3ESWB

Complex of yeast pngase with glcnac2-iac.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
b'SIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 19
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 3eswB00
2QSHX 2F4OB 1PVEA 2QSFX 2QSGX 1X3WB 1TP4A 4YIRX 2F4MB 1OQYA 3ESWB 1X3ZB 1QZEA
chains in the Genus database with same CATH superfamily
3Q3SA 1F43A 1H9GA 2L9VA 3PSIA 5F1RA 3M1CA 1LB2A 1U9NA 3E97A 3PQJA 3A4CA 4AYBN 3ZXSA 1V4RA 3D5LA 2WC2A 1EH8A 4NQWA 3BTIA 3LSIA 2HU9A 1FOYA 1K83J 4AIKA 3BJOA 4G7ZF 4EV0A 1ZGWA 2CUFA 3CCMI 2DCEA 2XGXA 3JRDA 4EM1A 1FBUA 1FY7A 4XRSG 2F4OB 3V4GA 3HEFA 4JP0A 4DJAA 1XCVA 3CC4I 1I3QJ 2DPUA 3SDBA 1IV6A 1WQ2A 4JOMA 2DMNA 2R7DA 2OV7A 3AAFA 1YHQI 2DMUA 4RDUA 3L2WA 2E1NA 2UUZA 2BYVE 2LYCA 4ZDPA 3A0HC 1K79A 3DKYA 2A68F 1SVMA 2VXDA 3BJAA 2DA6A 3P9KA 1JUSA 3J81K 1HSTA 2EFNA 1YIJI 3FZVA 3RDIA 2BE5F 2IRFG 4UV9A 3OY9A 3CDIA 2K5CA 2Y69H 4UVAA 5J1UA 5ICGA 3FMRA 2EZIA 3PSFA 3BOQA 2EZKA 4EJOA 3M4OJ 1MD0A 1SD6A 4Y17A 3LAJA 2DA5A 4QSHA 3CO7C 1T0FA 3U2RA 4B48A 2PJPA 4JX6A 3PFYA 4XK4A 4F3QA 2CW7A 2K7LA 2QLZA 4U88A 1U8RA 1IN6A 2BW3B 1S7AA 1W5CC 3VEPA 5FFXA 4XKCA 2CRGA 4B1RA 2O9LA 1BI2A 2KL4A 3Q9VA 3E6DA 5FKKA 1SFOJ 1NG7A 1MH4A 4BAYA 5CQGA 2L5QA 1D1AA 4IO9F 4Q47A 1HW5A 3IRRA 3QODA 3CTAA 2AXTC 3JAMK 3WE2A 5JHFA 4EJUA 5ILUA 3M1EA 1AOYA 2YPRA 4GRIA 4LLLA 3OIPA 1EH7A 4HSRA 2PN6A 3CC2I 2ZNYA 3BTLA 3GO5A 3CZ6A 2QENA 1DGWY 2YX7A 1BJZA 4RMNA 5HDNA 4NQWB 1J7KA 2OPTA 2CJJA 4BXUA 2E2HJ 2HOEA 2P4WA 4FHTA 4ENJA 1PJRA 1XD7A 4NC7A 4PSWA 3KEYA 1KQ9A 1S9HA 1HBXG 1IXCA 1Z77A 2M8GX 4FX0A 5BOXA 2ME0A 3LA7A 2HOTA 3BR1A 1RKWA 4HBLA 1BN5A 3HOXJ 1QGPA 2WV1A 4LITA 4EVIA 3TOBA 3TW6A 2CV2A 2VBZA 1O3QA 3LMMA 3KEOA 1SEUA 5J8FA 2XDVA 5AONA 4D1QA 2VKHA 1TWHJ 3FXQA 3Q9SA 3BZKA 4G8XA 2IS2A 5LFAA 5J8CA 1HDDC 4Q4ZF 1HCRA 3EQLF 3HIFA 3EUAA 2YU3A 5LEJA 3LSPA 5FKMA 2L0KA 4E4HA 3WTSC 3I55I 2VIXA 5F27A 5M3MJ 2BV6A 2ZO4A 1D5YA 1VQ6I 5FJ8J 1VNDA 