3ERXA

High-resolution structure of paracoccus pantotrophus pseudoazurin
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
123
structure length
123
Chain Sequence
b'ATHEVHMLNKGESGAMVFEPAFVRAEPGDVINFVPTDKSHNVEAIKEILPEGVESFKSKINESYTLTVTEPGLYGVKCTPHFGMGMVGLVQVGDAPENLDAAKTAKMPKKARERMDAELAQVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pseudoazurin
publication title The 1.4 A resolution structure of Paracoccus pantotrophus pseudoazurin.
pubmed doi rcsb
source organism Paracoccus pantotrophus
molecule tags Electron transport
total genus 33
structure length 123
sequence length 123
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3erxA00
2FQGA 2XV0A 3TASA 2QDWA 3QJUB 2IAAC 2FQEA 2BP8A 1XB6A 3BQVA 3G5WA 3NJMA 1NDTA 2CJ3A 1TEGA 3PPSA 1GY2A 2BW4A 5A7EA 2HRHA 1ZIBA 3FU9A 2IDFA 1GS6X 2BZCA 1EHKB 1E30A 2FJSA 1N70A 1L9OA 3T6ZA 1JZJA 4DP4X 3CVCA 2VN3A 3UAAA 1JVOA 1OOWA 4G72B 1ZV2A 2YQBA 1SF3A 2BO0A 4KO9A 1J9QA 4KOCA 4W9ZA 4YL4A 1AR1B 3WG7B 3NP3A 1W8EA 3EHBB 3C75A 1SJMA 2BWIA 1ET7A 4HAKA 1J9RA 1ET5A 1M56B 2XX1A 4PAZA 2HX9A 2N0MA 4BK5C 1WS8A 1BQ5A 1A8ZA 3D12B 3X1NA 1PF3A 2R7EB 3EH5B 3QJQB 3N2JA 1DYZA 2HX8A 4HALA 1ZPUA 2IWFA 3HB3B 1KBWA 3UAEA 4L0PB 5D4HA 3FSVA 2YXVA 3TBBA 4CSPA 5AZUA 3AW5A 4DP0X 1PNCA 3QJSB 3NSFA 5TK2A 1XB8A 2TSBA 2P80A 1J9SA 4GXFA 4ZK8A 4JHUA 2J57A 1MG2C 1W6WA 3UGEA 1MG3C 5B3SB 2J55A 3FSZA 1FWXA 1E67A 1IKOP 4A66A 4GP5B 3T6WA 3WKPA 4CSZA 2DYSB 2EIJB 1IC0A 2PP9A 3X2QB 4GP8B 4Q8BA 1OCCB 2XV3A 1KGYE 3SBPA 4YSCA 3CDZA 1AIZA 1WS7A 2HX7A 3FT0A 3NJIA 2BWDA 3GXUB 1AZBA 1KBVA 3NJHA 4YSEA 2UX7A 3MBWB 4UANA 4HZ1A 5I26A 2YXWA 1A3ZA 1M57B 5B1BB 2XYBA 3OMIB 3WNJA 2H47C 3ABGA 5B7EA 1PZCA 1AQ8A 2IDUA 1IBYA 3NJKA 1ETJA 4KNSA 2I7SA 3T9WA 2J56A 3IE9A 2OV0A 1CYXA 3WIAA 1JXFA 4AX3A 1X9RA 2IDTA 2YAPA 4E9RA 1AG0A 2WO3B 2FT6A 1WA0X 3CVBA 1NINA 2CALA 2GI0A 2Y1AA 4A67A 2FNWA 1X9UA 4WKXA 2I85A 3ABLB 4KNTA 3UACA 4YSAA 1J5CA 1CC3A 4BXSV 2ZWNA 1W6LA 5B7FA 3T6VA 1HFUA 4HHWA 4DPAX 4DPCX 1WA1X 1SFHA 2E86A 4G7QB 3ABKB 4HCGA 2VW4A 4E9YA 3S8FB 4QKTA 1PCSA 1BXAA 5I6NA 2XWZA 2QPDB 5ANHA 6PAZA 3QJRB 2ZONA 2R7EA 2IDSA 3SBQA 4K9JA 4YSQA 3EH3B 4A2DA 5D4IA 1DZ0A 1JXDA 4GY4A 4NAJA 5B1JA 4Q89A 3EF4A 4KO6A 1BQKA 1R1CA 2XXFA 2PPDA 1NICA 1GYCA 1OE1A 2BW5A 4DP6X 3FS9A 2FT8A 2PP8A 2QT6A 1SFDA 2H5UA 3AG4B 1ASPA 3JTBA 2YAQA 5I5JA 3X1BA 3S3CB 5EHFA 1ILUA 1NWOA 4YSUA 3WNIA 2X88A 1NWPA 1SF5A 2W8CA 2VM4A 2VSKB 2AFNA 3WKQA 1ASOA 2BHFA 2WSDA 3RYMA 3NJNA 4X4KA 1HAUA 1XB3A 4A2GA 2PPAA 3FYIB 5B7MA 1AZUA 1AZRA 3QQXA 3T71A 5FC9A 1GY1A 1ZDSA 4AKOA 1V10A 2JXMA 4AI7A 4YSDA 1NZRA 2XLLA 5AFAA 2FTAA 1SNRA 8PAZA 1NPNA 3ABMB 3UADA 3S8GB 2ZOOA 3KW8A 4YVUA 1KV7A 2CUAA 1OCOB 2Q5BA 2FT7A 3PAZA 4DP9X 3TU6A 1QNIA 1PNDA 2LLNA 2IWKA 4KO5A 4NERA 3WI9A 4YSOA 4BWWA 5I6OA 3NJGA 1AAJA 2W88A 3X1FA 3NSYA 1E65A 1VLXA 3QPKA 3TBCA 4YSPA 1J5DA 1ID2A 3ASNB 3H4FA 1A4CA 2CAKA 1AS8A 1OV8A 5F7BA 3NJLA 4G70B 1OF0A 2JKWA 1A65A 4MFHA 1CURA 3FYEB 2AANA 2CBPA 4G7RB 3ZDWA 4M3HA 3EH4B 4BWTA 5AKRA 1BEXA 4DPBX 3NJFA 1JZFA 4A2FA 2PPEA 2XU9A 1JZHA 1RZQA 4KNUA 3KW7A 2QPEB 5I28A 2YAFA 2EIKB 4HCIA 3UABA 1F56A 1MZZA 2EINB 2GC7C 3ZIYA 2XXGA 1L9QA 1ZIAA 2BP8B 2DYRB 2NRDA 3OD3A 2RACA 4E9XA 3NSCA 3ZX1A 4YSTA 3SQRA 5F7AA 1KDIA 2I7OA 1MZYA 5PAZA 1AS6A 3IBOA 1PMYA 2TSAA 2EIMB 1JZGA 3NT0A 3T6XA 3PAVA 1L9SA 1OE3A 3U25A 2IDQA 1KYAA 2BZ7A 1JZIA 2VSMB 3ASOB 4HIPA 1L9RA 1BXUA 2DV6A 1ZDQA 3NYKA 1AZNA 5I6MA 2XV2A 3IN0A 4W1TA 2MRYA 2PCYA 1OE2A 2EILB 1PLAA 3N55A 3NP4A 3PCYA 1FFTB 2Q9OA 3CVDA 1JZEA 2X87A 1BXVA 1B3IA 2MTAA 4KO7A 1OCZB 1PY0A 3IEAA 3QJTB 7PCYA 2PLTA 3FPYA 3OMNB 3S3DB 4E9WA 4N4YB 3DKHA 1AOZA 2FQFA 1GS7A 3AG1B 1JVLA 2OJ1A 1PAZA 2IH8A 4P5SA 5TK4A 3GYRA 1KCBA 4G7SB 4DP5X 1FA4A 2UXGA 5B1JC 1AZCA 2XUWA 4EF3A 4PCYA 2GB2A 1WA2X 1IBZA 1GS8A 3FU8A 2AVFA 4M4RB 2GIMA 4AZUA 1TU2A 4UF7C 1N68A 1OCRB 2HRGA 3CDZB 5I6LA 1JOIA 1SDDB 3AG2B 1ADWA 4E9VA 3CG8A 3OQRA 2GBAA 4A2EA 2FQDA 3AY2A 1QLEB 1T5KA 1ASQA 6PCYA 4E9QA 2CCWA 5B1AB 3V9CA 3ZBMA 2A3TA 2VM3A 3QJVB 3X1GA 3FQ2A 3PLYA 5D4JA 3HEIB 4KOBA 2HLEB 1JXGA 1EZLA 3NSDA 3H56A 4F2FA 1BQRA 2AZUA 2Y69B 1AACA 2BP0B 3DIVA 2AZAA 2J5WA 1WAEA 5B1KA 3FU7B 3IN2A 1PLCA 1RZPA 1SHXA 3DTUB 3AZUA 2IWEA 3PXLA 4N8UA 4UAHA 5I6KA 2DY2A 1M9WA 1NTDA 1A4AA 1GW0A 1NPJA 5E9NA 4ENZA 2VW6A 3SBRA 5LDUA 4P5RA 1I53A 2QDVA 1GR7A 3FSWA 4F7KA 1NIBA 4BDVB 1RCYA 2PPFA 1A4BA 4DP1X 2B3IA 1BYPA 2P80D 1L9PA 1ILSA 2XX0A 1NIFA 1URIA 3JT2A 2ZXWB 3TA4D 2GHZA 1QHQA 4YSRA 1V55B 4QLWA 2B08A 4YSSA 1AS7A 2IH9A 2VW7A 5I5MA 4YVNA 2GC4C 2JFCA 4AKPA 1YLBB 1AG6A 4FA7B 1RKRA 1BAWA 3BVDB 2UX6A 3NJJA 3ERXA 4HCFA 4GP4B 1KCWA 1TEFA 2YARA 1JERA 1MDAA 3AG3B 3L45A 4BXVA 4NB7A 4DP7X 4GYBA 1L9TA 2XVBA 1ET8A 3PAUA 4BWUA 2YAHA 4DP2X 1SDDA 5IY5B 2DWTA 1V54B 2UXTA 4AKQA 2YAMA 3FSAA 4JHVA 1UATA 7PAZA 4E9SA 4G71B 2UXVA 2YAEA 2PP7A 5I6PA 4E9TA 3GDCA 1TKWA 1PZAA 2WO2B 2DWSA 1IUZA 1NIAA 1J9TA 2HZHA 4TXVB 4A68A 2PPCA 2H3XC 4RH4A 2BP0A 1SHWA 3FU7A 4FAAB 5PCYA 1E5YA 1CUOA 3FQYA 1PZBA 3FPXA 4HHGA 2GSMB 1XMEB 4WTQA 1HAWA 1AANA 4A2HA 3OMAB 1GSKA 2HXAA 4DP8X 1KDJA 4BDVA 2UXFA 2VMJA 1CYWA 1NIDA 2FWLB 5I5IA 2YAOA 1E5ZA 9PCYA 1PLBA 4F2EA 2OCCB 3MX0B 3H4HA 3X1EA 3V9EA 1NIEA 3OM3B 3CZUB 4JKNA 3S3BB 1BYOA 2PCFA 3FQ1A
