IAY A;  2XN9 C;  1VDZ A;  4LUZ A;  4A3G H;  1SYB A;  1SRU A;  1XMO Q;  3OIP A;  3SR1 A;  4JI7 Q;  1K8G A;  2BA1 A;  1WTH A;  2CQA A;  4QIW E;  4JBK A;  3ND9 A;  2V4D A;  3S1R B;  1UAP A;  2SOB A;  4J6H A;  2RSO A;  1V43 A;  3T1H Q;  1A3V A;  2EYJ A;  1LTR D;  1GOZ A;  4HR7 B;  2YU9 H;  1E2V A;  4QB4 A;  4IZ8 A;  1K83 B;  4KHV A;  4PMC A;  4DV5 Q;  4JI7 L;  3GTG B;  4AYB B;  4TSS A;  4UP9 A;  3OW7 A;  2RQX A;  4KKS A;  1S5D D;  5IGF A;  4Q5V A;  1UNS A;  3JAM i;  1ZKO A;  2Z8L A;  3M4O H;  1AP0 A;  3EJI A;  2ALY B;  1S5F D;  3AMU A;  1X3F A;  1YHB A;  4PQX A;  3T1H L;  2IW3 A;  1PZJ D;  3D6W A;  3PO3 G;  4MTN A;  2A73 B;  3MZ5 A;  1EZ6 A;  2RBM A;  2EY5 A;  3E3X A;  2IX3 A;  1SMX A;  1VQ8 A;  3S15 B;  2CHB D;  2X6G A;  4HSP A;  1LT6 D;  4P74 A;  2SNM A;  3E5S A;  1X55 A;  4JI8 L;  3X3N A;  1YNN C;  3CQZ H;  1F2Y A;  1SYD A;  2XNA C;  5FO9 B;  4DV7 Q;  1SEB D;  2VUM B;  5C3E B;  3H3V I;  4DNR B;  3M4Y A;  4GOP A;  2K50 A;  1JJC B;  4P75 A;  4RAU C;  2Q8I B;  1CM9 A;  1HZC A;  1TT2 A;  5AFW A;  2F0N A;  4OWW B;  4J15 A;  2ASB A;  3A55 A;  4H0L C;  2EE1 A;  3ICE A;  2ZXR A;  3I55 A;  2F0D A;  5D65 A;  1PH9 A;  3WDN A;  1SNC A;  4XYO A;  4HJA A;  4M1U B;  1ROD A;  2E2H B;  1XXG A;  1E0B A;  1QUQ A;  2A68 D;  1EQQ A;  2EYL A;  5IT9 L;  4MN3 A;  2G9H D;  1RF2 D;  2R93 G;  5LMU Q;  2KHS A;  1J5E Q;  1XYI A;  5DM6 3;  1LTB D;  4IJL A;  1HNW L;  2TSS A;  1MI2 A;  4OL7 A;  4GN3 B;  4HTH A;  3C46 A;  3T1Y Q;  5M5X H;  4K5W A;  4DNT B;  1EZ8 A;  4R8I A;  2R92 G;  1HXY D;  4KMU C;  1EIH A;  2AKW B;  2VS1 A;  5EBD A;  4BBS H;  1K8A C;  2H1E A;  3FDT A;  3PIP 3;  3TP8 A;  1U9R A;  3BVZ A;  3QIA A;  4A3F B;  2Q8R E;  3CCM A;  1YNJ D;  1K8O A;  1BO0 A;  4HJ7 A;  3FPU B;  1J5E L;  5HGQ A;  2KQ3 A;  1V1Q A;  5E1F A;  3NBI A;  1B8A A;  3T53 B;  3F8T A;  4A3K G;  4A3B H;  3I4O A;  4DV1 Q;  1E22 A;  1E3P A;  1XTC D;  1YVC A;  2A6H D;  2B2U C;  4RH6 A;  4JOI A;  1KLG D;  1DOL A;  3D3R A;  2R7F A;  4O0A A;  2LY7 A;  1R9T B;  3PO2 H;  4A75 A;  1N9W A;  1Q12 A;  3KF6 B;  4XQJ A;  1LTG D;  2E2I B;  1AEX A;  3PUV A;  2AHO B;  1J8I A;  2OQK A;  1G51 A;  3CKI B;  4TQU S;  2Q2T A;  1NR4 A;  3J81 L;  2SEB D;  4A93 B;  3S2D H;  4ZYS A;  4X64 Q;  4FO2 A;  2Z9H A;  4IO9 A;  2PZU A;  5JOB A;  1CSP A;  3L7Z C;  3NEL A;  4XIG S;  1DZ1 A;  1DGS A;  2VB2 X;  2F4V Q;  5FO8 B;  3R2I A;  3RZO H;  1I4Q A;  4IUR A;  3RNU A;  4LNQ A;  2XTI A;  5EPJ A;  3PF4 A;  2JA5 B;  4DK6 C;  1F2Z A;  1SMY D;  2PNH A;  3HGB A;  4ZUJ A;  2I5H A;  3AU7 A;  1ILQ A;  4X64 L;  5C4Z A;  2X69 A;  2PQA B;  5CBA E;  1KNE A;  5KEE A;  2F3W A;  3TRE A;  3STB D;  4FF2 A;  2EYF A;  4R4I A;  4C3H