3ESMA

Crystal structure of an uncharacterized protein from nocardia farcinica reveals an immunoglobulin-like fold
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
138
structure length
136
Chain Sequence
SLHVTADAPGAAQGGYSVVTFRVPTESETAATTAMTVTLPNVRSARTEPMPGWTARVDRNDKSEAVSVTWTADPGNPGVQPGQFQRFVVSIGPLPSAETVSFPAEQTYSDGRVVAWNQPPAASEPEHPAPTLTLAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an uncharacterized protein from Nocardia farcinica reveals an immunoglobulin-like fold
rcsb
source organism Nocardia farcinica
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein
total genus 25
structure length 136
sequence length 138
ec nomenclature
pdb deposition date 2008-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07987 DUF1775 Domain of unkown function (DUF1775)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2230 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3esmA00
3ESMA
chains in the Genus database with same CATH superfamily
1TJHL 3ELQA 3W0WE 1B2YA 2R69A 2OI9C 3PG2A 3U0PA 2GVYA 2V9TA 4NP4H 1NUDA 2VLJE 4CN4A 4DK5A 1ZHLA 3T1WA 2FO8A 2OR9L 3PXJA 2CKBB 1X6LA 3BWAB 3MBXH 1CB4A 3IGAB 5I5RA 4GLRH 4BINA 4OGXL 1Z7JA 1BREA 2G3XA 1VF5C 4L9DA 1R33A 1JVOA 4KKCD 2Z93B 1FL6B 1TQSA 5GRVL 1I8KA 5LGJA 1I7ZB 4MRCA 2VR5A 1UH4A 3GJEA 5DHYA 4GO9A 3QUXB 4YFDB 3VB9A 2AABH 3KYAA 4M9PA 2ZUWA 4QRUB 2JIXB 1OGAE 3S88L 3HRZB 2KI6A 4IKIA 2H1XA 2WN2A 3F6LA 3MGOB 4QRAA 4OUOA 5ID1A 4Y2DB 2W94A 1ETJA 5IJVA 1GL4B 2G2RB 1AAJA 5D1ZB 1ACYL 1KIQA 3OAZK 2NZIA 4WW1A 5KAQG 4O51B 3VU1A 3JWOC 3IDIB 4NWTL 4AENB 4C8XA 4TLSA 2R1XA 3KYNB 4ZFOA 5JXAH 1CFMA 3T2PA 3V8CA 2BVTA 3VXNB 5I30H 1DBKL 4HZLA 4NQVA 4NJ9L 2G2RA 2NMSA 2ID5A 4DP9X 3C5JB 1UD6A 4G5ZL 2QLYA 3GRGA 4A63A 1FNSL 2XTJB 1CE1H 5IUCA 4Z8FL 1VDGA 3VXPB 1N6UA 4HZLB 3D8MA 1E4HA 3MR9B 4JRYA 4NAJA 4RMTA 4QF1A 2E47A 2O5YL 3FCBA 4JKMA 2OSLB 4RZCB 5EA0H 3RIFF 3HE7B 2GABA 3T2QA 5DS8A 4PSRA 1PZDA 4MJIB 2V2XB 2RJMA 2B3RA 2WLIA 2ZP9A 3N40F 4NX0A 3MODL 5KS9A 4HP5A 1V55B 3GI9L 3N50A 2DWXA 2YMOA 5AL0A 3UERA 3CK0L 3O3EB 2ENYA 4E41D 5E9DB 1D9KA 1JXGA 3B9KC 2Z6FA 2G9HA 4AYFB 1QACA 2KDYA 4PJIE 4WK2B 5AW1B 1PKQA 1RAMA 1WTLA 2Q86B 3CVDA 5L2KE 3HMXA 5I15L 5T1LD 3OG6B 4TVPL 2YQGA 1B4RA 5JLZA 5E9DA 4N0YH 2BVOA 3CVHH 3S4SG 4NQXA 1CFSB 2R51A 3UTPD 2DQGH 4Y0GA 4FEMA 5TTRA 2X4SB 1PZSA 5C07B 5JW4N 2JKWA 3AXLA 5C2BL 3P9MA 5A7EA 7FABH 3MC0A 4XMKH 3OZ9L 4B9FA 3MBEA 3NN8A 2IH1B 5DK2B 1HJBC 3GMMA 1MJ7L 3T65B 5DSCB 3AXLB 4LLDA 1RK0A 1YNLH 3TVMA 4FLHA 4NO2B 1HI6B 3F01A 5E51A 1B2WL 2WNXA 3HMXH 3ARFC 2GTQA 1LVEA 4QPEA 2DQJL 4G8GA 3RIFK 2JJWA 2WXHA 2O5XL 1ZLWK 2R15A 2VSDA 1LO5A 4KKQA 3DHUA 4FI6A 4NQEE 5E00B 4CC0A 4HPYH 4NCDA 1B4LA 1YZZA 2X6MA 1W0VB 2AGJL 3A3YB 3JV4A 4HMEA 4M6ML 4NZ8A 4IRSB 1MNUL 5CINL 2QHRL 3UROR 1MIML 3KG5A 5C08E 1N6QL 1SM3L 2OKMA 2C3XA 4KY1H 3BHBA 3SEPA 1I7RB 1NCBH 2QV4A 2OMTB 4N1CA 3WKYA 3RPIA 5IHZB 3H3BC 5AOMA 4XN2A 2JJSC 4P2OC 1BZEA 2MMXA 1UACL 3V0IA 4KTEH 4H44C 4NN7B 2V17H 4CC4A 1KN4H 3MMEB 1G7LA 2BJML 2XQYA 1YN6B 2OX5A 5E7FA 4AQ1A 2X9ZA 5IQLA 1FYTE 3LEVL 2QL1A 1KCUL 1T2QH 3GKWH 1FIGH 1MFBL 2VITA 1CFTA 4PV8B 3IMTA 1XBRA 2Z1PA 2K3HA 4JRFA 1M6OB 1MF2L 4FA6A 3SCMB 3M6DA 2BFVL 3HZMB 4JFQB 4JZJB 4YIQB 1DN0A 2D03L 5EMYA 5F7EH 2D7NA 1PNCA 4W9CC 2D2CC 3NP3A 4P07A 5IY5B 4TQEL 5JORB 5CFAA 5CGYD 3STLB 1KPRA 2WY3B 2CGRL 2QR0B 5K9KB 3Q5TA 4XWGH 4YIQA 3EXJA 3KW8A 1FPTH 4HK0A 2R1WA 1NIAA 4FXTA 1QSFA 4MWFA 1GIGH 1WFJA 4U6VH 4MD5A 5DEGB 3WFEH 2WWKT 4Y8DC 1JFQH 2Q8AL 5FGCB 4XN9A 3RU8H 3NEOA 4X6DB 1J5OH 4UTAH 1SHXA 1PX4A 4UV7L 1G7JA 4X50A 4KXDA 4X8XA 4CN6A 2PWDA 1MELA 5SWZA 4H88L 5BVJB 1OF2B 2OCCB 1S4IA 3IU4H 1ID5I 1TQCB 1T0NA 1KDIA 3SJVE 2OYMA 5DJ2A 3CQFA 2WLLB 2ZICA 3QEQB 5KAQF 1HHIB 3LKQB 1YMHB 2NY0D 4DFHA 3CMOH 1BMGA 1MCOL 3B2MA 4LCCC 4HLZH 4XN1A 1JSYA 4OD1L 3FN0H 5FFOA 3WFCH 3O6FD 2UUDH 2WIMA 3MJWA 3EJTA 1AGDB 3GWJA 3CLFH 4NQEB 2R0WL 6PCYA 2EDHA 3HFMH 3HHSB 3PP4H 2KH2B 3KPNB 1DP0A 3GSUB 1WBYB 1ZCRA 1EO8L 2KQMA 1TJMA 5MEND 3MLWL 4LOUD 2CDEB 4PWHA 3FT4B 2CPUA 1S6NA 2RGSA 2MJWA 4AUJA 3G6AA 2YC1B 3V5DB 1YYML 1QI3A 2QLVB 2WO3B 1X7TA 3EF7A 2HTKC 3ZZQA 1CD9B 2VZSA 4LEOA 4OZIB 4IIZA 1YECH 4YDKL 2B1AH 2VM9A 1SDAB 1XSJA 1K4CB 2DIEA 1OEZW 4HOWA 3DX8A 1VAHA 2ATPB 4Y89A 2ZT9C 5DO8A 3RRQA 5JPNA 3HOGA 1G87A 1BVZA 3ZHKA 4AC2A 3LN5B 1UEYA 4X7SL 2J25A 2WMPB 3TZVA 2DJSA 2YPLD 5FW8A 2YD2A 5HI3C 5IVXF 1AHKA 1UVQB 2BP8A 1LEGB 1I9JL 3F83A 3VXUA 4GRLD 1ETB1 3FFDA 3ZDYB 1YJDH 4IMKC 1JHKL 2HT4C 1SVBA 2A4EA 1D5ZA 4KY2A 5KBPA 4Y1TA 2CJ3A 1DL7L 5D8JL 3RGVD 2DWEB 3BGMA 3KWWA 4JKWA 5EF3A 5IJKA 4LAJH 3DJTA 4X9GA 1PLCA 3V2AR 4F27A 3S4SA 4JANA 3ZKMD 1QMUA 3FO2B 5LDSA 5DMYA 4Y9EA 2DWEA 1S7RB 2V8MA 1WE5A 4X9HA 4MNQE 1UOLA 4XH2B 5KUKA 3L3DB 1QOKA 5GIRB 1JGLL 3S4SB 2OSWA 4L4VD 1DCEA 4PJDE 4ZQTA 2YHGA 1MQKL 3D39E 4O4YL 1JI1A 5EUOF 1AZVA 1DDHA 1NIDA 5BOZG 3FU0A 1Z3GL 4PJDF 1XSKA 4M43H 1LWRA 2JIXA 2EJ1A 1AVAA 2F8OA 4JDVB 4ZFZB 2I26N 4HF5H 2DIBA 4A7UA 2YK1H 4ERSL 2FDBP 4P9MH 4FTVD 3O2DH 5TDPB 2P5EA 1NCWL 4GUQA 3IDMA 2AQSA 5TPWH 5GQBA 5IFHL 1MHEA 2YXFA 3MRIA 3JV5A 3QQ4A 4Q74A 4KPHL 3S3BB 2NXZC 2X4PB 1GAFH 3QCTH 3EDDA 