chains in the Genus database with same CATH superfamily
4ZFGH 1LEIB 5AB0A 1LWHA 2ZWYA 1IC4H 4K3GA 1UCTA 4ZFZA 1S8DB 4U2YA 1CN4A 1AGBB 3NJMA 2XTJC 5I8OL 2BSRB 4DJMA 4H44C 3DYOA 3PPSA 2BW4A 4U0RC 1JUFA 4AL8H 3MLUL 1EZVY 2VDQL 1BIHA 3IAGC 4H0IA 2Y5EA 2K70A 4KJQD 4BQ8A 4JFZL 4KKAD 1T0MA 3X12A 2DPKA 1I3VA 1L9OA 3O2DL 4HKBB 2G3NA 1S5IL 4K5LA 3HE7B 4OJAA 3TV3L 4DSYA 5JOEA 1AKJB 4AH2A 5JHDB 1FVDB 4PBVC 1U8LA 4OCMC 4JPIB 5DJXA 4HW6A 2DBLL 2NLJA 1G6VK 3TEYA 3PWJA 4O2FA 5DWUH 4MA8L 1GJIA 2XJKA 3WL9A 3C75A 3MRQA 4NFCA 4N0UB 1U91B 1SJMA 1E7UA 3U36B 3S88L 4OI7A 4FHBD 1ET5A 2XN1A 4FFZA 3OXRA 2AV7B 2HT3D 4IOIA 1Q9LA 4UQ9A 1RZJH 4BK5C 4XR8C 4ZUTA 1GXEA 1AQMA 1PF3A 1Z9PA 2DWXA 4JFYB 5EH1A 3RVUD 1TFHA 3ARYA 4Q6YA 4PQXA 4W93A 2NT1A 2EE9A 3QNXA 3VXMD 4XX1E 4QR7A 2EDHA 5AZUA 4Q4IA 2ZSWA 2VXSL 3W9DB 4K9EL 2JB5L 4X4XA 4KQ0A 2WPGA 1CBJA 4UILL 2NZIA 4IRJD 2NW3B 2Q8AH 1U3HC 1VB9A 1CGUA 1BZEA 4N2GA 5K39B 3UYRH 2EH7H 3ZZLA 3S0PA 3EDKA 2FO4B 1H19A 4U1KA 3GK8H 2DYSB 4JPKL 1YAZA 2A83A 4BFOA 4GRLC 2Q76A 4OLYH 4JFEB 3V5KA 4WY7L 3II3A 1HHIA 3IGLA 2VDMB 2ESVD 5CJQH 1HE7A 3KLLA 5IOPA 2EVGA 4P46A 1FFPB 2DS4A 4LL1A 4YE4H 5F1IA 2EUXA 4LCIH 1TQUA 4TLSA 4P9HC 4AVKA 4M5SA 1QBLH 5HHOB 2QELA 3E80A 3L16A 3N42F 3GBNL 4M5ZL 1O9ZA 3T3MF 4EI6A 3E2HB 4DPRA 3W37A 2I25N 1G7LA 1AIFA 2XWBA 5AOZA 1Z6JT 3IE9A 2GUOB 1JNJA 5DJ8A 1FO0H 3PXJA 5HYSG 3RU8L 1FG2A 3TFKC 3RUGB 4NUGL 3NESA 1Y0LA 3BXNB 4A67A 2FNWA 1C1EH 3D4YA 1PYWA 4EBQH 2WQVA 4F33B 5FCSH 2JELL 3OPUA 1M7IA 3OXSA 1INQB 4HHWA 2F8XC 3MUY1 2IC2A 5A2LH 4QRTB 2MOGA 3Q44A 5JW4Q 4HCGA 2VW4A 4JO4L 3UTTD 4EMZA 5C6TL 3REWB 3GS4A 3L1GA 3DJTA 3TYFB 4Z7VB 3V7AG 5F9OH 1JPGB 4PWIA 3HUJB 1EEYA 2ICWB 3ZHNA 2WV3A 3HR5A 1AYRA 2DJUA 3EH3B 3V52L 5JR1L 2O6PA 5D5MF 1MNUH 1I31A 2NY3D 2OPCA 3MV8B 4HIQA 3B1UA 5I2IB 5IB1B 2YHGA 3QORB 1N0LA 2D3LA 3F7KA 3K46A 2HJKB 4HIHA 4JKWA 4Y2DC 1TITA 3LH9A 2OZ4L 5JA9A 4QOKD 4G43A 3GSQB 4N2KA 4B41A 3EBIA 4MQTB 1UM4L 4ZFGL 3HZVB 1IC4L 4WHTB 4L3CA 2FT8A 4PRHA 4KKLD 3WS3A 3F7RA 1OP5H 3WY1A 1ASPA 2D9QB 4WFED 2YD5A 4ACPA 2EKSB 1S3KH 5I5JA 3T2NH 2KBGA 1VDGA 4RMBA 4AQ1A 3F04A 4AL8L 1NWOA 3BWUF 3VFNB 4AQ1C 5D7LD 2K6ZA 3RQ3A 3OAZK 1YNKH 4HIEB 4A55A 5E6RB 4O9HH 4DEPC 2VM4A 2ATAA 3F12B 3LTVA 5GRZA 4PHXA 1GYUA 2OMYA 5AVUB 3IJSB 5D96C 3T65A 1KB5A 1VFAA 3QEHB 3JWNH 3K81A 2KZBA 2BSSB 1PS3A 2JXMA 3SYPA 4CA4A 3V6OC 3EJQA 5DWUL 4DUWA 2R0WL 5EPMA 1Q8MA 4F9PA 3EYSH 3TIDB 5K9OA 3GMLA 4P23D 3APDA 1A64A 4H13C 1MJUH 4BWWA 1RZJL 2B1HH 1P5VB 3X1FA 3KYOB 2DAVA 5JMOC 1HXYA 2H6OA 3LZLA 2QZQA 4HUWB 1CURA 4UIMA 3ZDWA 5EEWA 3VH8A 1IJ9A 2CDFB 4KPHH 4OJDH 4RZCA 1YEDB 4YDLB 2Q8AL 1EUTA 3A23A 3BUPA 1LE5A 3UYRL 3FN9A 1I7UA 1HHHB 1S78C 1N4XH 1U21A 2CJSA 3ETBF 5IVXE 4B27A 3GK8L 1A6PA 4L8CB 3N50A 4OLYL 5E9AA 2NTFB 1KWKA 1WDAA 5CJQL 2NTSP 3D2UA 1S7QB 1PSKH 2RD0A 4YE4L 5IB2B 3FQRB 4LCIL 2XETA 3BAIA 1QBLL 4PJBF 4BRVA 4TL5A 4EPSA 1AS6A 4XN5A 4CN6A 4GPVA 5IHUH 4AZ8B 3PAVA 4L29B 3DUSA 2Z4QB 1P0SE 2DMGA 5LWYH 2AK4A 3E3QC 3KG5A 5ICUA 2ZOUA 2BZ7A 5I1EL 3QIUA 2XWDA 32C2B 3QIUC 5BMFL 1A6UH 1RD6A 2JCCF 4RIRB 3IJEB 4HUVA 1FO0L 1J05B 1KBGH 4W9HC 4S1SH 4IKIA 1FZOB 4PJ7B 4UTAA 1HU8A 3DHMA 4BSVB 2F1BA 2XIDA 1C1EL 1CYGA 4QWWC 2A38A 1T0NA 5I0WA 1J9CT 3BSHA 3CVDA 1M1SA 2QVMA 3FOLB 2ZWKA 5D1QD 3IDGB 3IEAA 4N0FB 4Z7NB 5I19H 2KLSA 4NQTA 1EHLH 1KG0B 1BAGA 3UGUA 4QRPA 4MA3B 4NN7C 3DVIA 3WN5B 4IU2B 5BUAA 3GJFB 1CD9B 1QA9B 4L9DA 4BCZA 1XSKA 4X7FC 2AF2A 1QRNB 5L2JB 5TF1H 3GIZH 3ETBJ 4LARH 1YEJH 1E4WL 3H2QA 2BP5M 4R0LB 4WW2B 4KQ4L 3F3HA 3NCYS 1HYRC 5GGRB 4XRCA 2F7RA 4JY4A 4K71C 2V9UA 3UJIH 3DGCR 2AVFA 1GC1H 1UQSB 3ATDA 2X38A 1N68A 1DEEB 1FNEA 2WLLA 3CU7A 4POUB 3RGHA 3C5ZA 4DFHA 4NFDA 2E76C 1JOIA 1NAMB 1SDDB 1CLVA 2K8QA 3AG2B 3IDMB 4Y1AE 3IJYB 2VDNB 2IJ0C 3WCYA 1AQDA 2NY0D 3N9GL 4FXKA 4LCCA 4EN3B 5ID0B 2FR4B 2FQDA 2I26N 1P1ZB 4FN0A 2F74A 2K7QA 5F72S 3T2NL 1XTLA 3M46A 1HH6A 2YXFA 2CIIB 4ZFFA 4KHTL 2EDDA 1OGTA 2YD9A 2JJUA 3MYJB 4H1LH 4O9HL 1WCBB 1U0QA 3BHBA 2NZ9C 1TJIL 4LLYA 1JXGA 1I8IB 3CZFA 1EZLA 4LDOB 4QCIB 4LNRA 3Q06A 2K45A 5IJKC 4PREB 2EDYA 4ZBJA 2X6VA 3O6FC 3CMOH 3IVKB 2VZUA 3C87A 3MV11 2J5WA 4PJIE 5DJAA 2W5PA 4OCRH 2BS9A 4OCWH 4GIPD 4Z3IA 1CR9L 3IN2A 3TYGH 3D07A 1J10A 2QADC 2YD0A 3RL2B 4AM0A 4AMWA 1LLAA 2AQSA 4N8UA 5J13B 3WJMB 4FFWC 4B96A 1W72B 3EYSL 1KFGA 1JMZA 1LK2B 4V33A 3L2LA 4M7ZB 2F6AA 1MJUL 3BJLA 2OSLB 2B1HL 2J20A 4I0CC 1QSED 4X7EC 2RBLA 4ESKA 4PBDA 2A9AA 4JRXA 1E8XA 2JMRA 2OMVB 1ZANL 2O4EA 2E6PA 3CV5A 1R9FA 4JLRB 4DP1X 3DTDA 5EZJB 5HDBB 1WBZA 4QRSB 3TA4D 1RULH 2A9CA 4TNEA 2ARJB 4K5OA 5IWLA 1TQBB 1S7SB 4WCYH 3MNVA 2NPLX 2NNAA 1OAKL 3BWAA 1ND0A 2B08A 2B16A 2DI9A 3ECUA 4JFSA 2NY4D 1N59A 1HSAA 2ZX9A 2BJMH 5IG7A 3DOSA 3PWLB 4KRMB 4Q2ZA 4DO6A 5F8QC 2K1MA 3LN4B 4MNHA 2MQ0A 2HLAB 5LBSL 1FRGH 2VN6A 2RHEA 5GS2D 3QIWC 4XCFH 3MSPA 4K7PH 5CJBA 2XN9E 3BEWB 2DM7A 2OTWB 2C26A 2LFGA 4M8VA 1WBYA 1PSKL 4JO8A 1YMMA 4Y4HD 4GYBA 2FEEL 5EFIA 2WMPB 5K5YA 1TDQA 1FP5A 4R4FH 5C1MB 1ROWA 1GJWA 3MGOB 