H;  4GNX C;  1NY4 A;  1STA A;  1PLF A;  1EFW A;  1IBK Q;  4LF8 Q;  3S14 B;  5IYD G;  3DLL A;  3D0F A;  1PTO D;  4A3D B;  2DNC A;  3J81 j;  1S72 A;  3TN2 A;  1UEA B;  2L15 A;  4GZY C;  2K04 A;  1VQK A;  2K5Q A;  3AFQ A;  3T51 B;  3S1Q B;  5EPL A;  4PMW A;  4OHJ A;  2R7Z B;  5BN5 A;  3V05 A;  1BXT A;  1CHP D;  2ID0 A;  4AYB G;  1ENC A;  3BVM A;  3TZD A;  1IZ6 A;  3I70 A;  4BWG B;  2VQF Q;  2IY5 B;  4A3I B;  1UWV A;  5C0X G;  2Z4H A;  3PIP A;  5M5W B;  1IBK L;  4LF8 L;  1T5X D;  2L4N A;  3LX0 A;  3HP3 A;  4QF4 A;  2UUB Q;  2ZJR A;  1CSQ A;  4OIJ A;  3KLS X;  4C3I B;  2EYM A;  3FP9 A;  1LLR D;  3I56 A;  2Z6K C;  2HHH Q;  4P2C B;  4AYB E;  1X6O A;  2VQF L;  1V1O A;  4ZKB B;  2VUM G;  1C9O A;  5C3E G;  1SLJ A;  2EJM A;  4JI6 Q;  3MA2 B;  4RCN A;  4A76 A;  4KJN A;  3N52 A;  3GTP H;  1Q8K A;  5IYC H;  2UUB L;  5E3F A;  2RHQ B;  2F0G A;  3D4D A;  2SDF A;  2HUG A;  2YTV A;  1QCB D;  3GTK H;  1KAB A;  3UE1 A;  1AW7 A;  4GS3 A;  2N8N A;  1SNM A;  2B8F A;  3UDX A;  2DUD A;  3K57 A;  3S2H H;  1CTM A;  1ICW A;  2EY1 A;  3U9O A;  3MXP A;  4KN7 C;  1BR9 A;  3RLO A;  2MNA A;  1ET6 A;  1K28 A;  4ZQ3 A;  1Q90 A;  3GTL H;  4JBW A;  4X65 Q;  1PTO B;  2ZTE A;  3I4N B;  3ND8 A;  2JEA I;  5IE8 A;  4KHZ A;  2JA7 H;  3CCS A;  2HD3 A;  1WTX A;  3GTQ B;  5C0X J;  4CGY B;  2CCZ A;  1Y1V H;  1CUK A;  1U4L A;  2OTJ A;  1PRT C;  4ZKC B;  1PV4 A;  1FNU A;  3KYH C;  3NWT A;  3OPO A;  5C4H A;  2WAQ G;  3F1Z A;  5I9O A;  1KNA A;  1IYV A;  4GLX A;  1BQQ T;  1Q46 A;  3RZD B;  4KTA A;  4H7B A;  3G7L A;  4KLK A;  4C56 C;  4X65 L;  4JI1 Q;  3VA5 A;  1VQ5 A;  5IWA Q;  3KK7 A;  2Y0S G;  2JA8 H;  5GAD C;  1CI3 M;  3JAM E;  3H0G G;  5IT9 c;  2F0S A;  2BE5 C;  3K5N A;  4GKJ Q;  4WJW A;  3MWY W;  2JJQ A;  1DJR D;  2XRS D;  2EJG C;  5TSS A;  4LW1 A;  3BZK A;  3K7U C;  3NHH A;  2ICE C;  3HOV B;  1EU3 A;  1JR0 D;  5L37 A;  4R1J A;  2JP1 A;  1TII D;  3I4M H;  3RN2 A;  4RKB A;  4TRD A;  2F0M A;  1AE2 A;  4FXG C;  2XSC A;  2D62 A;  1TVX A;  1VQJ A;  5JJZ A;  2IWH A;  5KND A;  3OSO A;  4GKJ L;  2A5H A;  2AQ2 B;  3C3L A;  3AEV A;  1VF5 C;  2VB3 X;  5M3F B;  4OXP A;  4TVA B;  2JA5 G;  4R4T A;  1JWS D;  5EQ0 A;  3Q6S A;  4DR2 L;  2K05 A;  3VYU A;  1C0A A;  1N32 Q;  2IX1 A;  4GLA C;  1LO5 D;  5JPN C;  2WAC A;  1Q86 C;  1AE3 A;  3WWV A;  3PV0 A;  3TP5 A;  2K4K A;  3A8K E;  1N33 Q;  5KYL A;  1V9P A;  4PG3 A;  5IP7 G;  4FP5 D;  3S1N B;  2NVY H;  3UDF A;  1CA5 A;  1WTQ A;  3J81 c;  5JJK A;  2ZM6 Q;  2R7Z G;  2K14 A;  4DK3 C;  3T4A C;  3HOX H;  1BOS A;  2AUK A;  2JA6 B;  4A3J H;  4BS9 A;  1IBL Q;  1N32 L;  1EL0 A;  1PTO F;  1SYE A;  1X32 A;  4MNO A;  5CYU A;  1HZA A;  5CV4 A;  4A3I G;  