2P5EB 4MD0B 2QQLH 5ITBL 1BM7A 4O00A 3FSAA 4QJ4B 4GJTB 4QGTA 1NCNA 2JXMA 2WQRA 3ZN6A 1WC7A 4AEFA 2X41A 1UWEL 4R96B 2Y06L 1ZPUA 2A74A 2DQDH 3GMPB 3L95B 4K73A 4H5SA 1RUML 3DV6A 43C9A 3O11B 3QZOA 3MUUA 5EDSA 3MV8B 5A3ID 1FV1A 2IADA 1IGFL 2FEDC 3I9PA 3ZKXC 2Z1KA 1CDIA 2D3JA 3P3RA 4LHUG 4CMMB 5EZPA 5CSBA 3MJ9H 1XB6A 4L48A 5DJ6B 3VWKC 1A5FH 1EPFA 4RFOL 4ZMLA 2GIYA 2D3LA 4UQ2A 5ELIA 4PR5B 4HJ0C 1U92B 5GGVY 4U6XA 4QRPA 3OTTA 3RVVC 4LDOB 4J2XA 4MLIA 1Q0YL 2IBGA 3SE4C 2HA1A 4WI3A 3AGWA 3HNVL 4HGWB 3WKMH 5HVGB 5GS1C 1OPGL 3FL7A 5J57B 3EHBC 5D4HA 4XR8C 5DD1L 3IGKA 4CAGA 4N2GA 4JCWA 5D1XE 4R0LC 1P53A 3RFRA 5DRZA 3VFGL 4GIPD 3GDCA 3NACL 4XXCA 2EEFA 4D0CA 3OC5A 3NN8B 5DK2A 3MJ7B 4PW4A 2VQTA 1AQHA 3ZE0E 1FDLL 2E4TA 3O3BB 3D39B 4YXHH 1BGXH 5AOJA 5J0BA 3SE3A 3PXLA 1NBYB 2CGRH 4G71B 2WC7A 4MQXC 4ENEC 2NY1C 1PCSA 1AACA 3LXUX 3DIVA 3NPSC 4OZFA 1IAKB 2RHEA 5EUOA 1VEMA 2QPDB 4H8QA 3WGUB 1H5BC 4JN2A 3IETB 4GQ9L 3BVVA 1TQWA 3MLYH 1KTDB 4PJHF 1E2ZA 2VO5A 4JRXD 4L8SA 4NPJA 3AQXA 4ZW3A 4AZ8B 4X7EC 2PR4H 3KXFA 5F1IA 3KR3L 2BNUA 4K7PL 4NNXA 3QXAB 3SD2A 4YHPA 2VLLB 4ADGA 4KI5C 2Z7YA 2RQEA 4NHUA 4UZGA 1JNNL 2YOAA 1CFQA 4M1GL 1C5BL 4YDVB 3EFDH 2ZP8A 4NERA 2B14A 4JPKH 1CICA 4E2OA 1N6QH 2DQCH 3LKNA 3K2UH 1Q9OA 1M05A 2HUEA 3IDGA 2ZOOA 4AQ8A 1LO0H 1BIIA 5HGDB 1EHAA 3VYPA 4EZJA 2FT7A 4Y7MA 1S9YA 3MROB 5CD5D 5F9OH 2X4OA 2BC4A 1C8PA 1NEZA 1OARH 1NMAH 3IJYB 5EEYA 3GSXA 3LMJH 4RRPA 4ZMWA 2G75B 4YHNA 3ECQA 1KN2H 5HXMA 1JPGA 1E50A 3X3GH 3LQMA 4JFUA 5DUPH 2GJRA 5BRZE 5CGMA 3ULVF 4OD2B 1CE6B 4HIJB 1UZ6E 4EAEA 1TVBA 5CWSA 5E99H 1L9SA 2W9EH 5ACZA 2ZXWB 4G2AA 4OTXL 3QDGA 1UD4A 3Q8FA 2WZ6A 5FHAL 2OQJB 3DI3B 8FABB 3RYMA 5HDQL 3GLDA 2E7DA 4HKXB 5I8KH 2DQTL 5C1MB 4PGZA 5D93B 4HJEA 4APQB 5KVMC 1AKJB 3HFML 4K9EC 3NJIA 1COBA 4W9KC 4ZX3A 1JRHI 1UWXK 1PKOA 4UILH 2ALAA 2F8XC 5HHOB 3MFFB 3O2WH 3TC9A 2R0KL 5DI8A 2H7WA 2JJTC 4HK3J 4F7CB 1FCCA 5DZ9A 1YJDL 1DEEA 4XZ4A 3TF7C 1PKQE 1XFPA 3OZKA 2WSPA 1G4MA 1INDL 3A4AA 2ZG1A 3LDBC 2WINB 4F5CA 2V2WA 3QIWC 5DJCA 4PM1A 4P2QE 1MCOH 1ZHBA 3GXPA 4WVRA 4A39A 2MIZA 1ZTXH 3D2TA 1A6ZB 1PTZA 1FQ9C 3FB8A 3ZTCC 3IYLW 4YL9A 3KM2A 4ABUA 3MSPA 4GUPA 5KANI 3VXOA 3FT4A 1I75A 4J3OF 4CSSA 5FHAH 2A73B 1TTFA 5FF6A 4LGSB 4BXVA 1EZSA 1DQMH 5B38G 3ME0A 1RPKA 4G7SB 1GC1C 3NZHH 4KRMB 4LQFL 4K07A 4OZIA 3QWQB 2GK0A 4KRPD 5GSVA 5JHDE 5D7KD 3DSNB 1KEML 1GTNA 4P9HL 1CLYH 5DA4A 4OJFL 1E8YA 4NWTH 3PP4L 4JQXA 1D9KC 4U3SA 2F6AA 2E5EA 3C6LD 4XMXA 4JCMA 1EFXA 2EDEA 2YMTA 3KJ6H 2K78A 2EDRA 3N40P 5GZNC 1TSRA 3ZX1A 1AZUA 4NKQB 1HNFA 4CC1A 4HFUL 1F4AA 5CKAA 4WW2F 2WZPD 4HKJA 1D7FA 4OIFA 5DYOA 1CVRA 3SQOL 3BZ4B 3KEHA 2FGZA 5GS2H 4PGJA 5BRZB 3LIZH 4ZD3L 1AGFA 5I74C 2ARJB 2ARWA 3L6FB 1IKOP 2EYTA 3RB7A 3GSNB 3I75B 2ETWA 1CWVA 3K3QA 3KLAB 1XGTA 4A7GA 2OR9H 3CFUA 4EMZA 3ZHNA 3W9EB 5KVGH 1EX0A 2XVGA 3A23A 1ZWIB 1UWGH 5D7EA 3QK0A 1MLBB 3IFLH 4FQCH 5D7IA 4ELME 1UTDA 4JFFE 4UQ3B 5L6YH 1ZAGA 1SMAA 2E86A 4LHQB 3EKCA 1FFRA 2JTDA 3GMQB 3KPLB 5MP6L 2CO2A 1M2OA 5CILL 4YWGH 5DHYB 1E67A 2F7IA 4G8GE 3X11A 4OF3A 4X0NA 3FQWB 2OSYA 1H9DA 4LE8A 1UGKA 3JWDC 1N64L 1N59A 1KCSH 2CO7A 4BM7A 5K9QI 4PGDA 3HG1D 2COQA 4I88A 3UAEA 2N1TE 2Y36H 3KPOA 2JELH 3MRLA 4P2YA 4QGYA 5DEFA 4FRWA 3B9AA 5AQ0A 5C6TL 4PYGA 5I74B 3VXNA 2Y22A 1JOIA 4ZYKA 1UUSA 1DVYA 1NUFA 3UBXI 3IFPB 2WLIB 1BJMA 3DSFH 2VDQL 2ERJC 1WFTA 3DMMD 5I15H 1RFDH 3U0WL 5ICUA 1B3IA 1A7RH 1NSNH 3H9SA 3RFZC 3KYOB 2FJGA 1TEFA 5H35B 1EVUA 3LHAA 4I0PB 2E7HA 1IEBA 3LCYA 4Q6YA 3TBSB 4P3DA 3BZFB 4LSQL 4L4JA 3OR7B 4Z0BL 1QZ1A 3X3FL 5C0EA 3BPNB 4P8QA 3KYOA 1U3ZA 2XTJC 2O5XH 2B15A 5SWSA 3TYFA 3ZMNA 1CFSA 3KPPA 2AJVL 1U41A 3OGCB 3ZTDC 5C6TH 1OB0A 5KUMA 3R4DA 3D0LB 2HP4A 2YRBA 3TYFB 4RRPG 5FV1L 3RGBA 4NZUH 1ZDSA 4S11A 5C6PB 1S8DA 2QSVA 1PZCA 3E3QC 2CXGA 3O6KH 4ZPTB 3TVMB 1NPNA 3D0LA 3QJRB 4HWBH 5D7JC 3UXFA 1NCDH 2KYIA 3F2LA 1WLHA 1J1XH 4HUCA 4JR9H 4S1DC 5JIQA 5D6DA 4LEBA 2XXCB 3QFJA 1OQOA 4WI2A 4BD4A 4UT6H 4YNYB 3VQLA 1H15B 5B39A 3P4OB 5EU5A 2VCOA 4M5YL 4XP9H 3K71B 3TFKD 1L7IL 2C3GA 3GMOB 5DWUL 3KCWA 4JFFB 4BGDA 3WTVA 2IH1A 3PHAA 1WVZA 4XWOC 3VGHA 3QWRD 5F96L 4Y4FD 2PW2B 3CC5B 4UOW1 2CGZA 1OSPL 1N0LA 1HOEA 1IAIL 2K70A 1JPSL 4PYHA 5KVDH 1F90H 1F0LA 4G70B 1U8MA 4WTWA 2J6EA 3D69B 1H3XA 3DOSA 2Q8BH 4H8PA 3FCTA 1NWOA 4X4KA 4A67A 3BI9X 1HN1A 2PCFB 4HPOL 4GINA 2UWEA 4PGCA 5CEZH 4GPVA 2PO6D 4K5OA 4ZFGH 3TESA 3QXAA 5DD5L 5C0BE 5JPNC 1AIFA 1VJSA 1CFQB 5IB2B 3UCQA 4XPFH 2FQDA 4XVSL 1XWVA 2N7BA 3RDJA 2FVNA 3VXUD 3QQ9D 5BO0D 3MRNA 1WFNA 3UTSB 1LK2B 2ZCZA 1KJ2L 1KJ2H 2J6EH 3KL0A 1UCBL 3D50A 3KJ4C 3VFRB 4PI0A 3SE9H 2VIRB 3FQXB 4PRNA 2E9JA 3L3KA 3WS3A 4NQCA 1Z5LB 4DP0X 5CUSL 4IMLA 3E9UA 3HZMA 3LPFA 1XDTT 3VFRA 3DRQA 3VFOB 2V7HB 2VDLL 3CDGA 3L3KB 4DCQB 1OF2A 1BVLB 2XTLA 3EJYD 2B1HL 2VQUA 4HT1L 3T0EB 4DN3H 3WGVB 4B7LA 5CGYC 3Q2NA 2F7OA 3O4OB 4GG6F 2IIJA 1SXNA 1JFQL 3CHRA 2Q8AH 3RTQC 1KN2L 3SOTA 3SYCA 3TLRA 3ESOA 3WEMA 4JVPA 1NA8A 5A3IC 5KSVA 3T0EA 2CJUL 1IL1A 4F58L 1INDH 3BVNB 1A47A 4G80B 4U4BA 3K74B 1ZS8B 4OR1A 1MI5E 3PWNB 1J0IA 1BMZA 3QYMA 3O3AA 4X4XB 4X5RA 1SBSH 4F7CA 1FNGA 1IGYA 1IL1B 3RI5K 4KOBA 2BNQA 2YZ8A 5FUZH 4PJEE 4AGNA 1NAMA 4L9LA 