2FAUA 3Q3GA 4ERSH 5GISH 1QFWM 5FM4A 4MRCA 4FKKA 3ESNA 1CQKA 4Q0XH 3LXCA 4NQDD 4NX0A 5LWYL 3EF7A 4GQ9H 2X6MA 1A6UL 1I3GH 1TKWA 5J12B 4U6HA 1KBGL 1Y07A 4S1SL 1HSBB 2EYSB 4AGPA 1A6VH 1ODAA 3UAJA 3UAJC 5I1GH 5C08D 4JFOB 1AR1D 3ZO0A 3BVWA 5MEQA 5J57B 1UWFA 1WAAA 3KGUA 5DD1H 2H6PA 2H3NA 3I6KA 3QJZA 4OF6A 5JXED 2ZAHA 3L5HA 5I19L 1EHLL 1S46A 4GW5B 3QDMA 1X5HA 5IQ7H 3A3YB 4JFTA 5EO9B 1TLKA 2FIKA 3G6JF 2Y7QA 3WEMA 1IJNA 3ETTA 4L1DA 4XWOC 1EIBA 2XPGB 2FYYA 4IRSB 5E6UB 1P6FA 3VXPB 4QHUA 3WHXB 4X6CE 5B21A 3GIZL 4LARL 5C0CB 4FL4B 1JPFA 2VJ0A 5B3NA 1HHJB 4PB9H 1FV1B 2OMXA 2ZCKH 4J2XA 3JWNE 4JL1A 3UJIL 1OSYA 1LHZA 3QQ3A 4ZXBA 4ZXBC 1GC1L 4R7DA 2CKNA 1HKLH 2L04A 4RDQF 3QSKB 1JV5B 1XGZA 1IEBB 4L9LA 4ZYKA 2VRAA 5I1HH 5MI0C 2EDBA 1A7BA 5FYKD 4L4JA 4XXDB 3WMQA 5KYWB 5DK2B 3QRFM 3N0PB 3VW3H 3I75A 2IGLA 3KYMA 3O2VH 4UU9B 3LZRA 1CU4H 1DN0A 3RKDC 5DJ2A 2OYMA 3AQZA 4ZW5A 4XO9A 4X5PA 2IPUG 1BZ8A 3VG9C 1JP5A 5F44A 3T6QC 5EU6A 3UOAB 2FJSA 1NFDB 4J23A 3ILQC 4N2DA 5CBEB 2K3HA 2XWJA 4WWKB 1B2WH 4E42A 4M3KB 1N12A 1KXQE 3GSNH 2YD7A 3CMOL 5E6IC 3VXQA 2WLIA 4ICWA 3APCA 4OCRL 4NN5C 4YL4A 4OCWL 1D5BB 2Z31B 1E2VA 1CFTB 1LP9F 3TYGL 2DQUL 2W0FB 1MVFA 3HC4H 5DI8A 5JHLA 1ET7A 2F7OA 5BRZA 3L7EA 3MRNA 2DQFA 5I8EA 1INDH 1XT5A 3S98A 2OMNA 3ROLB 1D5MB 5JORA 4P2OD 4I2XA 4U6XA 3IT8D 5AOIA 1G6RA 3U46B 1OAZH 3CN1A 3I9IA 1E0OB 4XP9H 1Y1DA 3FO2B 1M2OA 2IOMA 1HHGB 1RULL 1IU1A 1N3NA 4BFKA 3K0WA 4XAKE 4Z7UB 1Z9NA 3GMQB 4DGUA 2UZPA 1XXDC 3HOGA 2BJML 4LOVA 3R8BB 2K3TA 4ZX6A 2O5YH 2VDLH 1KXHA 1JGDA 3H6AA 5J6HA 1UM6H 2EVFA 4MNGA 2PP9A 2BNQA 2R1XB 1FRGL 1YN7A 1A7NH 4XCFL 5JW4M 2I9LB 1JHLH 3DBXA 1DFBL 2OMWB 3N43F 2XG4B 3L3IA 1AO7B 3NJIA 1EXGA 3WV0A 4R5XA 5SX4H 1QI5A 3Q2VA 4PB0L 3VYNA 3ZR6A 1KIPA 4R4FL 2IAMB 4KK6D 1QFWI 3QJHA 4Y9FA 2GEQA 2OQJB 2WINB 4ERSL 5GISL 1KF9B 3NIGF 4ISVA 1G7QA 1LVEA 2V0AA 4JZJA 4JZJC 4RAUA 4Q0XL 5GS3A 3NJKA 2GIXA 5D1XE 1SVBA 5JNYB 1MJ7H 4GQ9L 5ESAB 3V0EA 2JI3A 1I3GL 3VWKA 2YXMA 1ZT1A 4FQQA 3VWKC 5JIMA 1A6VL 3MRDB 4UYPA 5I1GL 1X9UA 4WKXA 4OQTA 4P3CH 1J5CA 3CSFA 4L0ZA 4XHJD 1T21A 3BIKA 4FQXD 3BGMA 2FWOA 2KT6A 5KZCD 4XAWL 5DD1L 2Q2EB 5KN5B 1IM9A 2XHNA 1E27A 1ZRUA 3SE4A 2IXQA 4G7QB 5A2IH 5IQ7L 3V4VA 4B7LA 1KLFB 3HZYB 5J06A 4EJ1C 2KMWA 1HQ4B 4YR6A 4ZG1A 2E4FA 4F37F 1OT4A 3W0WA 2OL3H 1XGTA 4PRPD 4PLJD 2IDSA 1QHOA 3D8MA 4U1LB 4AV4A 5F88B 1IQWH 4HUMB 4PB9L 3PS6A 2BVEA 2ZCKL 3HW7A 2EVHA 1Q94A 4OFYD 3OZLA 2XN2A 3I9PA 4TPRH 2WD0A 4CMHC 1HKLL 5EUOA 2AJZB 4EEEA 4N3TA 1MHEB 4PJ5E 5I1HL 3VXUB 1IFGA 5E94B 2PP8A 3FFCD 3N40P 4LB8A 1M2VA 1RK1A 4MDIB 3WKNA 2K4AA 2YAQA 4QO1A 2X10A 1TNNA 3AQDA 3VW3L 3O2VL 1CU4L 4DZ8B 1CL7I 4I4WA 1OIOA 1OGAD 4AYFB 4OF0A 1MQKL 4JFFD 1X4XA 4XNUL 4GFXA 4PJEF 5JIPA 1MSPA 2UYLA 1GMIA 2ADIA 4UV7H 2VLRA 5E1IA 1CJYA 1EANA 1YPZB 5IF0B 5BQDA 3MLZH 3BH8A 3GSNL 4F93B 8PAZA 4FKEA 2DYPA 1VEMA 2YBGA 5T3ZD 2NX5E 4G3YH 3ZHKA 3HC4L 3ZHFA 2Q5BA 4P2QB 2LLNA 1PNDA 1INDL 2IWKA 3MDJA 4KO5A 2C5DC 4NERA 3SEPA 3D87B 2FO8A 3NJGA 4EIBA 4N1HB 1EZVX 1TPXB 3CFMA 3EYOB 1CICA 3KPSA 3U6XA 1CICC 3I6LD 4HIXH 1ZLVH 1YEFH 4XN4A 1Y18B 4I3GA 4XP4L 3IJHB 2CRIA 5DEGA 2GSIB 4XP9L 3O2DA 3NPZB 4L4TA 2FGWH 2HFFA 3CH8A 4B0MB 5C0RH 2HYMA 3TN0C 2I9TB 1SY6H 1FFRA 2D0HA 1HL4A 5FO7A 4KMQA 2CHXA 2QPEB 4Q74A 1F1GA 4FYSA 2CNZA 2O5YL 1JSYA 5FA4B 4JM0A 4GI8A 3LVTA 5JMRA 5K9JH 3V5DB 2PTTA 3ZQWA 1URLA 3Q1SH 1JHLL 1UT9A 4AE1A 4KKCC 1OSZA 3BLPX 3RVTC 4K7FB 3RWEB 4K23H 1SRDA 2P1YA 4NUPA 1IAIH 1QNZH 1YYLL 4D0DA 3NT0A 4TV3A 3FJTA 3AXIA 4HPYH 1KY6A 2YPKA 3IMBA 3RI5K 4K9EC 5AAMC 4EDXB 3CZJA 2IDQA 2VSMB 1NDMA 1HQRA 1MJ7L 1VFBA 5CEYA 1K3IA 1NGWB 5ISZD 2P28B 5I15H 2A6DB 2ZKYA 3D1MC 1F45A 1AZNA 2G9HB 1B0RB 5G4NA 3DIFB 2DOCA 4P5KB 3H9SD 3HC2A 3PCYA 4P3CL 3UPCA 5I5RA 3PPEA 3BRDA 1T1ZB 4DH2A 4GG8A 1JZ8A 4I85A 4OCXH 2QR0B 4OT1L 4F8LA 3N85H 4RFEA 1AQHA 3QJTB 2YEZB 3MV7A 3CFJB 5JOFB 3G04B 1B88A 1IBFA 1KIRB 4OU3A 5DZAA 1YDPB 1OTTC 2BCMA 3B83A 1Z9SA 1U8CA 3MVSA 4L3EE 5D5ME 5C0AB 2VR4A 3HS8A 4AOFA 3KS0H 3P4NB 1HEJC 1I1AC 2J1WA 3NJXA 4FNPA 3AG1B 1JVLA 3ATBA 4LSTH 4LLQA 3MRFA 3R18A 4G7SB 1R5IB 4M93B 3AWFA 2X5PA 2XFGB 3NJVA 4PJFF 2YWYA 2B9BA 1BFSA 1FGNH 3QPXH 4K94H 4GINA 4TPRL 2OZNA 3IU3B 4CC4A 3R0NA 3WELA 4F2MB 2ZF9A 4JRYD 1XF5B 4N9GA 4AJ0A 4RGNB 2OCFD 2GBAA 1ZE3H 4RMQA 1MHHB 4LEOB 1GSMA 3L4VA 2QKSA 4PW3A 4ZMLA 1OW0A 1OW0C 3N5AA 2A3TA 4OKVB 1KXVA 5KG9B 1KXVC 2X6UA 3B7YA 1KYOJ 1T1YA 3C6LB 1X7SA 1X44A 3OKDA 1RURH 1ZJAA 1KELL 4AIOA 1Q4NX 1BQRA 3NIDB 4QY8A 3SOTA 3QG6A 3MLZL 5CWSA 5DU7A 5FGCE 1MLCB 1CQYA 1T2XA 2OZ4A 1E6JH 2P7TA 4UQBA 4NNPH 4XH2A 2GJZB 3MMEA 4G3YL 3CFQA 1EEZA 4NRXA 2Q7YA 3VXRA 4CJ1A 1HXMB 4WV1B 3QXVA 1YUKB 4AT6A 5FYLD 5EUKA 2YD1A 4C4UA 4KFZC 4QYOB 3LMJH 2FJGA 3K80A 2QMJA 4HIXL 5GS0D 4AL8C 1YEFL 5JW3L 2DRUA 2GJRA 1A4BA 1NMAH 4LBEB 1GZQA 1MCQA 3CFBA 5FOJA 1KZYA 1UM5H 1WCQA 4R97B 1KCRL 2CDEA 4ODSL 5IJDC 4ALAL 1U8OB 3WEOA 2FGWL 4HJGB 4OZ4A 2FH6A 2PUQT 4KTEH 5C0RL 2R2EB 2PYEA 4JO1H 2YRPA 1LK3H 1BZ7A 4HWBH 5I5MA 2JFCA 1A5FH 4PJBE 1AG6A 5B38G 5JLZB 3F7QA 2ATPA 2NW2A 4F15B 2E3VA 5J1AB 3B9KA 1FZJB 3B9KC 1DQKA 3ALWA 4X6DF 3ZYJA 3GT6A 5K9JL 5KSBE 