1A2T A;  5M3M H;  4QGU A;  4XTC S;  5ISR A;  1HNX Q;  4ZUI A;  2NVQ H;  2CWP A;  1K9M C;  4BXX G;  1QJO A;  3BJU A;  3CXC A;  2UUC Q;  2VQE Q;  1KRT A;  4CKB A;  1EEI D;  3ULP A;  3HOZ H;  3VR5 A;  3ER0 A;  2ZM6 L;  1XJV A;  4IFD I;  2BOS A;  2QW7 A;  2B2V C;  1Z9F A;  3ULL A;  1LTI D;  1ZXT A;  3AQQ A;  1EY8 A;  2K5V A;  3CAM A;  2VXW A;  2DY8 A;  4ODG A;  1HZ9 A;  4F87 A;  3OTO Q;  1HNX L;  2NN6 H;  1XNQ L;  3CRK C;  1L1O B;  3MTS A;  1A15 A;  3NTK A;  2UUC L;  3U50 C;  2WFW A;  4DUY Q;  3M3Y H;  4FXD A;  4KHP Q;  2F52 A;  1Y69 U;  3CRL C;  4B3T L;  5K36 G;  1BCP D;  2KOL A;  3VA7 A;  1EQV A;  1D5M C;  4G7O C;  2D0P A;  4Y7N B;  5A35 A;  2PO4 A;  3IKJ A;  4C3J H;  3QG1 A;  1VQP A;  3QJY A;  3AB9 A;  2RCF A;  1M90 C;  3OTO L;  4YCU A;  4FF1 A;  4JBM A;  3SK4 A;  1SND A;  5FKA C;  4ULL A;  3J80 L;  1PFM A;  1N34 L;  1IYU A;  4KN4 C;  4X66 Q;  3HOY B;  1KL9 A;  5GAH C;  5LMN Q;  1CKO A;  1UEB A;  3HOU G;  3KUP A;  2N3S A;  2OEO A;  1VQD A;  1LTT D;  2WKD A;  1S4Z A;  2CH4 W;  3HOW G;  3K59 A;  1HA5 A;  1Q1B A;  3E9I A;  5GRO A;  1TWG H;  3AFP A;  2EY6 A;  1OXX K;  2ZJP A;  1TWC B;  3SK8 A;  2L12 A;  1NR2 A;  4R4Q A;  1TWF H;  1O78 A;  2E8G A;  1IBM L;  5LMN L;  3QB3 A;  3D4W A;  4C1N I;  1HQM C;  3HKZ G;  4B08 A;  4A3G B;  2UXD Q;  1LAB A;  2L5T A;  3C2P A;  1D2B A;  4HMJ A;  3A54 A;  2FIN B;  1D5Z C;  3GP7 A;  1HHV A;  4B3R Q;  3MFG A;  2K33 A;  4KY5 A;  1YNX A;  3J7A V;  4BBR G;  2F0K A;  5JEA H;  3HOV G;  1EFI D;  4RMF A;  1E24 A;  2R92 B;  2YU9 B;  1D6E C;  1GUG A;  1GO3 E;  2BH8 A;  1NMF A;  1LTA D;  1FYC A;  4X3K A;  1CHQ D;  4XT1 B;  3CHB D;  3H3V C;  2UXD L;  3MC0 B;  2NVX B;  3GTM B;  3A74 A;  4IUN A;  2HQL A;  1BCP B;  3E0E A;  3KF8 B;  4AQY L;  2MJ8 A;  4JI5 L;  1KTK A;  1IKL A;  1Y8P B;  1I6V C;  3M4O B;  2F0H A;  1Y1W H;  1Q7Y C;  1HQR D;  1GM5 A;  1SNO A;  4ZCK A;  5M3F G;  4A3K B;  1I4R A;  1W6J A;  3P20 A;  2KEC A;  4JV5 Q;  1IL8 A;  5ELB A;  2FXQ A;  1PHJ A;  4POG A;  3TME A;  2A8V A;  1LM0 A;  1ET9 A;  1TWH B;  2GVA A;  1JJ2 A;  3K58 A;  4KK7 A;  1PZK D;  3CQZ B;  1G2T A;  2J0T D;  4CKE A;  2F0Q A;  1II3 A;  1B1Z A;  4KY6 A;  4ME5 A;  3SK5 A;  4ZLT F;  2A68 C;  4DUZ Q;  2A6E D;  2EYP A;  3HEJ A;  5FLX E;  2R7D A;  3V2T A;  4FXK C;  2WB1 B;  4MZ9 A;  1CFM A;  1CK1 A;  3EIV A;  4DAV A;  4KD3 A;  1Y8O B;  1HPC A;  1GHJ A;  1STY A;  4DAY A; 
#chains in the Genus database with same CATH homology