3QJSB 4JHZA 4MQTB 1LNUB 1KGJA 1TU2A 2DM2A 4KKLC 5DJDA 5FB8B 4OJYA 3V4VH 4PREB 2X4QB 3BRGC 4PCTA 4QXGH 2YEQA 1J8HE 3OC8A 5C09E 5F0PB 3RIKA 3FQUB 4DP1X 5E5UB 3EBIA 4GUPB 3WFHB 3AU1A 2HVJB 2NZ1A 1H3PH 4MAUH 2PP9A 1W8NA 5EO1A 4IIQA 1NMBL 2VSMB 3T0WA 3HHSA 5E2TL 4P46C 3IMRA 2XY2A 4OGAD 1OKEA 4BYHA 3AQDA 3FQUA 3KPQA 5C0IA 4W4OA 3H0TB 4WWKD 1DQQA 4I2XA 3BSGA 2FJFA 4R84A 3ARGD 3RIAK 4IBZA 5CJXA 3PUCA 4KK6D 4LSPL 2QVKA 4KKAC 5T33H 4QYOA 4BQ8A 4FYTA 3H6JA 5HGBA 4YSEA 2OMYB 5BZXA 1MHHB 1NIEA 5TF1H 3ZPDA 5BZDA 3FU8A 1F42A 4NQTA 2UY7A 2GI0A 3ZGIA 1IRAY 5I6MA 1QNZL 4JVWA 4L29B 1FGVH 3ULVE 1EIBA 3HN3A 4UIMB 1I9EA 1XMEB 2HKFL 3B9KB 3L3JB 4N2OA 5TFSL 1HILA 4HUXB 3PIQB 4HXBH 4RWYH 1J8RA 3OB8A 5AUMB 1OM3L 3W82A 5FM5O 1G43A 3NJJA 3OLIA 3A47A 5AOKA 3WN5B 3QUZC 5JHBA 3LHPH 3IMVA 5KVEE 2M2DA 3L5WA 3US1A 1FN4A 4ACTA 1MCIA 5GIRA 4LRNL 5EO9B 1RHHA 2WLKA 1QBLL 1AD9B 1GYCA 1MVFA 3CDCA 3DVNB 3F5WB 3OAYH 4YH6A 5SV4A 1QBML 3BWAA 3U1SH 4BRVA 4Z7WF 1TJGL 4M3HA 2GCYB 5CILH 5EU6D 3QRGH 3VXTB 4K3EL 2JQAA 4JDVA 4ZFZA 5L0QC 1I3GL 1EAPB 2B5IB 3DVNA 3KWTA 3HLAB 3HHMA 3ZU8A 5I6LA 3AG3B 4UWQB 5KBMA 4HIXL 4KTDH 2ZWKA 1JNLL 3TBTB 4JDEA 3VCLA 1F58H 4X5XA 3HVDA 2DZEA 3C6LC 3WFDH 1KUMA 5IFJA 2ESVB 4NPKA 2LGNA 1IE4A 2X09A 1WK0A 2PPFA 3EG9B 4Y4HD 2ITCB 4RETB 1FNHA 2OCFD 5BXFA 4P5TD 2BSRA 1C1EL 1E2WA 4PJXA 5ABDE 3NACH 4QTHA 1NCAH 1MFAL 3M1CA 4NUGH 2XFXA 1QUNB 4LLAA 1YDPA 4LOEA 4YHOL 2Z34A 1NFDA 1CE1L 2R1YB 4Q2ZB 5E5MA 5I18H 5IFHH 3DMMB 5TPWL 1U42A 4NKIL 4RQQA 1TSHA 3IF1B 1EBPA 5K33A 1OPGH 4LDLB 1C7SA 3C5JA 1RUAL 2BSBA 1AZZC 1TZGL 4HAFA 4HETA 5JQ6L 1MFEL 5C0BD 3F7YA 4KZ0A 4L4TA 4AYMC 3GSNH 3D4ZA 3B3IA 3VFSA 5DRWA 5CBEB 2FWSA 4PJ7E 4QTIL 1Y18B 3WNKA 2CRZA 2IPUK 2CUHA 1N19A 3CFNA 5CBAB 3BN9C 3VYNA 2OR8A 4UT6A 1VFBA 4PJ5D 1KB3A 3WNIA 3BH8B 4FLSA 4GSDH 5TE4L 1SHWA 4I9WE 1QG3A 3MUJA 2F7PA 3ZHDA 1EHLL 1PG7H 1WZKA 4K7FA 1EJ8A 2QSCH 1DBML 1NOFA 3GXTA 4JM2B 1PKQB 4HK3N 4JZNB 2ZSVB 2XVLA 3OKOB 4UNUA 3JWNE 3M88A 2ZCHL 1CG9B 1RSYA 1TJIH 4U6XB 3LZFL 1J1PH 4NLHA 1P4LA 1FRGH 3V4PH 4N90E 5HI5C 4JZNA 1HS6A 2ITDA 4F8OA 3LMJL 3QC5X 1U8IA 5I1EH 3TJHD 4WHYG 4NQQA 3WO4B 5JXEA 5FS5A 3B56A 4HF5L 4PJ8B 2VMDA 5D7SH 5T1KB 1A6UH 1ZV2A 4PJXF 2VSCA 4Q7DA 1RK0B 2ZWSA 4PLKC 1WHPA 2RR3A 1A4BA 2AJZB 4N0CD 1WG3A 4UOJA 1H3TA 4PTUA 3DPDA 4ANVA 2XETA 2BVUA 4ZFGL 5AL8A 3MPCA 1AGEA 5IV2B 4S1SH 1REIA 2AJSH 4PSPA 1OTTD 5HDQH 2FR4B 1ONQA 2J5LC 4KKBC 4I77H 3QDJA 2BPBA 3D48R 3BT2H 2NY1D 5INDB 3QW9A 4E0RB 4X6FA 1JMXA 5IV2A 4N90D 5LJYH 5EUOB 1KYDA 1F90L 4LZKA 4PJ9D 2QFRA 4HJIA 2VJ8A 2F61A 3LNIA 4GP8B 4HWBA 4UF7C 5FGRA 1YEFH 3RWDA 1PPIA 1NKOA 1BFVH 2QDVA 2R59A 1QFWH 3IPBA 3F7QA 4QUOA 5DFTA 5IB2A 1ZGLM 2HB0A 1YEWA 5E8EB 1JGIA 1QYGL 2CHZA 1N7ML 4F1ZA 4YHNB 1K3IA 1KB9K 5A2BA 3NJHA 2O26U 1YEDA 3V6OA 3EJZD 3K2UL 2AK4A 4K7PY 3LZRA 4G8IB 5TJWK 2VAAB 3W5MA 5E5LA 4ES8A 4NUQA 3HE7C 4KZEL 2D4FA 1M05B 4NQCB 3STLA 3QEQD 1S9YB 3MROA 4A2GA 2ZCKL 5T1MB 1C5CH 3DRQB 3QJTB 3GBML 4X5LA 4XNXL 5DR5H 2N0KA 4ELDA 5F9DC 3RJQB 3C12A 4MA3A 5ITFB 2YRZA 3VYOA 4LARL 4ADJA 1YLBB 2IWFA 1JZEA 3LZLA 3GJFA 1CT8A 4HKXA 5BZWA 3UTSD 3MXVH 1O7SA 1AZBA 1ILSA 4L8DB 5DF0A 1I1FA 1IQDB 3GUTA 3HVNA 2ZXGA 4IGBD 5G5DB 4X0KA 1SF5A 2WWOA 5EH1A 1NC2B 3RWEA 2AK1L 3WYRA 2WCGA 1VACB 3VFVA 5JIMA 1X3DA 3X12B 2X4NB 4HC1H 1LE5B 4ZUWA 3GUTB 2V2WB 3VXRA 1WAEA 1B9ZA 3UMNA 3V6FB 4L23A 1HCYA 1I1AB 4HUWA 2UZIH 3DX0A 2FD6H 3DO4A 3RE0A 2OAAA 3MFGB 2OL3A 3N1GC 3ARBA 4Z7VF 4EOWH 2VB5A 3EFOA 2W59A 1Y1UA 2IQAB 2W07A 1MRDL 1OK0A 4TKWA 3F7RA 2OM5A 3V55A 1P7BA 3LRHA 3WS6A 4Q6KA 4OGAC 5F3FA 2XWJB 3ARBB 4AE1A 1AY1H 3O8XD 2BHZA 4URTB 1Q9KB 4F2FA 3K72B 3UMTA 3WAJA 3POHA 3ECBB 2YAPA 2MKWA 3UO1L 1F3DH 2UZYB 4BHUA 3SGJA 4XNUH 5T5FH 5FA3B 1F58L 4A6YL 5DO2C 4WUKL 4P5RA 1OVZA 1JF5A 3LNFA 3IU3A 2EKJA 3HMWH 1BZ9B 2F5BH 1RZ7H 1Q9LB 2GIMA 3MRKB 2AQRA 1YO4A 3QHFL 4NJAH 1Z3GH 1Z9NA 5PCYA 2MCMA 4DO6A 1YYCA 3B2DC 1PEWA 2ZXQA 5BZDB 4PRBB 1U3YA 4FQ2L 2J8UB 4S0TD 5EWIL 5D1QA 3HRPA 5AKRA 1S3KL 1H3PL 3PF2A 3HS0C 1L9PA 2HFTA 3UEQA 4EN3A 3EJPA 3OV6A 2YD6A 2Y6SC 4YDLC 1IQWL 1J11A 1VB9A 4J27A 4JUSA 3RA7H 2EVIA 1J12A 3MOBL 5B4MD 1AXTL 3DX7A 5EN2A 2XXMB 3N43B 1SN0A 4KPHH 4OZHF 1JGUL 4FTDA 4OZHB 3ZIMA 1FLRH 4G5AA 1KV7A 1TEYA 2C5DC 4M7LH 1BJ8A 5DFVD 2ZOKA 1CXFA 5A40E 4F2ME 1XCQB 4M6OH 2EXYC 4S1QL 3IS1X 4WWKC 4KI1A 3RGVC 3N85L 5T3XH 4AIZA 3MVSA 3T6ZA 4HQQH 4Z3IA 3TA3C 5A2FA 3ES6B 6FABH 2EH7H 2ZF9A 1OIOA 2VC2H 3BGFB 4X6CA 5IREA 1NDMA 4JB9L 4OCNC 2CHDA 2OJZL 1EAQA 4IJTA 1WS7A 4KK9D 4AMWA 2Z64C 5EBMA 4X9IA 5ADPH 3DROA 3HG1A 4RMVA 4D9LH 4F9PC 1RZKH 2BVQB 1KLUA 4WGVB 4WNJA 2Z93A 1ZE3C 1YG9A 4Y8AA 1X5IA 2GBTA 2VDOH 4E68A 1F86A 5KG9B 3TT3L 2BSRB 4FERA 3WEXA 4MB4A 5JHLH 4Z7NE 5AVZB 2AJSL 1RZIB 1NFDB 2R1YA 4OM1H 4IBSA 4Q2ZA 1I8UA 3I50L 3WNNA 1T1YA 5E56A 4WWID 1HQRA 1CXKA 4HG4K 3RI5F 4DERA 1CDHA 4JFHE 4LL1A 4OM0H 1L5GB 3V4PA 5I16A 5I23A 4P4KD 3SIKA 1NGYA 4Z5RA 1JNHB 4S10A 4NQVB 3NQIA 3OXRB 4KV5F 4L4VA 4XBMA 2IGFL 4U1IB 4JO4L 1L0PA 3D4YA 5CLZA 3T2NL 3AROA 1AHWA 1EAOA 3L5XL 2XQBH 3VD5A 2IDTA 3HB3B 1FO0H 5EC1B 2WW8A 1AC0A 4JRYB 5GGVL 1AGBB 1OAYL 1VADA 1WAPA 5EA0L 3V4PL 3D2UA 2YD4A 2B20A 