3UYOD 1F3JB 3HC0B 3H7BA 1MDAA 2F1AA 4FQCH 1RZJC 4J39A 2H2PD 4K23L 1MCWW 3P3TA 1BZOA 1P9MA 1P9MC 3BE1H 1AGCA 1M6OA 4MXVE 5F7KC 1OB0A 1IAIL 3PL6A 4B60A 4BKLB 4ANXA 3US0A 4N26A 1E43A 1QNZL 5ANMA 2C3GA 3HHRB 4XODA 4HPYL 2PWFA 3IGUA 3L3DA 4ADGA 3VI4A 3KXFD 3FF7A 3V0VB 2X6CA 5DUJA 3B37A 3IGAA 1U58A 3HE7D 1AKJD 5JHDD 2V2TA 3R06A 4IBQA 3CGTA 3LKQA 3VCLA 2CRMA 4ZNCD 1WYJA 1HDMA 2O61B 3KJ4C 3VFSA 1BPVA 2ZXAA 3LNHA 1HJBC 1MH5B 2H3XC 4Z77A 3HCVA 4KK5C 1ZHLB 1JZ3A 4EIGB 2MTPA 4U1NA 4HF5H 1G9HA 4A6YB 3H9ZA 3N85L 5KJRL 3O3UN 4M03A 3OQ3B 3RE0A 4ZMWA 2GJ6B 3TNNA 3KH4A 5I1IH 2DJ4A 1XGPA 1LEGB 1MXDA 3CVIH 4FG6C 3AWEA 4KX9A 4PWJA 4AM0Q 3J2PA 2YSSA 4HC1L 4ZUSA 1F00I 1KN2H 1P69B 3QPQD 1VF5C 4WNQA 1K4DA 2ZUXA 3D85A 3X3GH 1PZ5A 5AYUH 3U7YH 4KMTH 1FO0A 1OT2A 1ZLSH 2FECL 3H4HA 4MJJA 1JPEA 3LSOB 1FGNL 3QPXL 4JHWH 4JKNA 4K94L 4OM1H 4BZ1A 1AGFB 1N2RB 3K4AA 1K6QH 1WWAX 2OX5B 4JFED 5HVGB 2ZSVB 4GXVH 4M6NH 4ORGB 4EI5A 3TWCH 4QGTA 4KJWD 3ZHDA 4C4KO 4YO0A 1HWHB 2WHVA 2IV8A 5CEXB 3FN3A 4WFHE 5HHOD 4PRAA 4B6ZA 5JOPD 1UD6A 3FU9A 4V1DB 2BZCA 4NT6A 2OTPA 1EHKB 4YS4A 5AB2A 1YSOA 3OTTA 4LQFH 4G9FB 4GQZA 4IBYA 4WSJA 1CO1A 3BPOC 5CILH 4NP9A 4DKAA 4DP4X 3DHJA 1RURL 2WLKA 5F7NC 2PYFB 2PXYA 3PIQB 3UAAA 1UA3A 3TTSA 3BX7C 3OKMB 4M1CD 2UWEF 3R1GL 3T0EA 3T0EC 4AENB 1FJ1A 1OSPH 4XMPH 3L48A 1E6JL 2ZYSA 2OXGA 5AENA 4NI6A 1HL9A 1I1RA 4LLWB 3SDDD 4ELMA 5FDWA 1UB5A 1YO4A 5B8CC 4PMFA 3D0AA 1U95B 3VDAA 1ZT7A 4PHZA 3WKMH 4HK0B 2VMCA 2QJDA 3D12B 3GSXB 4I5BA 4X8JA 4QRRB 5DJZA 3LMJL 5IVZA 4FJZA 3DTXB 3KEDA 1NMAL 3HIZA 3A5VA 4MA7H 1Y1UA 3HB3B 1NC2B 4WO4A 4WQOA 4Z0XB 4WO4C 1JF1A 1PY4A 2YA0A 3FSVA 5D4HA 1T5XB 1UM5L 4MJ5B 2X4TA 5D2NA 3WNPA 3QDGE 4OD2A 5KW9L 4YHKH 3JWNC 2W59A 1U2YA 2D31B 4KTEL 5B3SB 2QL1A 5L0QB 4IMLA 1A25A 1OHQA 2VN5A 4JO1L 3B7UX 4MAYA 1M6UA 3ARBA 1LK3L 2X7LA 3ARBC 4M4RA 4HWBL 4MAYC 4AYBA 1A5FL 1BEYH 1IC0A 3QORD 3KLHD 4OIFA 4E41E 1XMWA 2MHAA 5CAYB 5BV7B 1ZWIB 3AMLA 2G75A 1RERA 4I7ZC 4EVNB 2O5ZL 4TUKH 1JGVH 3DVGA 4GAGH 5E56A 5K1VA 4KROB 5K59E 3KWVA 3NFPB 4JHBA 4APXA 3BE1L 4I9XA 5CFAA 1SMOA 2IF7A 2VR7A 5IEKA 2LLLA 2UZXA 1M9SA 5EEXA 4MLIA 5LN4A 1WZLA 4JQVA 2L4OA 3V7AE 3EJPA 4R90L 2VZSA 5HDWA 4G8FB 5I18L 4R26H 3LHPH 3PGDA 4PJGA 2E7HA 1CYXA 1BM3H 4GBXA 4AGQA 4GBXC 3RDTB 4DKDC 3BEVA 2V5YA 3SYCA 1AFVH 2CA3A 4HFWB 4MXQD 2W0KA 4AIEA 4ZMAT 1NPUA 1KEGH 1EXUA 5LBSA 3W2DH 3FO1B 3G6JE 1RXLA 3Q9PA 1ESOA 4MWFA 2MCPH 5F7DB 5E2VH 4FERA 2AI0H 4LIQL 4HF5L 3CNKA 5DCCA 2E86A 3HRZC 3HG1E 3MUJA 1UA6H 2EXTA 3L54A 1R3LA 5B38A 4PGEB 5FGRA 3MLPA 5I1IL 1HCVA 3CVIL 2FEDC 1BAFH 4ODVH 2IQ9H 1EAQA 1DO5A 4NJAH 5DUMH 1G4MA 4PRDA 5I1DB 3V4UH 1KN2L 2R7EA 3FUFA 2WZPA 5FKPA 1KTLB 4N2AA 2F18A 2HRPL 1BFOA 2AQQA 1OY3B 3X3GL 3MRJB 3GUTB 5AYUL 2V7HB 5ESVB 4JY6B 1GL4B 2X3BA 4KMTL 5IHZA 1XBRA 5EU5A 3PQYB 2CPUA 1ZLSL 3DSNA 2WM0A 2VDOH 2K78A 1QEWB 1XV8A 4GRWF 3VU2A 4MQXC 2D7TH 4JHWL 4OM1L 5CSGA 4Y16A 2F9BT 1K6QL 1S4IA 2IANA 4Y16C 5EU3A 4GS7B 4GXVL 3RIFF 3ZMEA 1HL8A 3TWCL 1JFQL 4MJIE 3JV4B 4HUXA 2ERJB 1KJ2A 4PP2B 3IXTB 1QFPA 4HS6A 3KR3H 3JTBA 3NIFF 5HHPB 1UOWA 3L4CA 2JH2A 3RHWK 5GXBB 1S7TB 5E9DE 4W70A 4ATWA 4KC3B 2FSEB 3OVUB 1JHTB 1I7TB 1KLGA 4N0YH 1AGEB 3EJYC 3BQUA 4WI9A 5DZPA 3BQUC 5B3JE 2G30A 1DVTA 5JW4R 2AFNA 2VDKB 1KXTB 1ASOA 1H6EA 3MRKA 3TBSA 3QEQA 1FORH 4OGAC 5CILL 1CXLA 3NJNA 3WLBA 2KQNA 3PV7A 2OR8A 5AG9A 4FTVE 2DI8A 3O41A 1GC1C 5I71C 4YUEH 4U3HA 4CSSA 1OSPL 4PW4A 4XMPL 2VLJE 3FFDB 3SDXA 5F7UA 3LKSB 2XIBA 3BPLC 3IXAB 3O0LA 3DUHA 3SODB 4LHJB 4TUOA 4EZMA 4OZHA 3VQ2C 4OV6F 4Y7OC 3WKML 2BNRA 4KZEH 2LGNA 1UH3A 5DS8A 1QLEH 5BJTB 1QOKA 4W9DC 4GT0A 5DRNB 4H1LA 5DA4A 4I77H 5FA3B 5AOKA 1QRND 4TTGA 3NVQA 1QUNA 4MDJA 5TJWK 5DJYB 12E8H 1BEXA 4YHKL 4DPBX 4N2EA 3EDFA 2Z8SA 1FYTA 3AY4A 3BLKA 4JZNB 3AY4C 2EXWD 2J73A 2VISB 3KW7A 4YDVB 3F8UB 2JCWA 1RJLA 3KPRA 3SJVE 3O9WA 2EIKB 5H37H 3O9WC 3QC5X 5C8JB 3IETB 1AP2A 2EAEA 1BEYL 1OTSD 3II1A 4QHMA 3DSFH 3DX6B 3MCKB 5EC1B 4GAFB 2NRDA 4PJDB 5E8EB 2ZYIA 3AB0B 3N91A 3QJFB 5H94B 2P52A 4AJWA 5HGAB 1XF2B 4TUKL 2Z35A 3IFLH 4GAGL 4E5XA 5BQ7A 3QDHA 1SJHB 3PDDA 4EN3D 3UEQA 3HS9A 2FE0A 5A6MA 2LU3A 2O72A 2E9WA 1F18A 4Z7WE 1K5WA 3ARQA 4GSRA 1KYAA 4DOHE 3EJUA 4OH2A 1HVXA 4R26L 1BM3L 4PRIA 1BG9A 2PMZA 2X12A 2ICEA 1AFVL 2ICEC 1KEGL 1JG9A 3W2DL 3KDMA 4APQA 1U3JA 2C7UA 1FFTB 2Z93B 1U9KA 3KAAA 3VE0A 1MCJA 4OIBA 5LHDA 2MCPL 1ACXA 5E2VL 1B4TA 2H3KA 2AI0L 2APXA 1A4KB 1IBGH 2DJMA 4BFGA 2DLFH 3A21A 1UA6L 1BF2A 2XA8H 2J4WH 1XH2A 4G42B 3UZQB 1LO5B 2NY1B 3OX8A 1BAFL 1TMQA 4ODVL 2NXZC 2IQ9L 4G8GB 4PWKA 4AYEC 3QZNA 1EO7A 4NJAL 5EBMB 3VXME 5LBVA 3RB5A 3V4UL 4PP1D 4YH6A 5D7JB 4MCYB 3VX1A 4RX4A 3POHA 4WTWA 5F1NB 4WEMB 1SYSB 4UF7C 2VDOL 1WWBX 2XTLA 4V11A 5HDRA 3ZYZA 4HJUA 2FHCA 2D7TL 5G55A 4NKMA 2BVOA 1NFIB 2R1WB 2W65A 2XBZA 4HMEA 4LPTA 5IM7A 5E23A 1QR1B 1HH9B 2ESVE 5DYOA 3C08H 5I82A 1TZGH 4JVUA 5DEJA 4PJEE 1I3RB 1F6AB 3KR3L 4AQ8A 4AQ8C 4LF3A 5C0FB 4WWNA 3FH7A 4OCYH 4E9QA 3CLEH 4CW1B 2BMKA 1ZLUK 5CZXD 3ZBMA 3BPCB 1A9EA 3X1GA 4GMSL 3CAFA 1QVOA 2WJ5A 4PRBB 1A1NA 1KC5H 1VGKA 4UM8B 5CN2A 1FORL 2R69H 3IWVA 1E9PA 2A99A 4U49A 5DJ0B 4JCWA 5EU7E 