 3NBH A;  1ZYR D;  2PYK A;  1F9S A;  4IFD H;  1RD9 D;  3UI2 A;  4DA2 A;  2XWJ B;  1JWM D;  3PUW A;  3VYR A;  1WVL A;  3RMH A;  4DK1 A;  2G9D A;  1KDC A;  5M5X B;  1Z47 A;  1JOO A;  4BBS B;  4K8J A;  1RDP D;  5LL6 S;  1EY4 A;  1TS2 A;  2A6H C;  1PRT F;  4H13 C;  4FYD A;  2K7V A;  1H9R A;  4CJ2 C;  2B2U A;  4LJZ C;  4ABN A;  4A3B B;  1L0Y B;  1SE3 A;  5IGD A;  5EKK A;  1SAP A;  3A8J E;  3D6C A;  2EOT A;  1M4V A;  4M8A A;  2PPB C;  1C48 A;  2CVR A;  1BCP F;  3S1M B;  4Q0F A;  1ESF A;  1CA6 A;  5T1G A;  3BVG A;  4KI0 A;  4DF7 A;  3PMF A;  5EGT A;  4RGO S;  3F2U A;  1SMY C;  4NDX A;  3ZYY X;  3GTJ B;  1JQY D;  3L9A X;  1PYW D;  3RZO B;  4UDU C;  1SSO A;  1PTO C;  5KGU A;  5CV9 A;  2O2L D;  3GO5 A;  5LHY 1;  5E4X A;  2N55 A;  2AWO A;  3MHB A;  4J8Q A;  4KD4 A;  3GQB A;  2NVT B;  5BN4 A;  1ENA A;  1B2T A;  3E0J A;  2R3Z A;  1C8C A;  1LTS D;  4K6D A;  3OWF A;  3MXN A;  5EKI A;  3OIQ A;  5CV6 A;  1A3U A;  2Z4I A;  2B2Y C;  2WAQ B;  3NWS A;  1ILP A;  1RHP A;  4V0B A;  4V19 0;  2Y0S B;  2D9U A;  3MXU A;  4L63 B;  4KJO A;  4WOR A;  3H0G B;  5EPK A;  4ZAI A;  5C6A A;  4F8M A;  1ZEQ X;  2WV6 D;  4IFD J;  3A56 A;  3H6M A;  4LAA A;  2RDF A;  1CZW A;  4G57 A;  1STB A;  5C4J B;  2XIW A;  3V96 A;  2B39 A;  2QIL A;  3S2H B;  5ELF A;  3S9W A;  2CW0 D;  1UUP A;  2EYO A;  3HZX A;  1OXV A;  3EFX D;  3NK9 A;  1SXT A;  4XYQ A;  3CU7 A;  1Q3L A;  2C5C A;  2E2D C;  3VYT A;  2IT1 A;  1Z7T A;  3Q24 A;  4OO1 H;  5IIF A;  2JA7 B;  3C1E A;  4EGV A;  3S17 B;  2E76 C;  2ZXP A;  2JSO A;  5J22 A;  1LAC A;  2FHT A;  1YNN D;  3DEO A;  2DN8 A;  1AZP A;  1Q8I A;  3TZU A;  4PMB A;  2KUM A;  3BDC A;  2SNS A;  4EQN A;  1BNZ A;  1VMP A;  1CQV A;  2MGS A;  1HUN A;  1JB3 A;  3D8G A;  1Y8N B;  1JIC A;  3MEH A;  2FMC A;  3D31 A;  3URY A;  3I4M B;  1WTV A;  1K8M A;  2BDN A;  2FFK B;  3R2T A;  3TP7 A;  5I4D A;  2K1B A;  3I4L A;  2EYH A;  4BA1 I;  1HFN A;  3K5O A;  2MUY A;  1V1P A;  3LWE A;  2NN6 I;  1JOR A;  1IW7 D;  3QOL A;  1GJX A;  1H9S B;  2JE6 I;  2E75 C;  3VR6 A;  3I3C A;  1F2L A;  2PW7 A;  4C3H G;  1A6X A;  2IL8 A;  4F88 A;  1EYA A;  2D5D A;  3HOU B;  1G29 1;  3RLF A;  5JPM C;  4A3J B;  1Z6H A;  3HOW B;  5G3L D;  5M3M B;  1GUW A;  1IKM A;  1TY2 A;  2B2V A;  1ML0 D;  3HOZ B;  3HKZ B;  3ONA B;  1SYC A;  2E74 C;  4IQZ A;  2F0T A;  3G6J B;  1DCZ A;  5CV7 A;  4IUQ A;  3NPP A;  1BCP C;  2KVM A;  1L0X B;  2K5D A;  2ZXO A;  5KRU A;  4CJ1 B;  1WTO A;  5A2Q E;  4EQO A;  1DXM A;  3GV6 A;  5CR3 A;  4BBR B;  2EVB A;  3M3Y B;  4HMI A;  1FNV A;  2FMM A;  2HQE A;  3HS0 C;  5FO7 B;  4C3J B;  4RHS A;  1Q1E A;  4FNF A;  4DGZ A;  3KBG A;  1T5E A;  1NSN S;  4DN4 M;  1QG7 A;  2BDO A;  2HDM A;  2KEE A;  1I4P A;  1EIG A;  1PMR A;  1RCV D;  4ZK9 B;  1SE2 A;  1F9R A;  5NUC A;  1G8Z D;  5C3W A;  1JCK B;  2KCN A;  3GV3 A;  2RDG A;  4K8I A;  1MSG A;  1TWG B;  2H4O A;  2MP1 A;  3KBX A;  1BDO A;  5BN3 A;  1TKW B;  