4M3GA 2LD5A 4FCYA 2WBMA 4A3MJ 3CCSI 3FBIB 1ETWA 1ETYA 1RETA 1YYVA 3PNVA 2NRAC 4A3GJ 2MC4A 4HNUA 2JT1A 4O5VA 5A2QK 4ZTFA 2AO9A 3D0SA 2FMLA 1W36C 1I1SA 3U21A 4DGWB 1ACIA 2M87A 4I7HA 2K85A 3O8HA 5GP9A 3JRCA 5LRSA 3RTRA 2FX0A 2HWVA 1JT0A 2WV0A 2OJED 2STWA 4BXFA 1RESA 3UKGA 2LLKA 3J81Z 3VDXA 3PJRA 1ENHA 1U5TA 2RREA 1G3TA 5LHGA 4EJTA 3ABKH 3PIPF 1T98A 1YQAA 1KYWA 3F0CA 1BIAA 3KYCB 1KYZA 2Y2ZA 1BIBA 2L9SA 4KMFA 3ZMDA 3KFWX 1Y8RB 4RB0A 4KDPA 1IRGA 2OA4A 1Z6RA 2DT7B 3T8TA 2FUG2 5JI6A 5C44J 2DA2A 3IUOA 2MYSA 1G59A 4A0ZA 1G6NA 2M45A 3B6AA 3CUQA 3GFLA 5L3FA 3FXLA 1AU7A 4HX4A 1D0YA 2L9NA 4XLPF 3SFZA 4AIHA 4Q5SF 4KN7X 2PG4A 3FMQA 2GBYA 1SMYF 3OYMA 3E7LA 1W7PD 2QQBA 5FLMJ 1IDYA 2JUGA 2ECCA 5J4VA 3JAMZ 2ZBKA 1YIOA 3TDUC 1IXRC 4P5OA 5BS6A 2DA7A 1XTAA 1QPMA 3G71I 4A3KJ 3S2HJ 1WJDA 2BY1A 4F52A 2W4SA 3P9IA 2HOSA 1SVOA 2DA1A 4OWRB 3K70C 1DU6A 2HEOA 2M1BA 5DM6F 4G6TB 3O2PE 3PNTA 4BY7J 4RAFA 4I6ZA 4MQ9F 1ZAOA 5FD5A 5L3DA 4Y13A 5EDNA 1GDTA 1QNTA 5H20A 3LA2A 2F5FA 1GXQA 1ZRDA 3Q0VA 4XORA 3ZQLA 4A0XA 3BT9A 2ADUA 2EA4A 2XUBA 2E71A 2FJ1A 2L7MP 3H1CA 3IAM2 3HGYA 1FNNA 2ZJQF 3L1PA 2Y31A 1QZZA 4PGGA 4BDZA 4B3AA 5HVQC 2P5KA 4KICA 4LG3A 4RM2A 3ZQQA 5IOZA 3GFIA 2EV0A 2CV0A 1YW9A 1TZLA 2M30A 1B9MA 4IXAA 4DNCA 1FZPB 1ZRCA 3GX4X 2A6HF 3M9AA 3QPLA 1ONVA 4ENMA 1U5TB 3HM5A 3K2ZA 2AHQA 5F0HA 4PUSA 4PFPA 3VPRA 3DBLB 1U78A 5ILSA 2F5VA 4M6VA 4CO8A 3L7WA 4OIQF 3JW4A 2M5WA 2GOXB 3TL4X 3JRAA 2W84A 3FMSA 5KK1A 3EPZA 1MZBA 3WTZA 2Z9OA 3H3VK 1Y56A 3I9V2 3I54A 4M9XA 1LFUP 3EETA 1ZLJA 3W2VA 1OMIA 1ZHFA 3CUQB 2HTJA 2GAUA 5HDKA 4XLEA 4BUPA 2W85A 1X3UA 4ZDLA 1SFXA 2EB7A 2LK2A 1S8NA 3AFHA 4EMSA 4UB6C 2DFIA 2LRDA 3EUHC 2YR2A 2ISYA 1BC8C 3FK6A 2KJCA 1Z3XA 2LFBA 2ZXWH 4OU0A 1A6QA 2XGDA 3FXUA 4BS9A 2OF7A 3WTWC 2V9VA 3R4KA 1B6AA 4OIRF 2Z3YA 2A61A 3TO7A 4LB5A 1W7PA 3FWEA 1FBSA 4M9SA 2PMZA 2X6XA 3F8MA 2P8TA 1E3PA 4II2A 3WGGA 4LJZF 3H3UA 2HI3A 2X1DA 3OL3A 3M7GA 1TLHB 4I98B 3WTUC 1DPUA 5FGMA 1BOAA 