5HTSA 1AYOA 4AUJA 2EDLA 2H45A 3NUKA 4ZQTA 2RH0A 3LDBC 4YUEL 2CGRH 3B5TA 3BP6A 1AHWB 1NANH 3QVAA 2CIKB 2D7PA 3CBJB 4OZFH 5CGYC 2I69A 1FH2A 1SLUA 5D1ZA 5GS2H 3T0AA 2MNUA 4ENZA 3B7RL 4HZLB 1R33A 2DM2A 2C1PA 4FXGA 2MNWA 5D5MA 2R1YB 1I53A 3RGVA 3RGVC 4KZEL 2N56A 2Y9RT 3FBQA 3LQAH 4AG4H 1DE4A 2YSTA 4L05A 4IOFC 1QLEL 2KHAA 4NI3A 5CLTA 4BZ2H 1T4WA 4IRSD 3KPMA 4FG0A 5HYEA 1MN4A 1D9KB 4BFBD 1QASA 1G43A 5C0CD 2G5BA 2FYVA 4PWGA 4WNJA 2PCFB 2VW7A 2IBZY 1B9ZA 3DX8A 3IJ8A 3RY6A 4CVXA 2EDRA 2EDXA 5IVXB 3LXUX 4QHKJ 1SN0A 1JK9A 3BWUC 3CIQA 1T7WA 4BKSC 5ILTH 1X7QA 4JDZA 1FG9C 2I24N 3DSFL 3FQXA 3ZDYF 4K5MA 4UBDC 3ZGIA 2WYZA 3GBEA 1RIHL 5IJCC 5JPMC 4NWUH 1RIUH 3SPVB 3LKOA 4G8IB 4GAYA 2XWRA 2ORBH 2A0LC 1P2CB 1TO4A 2PW2A 3BPNB 3OHXC 1LDPH 1UOLA 2YAHA 3Q7JA 4AGMA 1DBKH 5HHQA 4NKOA 4NO5B 2CQVA 1EAJA 3C5JA 4X98A 1A6ZA 3LRSB 5GGUB 2JKRM 3DETC 2A9NH 1EBPA 2BIOA 4LDCA 4TVPD 1U8IA 4MCZB 2B0SL 4WFFD 4K5PA 2VXUH 2G2RA 4WWKD 4E9TA 4QPEA 1G7MB 3QH3A 1S7UA 1GGIL 1PX3A 5FK9A 4CADB 1CFMA 1KJMB 1J9TA 1T04A 3IDUA 3MRMA 3ZDZE 2DIEA 3SSGA 1U8PA 2Z31D 4BUQA 3OR7B 4HKJB 2BP0A 4U3SA 4IKKA 1RSYA 5FYKH 3L9RA 5MHSD 4FAAB 1ZS2A 1O0VA 4X9BA 1IBGL 4HUKB 4J2QA 2IQAB 4PJFE 1KJVA 1H15B 3FOMA 5EOTA 4F8OA 2XA8L 1JGEA 2J4WL 5C0IB 1GSKA 4MD0A 1DP0A 3KPQA 2AAAA 2CD0A 3FB5B 1Q72H 3HC3H 4BDVA 3QIBA 1DQTA 3QIBC 5HY9A 2W94A 3BFWA 5F7YC 5C09B 4H8PA 5FF6B 2CM5A 5A7BA 2X4NB 3T8XA 1Q9OB 4LVNB 4UQDA 4PJBA 2GT9A 4ZW6A 3DGGB 3UTSD 2HUEA 3MOQA 5CJOH 5C9JA 3TJEH 1Z3RA 2XWCA 5JA8B 1OTUC 4AQEB 2BOBA 2JKNA 3AS3A 1BBJA 2FJFA 4DKFL 3C08L 4TUJA 2XXCB 5KSUA 2JCCA 3MA7A 1P7HL 4X2UA 1AO7D 2JKJA 2CJ3A 4LP8A 4YPGA 2WLYA 3QNYA 2WUCL 4ZSOE 4OCYL 7TAAA 1W0VB 3CLEL 4G9DB 3RDJA 5JO5A 2AJSH 2KPWA 2IAMD 3GJEB 5JW5A 5D2LF 2YRLA 4MSWB 3LD8B 1NGQH 4CBPA 4LO9A 3PDOA 5FHAH 2G3MA 3JVGC 5K1JA 1KC5L 3NRQA 5T5NG 3UYPB 2VQ4A 1VIWA 1OOWA 2VR8A 2XY1A 2WZ0A 3TPUA 4OI8A 2YQBA 1FUNA 4BQBA 4U1JA 4PJIB 1ZXKA 2J8UE 2JI1A 3IFOB 2CGRL 1MF2H 3ILPA 3LN5A 3EYQC 4U1MB 2VR5A 1C12B 2BWIA 2F8IA 3VFUA 4MJ4A 1JF5A 2LAGB 3EO9L 1MJJB 1TQCC 1T80A 2D4FA 3O4LB 5DHYA 3VD1A 4JAMB 1EFXA 5D1QE 3UBXA 4MB4A 5IBUB 3ZKXC 3BZ4B 3ROOA 2B15A 4J1UA 5E99H 3LQAL 4AG4L 2AS5M 1GGBL 1WISA 4ETQA 3WUWB 4O58H 4KHXH 4BZ2L 1KBWA 2JJVA 3MYZA 3V0IA 4ZPTB 4D9QD 3RA7L 3VUAA 5FM5O 3FF8A 3QJSB 3F00A 1UZ8B 4JN2B 1XAUA 3ZXAC 4EUPB 1I85C 4L37A 4X6DE 2RFXB 4AY0A 5C7ZA 3P4MB 2Y3NA 4NSKB 1ZA6B 4OLVH 5E8OB 4CSZA 2AABH 3T0VA 3ALXA 2HVJA 5ILTL 5KYUB 3DXAA 2MFNA 4GMTH 3WTWA 3GZQA 1PD1A 4H5SA 3EG9B 3CFUA 3PFUA 3D30A 4FZEH 3VD7A 3MZTA 4MA1B 3TV8A 5I1KH 3I6SA 5GRYA 3UZVA 3VXUD 2BWDA 1JZ7A 5JPNA 2FZ3A 4NWUL 3NJHA 4W9KC 1RIUL 5F0PB 5JPNC 1SUJA 4KNQA 1BBDH 3GBMH 3GRWH 2ORBL 1K4CB 5IFAH 2P8LA 5IW6B 5D8JH 5HP5A 4GH7B 5IMLA 3ZJAA 3F05A 2XZCH 1J11A 2J43A 1IBYA 4ALAC 2A9NL 3AAZA 3K72A 4FADA 5BXFA 1TJHH 1JXFA 4JFXA 1YNLH 5GGSA 4ACTA 1FZMA 4W9JC 1QMUA 2VXUL 1S7XA 4HQQL 4TQIA 4KTGA 4XNQB 5C92A 2DLTA 5HXMA 4Q97A 1V3LA 2MMXA 2QBWA 3H3BC 3VFMB 5KVFH 5CLXA 3TH4T 3DJRA 1IAOB 3BP4B 3C5SB 3VJ6A 3MV9B 2QMKA 3QCTH 4P2QD 3THML 4QAWA 4QDGA 4XN8A 2SEBB 4XTRC 4PS3A 2OTUB 3ARGB 5FIEA 1NJ9A 4QNPF 1QSEE 3BP5B 1XZWA 5FB8B 3RUGF 4HCRA 4HUNB 4L8SB 3ZKND 1YRKA 4IYKA 3QDGA 3HC3L 1Q72L 4NPYA 3TEUA 1QAWA 2ZXQA 1J1PH 3WEXA 1DUYB 4RWHA 2X9WA 5ELIA 3SDAA 1ZHNB 3SDAC 1Q1PA 3MRCB 3UCRA 4KVCL 5CJOL 4X7TA 3PWNB 1A1OB 4Z7VF 3TJEL 3KBFA 4PMEA 3ZTCC 5E24E 5AUMB 3CBKB 5T3ZH 5I23A 5HGGS 3BOVA 1NEZB 1KPUB 2A9DA 2GSGA 3KNBA 1JDDA 3ZKSD 4X0KA 3UH8A 3MUHL 3TLRA 1HEZA 5IKCB 3EGDA 5HI3C 5EG6C 4FF9A 4M6OL 1AZZC 5B39G 1L6ZA 2C9VA 3STZA 1MFEL 4HC1A 4PFEA 3HVNA 2AJSL 2X88A 4J3VA 2ZZUT 4V2CB 3HI6H 2D2OA 1NGQL 4G8EA 5FHAL 4LCWB 3RYMA 1MCRA 3F83A 1YAIA 1JTTA 3P0GB 4NQDE 4UB0H 4X4KA 3H53A 4NGHH 4A2GA 3MXVH 3PABA 1UUSA 2X4UB 3MUGB 3QQXA 3GS7A 4B97A 2WBJA 4O02B 4J3OF 4AI7A 2YPLA 2GK0A 4K94C 5FWQA 4NJ9H 3QYCA 3SKJH 4P9MH 1GKEA 3KW8A 5C08E 1MF2L 1SBSH 2CUAA 3L4TA 3IKCB 3KPOA 3ZKMC 3EDDA 3KLSA 3HG0A 3QQ4A 4ODXB 5EBLA 2XG5A 4IOSD 3E7JA 3L4YA 4JFVA 1ZE3C 4H0LC 2X4SA 5EOQH 2GW5A 3D3VA 1MWAH 1A3LH 5G5DA 2COQA 3TA3B 1IE4A 5GIRA 1JYNA 3HN8A 2Z7YA 2ED7A 2CAKA 1AS8A 1OV8A 5C0AD 2CKBB 4O58L 3J7HA 4KHXL 4WTXA 3P30H 4G70B 4ABWA 5HI4D 3MRRA 4K3DH 3B7SA 1TZIB 1UUNA 4FXTA 5BRQA 2HJLB 2XJLA 3ARPA 4ZMQA 4QD2E 3RPBA 2X1OA 3FAWA 2IALA 3LKRB 3NDYE 2KQMA 4KKPA 2XU9A 4DGVH 1BVKA 2ICWJ 4OLVL 3LB6C 3CFEA 2AABL 4ZMTA 4PJ8A 4OFDA 4PJ8C 4S1DC 4ZTOL 1ZVSB 4N3UA 1UT2A 5LBGA 4GMTL 3II2A 1QW8A 3VRJA 2BDNL 5JQ6H 1FI8C 1BW8A 3RFZC 3WJJA 4FZEL 3TF4A 2ZWSA 5FYKE 1XD1A 4XB3A 3GO1H 4RGND 1AR2A 3GMPB 3B9DA 1KDIA 3NFNB 1BBDL 3GBML 3GRWL 3K71B 2Z92B 2XWTB 5IFAL 2EQDA 1WD8A 5D8JL 1LP9A 1A21A 3NOIA 1U41A 3WTVA 1F8TH 2XZCL 2FX7H 3MNWA 4GRMB 3SY0B 2ILLA 5K9QG 2AEIT 1F4HA 4QEGA 3B6SA 3ASOB 1H5BB 5D1XB 3C8KA 1E9OB 3C6LD 1TJHL 2J5LC 4WTZA 4HETA 1ZVYA 1XF3A 4P5TA 2VLJA 4C56B 4G6MH 4AITA 4HWBA 2XYCA 2W60A 2IADB 5IW3A 5IQMA 3IF1B 5KVFL 3MBEB 2H32H 2WUBH 4AC2A 2C9RA 3GLDA 4IGBC 4YHZH 1AD0A 4UWQB 3SO3C 3QCTL 5BPPA 2R23A 3QRBA 1YY9D 4RSVA 2ZUTA 3OMNB 1UADC 2WYTA 5E1HB 5SX5K 4NBXB 8FABB 2C1OA 2HVKB 2KKQA 4PJ7F 2O6FA 4Y2LA 