2RDH A;  4QUC A;  1QOH A;  3NQT A;  3DM1 A;  4XDX A;  1EU4 A;  1SDF A;  3HRZ C;  1MD2 D;  3NQI A;  2NTS A;  3VR2 A;  1WD0 A;  1KDA A;  1HRJ A;  4K14 A;  3DEP A;  3SK6 A;  2OXP A;  1WD1 A;  4QMG A;  1NCV A;  1F9Q A;  4E6I A;  5DEH A;  5DM7 3;  4QIW B;  2PW5 A;  5FK9 C;  1EYC A;  2HDL A;  1U4P A;  4NP5 A;  3DWP A;  1QE6 A;  1H9K A;  1Y1W B;  4K6L A;  4R8N A;  1F9P A;  4N9P A;  4RFB A;  5HUR A;  1ESR A;  3SEB A;  3N6R A;  5IGC A;  4BY7 B;  2I07 B;  4TKO B;  4L6T B;  2C9O A;  3M85 A;  2AUJ D;  3MVV A;  1I4H A;  4L8J A;  1I6H B;  2NZ1 D;  2XRQ D;  3NSW A;  2LKV A;  1DM0 B;  5CGK A;  2ZT9 C;  3R93 A;  3KLR A;  5ELE A;  1RTN A;  2BE5 D;  4G7Z C;  3H09 A;  1O7Z A;  2WKC A;  1STG A;  2RKS A;  1PXU A;  4B9X A;  1GUS A;  1HUM A;  1GHK A;  2LFN A;  1S5C D;  3RD4 A;  2B2W C;  1D5X C;  3JAM L;  2LS0 1;  3S16 B;  5G3L F;  2K32 A;  1DYQ A;  2DNE A;  4ID6 A;  1JC7 A;  1KDB A;  1RKN A;  2F3V A;  2L9H A;  1STE A;  2A69 D;  1KLU D;  4WFN 3;  4DFA A;  2NN6 G;  3NUC A;  2AQ3 B;  1PFB A;  2JYO A;  1AZQ A;  5COR A;  2XWB B;  4KY7 A;  5I6Y A;  1FGB D;  1MGS A;  4BA2 I;  1SNQ A;  2PMZ B;  4YIJ A;  5K5P A;  3K7A B;  4C3J G;  1CZG A;  4K2L A;  2R6G A;  5COY A;  5IT9 E;  4DXG A;  5M9O A;  1D1K A;  3Q22 A;  2ICI A;  3ERO A;  3FKI B;  4I7Z C;  3U9S A;  2IPK D;  2B2T C;  1B50 A;  2F0U A;  3NP8 A;  4B9W A;  4PV1 C;  3M7G A;  4RWS C;  2O4X A;  2F0L A;  3EQL C;  1U4M A;  3FRP B;  4X3U A;  3LWU A;  1X3Q A;  1DOK A;  3KLS A;  1WCM B;  2J4X A;  4MIU A;  5EBC A;  3DWQ A;  1DON A;  3DXJ C;  1MSH A;  4A3E B;  2QDB A;  3OHX C;  1IHZ A;  1YNJ C;  3BYY B;  1NAP A;  3P1H A;  5JEA G;  1FNW A;  4CBV A;  2KED A;  4LMQ D;  4X3T A;  2B2Y A;  4HED A;  3J81 E;  1QB5 D;  1BF4 A;  3L3O C;  1TS3 A;  4R9W A;  4OO1 I;  2TMP A;  5IOD A;  3D4R A;  4NW2 A;  2K03 A;  3OOC A;  3VR3 A;  3NTH A;  1B44 D;  3P75 A;  4KV6 A;  3PO2 B;  2RA4 A;  4JK1 C;  1CT1 D;  2WII B;  2WIN B;  5CC4 A;  3QOJ A;  1EY0 A;  2CW0 C;  1HTL D;  3TDQ A;  1G91 A;  4J1M A;  3S2D B;  1LV9 A;  5KNC A;  4KKT A;  2F0V A;  3BYT B;  4RGN A;  3T16 A;  2YYZ A;  3VR4 A;  5FOB B;  4IFD G;  1D1I A;  5JEA J;  3DMU A;  1I4X A;  2PZT A;  1GXD C;  3SE0 A;  2JEB I;  2F0I A;  2HCI A;  5C5M A;  5C4X B;  1EEF D;  1JWU D;  1WTW A;  1VF7 A;  4C3H B;  3QWN A;  5T1I A;  5KIX A;  5KYI A;  2PQE A;  3BZD B;  1X3P A;  2FJ2 A;  1O80 A;  2KCC A;  2EY2 A;  5C5L A;  3W3A A;  5J39 A;  4RKL A;  3IFD A;  1S5B D;  1TU2 B;  2L0C A;  1SNP A;  1XWE A;  4EVO A;  1G2S A;  5I2Y A;  1B53 A;  4NKL A;  3SVM A;  1WTR A;  1IW7 C;  3W2D A;  5FLX L;  1C4Q A;  2AWN A;  3H94 A;  2MHV A;  3GTP B;  1BBX C;  4IUP A;  2IJ0 A;  5C0X H;  1SBB B;  3A7A B;  1R4Q B;  3GTK