4WNQB 3PV6A 4CU6A 4ZNEA 3AT9A 2B39A 2O5YH 1YECL 4YDKH 2J88H 4K7FB 4WWKA 1ET8A 1LO3H 4FTVA 3ESMA 4P3DB 2DDQH 1W72A 5I75B 3NVQA 2X3BA 2ED6A 3L16A 5KSAB 4AT6B 5D55A 5LVEA 2VDPL 1S9XA 1DTUA 1JK8B 1E3FA 3IGUA 5DJ0A 1HXYB 1PG7L 3TWYA 3NABL 4UTCA 3OKKA 4HDIB 1PD1A 2ITEA 4P57B 4PGBA 5GPRA 4HAKA 3VTMA 1JWMB 2QADD 1FG2B 1T2XA 1JZFA 2I9TB 3NCYS 4GOSA 1P9MC 2A4ZA 1CI3M 1ED3A 1RPQA 1A0QH 2F5AH 2Z92A 2X87A 3ETTA 4HCFA 2WBKA 1NDGB 4KMTL 4EN3D 5TQ2H 5JIPA 2F58H 3CXHJ 1RL1A 1W72L 2Y7MA 3VRIB 4NYLA 4XT1C 1N5AB 4YFLI 4FQXA 4X8GA 5I71C 1IM9B 4PHXA 2PW2A 3BVWA 4OD1H 4K71B 1A4JA 3B9VA 3IB4A 3ECUA 5I1JH 4IYKA 4AIXA 5E2WH 4MKTA 4R4BA 5FO9A 5E6IB 1GMIA 3FZUC 5HHMB 4Q6IA 3GSOA 3GK8H 2HN7A 4PCSA 5DZPA 4YNYA 4B0MB 1RHFA 1E5YA 3L3GA 1MCBA 3K7UA 3PNWA 4EDWL 1U8JA 1DJGA 2NYYC 2EO9A 2NX5A 2QMKA 5F72S 3ZDXE 1X5LA 1JGEB 4IRJC 2A0LC 4TV3A 4XN5A 1DQVA 3PAUA 4M6MH 4ZAKB 3PP3K 2J4WL 1VZGA 1U8JB 2VERA 3NCCB 3NFSH 5DD6B 2W81C 5KYYA 4K15A 4N3UA 4NNXB 2FBJH 1G1KA 2OMUB 3PGDA 4KZDL 5GJTL 4U1NA 3RWJA 1J8KA 3QIUA 1GOFA 1AZCA 4GUCA 3K1DA 4ODUA 3VX0A 4WEBH 5GS0L 3MV7E 4O02A 2FWUA 4QTFA 1J1XL 4JR9L 3FT1A 3GSVB 4GW4B 1MVUB 3VXME 4PLKD 1H8OA 3AVEA 1WFMA 3ARBC 5HPMB 5LN4A 2APWA 2YPLA 3VWKA 1FHGA 4R83A 3WIFA 5SX4H 4KC3B 4Z3JA 1KYOK 1U0QA 4PJFF 1EDHA 4PRPD 3FUMA 5C0FA 5F7AA 3F7LA 4GW4A 4XMLH 3ZKXB 2HTLC 3KCPB 2IFFL 4FMVA 3EYUH 3I6LE 2ZWYA 4WFGE 4F2EA 4AUUA 4JFVA 3O6FA 2XNAB 1WA2X 5HJGA 3NH7L 4Q9QL 1P4BH 2OMZB 5FPIA 1R5IA 2K8MA 1T3FA 4JFSA 2EO1A 1SM3H 4IMLB 4M61A 3NK4A 3L7FB 2ZXDA 4B41A 4FE9A 5HYJD 3MRGA 2KBGA 3GIZH 1HNYA 1YAZA 2PUQT 3AACA 3FRPB 4MNGA 3EDEA 1WJ3A 2HVBA 3FTVA 4YDIL 2QPFA 3L7FA 3I6GB 5ICXB 4FFWD 3M7OA 3VMPA 4DVRL 4R0LA 3SHSA 2UY6B 3QUZA 1LDSA 4PREA 4ZXBD 5E9AA 4KUZL 1JD9A 4L8BA 2JK5A 4YZFE 1PW3A 3LKQA 1V7NH 4PAZA 5CR8A 3EGSB 1PD6A 1RJYB 3GSRA 2G5BA 4FQJH 4YUEH 2EIZA 3RKDC 3MLSH 2F7RA 2IEPA 4Z95L 4JKPH 3SKMB 2P8PB 2KT6A 3H0TA 3P3UA 4HUMB 3NBNA 3NA4A 3E6FB 4UNIA 2VT0A 2JCCA 3OKEA 1A9BB 4LHJB 4CVWA 3L17A 3KZ8A 3EJCA 1JI2A 5J13B 1BFTA 4G7VH 4ERSH 5I6XB 1CLYL 3C6SA 1I85C 1G7PB 4GIAA 2A6IB 1KBGH 1A9BA 4XVTL 4QRRB 3QJZA 4W68A 3CZLA 4Q14A 3AITA 4Z0XB 4F7MA 3SBPA 3KPRB 4JG5A 5FCUL 1KLFA 2AQPA 5IKCB 3T6WA 2ATAA 4PRPA 1PZ3A 1S9WA 3NSYA 5AOIA 5HHQB 1FUNA 5CEXA 2FYVA 4KKAD 4NXSA 1OAYH 4H7VA 4PRPB 2FEEL 4I4WB 2FHFA 3U2SB 1WZLA 1S46A 1IAIM 2VGLM 4NZRL 3HG3A 4LSSL 4V1DD 3T3PF 4HULB 5I66B 4XCCL 2Q5BA 5IVXA 3L3JA 3AZUA 4FL4C 2J8HA 2VXTH 1A4KB 1KNOA 4X5WA 5F0LB 2AJUH 5I1IH 3GD1C 3VD9A 3SJVD 4AL8C 2NPLX 5AUMA 2R8SH 5DC0A 2EO7A 5MERA 2KDGA 5D1ZI 2IAMB 1WD8A 5HJBA 4U4IA 1V3KA 2IAAC 5BW7C 2XBTA 2PPDA 1CDGA 2R2EA 1L9NA 4X5XB 1ZWIA 2AS5M 1LP9E 2DMHA 5IFJB 5LWYH 2R69H 5D7IF 3GKZA 2KKQA 5D7IB 4Q9BA 2AABL 3SQBB 1IT9H 1NJ9A 2UXGA 3IPEA 1TZ8A 3EYQC 3LEXB 2GJPA 3DROB 3HG1B 3O9WA 3C9NA 3KH4A 5GRJH 1ZHNB 4BE6A 4P2OA 4OD3H 3MBWA 3Q3GB 3GEFA 4JFWA 4AYGA 1UQSB 2FLMA 5ID1B 5LBSA 1KCLA 5HDLA 4O9HH 5JZ7D 1IGIL 4JMXA 2AXGA 3NFPB 4KVNL 3OG4B 2OMWA 4YR6A 1WBZA 4WI8A 1BX2B 9CGTA 4WI6A 4HQQL 4XC3L 3BZEB 3EW3B 1VKXA 5G4NA 1U2CA 3SOBL 3B3IB 2IGFH 2FL5A 1DSWA 2WQSA 3UPRB 3DVFA 3JV6A 3HZVA 1XXFC 4R8WL 5KZCB 4G8EA 2IG2H 2NY3C 1L4IA 1Q8MA 2AJ3B 3H4FA 2Y3AA 1NGPH 2QHLA 3N44F 3QUKB 4UT6L 4P2OD 2GSMB 3PWVA 3ULVL 2FSDA 5C8JB 4GO6B 4P48A 1CF8L 1QTSA 3OB0K 4TYUA 2D7OA 3DTXB 4X6EB 1TOXA 1MCQA 4X7TB 1SBBA 2Y1ZA 2GTZB 3G5YA 1JHLL 2V2XA 2P44B 1SDDA 1D5XB 2BOBB 2P42B 2AEOA 1BBJA 5IOKA 4MYWB 4B3EA 3B6SA 1AFVH 3CFKB 2Y6TE 2IPTH 1T7WA 3O8XC 5HGHA 1BXAA 4NGHH 3RX5A 2AK4E 3GHEL 5I17A 5JZ7C 2VDPB 3H6AA 1YEIH 1BG9A 3HR5A 3JWOH 4YS4A 3ZYIA 2X7LA 4NBYB 1KY6A 4H8HA 1A8JH 2CDGA 3O41A 3F8UB 5H2BB 2VYRE 5F1NA 4RX4D 3CFKA 3MLUL 1U8IB 4FX5A 4CBZA 5F21B 3NT0A 5D1QD 3FPYA 5IM7B 2CE6A 2E6JA 2Y2TA 1P5UC 3DX9B 4AVHA 5BOJA 1HE7A 5ALCL 1BF5A 4KI5D 1GSMA 5C9KA 2V5TA 2ZOUA 3ARDC 3ILEA 4LF3A 4NZFA 1MREH 1HDMA 3GMMB 3ARZA 3V95A 5IW1A 4LLDB 1OGAB 3ABMB 3B34A 5I1AB 5EU5B 5L2KD 3L2LA 2A9BA 3B2UD 4NO2A 2EXWD 2J1ZA 3MRBA 3NFNA 1GKOA 4XBGA 3PJLA 4M03A 2HT3D 2FQEA 5IK3A 4RA3A 2CR0A 3FOLA 5L8LB 2P45B 5EORL 3BKJH 1TETH 2WXOA 3ARUA 4MA8L 1AO7B 2Y72A 4DP2X 4FNQA 3IE4A 4N0UB 1EK3A 2EXTA 3MA9L 4Z7WB 4OLYH 3TBWB 4D9QD 1KLGB 4MSWA 5DLML 4PD4K 3V0WH 3CHQA 5LQBH 2W0FA 4ELMB 3H53A 4ADIA 1QFOA 2ZE0A 2BXZA 1T5XA 1SF3A 4XPAH 3SDCB 1TIUA 2XT1B 1YUHA 1JXJA 4R7DB 1CXIA 1XX9C 4ILDA 4P23D 4FZ8H 3I9IA 4PTTB 3GSQA 3IJ9A 1N4XL 2FH6A 2NW3B 1NKRA 4KJWD 4PJ7A 4R90H 5H94B 5C97A 4LP5A 5DHVA 3FQNA 5DZLA 5ICZB 5D7LE 3CH1A 1SXZA 3MYZA 4MJIE 5AKVA 4MXQC 3SGDI 5FC9A 1S5IL 2AMUA 4JFEE 1FORL 4TNEA 1AY1L 5A2IH 3NA9H 4HKZA 4QO1B 1BZ8A 3U82B 5I2IB 5KW9H 4U1HB 3S9DB 3UYRL 3DC0A 3CH1B 5SWZD 2OYLA 2DICA 2GSGA 1JF6A 1ZV5A 2PCYA 2IH8A 4YC2B 2GI7A 4OCXL 4GG8A 1I4FA 4OGYH 3ARVA 1I3RB 2C3WA 3LKPB 5SWSE 3L13A 2J56A 2VAAA 1HEJC 1HQ4A 3CZSA 5EU7E 5JR1H 2Y9RT 4GG8B 2WZ0A 1YY8A 3BVDB 1BPLB 2EUZA 3APCA 1YEFL 1T03H 3OHXB 2APSA 2WYZA 4KH9A 1Z5HA 4LLUA 4R5TA 3ZE2F 2ADGA 2CHWA 3P3YA 2CH8A 2D0HA 2ZX5A 3WHXB 2DQUL 2KZBA 3S36X 1OK8A 4XO9A 2FNBA 3X1EA 4HWZB 5IB1A 1ZIBA 4L8DA 4TPRL 1JVKA 1UYWL 2JKIS 3OM3B 1KIRB 4KV5E 4B5ZA 1A1NA 3QDGD 5FYJU 1J0ZA 1X4ZA 1NC2A 3EBAA 