4RA0C 4YHNA 3VFPB 1UXSA 1TR7A 3S5ZA 1ROCA 1QBBA 2ZUSA 2B5IB 5SV4A 3HLKA 1M1XA 1CDHA 3L4ZA 3QZWG 2KC0A 4JJ5A 4Q58C 5E0QA 3QE5A 2GB2A 1J1PL 4YK4B 1RK0A 4Y0GA 1PG7H 1SQMA 4ZX4A 3MJ7A 1DBBL 5F7EH 4JBSA 1H8SA 3EGSA 2QQQA 1FFNA 2F2HA 3CDZB 3NZ8A 5T3ZL 4TUUA 5JZ7D 1U2CA 3B8YA 3Q2LA 2ADGB 3CHPA 3BFOA 3ZDXB 5HBBA 5I8CA 1S9KC 4NHUB 4MZRA 2V2WA 2ATKB 4WW2F 5FYLH 1NMCB 3IAPA 3PHQB 4MQ7B 5AAWA 3I2CH 3WNOA 4LLAA 3BVVA 2HT2C 4R5TA 5GS0H 3GLZA 3LNFA 1VZGA 1E90A 2RALA 5TDOB 2ZJSH 4KJQC 4WI4A 4KKAC 1VACA 3HI6L 2NDFA 2XIIA 3MJ9L 5AW0B 1I1FB 3H56A 4IMKA 2DTSA 2WTPA 3NABL 4NP4H 4UB0L 1NBZB 4JKPH 5ACZA 3MXVL 5A2AA 2BHYA 1UKQA 2PWEA 1WFOA 4LSUL 4RAVB 1UD4A 1SHXA 1WZAA 2IVFC 4MHHG 5DQ9B 5AVQB 4NJ9L 4HGWB 3SKJL 2IWEA 4KRNA 2CLVA 4P9ML 1SBSL 2VSCA 4ZO7A 4ODHH 2HT3C 4GSXA 4F7TA 4ES8A 5E2UH 4X9YA 3OSKA 5DO8A 1UOVA 3RVUC 4AC4A 1J18A 5EOQL 3RWIB 1RCYA 1OP9A 1FLTX 4F7PB 4ZUUB 1D3CA 2GJ6D 3VXMA 4XMUA 1U8HB 3FNKA 4QRUB 1I1CA 3P30L 3RWFB 1CE1H 3FQTB 3M17A 1QHQA 4LEEA 4N2IA 4K3DL 4PRPE 3RY5A 1MCIA 3FH8A 3SE6A 1IFHH 4IRJC 1CT8B 3D18B 3RURA 1HXKA 1ZY9A 2LU5A 4UZUA 2CMRH 5L4JA 3AFLA 4DGVL 1V7NH 1MOEA 3RX8A 1MVYA 2ZPKH 5AW8B 2XTJB 4Z95L 3SKNB 1RKRA 5HDBF 2CJTA 1BAWA 2M2DA 1IEHA 1JUFB 3BKJH 1JERA 3L45A 4U1GB 4EXPX 5AD0A 3X12B 1T0MB 3CC1A 3GO1L 3U48A 1I9EA 2V3EA 4BK8A 5C0BB 4G6KH 4AH2B 1NM4A 2ADFH 2DWEA 2BRQA 1U8LB 3QXUA 1OGAE 4NZTL 4PWFA 5DJXB 2L3BA 4V1DD 3SKMA 4JFFE 4LCUA 4BQ9A 2FX7L 4G9FD 4DVBA 4O2FB 3NCBB 3A47A 5E4OA 4Q6IA 4ZS7H 4JG0H 3MRQB 4Q6IC 1EXHA 1CBVL 3OWEA 1DBAH 3RNKA 4L4VE 2WNXA 2VE6B 1BREA 3OXRB 4IOIB 1Q9LB 3BCDA 4M43L 2WWOA 3S37X 3F01A 4GO6B 4HIJA 1G0YR 4ZUTB 1JXKA 5AYTA 2WYHA 3EKCA 4Z76A 3ME0A 1SHWA 2WUBL 4TSCH 1QG3A 2JJTA 5T3ZE 3GHEH 4PYHA 3QWQB 2VDMH 2DQEH 3QNXB 3T3PF 5IK3B 2NXYB 3UTTA 4UOQA 3ENEA 2ZSWB 3AROA 3TBYA 4X4XB 4F8TA 4ZW3A 4KZCA 4QRRD 3I6LE 5AW4B 3TS8A 5H4ZA 2ZXCA 4P3WA 3FMGH 3V5HA 3HB3D 5CINH 1NC2D 1BMWA 2UUDH 3OB0K 5ABDE 1PFOA 3ARDB 3MROA 2A83B 5DMYA 2Q76B 5DT1H 3V5KB 5AZ2H 3AUVA 1HHIB 1PVHA 1RP8A 3KJ6H 1D7CA 4G6JH 3HZMB 4I0PB 5IOPB 1PG7L 1CFSA 4KKBD 4P46B 4DHLA 1AGDA 1NIEA 2D73A 5F7EL 3CZUB 4S2SA 1X5AA 4QOKA 4PD4K 4NC1C 3P4LA 3GXFA 1ES0A 2F7IA 5CO1A 2QGCA 4Z7QF 3TH3T 3SKOA 2BZDA 1W8NA 2BP8A 4EI6B 4KKLC 1G7LB 1AIFB 2XWBB 1NA8A 5FYLL 4XP1L 3VQLA 3ZO9A 3I2CL 3LS5L 4JFQB 5GS0L 4KROD 1L0PA 2RQ8A 5AL0A 5D7LA 4Q14A 1HNGA 1QHPA 2JIXA 2ZJSL 1N70A 1OANA 1Y0LB 5F96H 3ZHLA 5DC0A 1PYWB 2AQ3A 2VN3A 3UBFA 4NP4L 3VB8A 4N90D 4G72B 4JKPL 1M7IB 3OXSB 5ISZE 5E6YA 3RDTD 4GKSA 3BW9B 2YKKA 1NCAH 3QUKA 1H0DA 1UD2A 2WWMC 2D3JA 4LFHD 4O51B 2ZF8A 3KBHE 3QZWA 3OAYH 1NFDF 3APMA 4ODHL 4P23C 4N87A 1EEYB 1HZHH 2ADYA 4PJFA 3X1NA 4IS6A 5F7MC 3QWRD 3HR5B 1I9JH 4ENED 3QC6X 1GZPA 1NSNH 3M8OH 1MELA 1F4WL 3QUYD 4JFHD 5AOMA 4X6BA 1RZGA 4RZKA 1BQHG 4L8BA 4TSBH 2YKLH 3GPSA 3MGTB 4HIHB 3F7PC 3HNVH 4IRZL 1FAIH 4XWGH 1BVNP 3AT0A 3TVMB 1IFHL 2MH4A 2XQ0A 4L48A 3ZDYE 1MI5E 1TENA 2CMRL 1FWXA 1SYVB 2J55A 3PWPE 1AC0A 5IREA 4U2ZA 1UG9A 2B1OA 4GI6A 1V7NL 5AYQA 3PQYD 4PRHB 3WS3B 1J48A 5DEFA 4DTGH 3SGDI 1BIIA 3X2QB 1FNLA 3WU1A 3LV3A 2WNKA 3N1QC 1OAXH 4GP8B 1A9BA 3L3OB 4YSCA 2ISDA 4AQ1B 2P24A 1UWEH 2DQHH 2IIJA 3BKJL 1JNNH 3DV6B 5D7IE 5AOLA 2ODIA 5E8NA 4NQEE 1JNLH 5F0JB 3N40F 5C0EA 5D96B 2HCZX 2OMYB 3T5WA 3T65B 2DN7A 1ZMYA 1VFAB 1W8OA 3G5XB 2C9PA 1AI1L 2ADFL 4G6KL 1OM3H 1S3RA 1JAEA 2JXMB 4CJ0A 5TFSH 2VR9A 1WIUA 1DJWA 1UT1A 2DMCA 1G5GA 2IBZX 2YEQA 3MNMA 2HKHL 4XE5B 4ZS7L 3CJJA 3DMMB 4JG0L 3TZVA 2YAPA 3CX5J 2EYTA 1DBAL 3LZFL 3GMLB 5H37A 3FT1A 1BF5A 3WDIA 3QI9B 1HINH 3VRLE 3RWCA 4M02A 1MKFA 2MPAL 1OO2A 4TSCL 5D1QC 3MFFA 3I74A 1HXYB 2VDML 3TIEA 1X3DA 1TTAA 4ZUWB 3MRHA 2VOTA 5E2WH 5J7CC 3CU1A 1BLNB 3LHAA 3Q6FB 4UIMB 5FYLE 1KWGA 3VD0A 2D3VA 2C3VA 4IIZA 2R27A 3BKCL 1VA9A 3HI5H 1LE5B 4XNAA 1I7RA 3GSVA 1I7UB 3FMGL 5CINL 1CLOL 1M71A 4X6DA 4UT9H 3QDJE 5IFHH 4WF7A 1GCYA 4FCAA 5DT1L 5KAQF 2CG9X 5AZ2L 5DK0A 3KJ6L 4NZDA 5IMOB 4KXDA 4QJ3B 1CMOA 1HL5A 3CCHA 3DUUA 1NICA 3N1MC 5BUPA 1MVUB 3FT4A 4U31A 3FS9A 4HSQA 2KZKA 4UINH 4XHQA 2WLJA 2ZUQC 3O3DA 1P6AB 3DUSB 4QHPA 2NY0C 3V0GA 3LKPA 3DROA 2AK4B 1QLRA 1YN6B 5EHFA 3QIUB 4U1IB 1DLHA 2BSBA 1KACB 3DJ9A 5E08H 5TDPA 3PV6B 4U1HB 4HUVB 4XCCL 1UB6A 3GJFH 3KLDA 4FMKA 3H9YA 4I9WD 1VRSA 2HFTA 5GSRB 4GB9A 1K8DA 1GOGA 1WICA 4HLJA 5F96L 2JNZA 1T0NB 3VMPA 2X9XA 3T71A 2O30A 2VLKA 3MLWH 4XC3H 5DRXB 1XR8A 3W82A 4YAQA 5AFAA 1U8NA 3MRLB 1NCAL 4QKXB 3QR1A 4MJ6A 5ICZB 4EQ3A 4XXWA 1KT2B 1NGXB 4O2EB 3BUQA 1KV7A 3GMNA 2CBOA 5I6OA 3D08A 1NAMH 3QRGH 1GVIA 3EJZD 1QSEA 3SY6A 4JHZA 1YPZF 2ENSA 2VDNH 5CSZA 2LTQC 2ZX6A 2Y3AA 1ID2A 5JIHA 2WY3B 2VRKA 1C08A 1NSNL 3AGVA 2F58H 4XRCB 3ULUD 5LJYH 2NY1D 4CBZA 4TSBL 4G8GD 4LOFA 1G1OA 1PY9A 2YKLL 4M3HA 3FH5A 5TQ2H 2WLLB 3HNVL 4XWGL 2BS8A 3OKLA 4JG1H 1HZKA 2NY4C 3C5ZB 4ABQA 5E6ZA 5D7JD 5CBAB 5E1QA 1YY8B 2YAFA 4DTGL 5HYSB 4OZFA 1MZZA 3BAEH 4FXKB 4LCCB 5CJ5A 2XXGA 1OAXL 3B3IB 4E41B 3D2TA 5LDSA 3WFBL 4G1MA 1FC2D 2DIJA 3PWUB 4ZMXA 4LAJH 4JFEE 4MZ2A 1UWEL 2DQHL 4ZFFB 1W72H 1I1YB 1JNNL 1OGTB 4XMKH 1ZGLA 4GT7A 3ZX1A 3LQAC 4N2MA 3IS1X 3BHBB 3WFCH 1IQDB 1DVUA 1U8QB 2I7OA 2UWEA 