B;  2BCO A;  5F2D A;  3HG9 A;  1AN8 A;  2QKI C;  4OIK A;  4DXF A;  5DAU A;  2K01 A;  2RSN A;  2HCC A;  5IGG A;  3GTL B;  3I8Z A;  3SXH A;  5I9P A;  2NYZ D;  1B9N A;  1KAA A;  1OXT A;  2M00 A;  3ERQ A;  2B8G A;  5EJW A;  2PCF B;  4HN7 A;  1Y1V B;  5JVG 3;  5I2X A;  4FF3 A;  2EPB A;  1SFO B;  1V8Q A;  2OT2 A;  3TBI B;  1H9M A;  4WRD A;  4OGQ C;  1CQF A;  3NE5 B;  2F4I A;  4ILW A;  4XQQ A;  3KF8 A;  5E4W C;  2JA8 B;  3VYS A;  4G4K A;  1BUV T;  2EXZ A;  3K6O A;  1OXU A;  3DHQ A;  1AFP A;  1FR3 A;  2N88 A;  1B9M A;  2F0W A;  3FPP A;  2B63 B;  5CMD A;  4DK0 A;  1TR5 A;  3WOE A;  4I65 A;  1A2U A;  2OF1 A;  1LT4 D;  3FVQ A;  1TQO A;  3PUY A;  1R4P B;  4IUV A;  5C3X A;  1PFN A;  4RGT A;  1WTP A;  3PIO 3;  3BS1 A;  4IUU A;  3OMC A;  4QUF A;  2M9V A;  5CV5 A;  3DUZ A;  4OO1 G;  2KJX A;  1LT3 D;  3SHL A;  4K5X A;  2D2C C;  5J1Z A;  2DY7 A;  4EQP A;  1J9O A;  1GUO A;  1GUT A;  2NVY B;  4FF4 A;  1G6Z A;  3BDL A;  1HCZ A;  1ONL A;  3HOX B;  5IGB A;  1I4G A;  5CV8 A;  1U4R A;  2F0J A;  1EWH A;  2NWG A;  3R8B A;  5IGE A;  5D3D A;  1EY7 A;  2NVQ B;  2J7Z A;  4X3S A;  2F03 A;  4RHR A;  2VNU D;  3WOF A;  2EZV A;  1OO9 B;  1F2M A;  3MXG A;  3J80 E;  2LMC B;  3PUX A;  1SJH D;  4XT3 B;  4DAP A;  1FD7 D;  4HSV A;  3X3M A;  5D3I B;  4RA8 A;  3Q23 A;  3NXW A;  1EOT A;  3C1F A;  2X6L A;  2ENB A;  3Q0A A;  4LK1 C;  4CHT B;  1SYG A;  1OXS C;  2QCP X;  2EJF C;  2F0O A;  4UAI A;  2QEJ C;  4F7X A;  3RUZ A;  4O42 A;  4H44 C;  1EYD A;  4FVM A;  1TS5 A;  2K28 A;  4PNY A;  3DWA A;  1HTP A;  2M2L A;  3R3O A;  2L1B A;  4IAL A;  3GTO B;  3I91 A;  2B2W A;  3J7A F;  1SYF A;  5ELC A;  5ELD A;  1TWA B;  2KA7 A;  4CJ0 B;  4HCS A;  1JE4 A;  3GD7 A;  5K36 H;  4S3S A;  2A69 C;  3ITP A;  1TWF B;  1O7L A;  1JOQ A;  2NBF A;  1VMC A;  3LNN A;  1EY6 A;  1A3T A;  4C1N K;  2F1M A;  1LT5 D;  2I46 A;  1PTO H;  5DNF A;  1E2W A;  2O5J C;  4CKC A;  4IUT A;  1QNK A;  1QWY A;  3OWE B;  2XVS A;  5JAV A;  1I50 B;  4O1N A;  2PZW A;  4XQN A;  2B2T A;  4C3I G;  1EWC A;  2JXM B;  4G7H C;  2RVL A;  1PRT D;  1PDQ A;  1GUN A;  1EQT A;  1F77 A;  2F0F A;  2A6E C;  1QIL A;  1STH A;  1HFG A;  1PZI D;  2Q8T A;  3P7J A;  2L55 A;  2PNR C;  1RTO A;  3I72 A;  1ZYR C;  3H91 A;  1NUC A;  4Z9C B;  5KNB A;  1B3A A;  3SDZ A;  1H9J A;  1O7Y A;  2NTT A;  2AQ1 B;  5M5Y B;  4QCL A;  4NMZ A;  3EA6 A;  3FMC A;  2MPM A;  2BA0 A;  3K5M A;  1TS4 A;  3PO3 B;  3K0Y A;  4RCO A;  1ENF A;  1TY0 A;  5CBE E;  4IN3 A;  1SJE D;  1STN A;  4U68 A;  3O13 A;  5EKL A;  1DOM A;  1RJT A;  2WP8 J;  5HGT A;  1B4O A;  3OMG A;  5A2Q L;  3EVQ A;  3NTI A;  1EY9 A;  2L11 A;  3E6Z X;  1M8A A;  4K5V A;  1XX8 A;  4DU9 A;  2NB0 A;  2EDG