3JWNH 1WCQA 2APBA 5GRZA 1E42A 1XGQB 2B1HH 1L0XA 2L3BA 3FO1B 3A6BH 3KVPA 4XC1H 1PG7W 4A6YB 1E9OA 4NRXB 4M00A 5DVOA 2CA3A 5EOTB 2VZVA 4J8RB 4EKJA 5DMKB 2CK0H 1IGJA 4GXVH 3V0DA 1DEEB 3STBA 1AI1H 3QI9C 4HG4J 5IVNA 2HH0L 4A6YA 5K59F 3AU1B 3IU3B 1MAML 3UTZB 3ATFA 4R2GD 2H1PH 4J8RA 5B22A 4IIQB 4KKLD 2YC1A 3L2NA 4NC1E 4FLRA 1MEXH 3P40A 5GRWA 4GXFA 1DQJA 3FOMA 1V3LA 3K72A 4L8CA 2WBJD 2HVKB 2W5PA 1FFNA 1R3HA 3LVEA 5LCVL 2ZUSA 3D9AH 3O6MH 4MB1A 1BVKA 5I8KL 4NZRH 3AMLA 5JPNB 4ZSOA 4GSXA 4PRAB 4ZZKA 2QVIA 3ESNA 1MWOA 1CU4L 2LAGB 2QADB 8CGTA 4OGXH 2O5ZL 4IHOB 4QAWA 1G1OA 4QHMB 3QDJD 2WWNA 1X5ZA 4ZSOB 1OB1A 3QR1A 4NHCL 5HDBB 3CN1A 4FJ6A 1MAJA 4GBXB 3IAQA 1KBGL 4BSWB 3VFPA 2M26A 3QORC 3WN5A 3SKNA 4KXZI 5AW8B 4HH9B 15C8H 3ISRA 3OX8B 4ZW8A 4AZUA 2PYEE 1C16A 4H0IA 3TIEA 1FN4B 2H32B 4LDEB 1H5BB 3KPSD 1PYWB 2Y6SD 3LIUA 3QNFA 3LEYH 1HHGB 2ZG2A 4ZUTA 2X4RA 4X6CB 4OJCA 5A16B 4DTGL 2X42A 4Z95H 4BCXA 5B3JE 5LNDA 3VXMA 1L0YA 3SYPA 2NY2D 3UJJH 2YKLH 3QA3B 4XP6H 2Y25A 5GGUA 1IBZA 35C8L 1J5DA 1UFGA 1OW0A 4L4TD 4GO8A 4P4KB 4XNMA 1PSKH 2D7PA 3IGAA 1KBBA 3MNZB 5AYTA 4N87A 3Q8EA 3QA3A 4L2YA 1Q72H 1UXWB 3H9HA 1MLBA 5C0AE 5HYSB 4KHXL 5DVKA 4FNUA 1OHZA 1FH2A 3Q9QA 4ETQA 4P4KA 5JMRA 1JFHA 3ABLB 3KGSA 2UZXB 2WOYA 2H3NB 4RDQG 1HQRB 5TGBA 3FO0H 2MPAH 2OMWB 1SYSA 3KPLA 5E1IA 3T4YB 4KX7A 4EN2A 4HOXA 1N3NB 4UOZA 5F9JB 5F9WB 3CSFA 3FB7A 1WICA 4HISA 3SO5A 4RSYA 3D07A 5KG9A 3OXRA 1BXXA 4FQXC 1U91B 4NQDE 2ENPA 1CGSL 4ZTPL 3PP3H 2YARA 1E4WL 4ZS6C 2L7EA 4N3TA 3INUL 2ZYHA 5E8PA 2CIIB 2EE3A 3KYNA 4ZFOB 2X2IA 2AJ3A 2FT8A 4FFWC 5MI0C 4DZBB 3C8KA 4WK4B 2I24N 5IHUH 2QVFB 1UA7A 1DUZA 3NJMA 4ABVA 3SDXE 1T4KB 3NJKA 4LLQA 1QR1A 1RPUA 3M45A 2WKOA 4F33A 2Y36L 4QR7A 1BQHB 1KC5L 1BD2E 2W38A 1W72B 1J9TA 2CO6B 1UOVA 3LZQA 1MCWW 2DTML 2IQ9L 3OAUH 1F3RB 2FATL 1UKTA 1KULA 1B88A 2YMXH 5EC1A 4AM0A 4IRSC 1XTMA 3EGXA 3FT2A 3HNVH 5HDBE 3VFMB 3WKML 4YWGL 5LAXB 1AGBA 3N42B 4ODTL 4GRLB 2DQEH 2I9LB 3CIAA 5FO2A 3PAVA 3JTBA 4FZ8L 2DPKA 1T6WA 4X6CF 3CVCA 2C4FU 4L3CA 3I6KA 4XVJH 2FEJA 3OGCA 4OF8A 3NMEA 4X6CE 2DS4A 2HMIC 3I3BA 1WRFA 1JK8A 4EDWH 3LZOA 2LFGA 3BSZH 3MOAL 4L3CB 1S7SB 2ZXCA 3OZ9H 3CZUB 3QHTC 1SPDA 1RIVL 2ENJA 1CL7H 1QLRA 4G3YH 1A3QA 1HINL 2B08A 2ED8A 3OMIB 3LS5L 5TF0A 5LBVA 1QBBA 4S1SL 2V17L 5C0DA 4CA4A 5E2WL 2OTWA 2J71A 5BMFL 5BQ7A 1LDPH 3HUJE 2VDNB 1BWMA 3MZTA 5AKSA 1A22B 3RWFA 1KIPA 1KTKE 2A0LD 4X6DF 5IJCC 1W91A 5ENWA 3C60C 4CVZB 1MREL 4GAYA 1FC2D 1DZ0A 2Z4QB 4WFGD 4L1LA 1TTUA 1UKSA 4G8AC 5GS2D 3D5OF 4F58H 3DXAA 2I32A 4GS7B 1TR7A 1RIHL 1D2OA 2VDRL 3LN4A 4PBDA 3NABH 2VSKB 2DQFB 3EGDA 4IOFD 1A9EA 3LXCA 5BZZA 1CICC 1MVUA 4JG1H 3VWJB 1V7MH 1PY9A 1QSZA 3JWOL 5IUSA 1XGUB 4Y5XA 3TTYA 4IRZH 4U2ZA 5ETUB 3KJ4B 1F8TL 3SODB 3RTLA 4HJUA 3C08L 2BP3A 2VR7A 3AWEA 2ARJQ 2DDQL 1FNEA 2OMUA 1FFOA 2K7QA 3L3OB 1Y6MR 2CUAA 5HGDA 4HKZB 4LRIC 1CZ8H 2FECL 1PX3A 2RMNA 4LIQL 1IARB 1UH3A 4BFGA 4ODUB 2WB7A 4KKNA 5H37A 3D18B 2BHUA 1R5IB 1AG0A 3HS8A 3V0VB 2C8NA 3FB5A 3IJ7A 3L9YA 4KKCC 4JFQA 4J23A 1KPVB 2XV6B 4PJGF 5ECGA 1ZLSH 3L7EB 4QRTA 4D2NA 3SDXA 1NGQL 2DLFH 4UB0H 4EUPB 2BNQD 3QEUB 5ANHA 4GG6E 4P59H 1KBWA 1G0DA 3BLKA 4HIHA 3QUZD 1NCHA 3FT3A 5A2CA 5DD5H 1E9QB 2QVTA 3NTCH 1X44A 3UDWA 4OJAA 2LLGA 3WKQA 3EUDA 3FF8A 2CHNA 3DO3A 1IE5A 1UM6H 3L3HA 1VACA 3J8F7 1KG0B 4J3OH 5EZLA 1Z2KA 2HLAA 1XO8A 4K5NA 1RUQH 3HR6A 2P49B 1OGAD 3IRZA 3DYOA 3V0EA 4ZX4A 4CL7A 3SDDA 1LP9A 5CZKA 1CYGA 4PPTA 2OJZH 2WQUA 5L7XL 1G7IA 5CUSH 4OCYL 4JLRA 5C3IA 4DNLA 4LCVA 4A2EA 3VB8A 2I25N 4G80A 4ODHL 2DIJA 5EOTA 5C0CE 1RURL 4TNWF 2FK9A 4EZLA 4WSGA 4RMUA 5FW6A 4FFVD 4GRWH 2J1XA 2KMWA 1FZJA 3BMVA 2EDBA 1SOXA 1ZXQA 2G5BB 5G4MA 3WOVA 4DN4H 5DMIH 2LAAA 3PFUA 2G2PA 4R7NA 1RULL 1BFOA 5BVPL 2DKUA 1WO2A 2JV6A 4PRDB 3IWVA 5DDHA 1IEAA 3TEYA 2HVJA 2NR6D 2VXUL 1SY6A 4BFJA 2NY4C 2HVKA 2NCEA 3V5KB 5EO1B 1A7QH 1Y0LA 1E8WA 5E8OA 4E9RA 1KXTA 3HFFA 5JW5A 4NKIH 1JG9A 4NKDB 5FK9B 4C4KO 1GJWA 4EI6A 1CR9L 1XZWA 2R0LH 3NJXA 1J0KA 2AW2A 1EGJL 2HFEA 1T7XA 4J2QA 1QEWA 4X4YB 3BLPX 3RL1A 3ABKB 4R26H 4GSQA 1FGVL 1K9TA 4NKDA 3ROOB 1E3XA 5T1LA 2YEZA 4N4YB 3POCA 2VN6A 5HHPA 1NFIB 4QHUA 4JG0H 5E9DD 3KH3A 5DD0L 4M7KH 3C75A 1UJTA 1LEGA 4JKLA 1JDDA 1EZVX 1H5BA 1SVZA 5BQDA 1NBCA 3MUHL 1MPAH 4Y5VB 2YBRB 2MTPA 3MLTB 4A37A 3LKRA 4WI5A 4GXUN 3HEIB 4IS6B 3VSVA 3F12B 5LDUA 5A16A 3VRJA 3MLVL 3ZZSA 3ISWA 2FRGP 1IM9D 3B43A 3ESVF 4TSAH 1E27A 1R1CA 3CUPB 5DURB 5HHOE 5J1SC 5AVXB 4M02A 5CD5C 3HJ0A 3MLTA 3IK2A 1XF1A 1KIUB 1NCTA 3FO2A 4OV5A 4FEIA 1S7RA 2HX9A 5IHLB 5EBMB 4C56E 2EKSA 1YYLL 5CN2A 1QHQA 4K5MA 1CURA 1FFTB 4KQ4L 4GFXA 2PR9A 1F45A 3O2DA 3L3IA 5IESH 3AREA 2BO0A 4PJCF 4NUJA 3T1FB 1XGPB 5E2VL 2EZ0D 2EC9U 2OP4L 2R1XB 4RFOH 4A55A 3AG4B 1UWGL 5CSGA 4OLVL 2EUVA 4S2SA 2DLHA 1OZTG 1G0YR 1VFUA 2C4FT 1MQ8A 1FE8L 2M8XA 4WNSA 4YBHA 4QTHB 2XYCA 1IGFH 3AXIA 2AZUA 4HS6A 1NLBL 1ADQH 5E24E 4P5TA 4QD2E 4ZO6A 3TA3D 4WY7H 2H0FA 4X7TA 5B7EA 2VZTA 4QOKA 2HRPL 4FG0A 2JJSA 3MN8A 1BAGA 5DO2D 1YEGL 1DFBL 2ITFA 1TZHB 2WKOF 4B6ZA 3U4BL 2PTTA 4FNPA 4LLVB 4D8PA 3UJJL 4F33B 1U3HD 1GAFL 1UJ3C 4PWEA 3WFBH 1JHLH 3QUKA 4F9LC 3CCHA 4MA1B 1QSVA 2ZXBA 2F74B 3AY2A 1PFOA 2EE6A 5I30L 3WD5L 3GMPA 