4LLYB 4OJFH 4EI0A 4LNRB 1XCTB 3T6XA 1EVTC 2NMSA 4HOMA 5JOPE 4OIAA 3HHSB 1OM3L 1OP5K 5BZZA 1T1WA 2VZOA 2AQ2A 4P07A 5D7HA 3IPEA 4KH9A 4P2CG 2JE8A 4UUJB 2DLIA 4AM0B 2WP3T 1CXFA 4Q9RH 2B77A 3D4ZA 1UKTA 3VYOA 4Y5YA 4Y5YC 2Y22A 3BD4A 3WEAA 1BWWA 5B1CA 4QNPE 3TTYA 3N04A 2ENYA 1AR1C 3RUGE 1HINL 1M05A 5DC2A 2HJFA 1OCZB 2QSTA 4AQZA 3SGEH 1PL3A 4S0SD 3GSWB 3X14A 43CAB 3CD4A 5JXEA 2EECA 2PLTA 5JXEC 1E3XA 4DGWC 3BZFA 3FPYA 1L7TH 3BO8B 4JPVL 1Z7JA 3B34A 3MNVB 1CK0L 2GITA 2NNAB 1CZ8L 1ND0B 2XZQH 3DKHA 1GS7A 1N59B 1HSAB 2NZ1A 3HI5L 3NEXA 4OKDA 4M6MH 4BE6A 3DOSB 4Z7VE 4KQ3L 4UT9L 3HUJE 2XUWA 5IFHL 4R2GB 1MAMH 4PJAE 5CNHA 4XCNB 1IBZA 1D9KD 4WHYG 2EJ1A 1BZDA 1IZKA 4UYQA 3LZOA 2ZP9A 3ZGHA 1WBYB 4DQOH 1YMMB 2YLKA 3MV8E 4JQIA 2HRGA 1JWSA 3VG0H 5EFIB 1IAKB 1OAYH 1J1XH 4EXKA 4UINL 3Q3GB 5IHBA 4X9GA 2AAVA 2APFA 1FFOA 4KZDH 1UJ3A 3AY2A 4X5QA 1UJ3C 2J44A 2DKUA 5E9DB 2OM5A 3G6DH 2UV3A 5LQBH 3CPLB 3ECQA 4LCWD 2NYYD 4PSPA 2DLEA 3BDYH 5DTFA 3ES6A 1T5WA 2FEEI 2WB1A 3BUYA 4NRYB 4U6HB 1AE6L 3OKEA 4K8RD 5D4JA 4KOBA 1WE5A 2N7AA 3TO2B 1PAMA 4WK4B 5EBWA 2ETWA 1XGUB 2Z4TA 1Q90A 3SPIA 4YBLC 1JTOA 4OZGA 5K93A 3UG3A 5KTEH 4RISL 3MLVH 3BRGC 4L3FA 3FQWA 5HGDA 4XC3L 2H6PB 3DV4A 3FDWA 3S37L 3A4AA 3QDMB 4YC2C 2BFVL 3CXHK 1S9WB 3VDBA 2ZX8A 3QZMA 1SXAA 1A4AA 4U4IA 4BFJA 1HIMH 5E1GA 5FYJE 2DMBA 5LDUA 1NAML 4QHUB 4P2OA 3QRGL 3KGSA 3OZ9H 3P11H 4P2OC 3G6AA 3NIDF 3EJCA 2VDNL 3ILDA 3P3UA 4PJXE 1JPFB 3PHAA 6FABH 3U6RA 4ZO8A 1PFCA 3WEBA 1F11B 2F58L 2OMXB 2WAHA 4TM9A 4G1EA 5E51A 1DJZA 3QQ3B 4R7DB 2XC8A 4TVPH 5TQ2L 4IIQA 1D2PA 4EKXA 1KFAH 1N8ZB 1CF8H 2WTRA 4JG1L 4YSSA 5C09D 3ARFA 1IGJA 3EYVA 4L9LB 4JRLA 2WKGA 4ZYKB 1H8LA 2N0KA 1CGTA 5ECJE 4OFKA 1XL4A 3L4WA 3ULSB 2LFEA 1K8IB 4X4MA 2PF6A 3I3DA 4C55A 3GB7A 2A9MH 3BAEL 1NEUA 3G7TA 3I75B 3MHZA 1Q1JH 3KYMB 3SKUD 3QFDA 2BY0A 5DJ2B 4IEFA 4JJHA 4N2NA 5BVJA 2A74C 3VG9B 5I9QB 1W72L 4XMKL 2FHFA 4GKNA 1QPKA 5AZEH 4JX0A 4DT2A 1X5GA 4HT1H 5LAXB 3WFCL 2XWJB 1E2ZA 4OJFL 3B2UD 4KK6C 3P0VH 5EO1A 1T7YA 3WE6A 4JREC 2EO7A 4UI2A 3T0XA 3VXQB 4JHVA 2WLIB 1ETZA 4XI5D 2I27N 4XNYH 1BFTA 5DI8B 4Q9RL 3L95A 1XFPA 4TULH 5C0ND 3L7EB 4FLSA 5BRZB 3Q8BA 1X4YA 4KVNH 5I8EB 1IUZA 2B2XH 1NIAA 4TXVB 5CD3A 1CDGA 1CXEA 4A68A 1G0DA 2PPCA 4I2XB 4XHJC 3GTVA 4QHNA 1XSOA 1G6RB 4FQXC 1NBCA 3EFDH 1KN4H 3DPDA 2Y25A 4MGXA 4OFIA 1ZHBA 3UO1H 2FVNA 2AJYH 2OI9C 4WUKH 5I30L 3T8VA 2AVGA 2ROXA 3WXVH 3O4LD 4JDVA 1KULA 3RIKA 3VM7A 1O9VA 1YECL 3CHRA 5GS1C 5GS1A 3GRWA 1L7TL 4Z7NE 5ID1A 4X6FA 1N3NB 4OLUH 4BKTC 3IMTA 2F54A 2XZQL 4RAHA 3FTZA 3GXTA 2HXAA 3MOBH 5CMAA 4Y5VA 4Y5VC 5DZNA 4M6ML 1UFGA 4PLJC 4JDTH 4YFEA 4HHAA 1JGDB 4MNGB 2FWLB 1MAML 1YN7B 2YAOA 3TWYA 4UDUB 2FUTA 4QI3A 1PLBA 2AEQH 3HPLA 3MTRA 4OFYA 3TEZA 3QXWA 1JIBA 2AJUL 5KVEH 5E8PA 5KYYA 2XBTA 3PP3H 4XOEA 4DQOL 5HD8D 4K15A 3RWGB 2VQ1A 1I75A 1S7WA 3VG0L 1KIPB 1OAYL 2P8MA 3A67H 4YOKA 3S7GA 3BIBX 3FFCA 3V8CA 1JI2A 3QJHB 3BQVA 2XN9D 5I73B 4XE0A 4ISVB 5EN2A 4JZJB 2BXZA 1B4JH 4JKMA 5FUZH 1ZIBA 2A6IA 2VLLB 3G6DL 4W81A 1FE8H 1GS6X 1SXSA 1F42A 3NGBC 5LQBL 1PKQA 3H7LA 5KVGH 3X11B 3BDYL 1CDCA 2GAZA 2H26B 1E30A 5DO2D 4K55A 3VWKB 4LNVA 3N44B 3WFHA 4OUUA 1GGCH 3EOYG 4JNXA 4LKCA 1T21B 1J7VR 2FWOB 2CK0H 3O8XA 5J1SC 3O8XC 3MLVL 1BJMA 1T03H 4JFDE 4YEEA 3U0WH 3S36H 2W81C 4XVUD 3NP3A 2IXQB 3V4VB 4ADIA 4HUUB 1CD8A 3RL1A 1G7PA 4HUCA 4YR6B 2WXLA 3IRZA 1HIML 3MV9D 3ISYA 1BQ5A 4FCHA 3BD5A 5DVNA 3OZ9L 1V3KA 3TNMA 3NH7H 2IPKA 3ARGD 5T8IA 4WI5A 2ALWA 2YWZA 4CKQA 4BFNA 4ZZKA 3SD5A 2V5RA 3PYCA 4IBZA 1T4KA 2YXVA 3FT2A 4KUZH 3MJ9A 4U0QB 4YLBA 4ZW7A 4BUGA 5BOJA 1Q94B 4U6VH 4MBOA 4RBPH 1VKXA 5HDBE 3WIIH 3MV01 4JCLA 2AXFA 5EUOB 1KFAL 2XZAH 4JHUA 1MG2C 2EO1A 3UGEA 2J2ZA 2BY2A 1H3VA 3FKUS 3KM2A 4GKOA 1DVXA 1WC7A 2QEJA 1OAQH 1G9MH 1MLBA 1N18A 1T3FA 4X6EA 4Y5XA 4Y5XC 2A9ML 1DSFH 1OCCB 1MCCA 1ZLDA 3VGBA 4J5VA 3BAYA 4UM9A 4TKWA 2V9QA 3BIAX 1T6WA 3DO7B 1JGLH 4HH8A 4HT1L 5T1JA 4WEBL 3LEVH 5BZWB 2ADIB 1PZCA 4OGXH 3BH8B 1FHNA 4FLOA 3VGAC 1P7QA 4MCNA 3ZT6A 1NLBH 5DSCA 2DYPB 4LPVA 3BRFA 1XF1A 2VGLM 1X9RA 3GMMB 4UOW0 2P5WE 2FT6A 1FL6A 4TULL 4KVNL 4FS0A 2V5SA 4R3SB 3EXLA 3H9SA 4UT6H 5T5FH 3KPSB 5LG6A 3UFIA 4RGMC 1V7MH 2VDQB 2Q6WA 1V3JA 1JRHL 1KN4L 3UO1L 1FBIH 1NCCH 2AJYL 3CXDH 4WUKL 1B0WA 1WA1X 2Q8BH 3WXVL 5DMKA 4GW1B 1VAHA 1LXMA 4ANUA 4L4TB 2G3XA 3TA3D 2HFFB 4Z7OE 5HYQA 1G94A 4OLUL 5ANHA 4I1PA 2GBUA 3TF7C 3MOBL 5FO7B 4HP5A 4K9JA 4JDTL 4CVZB 1DZ0A 4YGVA 3CN2A 2PTTB 4UNVA 4FOMA 2H4EA 2AEQL 5BS0E 1GRWA 5KVEL 2W9DH 2VITA 1PBYA 2H32A 3H0TB 2UVEA 1E42A 1C16B 3A67L 3K5SA 4JRYA 4KX8A 3ESUF 2R29A 3FB7A 4JPWL 5DJDA 5J1TC 1EDYA 4OI9A 2YPKB 3FTYA 3H6JA 4BH8A 4PCSA 2QVIA 4TQ8A 2UY7A 5FUZL 1VFBB 2DM3A 5DD6A 4X7DC 1FE8L 2ZUYA 1RH8A 3LRHA 5SX4I 4XNDA 5KVGL 2VNCA 1WAPA 1UACH 2CLZA 4HBQA 5T1DH 1KYDA 2BHFA 4H8VA 4LSRH 5L4IA 1T20A 4LVHC 3RZCB 1IAIM 2AW2A 4PEEA 5F1OB 1GGCL 5IT2H 3TBTB 3CSBA 3FYIB 4TVPE 5D1XD 1AZRA 1B4RA 4WFFE 3GINA 1O6SA 4ZS6D 3ESPA 1V10A 4YHPA 3L7FA 4RFEB 1T03L 4J3OG 2FTAA 1SNRA 3MV7B 3U0WL 4C56D 3UC2A 3S36L 5DJ6B 2ZCHH 3UAFA 1Z9SB 1U8CB 3AACA 3MBED 2FT7A 1FFQA 1NMBL 3AC0A 3ZE0B 5IB5B 4J8QA 1CG9A 2F5AH 