A;  1DD2 A;  2F0P A;  1E2Z A;  4KKU A;  1PRT B;  3MFY A;  4MHE A;  4HCE A;  3J7Y W;  3I90 A;  2K5W A;  4XXE A;  2R93 B;  3PUZ A;  5LL6 X;  4U67 3;  3TSS A;  2O5I C;  3A8I E;  5JVH 3;  5I6W A;  3FEW X;  4RGM A;  1H9S A;  5C44 B;  2QF7 A;  2A74 C;  3BDO A;  3QO2 A;  4ZRZ A;  3BG3 A;  2GA4 B;  3TP6 A;  1JOK A;  5IOC A;  4C2M B;  1SE4 A;  1EY5 A;  3IFT A;  2IX0 A;  3T56 B;  4A3M B;  2Z1C A;  2K6A A;  4HAE A;  3T13 A;  1W6K A;  2NUC A;  5C0X I;  1I3Q B;  4N9T A;  3IL8 A;  4K2K A;  2F0E A;  3MAQ A;  5D14 A;  1V1P B;  3M7N A;  1HA6 A;  1QNU A;  1S5E D;  3I73 A;  2E2J B;  2R61 A;  1MBY A;  4BY1 B;  3K5L A;  1VCI A;  3A7L A;  3IAY A;  2XN9 C;  1VDZ A;  1SYB A;  3OIP A;  3SR1 A;  2BA1 A;  2CQA A;  3ND9 A;  2V4D A;  3S1R B;  1UAP A;  2SOB A;  4J6H A;  2RSO A;  1V43 A;  1A3V A;  2EYJ A;  1LTR D;  1GOZ A;  4HR7 B;  1E2V A;  4QB4 A;  4IZ8 A;  1K83 B;  4KHV A;  4PMC A;  3GTG B;  4AYB B;  4TSS A;  3OW7 A;  2RQX A;  4KKS A;  1S5D D;  5IGF A;  4Q5V A;  1UNS A;  1ZKO A;  2Z8L A;  1AP0 A;  3EJI A;  1S5F D;  3AMU A;  4PQX A;  2IW3 A;  1PZJ D;  3D6W A;  2A73 B;  3MZ5 A;  1EZ6 A;  2RBM A;  2EY5 A;  2IX3 A;  3S15 B;  2CHB D;  2X6G A;  4HSP A;  1LT6 D;  2SNM A;  3E5S A;  3X3N A;  1YNN C;  1F2Y A;  1SYD A;  2XNA C;  5FO9 B;  1SEB D;  2VUM B;  5C3E B;  4DNR B;  3M4Y A;  4RAU C;  2Q8I B;  1CM9 A;  1TT2 A;  5AFW A;  2F0N A;  3A55 A;  4H0L C;  2EE1 A;  2ZXR A;  2F0D A;  5D65 A;  3WDN A;  1SNC A;  4XYO A;  4M1U B;  1ROD A;  2E2H B;  1XXG A;  1E0B A;  2A68 D;  2EYL A;  5IT9 L;  4MN3 A;  2G9H D;  1RF2 D;  2KHS A;  1XYI A;  5DM6 3;  1LTB D;  2TSS A;  1MI2 A;  4OL7 A;  4HTH A;  3C46 A;  4K5W A;  4DNT B;  1EZ8 A;  4R8I A;  1HXY D;  4KMU C;  1EIH A;  5EBD A;  2H1E A;  3FDT A;  3PIP 3;  3TP8 A;  1U9R A;  3BVZ A;  3QIA A;  4A3F B;  2Q8R E;  1YNJ D;  1K8O A;  1BO0 A;  3FPU B;  2KQ3 A;  5E1F A;  3NBI A;  3T53 B;  1XTC D;  2A6H D;  2B2U C;  4RH6 A;  1KLG D;  1DOL A;  3D3R A;  2LY7 A;  1R9T B;  1Q12 A;  4XQJ A;  1LTG D;  2E2I B;  1AEX A;  3PUV A;  1J8I A;  3CKI B;  4TQU S;  4A93 B;  1NR4 A;  3J81 L;  2SEB D;  4ZYS A;  4FO2 A;  2PZU A;  5JOB A;  3L7Z C;  4XIG S;  1DZ1 A;  2VB2 X;  5FO8 B;  3R2I A;  1I4Q A;  4IUR A;  5EPJ A;  2JA5 B;  1F2Z A;  1SMY D;  3HGB A;  4ZUJ A;  3AU7 A;  1ILQ A;  5C4Z A;  2X69 A;  5CBA E;  5KEE A;  1KNE A;  2F3W A;  4FF2 A;  2EYF A;  1STA A;  1PLF A;  3S14 B;  1PTO D;  4A3D B;  2DNC A;  3TN2 A;  1UEA B;  4GZY C;  2K04 A;  2K5Q A;  3T51 B;  3S1Q B;  5EPL A;  4PMW A;  4OHJ A;  2R7Z B;  5BN5 A;  3V05 A;  1BXT A;  1CHP D;  2ID0 A;  1ENC A;  3BVM A;  3TZD A;  3I70 A;  4BWG B;  4A3I B;  5C0X G;  2Z4H A;  5M5W B;  1T5X D;  2L4N A;  3LX0 A;  3HP3 A;  