3L95A 4WWPA 4QXTB 2FO4B 2OMNA 3PHQA 4X6EA 5DS2A 5IROD 3B2XA 3D52A 3D12B 3FT2B 2R2CA 2F74A 2WO2B 1GOGA 2Z31D 2K6WA 5TK4A 1VCAA 4YEEA 4LP4A 3QXVA 3QXUA 3S5ZA 4P5KA 2VUKA 3OR6B 1IKNA 3PQYE 1R34A 4PWIA 3S35H 3K5RA 3W5NA 2R4SH 4Y9FA 3WNLA 2V0AA 5E2UL 3T0DA 2EDDA 3BKYL 5TE6L 4KJQD 2AQTA 2SODB 2WNWA 1G9HA 5L88L 4ZXBB 2DYPB 3GK8L 3WUWA 3GNMH 3HG5A 1JPSH 4NP4L 2JH2A 4X9BA 3SPHA 1WDAA 4ZOBA 3RL2A 2RH0A 5CJ5A 1BIHA 2R4RL 1Y6NR 5ICYA 4BCYA 2XACC 5B1JC 3O45A 1B0RB 1DBKH 2AF2A 4PJCB 4TQPA 1A6UL 4XE0A 3T3PE 3U2IA 2ICWB 2DLFL 2F1AA 3CHOA 3MYJB 1W72H 2K4WA 5FGSA 3VFWA 4KO6A 2PW1A 5E6SB 4U0RB 1PF3A 5JO5A 1ZVSB 2WXMA 3FHAA 5ANMB 3FUFA 5HPOA 1XIWA 2RQ8A 4WGWB 2WAHA 3N1PC 4TF4A 4R4FH 4ZUVA 4Y5YC 4YXKL 4Z3GA 3LKSB 3N1QC 4ZAKA 2UWEB 3A6BL 4LCYB 4YLBA 3CNKA 4WUUB 1D7DA 3CQPA 3VI4A 4G6JL 3CFJB 4TSBH 5KSUA 5INCB 1HKFA 2QV2A 4TRPL 1KLGA 1IZKA 5EEVA 2EDXA 4RDBA 2W0FB 1XGUA 2NQCA 1KTCA 4Y5XB 4ELMA 3KHQA 5E99L 2GFBB 4U1HA 1I8IA 1MJUL 4N8VA 2H5UA 1HH9A 1XEUA 2BRRL 1MWAH 2XN9A 4AC4A 1QAWA 2H6UA 2R9HD 2Z35B 3TBYB 3MNDA 5EBWA 5JHDA 3DJ9A 2YEVB 3U9WA 1MFCH 1RERA 2UXVA 1F4YL 2BW5A 3C8DA 4WEEA 3TJEH 5FO8B 5JW3L 1E4KC 1NMCC 1DBJH 1P2CA 2FX8H 2IH9A 2JKSA 2WP3T 2XZCH 2YQBA 3BVUA 4H4NA 1TZAA 1ZT1B 3I74A 4NT6A 5LB1A 3OAZH 3ARBD 3ML9A 1MG3C 1HU8A 1L7IH 1PAMA 4FOMA 4AIEA 3GSXB 4H8WH 1UD8A 2OS7A 2W60B 2XNAA 4UILL 4ZO8A 1BVLA 3WL9A 2GJZB 4ZQKB 2A83B 2DF3A 3O4LB 1JPGB 4HIHB 4OFDA 4LBEA 3CDFA 1KEGH 3UGXA 3H9YA 2LOEA 3OHMB 2PR4L 4MZ3A 1KJVB 1MRCH 2YBGA 1IM3D 2GJZA 3GT6A 4O02H 3UCRA 3A22A 2XWTA 5I6PA 1KXQA 2Y23A 1T0MA 5BW7A 4R97B 5CHNA 3FH5A 5ABAA 1V7ML 1UH2A 3VI3A 3BUYB 1AS8A 4NN5C 1GS7A 1JTTA 1RZ7L 1AR1D 2NT0A 3BP6B 3MCKA 4NJAL 4OAWA 4JHWH 3TV8A 4RBPK 5I8CB 1FJ1A 2XFGB 4DZ8B 1LNUA 4J3VA 3EGSA 3UTZA 3VXSE 1KFAL 5MEOA 1Z5YD 1WZAA 3GIZL 3PAYA 1CTMA 4Y4HC 3SE8L 1NIFA 2IH3A 3BP6A 4RGMB 3ZKNC 1SXAA 3FO1A 1HZKA 2H0JA 3FTUA 2W07B 1JK9B 4P2RE 5HYSG 2CDEA 1T5KA 4F92B 2YLHA 4TNFA 5LCVA 2VR6A 4DK3A 4R5VA 3V5DA 5IWLC 5JDJA 4WUUE 3ILQC 1CR9H 2R0LL 4HJ0D 3BIKB 1Q0EA 2D31A 2R7EA 1BQUA 2ZUTA 2AJYH 3M46A 3VXOB 3FRPG 5LG6A 1EZUA 3NCBB 3SO3B 3BE1L 2HKFH 4NRZA 3A24A 4KFMA 2R7EB 4WKZA 1N64H 5LKNA 1MCDA 3P1VA 4PHZA 4HXBL 4W9LC 3QRFM 1OT1A 3LQAH 1BQSA 4RESB 1CBJA 4LLWA 5GSVB 5A2KH 2OTUA 1MPAL 4KK8C 1KFAH 1S5HB 2J5WA 3KEDA 2GHZA 3HUJF 3U0TA 3VGEA 3Q1SH 3LIZA 4OJFH 4PVBA 4WO4D 3O3UN 2OTUB 4GUOA 2X6BA 1OGTB 2E74C 3GHEH 3M7FB 3BGMB 3BKCH 3N43F 4JFDD 3VXMB 3L5WB 2EEAA 3V6ZB 4UDTA 5IB5B 3VG0H 2FATH 4C57C 4QHLA 5KSBF 1RUKH 4UIKH 4F15C 3CFBB 5GS1A 3MBED 3SKNB 3O4OC 1AGFB 1XGZA 2ZP0T 4F80A 1C16B 4QXUH 2F19L 3LTVA 4OZHA 4UBDC 3OMZA 3GPEA 3JBG7 2I7OA 2YKLL 5T1KD 5HGGS 5HYSA 1HHGA 2DH2A 3L1EA 2J3SA 4FFZA 1LE9B 1GC1L 2DYPD 2VWEE 2CXKA 4OV5B 2BHYA 3LEXA 5CEZE 1TF4A 4HOMA 5IJKC 3HC4L 4RWHA 1VHPA 3FN3A 4IDJH 1AHMA 1CD8A 3D34A 3X1FA 1HSBB 1IBFA 4FXGA 5D7HA 2BSEA 3VE0A 3BMWA 1SOKA 2CLVB 3E80A 3EJYC 3KBHE 3PV7A 1EZVY 4H8WC 4ORGB 4Y2OB 4CDHA 1Z9OA 4G42A 3MXWL 3VD0A 1QUNA 2XFXB 2KLSA 2H4EA 3VSTA 1PY4A 1GW0A 4FFZL 2ZKXA 2Z31B 4MDJB 4I13B 3V6OC 3VE0B 3BH9A 1HXMB 4OD3L 2YRPA 3KBFA 4LSRL 3TPKA 4OKVA 4XNAA 3X1BA 3A4EA 4EN3C 3L9EA 4UNVA 4D3CL 4TVSa 1AP2B 4MMZA 5ESQB 5AW2B 4HU2A 1YPZF 1QQDB 1P5VA 4D8PB 1U8OB 1F11B 4OZGF 4DZBA 1AH1A 1EFQA 4H8VA 5DJ6A 4QHNB 2VDRH 4UZUA 5K1VA 5LGYA 5IP4A 3MRCA 3QAQA 5AALA 1Q1JH 1U8OA 4MCNA 4PUBL 4FNRA 1QLEB 4ONFH 4HXAL 4POUB 2B2XH 2OMXA 1KCVH 1ZIAA 5D72H 3T5WA 4K23L 1K5NB 5KS9B 4Y5XC 4X9YA 1WV7T 3SGDH 3EJSA 1AQDA 3GLAA 1X4YA 1TJIL 2Q20A 2EZ0C 2WQXA 4UU9A 3AREC 5I19L 1LDPL 3CDYA 1JGLH 2OMXB 3PS6A 3GXFA 5T5NG 3EGXB 5L88H 5L9DH 3TXAA 1GYAA 3P0VH 4BZ2H 4LCUA 3BT2L 4MXVF 2ITDB 1R3KA 4U0QB 4BJLA 2Q8BL 5FWQA 2P5ED 5FKPA 2NUTB 4BELD 4PGBB 4BZ2L 4JZJC 4YDJA 3D30A 1BFSA 2FSEB 2DQUH 4CILA 3EZJB 1XL4A 5C0AA 5EHFA 3VJ6B 3VXQB 4WHYH 4I5BA 3D39A 4Y1AE 4E5XG 4O2FB 1QO3A 2HUHA 2NUTA 4PRHE 1QSEA 5F0JB 2CSPA 2VDQB 3HNTL 3KDMB 3QWOA 4OF5A 5IHBA 2BK8A 1MCRA 4AQZA 3DI2B 5CIPH 2H6PB 5CJ8A 5DSCA 3VFUB 2Y5TA 5MENA 3MYJA 4ODTH 3X2QB 3IRPX 2JVUA 2E7BA 1KBPA 1R3JB 3LKOA 5BQ7B 4P5MA 5MHSD 1W16A 2WXLA 3PABB 2WKLA 4FMFA 1SZNA 3DUUB 3V52L 1ZLUH 4PP2A 4NI3A 4X6FB 1TO5A 4ZUVB 5E00A 5IMLA 4X7FC 4GP5B 5B3JF 4GW5B 1JHTA 2E27H 4LCYA 4R97C 5KW9L 1OT4A 1XBDA 4BA8A 5INCA 2F54B 3M1OA 1XF5B 3FKUS 3DXAB 1DANT 4NQCD 1WUNT 2GT9B 5IMLB 3P30L 1IGTB 2WXFA 3W3BA 3ZR5A 4ZS7L 1BECA 1OAZH 3QNYA 5HTSA 1ZLVH 3RGVB 4I2XE 4Z76B 1FZOB 4OCRL 1KB5B 5I1LA 3CJJA 4RCAA 2WTPA 4L1HA 4R4NC 5KBDA 2EXSA 2W88A 4DKFL 3F85A 2IOMA 2WZPA 4RZKA 5DUBB 3HAEB 2W0LA 3PLYA 4LHUA 3MLPA 1AE6L 4LSQH 2GITB 3ML8A 2LTQC 1LWJA 1KB5A 2F53D 1ORSA 1RMFL 4LVNC 2PO6A 5C71A 4MNQA 2YPLB 3LH2L 3GXDA 4KXAA 3RX7A 5IEKB 1E9QA 4PJ9B 2Q3AA 3NZ8B 3GSWB 4M7ZC 3TZVC 3K1KC 1XH0A 3DGGB 5B1JA 4AV4A 1KCUH 1T2QL 5I73B 3C8HA 5F7NC 3REWB 4HWUA 5LO7A 2NY1B 2SEBA 2A9NH 4CRPA 4OW6A 3GRWA 2IV9A 4ICXA 4OGZA 2F0CA 4WHTA 4JPVH 1OD9A 5F1SA 3H56A 3DGGA 3QDMD 1TZOA 4NO0A 1WEJL 3W11C 3FCSA 1HAWA 3WHXA 1BQ5A 1J9SA 2XZAL 4I87A 4PJBE 1R3IL 1MIMH 4FXKA 4WEBL 4YXLH 2CGYA 2NCMA 2WXJA 5KYXA 1HZLA 1GIGL 4P04A 4WTXA 1KG0A 5EZLB 1YMMB 3VI3B 3BDYL 1LLAA 4FXKB 2R29A 1T1XB 