2HPOA 4LLQB 4NXKA 3QPKA 4RMUA 4XN9A 4E36A 1E7VA 5GS0C 2RCSH 3NH7L 4XC1H 3H4FA 1OF2A 3FT3A 4C4BA 1A4CA 5AVYB 1H6FA 2XWEA 2C9XA 3DYMA 2YQ2A 3VSVA 1SJEA 2JKWA 4KUZL 3TBWB 1KV3A 3MLTA 4U6VL 4BWTA 4IBUA 5AKRA 3WIIL 3QEUB 3JUZA 3NJFA 1X5ZA 2XZAL 4WJKB 1OQXA 4PTUA 5EZLB 3EFFA 4HD9A 4KNUA 4Z7UE 4N9GB 1I9IL 4OIIH 1OAQL 4BGLA 5M95B 5DMGD 1MCDA 3VO0A 1DLFH 1G9ML 1XAKA 2KH2B 1TUPA 1T0OA 1JK8B 4AV0A 5D2LA 2HMID 4DO4A 1VGEH 2X89D 4HU8A 2H7WA 1XEDA 3S9DB 1SDAB 3CHOA 1LEIA 3SYAA 1F4YL 2VERN 3HS0B 3IU4L 1NOFA 2H2PC 3NSCA 2OK0H 5IBUG 5HVHB 1T1YB 1JGLL 1KOAA 3OKDB 2BSRA 5KBDA 3LEVL 2IO5A 4X5XA 2EIMB 3IRCA 4QRAA 3WUWG 4OBRA 3QG6B 1NH6A 2YGQA 4OGXL 5CWSB 3UBXI 2AQPA 2E59A 4IRZA 3KXFA 1R19A 4JGUA 4HBCH 1FVCB 3CZEA 1CXIA 2P7TB 1RLWA 4XH2B 3WY2A 5IUSA 1NLBL 3WGVB 4EUPG 3HE7C 5JHDA 1CGSH 1FH5H 2J1KA 1P5UA 2XV2A 4NRXB 5ADPH 3IN0A 3VXRB 4Y19E 1H3WM 2XFXB 3KL0A 1ZV9A 5KVEE 4JGNA 1NCUA 1Q9KB 4WWID 5T5FL 4Z9KB 2PKDA 1V7ML 3T4YA 4N0UA 4G7VL 3PNRB 5LCVH 3U36A 3Q9QA 4H25B 1GZQB 1FBIL 1NCCL 2AV7A 3CFBB 3CXDL 1WHPA 4P2RA 2Z9TA 2Q8BL 1AOHA 1KIQA 3PGFH 4OD3H 3L3KA 3NACL 4JFYA 3P40A 4DGYH 1L3NA 4OZ4B 4K7PY 4B9PA 3BVUA 3NCWA 3NK3A 5I1AA 2X0WA 3WO4B 3BD3A 3QPQC 5KVGE 3QFJA 2FUQA 2MOQA 4KH2A 4NQUA 5DFTA 5B1JC 1AH1A 4HH9B 1T7VA 1ZLVK 3P2BA 4PCYA 4P2AA 2ATPB 3S5LA 1K5NA 3AABA 4CAGA 3B9KB 3Q2WA 4GUQA 4LASH 3W57A 1ZLEA 5GHWL 2YN5A 1JDCA 3D39B 3K8MA 4HA1A 4GKLA 4PRNB 1PG7W 1H8NA 3AXHA 5IQLA 3RX9A 4AZUA 3C5XA 1OCRB 1QTYT 2W9DL 3BUIA 3REVB 5FYKU 3RB7A 1DJGA 2JKIS 1CTNA 2XTJD 1M6OB 4IKNA 1XGYH 3PL6B 2DB8A 4KJWC 4HZAA 1FFPA 3WHE0 3FRPA 4A6YH 3ZSSA 3NPSB 2L7UA 2HLFD 1F97A 4UAOB 4OZIE 5HHOA 3VI4B 5A1AA 1BV8A 2Y6SD 3IGAB 2NDGA 3F65A 5B1AB 5C0BD 4O2CB 3FONA 2V2TB 3R06B 1CGVA 3E2HC 3LKQB 3VCLB 1UACL 5F9WB 4N0CD 1CI5A 1RK7A 1IAII 3AREB 5T1DL 1FNFA 3NSDA 4A2MA 3ZYOA 5IT2L 3RP1A 1WSST 4Z77B 3HCVB 4I18B 2GUOA 1WZ1L 3DIVA 3KWWA 2AZAA 4URKA 3P0YH 1LO2L 4M1CC 3NN8A 4U1NB 3UTOA 2EUZA 2HSIA 2VWEE 2P46B 1KGJA 1PLCA 1RZPA 3DTUB 1Z3GH 4LLDB 3RUGA 3BXNA 3LPOA 3U9WA 3ZTNH 1DANU 2E0PA 2ZCHL 3SDDC 3SDDA 4F33A 3C60B 1XGPB 1INQA 3SO5A 1TJGH 3FCSA 4M61A 1CS6A 4ZUSB 3SHSA 4P2QE 2F5AL 4AYDC 5AEAA 2NXYD 5HJ3B 2RCSL 3D85B 4XC1L 3REWA 1LDSA 5FGSA 4Z7VA 2B59B 3RILA 4ZMVA 5EIIA 4LL4A 2WIIA 4IK6A 4AV5A 1RJZB 4GXUN 4BGDA 1WV7T 3EO0A 3G5ZB 5SWSE 1KY7A 3ARDD 5F9JB 3O0RH 2WBXA 4EI5B 2FLMA 2GYSA 5I2IA 4I0PD 1UCBH 4OIIL 4YO0B 4P46D 3QORC 3DBSA 3A6OA 1DLFL 4M8QA 1KENL 5H2BB 3NJJA 3GSQA 2FECI 4GP4B 1VGEL 3EJRA 3OPZL 4NT6B 3OKKB 4WHTA 3SGKA 1ZA3A 1EDHA 3FCUB 5FO2A 3BZDA 2OK0L 1U42A 1UYWL 4KJYA 1DANT 2PXYB 5IVXF 5LO7A 1JCVA 1DEDA 4PI0A 3DVNA 4HIEA 3AXLA 1J5IA 2FJUB 1CD1A 2E5EA 1INEL 1JD7A 1FJ1B 4HBCL 2YAEA 2OXGB 3VFTA 4L3AA 4YHLH 2H41A 1L9MA 3LKNA 3QEHA 4ELMB 5FDWB 1G9NH 1R5WA 5L8JB 1X6LA 3MKGA 4FQJH 1FH5L 4MXQC 5ADPL 2BSSA 4KI5E 2FEJA 4YDZA 2DIBA 3PDGA 2ZTBA 4X8JB 1N7ML 4PJCE 5DJZB 5KUMA 3ABZA 5IVZB 5E70A 2GKIA 3C2SA 2EUVA 1CFNA 2Z91B 5LCVL 3W1ZA 5BV7H 3V0WL 4J12A 4FG2A 1I8LA 1I8LC 4OVVA 4JHAH 3PGFL 4OD3L 5FWRA 2DEXX 2NSXA 5D2NB 3VFGH 1VFUA 5J6SA 4DGYL 3GKWH 4OD2B 4B7IA 3CHQA 4FQHB 1WO2A 2HH0H 3E9TA 4IMLB 2YRZA 5J89A 2X7LB 4ODUB 1SHSA 4Y9GA 1O5DT 1WT5A 5DJCA 3ZN6A 2CDFA 4OVUA 3TVMD 4YDLC 2MHAB 4LASL 4WHYH 4N8CL 4YDJB 3WKYA 4UZGA 3BT2H 5HHVH 1HHHA 2MSPA 3H8NA 5F71A 5L8KB 3DVGB 2OJZH 4XGZB 4PRHD 4L8CA 3L8QA 1CVRA 2EC8A 4ANKA 4APXB 4G80A 4A39A 1XGYL 2V5MA 4X0NA 3FO0H 5IEKB 1L0QA 3DRQA 4FQPA 5KYNA 3MRBA 1BZ9B 4A6YL 2YPVH 3FQRA 3M45A 4F2ME 1PZ2A 5IB2A 4A2LA 2HRHA 4RSYA 2F15A 4RGNE 3SOBH 4AGOA 4PJGB 3PGDB 3D51A 1ZTMA 2NNXA 5FKAA 5IQNA 1JF6A 5DRZB 3BEVB 4L29A 1NQBA 3JWOH 1FGVH 4PY8I 1J8RA 5ABAA 3L3HA 3ZUNC 1EXUB 1P53A 1R46A 2CR3A 2L8AA 3JYCA 5A16A 1LYQA 1JVOA 4Y1SA 2BSED 3VXSA 3DK2A 3IJEA 4CU7A 1S5HA 3DMMD 3FT9A 2ENJA 2VDRL 2WXHA 1TCRB 4IW4C 4PJ7A 2OFQA 4Y7MA 1EA9C 4HJJH 4BSVA 3BH4A 1OQOA 5LXGL 4G7YL 3QI9D 5B38B 4PAZA 4LQ1A 3GTNA 4P8QA 3FOLA 4ODWA 2GY7B 2P5EB 1TJGL 4N0FA 1LMKA 3VFOA 1A8ZA 4CU8A 2R7EB 4JFUA 4ZQKA 5FKPB 4U05A 2OMZB 4O4YH 3GSUB 2HX8A 4PJIF 3WN5C 5IHZB 1NCIA 3FUEA 3UAEA 5EU5B 3VSTA 3GHBL 3QCUH 1QRNA 2WKOF 3WTUA 1O7VA 1S78D 3MACH 4IDLA 3F62A 3UMTA 3V79C 4EZJA 4BFRA 2FCBA 2JK5B 4CKVX 3R7RA 3WAKA 4R0LA 1XIWA 4R0LC 1XIWC 4WW2A 2IANB 4WW2C 3O0RL 2EXWC 5F89B 3CUPB 2PW1A 5HYIA 3EZ8A 5GJSH 4HUXB 1KJ2B 3H42L 1UCBL 4HS6B 3X13B 3OF6A 1KIUB 4IBVA 4XMWA 4OJCA 1MRCH 2NY5L 3OC5A 4W9FC 5J13C 3HG2A 3GXUB 4NZUL 3IDMA 1BLIA 3FU6A 3MRKB 4UANA 3TBSB 2PCXA 1P1VA 4F37K 4WO0A 1P1ZA 2AK4D 1IB5A 2QQNH 3V4PB 4TRPL 4X50A 3FUDA 2JLPA 3WLBB 1DBMH 4QXTA 5T3XL 1ADQH 4LVEA 4TNGA 1XWVA 1MFMA 1WCBA 1ETJA 1QFHA 5D7SH 4NLHA 3SDXB 4PREA 4YHLL 4B9CA 1G9NL 4FQJL 2EE6A 2B39A 4QUOA 2VL5A 4TUOB 4A7SA 4OZHB 3RZWA 4KNTA 2BNRB 3K91A 4FTDA 4WK2B 3ARZA 3ZMNA 5DS8B 2WXRA 1DHKA 5BV7L 1SOSA 4QRQA 4AEEA 1IKFH 4M7ZC 2OSLA 5E95B 4JHAL 3BYYA 5A3ID 4X9HA 2OMVA 3EOBA 3SPCA 3U2JA 1KB9K 2H6UA 2J6EL 3GKWL 5FHBH 4OLXH 5KBMA 2GJ6E 1FYTB 4MAUL 5GGTH 3MREB 3U4EA 2HH0L 3KPRB 1AD9B 4YSQA 1O6TA 2DKSA 3GM8A 1TQBC 1AP2B 4PP1C 3MGAA 3BKYL 4EOWL 1WWCA 3C5ZD 2WXFA 3BT2L 3PWLA 5HHVL 3LN4A 2DL2A 2Z35