4QF4 A;  4OIJ A;  3KLS X;  4C3I B;  2EYM A;  1LLR D;  4P2C B;  1V1O A;  4ZKB B;  2EJM A;  3MA2 B;  4RCN A;  4KJN A;  3N52 A;  5E3F A;  2F0G A;  3D4D A;  2SDF A;  2HUG A;  1QCB D;  1KAB A;  1AW7 A;  1SNM A;  2B8F A;  3K57 A;  1CTM A;  1ICW A;  2EY1 A;  3U9O A;  3MXP A;  4KN7 C;  1BR9 A;  1ET6 A;  4ZQ3 A;  1Q90 A;  4JBW A;  1PTO B;  3I4N B;  3ND8 A;  2JEA I;  4KHZ A;  1WTX A;  3GTQ B;  5C0X J;  4CGY B;  1U4L A;  1PRT C;  4ZKC B;  1FNU A;  3NWT A;  3OPO A;  5C4H A;  5I9O A;  1KNA A;  1IYV A;  1BQQ T;  3RZD B;  4KTA A;  4H7B A;  3G7L A;  4C56 C;  3VA5 A;  3KK7 A;  1CI3 M;  3JAM E;  2F0S A;  2BE5 C;  3K5N A;  4WJW A;  3MWY W;  1DJR D;  2XRS D;  2EJG C;  5TSS A;  3NHH A;  2ICE C;  3HOV B;  1EU3 A;  1JR0 D;  2JP1 A;  1TII D;  4RKB A;  4TRD A;  2F0M A;  4FXG C;  2XSC A;  2D62 A;  1TVX A;  5JJZ A;  2IWH A;  5KND A;  3OSO A;  2A5H A;  2AQ2 B;  3C3L A;  1VF5 C;  2VB3 X;  5M3F B;  1JWS D;  5EQ0 A;  3Q6S A;  2K05 A;  3VYU A;  2IX1 A;  1LO5 D;  5JPN C;  2WAC A;  3PV0 A;  3TP5 A;  3A8K E;  5KYL A;  4FP5 D;  3S1N B;  1CA5 A;  1WTQ A;  3T4A C;  1BOS A;  2AUK A;  2JA6 B;  4BS9 A;  1EL0 A;  1PTO F;  1SYE A;  1X32 A;  5CYU A;  5CV4 A;  1A2T A;  4XTC S;  5ISR A;  4ZUI A;  1QJO A;  4CKB A;  1EEI D;  3VR5 A;  4IFD I;  2BOS A;  2B2V C;  1LTI D;  1ZXT A;  1EY8 A;  2VXW A;  2DY8 A;  4ODG A;  4F87 A;  2NN6 H;  3CRK C;  3MTS A;  1A15 A;  3NTK A;  4FXD A;  1Y69 U;  3CRL C;  5K36 G;  1BCP D;  2KOL A;  3VA7 A;  1EQV A;  1D5M C;  4G7O C;  4Y7N B;  5A35 A;  2PO4 A;  3IKJ A;  3QG1 A;  3QJY A;  3AB9 A;  4FF1 A;  3SK4 A;  1SND A;  5FKA C;  4ULL A;  3J80 L;  1PFM A;  1IYU A;  4KN4 C;  3HOY B;  3KUP A;  2OEO A;  1LTT D;  2WKD A;  1S4Z A;  3K59 A;  1HA5 A;  1Q1B A;  2EY6 A;  1OXX K;  1TWC B;  3SK8 A;  2L12 A;  1NR2 A;  1O78 A;  3QB3 A;  3D4W A;  4C1N I;  1HQM C;  4B08 A;  4A3G B;  1LAB A;  2L5T A;  3C2P A;  1D2B A;  4HMJ A;  3A54 A;  2FIN B;  1D5Z C;  3GP7 A;  1HHV A;  3MFG A;  2K33 A;  4KY5 A;  3J7A V;  2F0K A;  5JEA H;  1EFI D;  2R92 B;  2YU9 B;  1D6E C;  1GUG A;  1LTA D;  1FYC A;  4X3K A;  1CHQ D;  4XT1 B;  3CHB D;  3H3V C;  3MC0 B;  2NVX B;  3GTM B;  4IUN A;  1BCP B;  2MJ8 A;  1KTK A;  1IKL A;  1Y8P B;  1I6V C;  3M4O B;  2F0H A;  1HQR D;  1SNO A;  4A3K B;  1I4R A;  1W6J A;  3P20 A;  2KEC A;  1IL8 A;  5ELB A;  3TME A;  1ET9 A;  1TWH B;  3K58 A;  4KK7 A;  1PZK D;  3CQZ B;  1G2T A;  2J0T D;  4CKE A;  2F0Q A;  1II3 A;  1B1Z A;  4KY6 A;  4ME5 A;  3SK5 A;  4ZLT F;  2A68 C;  2A6E D;  2EYP A;  3HEJ A;  5FLX E;  3V2T A;  4FXK C;  2WB1 B;  1CFM A;  1CK1 A;  4DAV A;  4KD3 A;  1Y8O B;  1HPC A;  1GHJ A;  1STY A;  4DAY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...