2X5PA 1SFDA 3PU7A 5JIDA 4NRXA 4FP8H 2VE6A 4X99B 2YLKA 2ZX8A 3QUZB 5FUOL 3Q9PA 3WE6A 4AGMA 4TULH 1MCCA 5EUOE 1UA3A 1H3WM 3IFNL 1WAAF 3N9GL 4L9LB 5IEHA 2ZNXA 3DIFB 1DQKA 3G5VA 5KJRH 4PRHA 5DJDB 5FB8A 1Y0LB 1FCGA 1V3MA 1NL0L 4N2AA 1KXVA 3TJPA 1M2VA 1RK1A 2G3NA 4UTBH 1D5BA 3RDTC 4CGTA 3BESR 3D9AL 4L8CB 4P5SA 2WNGA 5AB9A 2GYSA 1DBAH 1W80A 2NW2B 2XIIA 4EVNA 4HWEL 4Z23A 3GIVB 2X0UA 5FYJH 3W39A 1NCWH 5EEXA 2RFXA 2MQGA 2RIKA 3K0YA 1PLGH 4ZNCD 3CFIC 2WLYA 1RURH 4YZWA 2AERT 3VTAA 4UQIM 5FOBA 3KBPA 5AYUH 3DBSA 3SCMD 4LQFH 2X28A 1P1ZB 4EBQL 2J57A 4Z18A 3T3PB 1Q0XH 3D25B 4HYTB 3RUGB 5KOVC 3LH8A 1E27B 3G5XB 4FQXD 4AG4H 1U6AH 2JQZA 4UDTB 3ISYA 3VMOA 5IB5A 3QGVA 3VW3L 1VZIA 2K8QA 4JFDE 4PMFA 5GS1B 5E6UB 5EEUA 2ICCA 3OAWA 3QFJD 4N2CA 4X5WB 5AW0B 4JM4L 2ESVD 1D5IL 4ZK8A 1ZKAA 3FK3A 4Y5VA 1ZLUK 4XVUD 3DTDA 4I18C 2AHIA 1UM4L 3WY3A 3IJEB 2HKHL 2YD9A 5LGJB 4YXKH 3S5LG 3PHOA 2DL9A 1HL4A 1F3JB 3ULVC 1R3LB 3VXTA 1PS3A 4DP7X 1UXWA 3IE9A 1YMME 4XPTL 2GIXA 3U9PL 1KIUA 3RBGA 3QAZC 2Q7YB 3UYPA 2YPVL 4YX2H 3QNXA 4JRXE 1HSBA 4FXGB 4XZUB 3MODH 1K3ZA 1O7DC 3QCVL 5ID0A 2P4AB 2F1EA 3IDIA 4AENA 4U6TA 4ZUSB 2ESVA 3RNQA 1HYSD 4O9HL 3FB7B 4JK0D 4NOBA 4DVBA 1U3HA 2NT1A 4EQ2A 1R0AH 1MW0A 3MBXL 4O2CB 1WFOA 1PU0A 4PJXB 4OGQC 5HBBA 5LGKA 1IIKA 1TYEB 2ICES 1C1EH 1FA4A 4GI9A 3AY4C 1WBZB 2A6JA 4JUTA 3IDNB 4I85A 3FSVA 4P46D 5HGAA 1F56A 4GKSA 1KJMB 5AVQB 5JPMC 1T21B 4KI5F 1TQCC 4MZIA 3KLKA 5DQDH 1GZQA 2JKTM 4FG6D 2ADJB 4X5QA 2UUDK 4RSVA 4M7LT 1EXGA 3V0GA 1IKFH 4F8NA 4AVIA 4O2EB 5C8JA 2XN9E 2X05A 3MRCB 2AEQH 3PV6B 2IDFA 1PG7X 2XX1A 3ARGB 3ARED 4LRIA 2FEEI 4MVBC 1LL1A 1UB6A 4MD4A 4WWKB 2BY3A 4MJ6B 3UPCA 4AM0B 2G9HB 2J7LA 2XHNA 4LOUC 1TCRB 1T22B 4WZ9A 3KPPB 3R06A 3WEAA 3CFQA 1SDDB 1DN2A 5E1QA 5JYLA 4HOZA 4FYSA 3OXSB 5KVFE 1ZMYA 4M29A 4QXTA 4UU9B 4YK4B 2LABA 4XMZA 4GBXC 4MJ6A 3LZNA 3ZQXA 4NQXB 1F6FB 4X2UA 1LYQA 3UP6A 1T22A 3N0AA 1JGDB 1GS8A 5C07A 1TLKA 3OLGA 3RWIA 1S8DB 1P7QD 2HJLB 4ZPVA 2Z92B 4LT7A 5LXGH 4L5FH 3T2LA 3S35L 3UAAA 4E41B 4XHJC 5I0ZA 4HWNA 1J88A 1HK6A 2AJXH 2VMEA 4YAQA 1OCWL 2KL6A 4JREC 4HHGA 4NO3B 2BW4A 4BKLA 1NCUA 4WIQA 1PZBA 2EDYA 2VMCA 3N1FC 5F6HI 4CBPA 1UD3A 4R4BB 2NY2B 3DA0A 4JFFA 4XP9L 1ZVSA 1XAKA 2EDKA 2V8LA 2KS0A 4NSKA 4WDIA 1FIEA 4Q6IB 4WLCA 2FBOJ 3IN0A 2DQJH 1TQBB 2ERJB 2DRUA 3CC5A 2Y5TB 3HS0A 4MDIA 5MENB 3ZKQD 3MV9D 4CVZA 5I1AA 3OKLA 5IMOB 3M8OH 4FJYA 2Z4QA 3KPSB 4YXHL 2HT2D 4ODSL 3QARA 2GTWB 5LNEA 4OLYL 1LTXA 3O45B 3DHJA 3FQ2A 3DVGA 4G1EA 3DHPA 1MCEA 1I7RA 2AQNA 2QGDA 4QOKE 3GLEA 3RPIB 5IHZA 3C6LB 4NQDA 3N44B 4JBSA 5DC2A 3QDJB 1RZKC 5EEWA 4KUCF 2GT9A 4Y16D 3RLSA 4KH2A 5J6HA 1JS4A 4H8WL 3QVAA 1DJHA 3GSVA 5K9JL 3DMMC 4JFTA 4N2NA 5ISZD 1X6NA 5HPMA 3CE1A 4RGNB 3WIFB 3LD8C 3NIGE 2F8VA 3BXNB 3S37H 3Q0HA 3VSQA 4NNPH 2BNRE 3GEWB 3MJ9L 3CU1A 1HAUA 1XXDC 2VDQH 2Z35A 3TBYA 3CVIH 4N2FA 3SYAA 4MCZB 4CKQA 1JF1B 2XDHA 4LP8A 4HIIB 3ARWA 4BGLA 4HK0B 4Z7OF 3SDXB 4PY8I 4QCIB 3HE6A 2HX8A 4MJ5B 4DN3L 5D4JA 4FQPA 3PQYD 1Y1DA 4M5TA 1GJIA 1U95B 1BD2B 3MA7A 4MXWL 2CDFA 2DI8A 3PWLB 5C0ND 5SWQA 1TITA 4CADA 2APFA 4W9FC 1P69B 5I1JL 2XRAH 3J27A 3AG2B 1RZJL 1VPOH 1KBVA 2IALB 3S3DB 3ZE2B 3KW7A 2CCWA 1T0NB 2C9SA 3QUMH 1QRNA 5BRQA 2VLME 1CDYA 2A3TA 3IDUA 4E41E 1N8OE 5HHME 1G5GA 5EOCH 2PWFA 1H0DB 1K8DA 2VABA 3JTTB 1E28A 2IV8A 1SBSL 4X0KB 1INQB 1TVDA 2KPNA 1M42A 2CALA 4DK6A 1NWPA 3HCVA 2BWIA 4BCZA 3L9RB 1RZGB 3X12A 1FNGB 4H1LG 1BQKA 1GGUA 2XWTB 4AXWB 3BIAX 4O5LL 4P9HC 4XMTA 3DBXB 3RNKB 4L3EE 3BEVB 1DLFL 1XH3B 1KF9B 5DI8B 2X4QA 4PVMA 3UZQB 3BDBA 2Y2YA 4NQDD 1IGIH 4CVXA 1N6VA 1NUNB 2BRRH 3BN3B 3G04A 2O93L 3SY0A 4W4NA 3BOVA 2ZOLB 2FO1A 1JV5A 4FQQB 2NZ9C 1DQQB 5IQOA 1BLNB 3DOIA 3Q1EA 3MV9A 4WHCA 1CC3A 5BUPA 3BPLC 3C2AH 2E9WA 5FAAA 5AVYB 1P9MA 3W38A 2WVTA 4W4OC 3FTXA 3FTGA 4JPIA 3BKMH 4NDMA 5E8NB 3ILQD 5GGSB 3D08A 1TZIB 4IK6A 4N2HA 4B96A 5CEXB 4H25A 4FHBD 3BKML 2R0ZH 3BW9B 3G08A 5T1DL 4L18A 2BP8B 4Y1AB 3EYOB 5T1LB 2K4AA 3VD7A 4P23B 3BEWA 1BJ1J 2JKXA 5HD8D 3MLRL 3ZE0F 3LRSA 2J8UA 1E43A 3EO9H 1LK3L 2W65A 4MCYB 4NRYB 3RVWC 4XP1H 2VN3A 4QHMA 3ZHFA 4XGZB 1T4WA 4JRLA 4MQSB 1HWGB 4FABL 1RP9A 2PYFA 3IMUA 4V2CB 4D9LL 3SDYL 3WO4C 5L2KA 5EO9A 5HHMD 4X98B 2IANA 4DWHA 3VRJB 1SY6H 4L1DA 4I3RL 3DUSA 5E9DE 3CIQA 4E42A 2ARJA 1EJFA 5E4AA 3ZSTA 4AH2A 3N0PB 4DGVL 1PZUB 5L2KB 4TUOB 1SJMA 4K23H 4GAAA 4K2UH 2VDKB 4WCYH 2V33A 4PJHE 4B60A 1EAPA 1GW6A 1X5FA 4LGPB 1CYWA 2ZF8A 3FN0L 3CLFL 3GSNL 4JFYA 3RTQA 4ORGA 1MI5A 3QS3A 1R3LA 2YSSA 1NANI 4GAFB 3B2UC 3C5ZC 3RVTC 4HUKB 1KCKA 3RWHA 2FIKA 1XF4B 2EDWA 4OFQA 2DM3A 2V9RA 4ONHB 2NY5C 1ZGLP 1HSAA 1HINH 1IQWH 3VTTA 2VXSH 2AP2A 1NCAL 2ZUQC 2PCPB 5CMAA 3NSDA 1OTSC 1ZGLA 3BZEA 4NZUL 4RQQB 4PU2A 3X11B 1KIQB 2F2HA 2AV7B 5IGXL 2HRPH 4ESKA 1W6WA 1RZIA 4JRYD 2EYSA 4W6WB 3HB3D 3FQ4A 4OFKA 1KPUA 5KBLA 1F1DA 5EC2B 1CF1A 4XNBA 3U9UA 5I75C 3WLBA 4R96A 1M6UA 2NR6C 3AWFA 2DEXX 1EZLA 1CQYA 1Y18A 5D93C 3TT1H 1CFVL 3LXAA 1N0XL 2PWEA 3LH9A 5D96B 3MTRA 4QHKI 5EUKA 2E59A 3GM8A 5LG1A 3FFOA 1TDQA 1EMTH 3HC0A 2VUYA 4MHHI 3FTZA 2XXGA 5F7LB 1P5VB 4TLTA 4CMHC 4OI8A 4IU2B 4JW3A 2V2TA 4IBUA 4QRPB 4OZFG 3MV9E 1QWHA 4GRWE 2HWZH 3ZTNL 1VADB 4DETA 3SKJH 2ZSVA 3VFTB 2C9QA 3RY6A 5I71B 4HGWA 2X6VA 3AABA 4HGKC 3LS5H 3OXSA 5CCHE 4Q56A 3O3EA 1E6OH 3WKNA 2CO3A 2J6WA 3KE0A 4FN0A 4IOSA 4JPWL 4ANWA 4QHKJ 4IHBA 1ZK5A 4HCRL 1NCCL 4O2FA 2BFGA 4G72B 1PQZB 4YSCA 1JZ4A 2J2ZA 3RTQD 2WAQA 4EO5A 5T1KA 3BUIA 5SWZE 1I85A 4BRJA 1S78D 1DSYA 5PAZA 1HCVA 2P3YA 4WEMB 4IW4C 4HX1B 3TWCH 4JFED 4FQHA 2YD8A 4X6DE 1P6FA 3JQOB 1ZS2A 1I3UA 4M4PA 2QPSA 4OLZH 3QDAA 3NFSL 2MKLC 3B7YA 5SX5H 4RBPH 1F18A 4DGIH 1TTBA 5KS9F 1IAOA 2D9CA 2AJXL 1K2DA 3Q8AA 1Q1PA 2VDML 3CBJB 3CLEH 4LPTA 4JY4A 2F7QA 4M5SA 2DBJA 3RY4A 4F7TA 3K71A 4GW5A 4JPWH 3SJVB 5FO9B 3KDMA 1B4JL 3NESA 1NGZB 3MRMB 4UINH 1EEZA 1E6OL 1MHCA 2JE8A 1JL8A 3ARXA 3CZGA 3GBEA 4KVPA 4FQLH 1K2DB 5KVEL 3KS0H 3VFUA 3BSZA 2DM4A 4R2GB 3G6JF 4WRLA 3QO1B 4PJAA 4F7TB 5BPPA 4AEHH 1T1ZA 2X6UA 1LEIB 4JCLA 2VXUH 3GSQB 4Q8BA 3LX9A 4MJJA 3SPVB 4GSRA 5F7HA 3ASOB 1CK0L 2ZJSL 1ULVA 4JY5H 1WIPA 4J8QA 1Z9SB 1EWHA 1M57B 4RAVA 1B90A 4UB0L 1CICB 3K6SA 1KJ2A 1W9XA 3PGCB 4K9EL 1WT5A 2FNWA 3IDGB 5F7DB 3KPRD 2YAQA 2FJUB 5D6CB 3WEOA 1F1AA 3S35X 3ZL4L 5I2IA 3TZVD 5KVGE 2ZOWA 5I6OA 3GSWA 4AQ1B 1VSCA 3L2MA 4N9GA 5DZVA 1HESA 4POZC 3ENEA 4L1SA 1CFTB 4JG9A 2CBMA 5F71A 3IWUA 3L3OA 3QQ3A 5D2LF 4XNYH 1J86A 1DLHA 1A6VL 4JHAH 5E2JA 4J4PA 1X5AA 1GGIL 4CSTA 1FL3A 1K4DA 3F04A 2PN5A 3LPGA 1F1GA 1PD0A 5E0FA 3RZCD 4OBSA 4PJ6A 4JRXB 4LQ1A 3GGWB 1B6DA 4BZ1L 4PS4H 1OAUL 5CGTA 5EIVA 1NGWA 1XSOA 2R1WB 3A5VA 2PTVA 3U30B 1URZA 1EDYA 3DHMA 3RWEB 1I1AD 4J3BA 4LASL 4ZMQA 3U7AA 1I9IL 2VLJB 4N85A 2H0PA 4OQTH 4HWZA 5IB1B 3KNBA 5D2NB 2HTKD 4XPFL 5SWZB 1KWKA 1KIRA 4U1SB 1H0DA 3JTTA 1LO0L 4X7SH 1ODAA 4K0OA 3UOAB 3RFZB 1BVNP 4N8CH 4RLDA 4HHAA 4FCAA 3MLXL 2AFNA 3BLBA 2ED7A 2P8MA 4MNGB 4JJOA 1MY5A 3L9RA 3TBVA 3QNZA 3H3PH 2A77H 4EI5D 4N0CC 4D0BA 1KENH 5HYJB 4TM9A 4ODWA 4I3GA 3D3VA 3GTTA 1OCRB 4B9GA 2HJFB 2FIRT 3F05A 5GRUH 4JE0A 2O5ZH 2B9BA 2XWJA 1IGYB 3G6JB 1EA9C 2B0SL 1QABA 5KVDL 4UIKL 1MRFH 4UUJB 3TASA 3R1GL 4M1CC 3NRQA 4AOFA 2CR3A 4BBWA 2Q3ZA 5MEQB 1IU1A 2ZONA 4PW9A 5HHNB 2V5MA 2BHFA 3EAKA 3MRRA 3HE6C 3ZL4H 3ALPA 1R5VA 3CZNA 3KGUA 2B5IC 4CVUA 3H42H 4QTIH 1A6PA 5C6WH 1B3JA 5DMGC 2B4CC 1EO7A 3MGAA 5CJXC 5ANME 1M2VB 3FTGB 4FL4B 2HT3C 3QULB 3O0LA 4FQIH 3QZWA 5AAMA 3WD5H 2ZXAA 3P4MB 3UBGA 4N1EA 2E4FA 4PG2C 1FI8C 3BP7B 4KNQA 2X0WA 5IB4B 4OF7A 3S3PA 2BS9A 2OMYA 5AW4B 2W0KA 1QWUA 2CIKB 3ARDD 4D7BA 3I9AA 1MFAH 1S9WB 4GBXA 1MAKA 3LRSB 4ZAKD 2HJKA 4JJHA 2XUWA 2IBZX 1XR8B 3RL1B 4HUVA 2CM6A 4L3ED 2NXYB 2BSCA 4PRID 4LSRH 2R39A 1K8IA 1NL0H 3OVUB 4U3CA 3U4EB 5J06A 5FOBB 2PYFB 2XIDA 3AS0A 3U0PB 1HEZA 1QPKA 4JO2H 1NEUA 2PYED 4HIXH 4KTDL 3TNNA 4GSDL 4WAFA 4FQ2H 5EWIH 1F4WL 4W9EC 5E2VH 4TL4A 1YQ2A 2HPOA 5IVXB 2EICA 4YSSA 1WFIA 2DI9A 3A4DA 3NJVA 3APFA 2YA0A 2N3JA 2OYKA 1OP5K 3GZQA 3LNHA 3BYTA 4TUOA 1RHHB 3LKRB 3QDJE 4UAOC 1FSKB 3TNNB 3QG7H 4PS8A 2YPVA 1QBLH 3DX4A 3LSOB 4J3TA 4UQ3A 1N68A 3EOBB 2VR4A 3BKJL 5C0JB 3W0WD 1KLUB 2BSTB 5KBNC 1X5GA 5J7CC 1Y7VA 3SQBA 3RUGF 3OWEA 5I28A 2C9PA 1KTBA 1MIEL 1RZJC 3D87B 1VFOA 4RWYL 4QXUL 2CU9A 1NTDA 5C0JA 4JM2D 2BNRB 5CJQL 1N3NA 5F9JA 1JN6B 4HEME 3COOA 4WU7A 4XP6L 5HGAB 5DD1H 2VLKE 1T21A 3RURA 1EJOH 4LGRB 2GSIA 3EFFB 3WUZA 4IMKA 3BGFC 2XQYG 3O9WD 5FO7A 1N0XH 3HPLB 2IC2A 3V9CA 1HYSC 4D94A 4KHTH 4XE5B 2Z7UA 2VM3A 4WJ5A 2I60L 2W0PA 3H9SB 2DOCA 4RX4A 4ZUUB 4D9RD 1AHWB 1CL7I 5FO7B 3Q5OA 1F4YH 4I0PA 1F11A 1M9SA 1RUPL 3KGTA 2NNRA 4L5FL 3B2VH 4N2MA 4UDUA 4GEJA 4OI9A 2EC8A 4LCIH 5J1AA 2A9ML 2RB8A 5IFAH 4FULA 4QOKD 1P5UB 1ET5A 1L9QA 1OSYA 2ZKMX 3AW5A 1H6UA 2D3VA 2Y0SA 3DTXA 3WJLA 1MCFA 3ARDB 4MMZC 5I6KA 3SQRA 3K8LA 4M1DH 1KGWA 3HKZA 1G6RH 3BH8A 3L1FA 1XZ0A 3D05A 4I3SL 5I1GH 3CVHB 4Y2DD 5I19H 5BNXD 5B39G 1U4EA 1UENA 4N22A 5E0QA 2EIMB 2BIHA 5DS8B 1KCWA 4XP4H 4W9DC 3CN3A 1IBGL 3P9MB 5TQ2L 2AQ2A 1YSOA 4AIZB 3AG1B 9PCYA 4HXAH 3B5TA 4OLXH 1QATA 4BFBD 1A4CA 4BFNA 3I3DA 4LPXA 3KD4A 3BFWA 1WWCA 4GBXD 3VRIA 1PZ2A 5DXWA 4UV4H 5C0AB 5DRZB 3FJTA 5EU6B 5F9WC 2ENSA 4G1MA 1LO2L 2J44A 2DWDB 4FXKC 3WJJC 3MV7D 3QUYD 4XXDB 2XYBA 3SB3A 1WYJA 5GRJL 3WS6C 3QXWA 1ZJAA 2YD5A 3PNWB 2HKAA 4P5MB 1KTRL 4PWGA 4EDXA 3MRMA 3C2SA 1CBVH 2V4LA 4NJ9H 1UWFA 3FOLB 4Y2DC 1PVHA 4PP2B 1SLWA 4MS8D 1JV2A 1OAXL 3VFWB 2ZD0A 3F7VB 1YEKL 2A9DA 3SDXF 2CA4A 1EEYA 3L1OL 4JKKA 3FF7A 1CUOA 1OHQA 4MSWB 3BAIA 3MLXH 1E5AA 1JERA 4R7VA 4U1NB 4YBLC 5FGBA 3VWJA 5AB2A 3DARA 1T5XB 3PRZA 3SDCA 5EG6C 1IGTA 4NBZB 1CLVA 4QDGA 3R7RA 5AG9A 1L9TA 2NY5L 1NUGA 3BAJA 5AVSB 2G4EA 4E5XB 3IJHB 4NWUL 4Z7UE 3RZCB 3OHXC 1KYOJ 1ZEAL 5DUBA 4TQIA 2VDMB 3SGEH 5C0FB 3AADB 1ZV9A 2EINB 4PS4L 1D5MB 4UQEA 5IEKA 3IJHA 1S7XB 1FORH 1NOLA 3ARFD 2AKRB 4BKSC 3E2HC 1LEKA 4QMEA 3VG0L 2C1PB 1DBMH 4MMXC 1ZSHA 2YN5A 3REWA 2G75A 1I8AA 1JZJA 5JYMA 2EQDA 5DJ8A 2XWXA 5E6RB 5CCKH 2X6CA 3FT3B 1OSEA 3MI6A 4KU1A 1PJ9A 3T0EC 5J3HD 1NLDH 1LMKA 1VRSA 5T3XL 1B0GB 1E5UI 1OARL 4A66A 5CAYB 1AGCA 1QFWM 2IGLA 5TH2B 3HI6L 2A2QT 4WENB 3OZLA 4UM8B 1OTUD 4YSRA 4CSPA 1T03L 1BD2A 3MA7B 2P5WA 1ZE3H 1TVHA 4LU5L 4AXWA 3MRPA 5JHAA 3UZEC 2L4OA 4LSTL 1ACXA 1NCIA 2XZQL 3GI8H 5FIEA 5G5DA 3GUFA 2OL3L 5ESVB 4R0LB 5KSBE 3R8BB 4BDVB 2QT6A 4BXSV 2E7MA 1FIGL 1MFBH 2WO4A 2P8MB 3H3KA 1ZVYA 1P4IH 1U93A 1UM5H <