5K7ZA 4KITB 4N9HA 3M07A 3PQKA 1SFKA 2DMTA 1POGA 5FKOA 3CCLI 1Y0UA 1G3WA 4G94A 2EA2A 5DD4A 4RB1A 1XCBA 1T2KA 1MMSA 2HR3A 5F08A 2NYXA 1FIPA 2IGMA 2VOOA 1OCRH 3QYBA 3SHFA 2R7WA 4RBOA 4B8XA 3CCVI 2BOLA 2Y0SA 5M5XJ 3QPHA 1R5GA 3GFMA 4YELA 3BC8A 3PUFA 1R1UA 2V7FA 2CW0F 1JTYA 3TQNA 4EJWA 2X1EA 2N8GA 3KP5A 4AD9A 4KJZA 5IP7J 1A04A 1MMGA 1UHMA 2PMUA 5D4RA 5F04A 2R7ZJ 4G7OF 3A02A 2TDXA 4V19K 3AG2H 2W48A 2CFOA 1STZA 1WGXA 2JRMA 3LSJA 1DU0A 3K10A 3KLNA 4IRGA 1HKTA 2WAQN 4HV6A 4FX4A 1MBKA 3KZYA 2MSYA 1OISA 2ICWG 1MKMA 3GZ5A 2WB1N 2QUFA 3KLOA 1S3JA 1QHGA 3J7YJ 3E5UA 3E0JB 4A3CJ 4Z6YA 2V9PA 2Z1DA 1JJ6C 1BI0A 3GZNB 5KAFC 5DM7F 5J6XA 3MVPA 2RVCA 4D7MA 3VODA 2O7OA 2Z33A 1G2HA 3F9KA 1ETXA 3WHBA 1Q1HA 1S6LA 1GXPA 3SDGA 1ZG1A 4WX9A 4HOBA 3E1SA 4NC8A 1Y6IA 2MFZA 5H6QA 3ZQHA 1W7PB 3AG4H 3FK7A 1NTCA 4CSWA 2NVUB 3WE3A 3RYRA 3HPHA 1EJ9A 2IP2A 2VC0A 1ZTRA 5TJJA 1J2XA 4UV8A 2VLAA 1RPWA 1RZ4A 5EEAA 1XMAA 3BPXA 1I1GA 1KU9A 2LMDA 2KDZA 3RQIA 3KZZA 3Q0WA 1YRNA 4YFNF 2F2EA 4A3JJ 2LOOA 1XPXA 1ZGAA 1VZ0A 2OQGA 2HDCA 1NK3P 2R7XA 4AUXA 1CGPA 4PJLA 1A6IA 5FO5A 3CQZJ 2E7XA 2PBIA 3QQAA 4IKFA 1I6XA 3V8LA 3DKXA 4CZZA 1S7OA 3DEEA 4E7ZA 2H94A 3IHUA 2DYSH 2M9HA 4FT8A 1JUMA 2I5UA 3DV8A 3G2BA 4FE7A 2HOAA 3MKYB 1B8IA 3I4NJ 1WVRA 1GVDA 5HLHA 4ETSA 1PUFA 4MTEA 4PJJA 4BH9A 4EQQA 2R7UA 5LHHA 2A5YB 4Q48A 4IOAF 2VE8A 2LTPA 1K4SA 2GXGA 2FE3A 3QYFA 2MLGA 2L7ZA 4L18B 2KQRA 2Y75A 1BM9A 4Y7NJ 5GAHJ 4LB6B 3OV8A 3RKWA 4ZTJA 2GLOA 3IV5A 1YFHA 3OYNA 2VJ4A 2DA4A 1KU3A 4ESFA 2QVOA 4OIOF 4YRVA 1RUOA 4CCMA 5LD2C 5CJ9A 2H09A 2ISZA 4BBRJ 1WJCA 4I0AA 1ULYA 1VI0A 3LFUA 3MQ0A 2PLYA 3FXKA 2VBYA 1FC3A 4ZYDA 1TT0A 5CQEA 1PP7U 4HZFA 4YEJA 4GCVA 3H9QA 1TWAJ 1K6OA 1X2MA 3I71A 3LL7A 3F8FA 1WJAA 2EWNA 2XSDC 2F5DA 1YI2I 1XB4A 4HDVA 1R1TA 1AA7A 3OWTA 2HKXA 1X4PA 2DAOA 5DDGA 2STTA 5JHUA 2NS7A 3KP2A 1JTXA 3HKZA 2M2EA 2IJLA 3MAJA 1MGTA 2P5VA 4A5MA 3RIRA 3NWTA 2LKPA 5BPIA 3RCOA 4YFKF 1R36A 1A35A 1DQUA 1LKXA 2JA6J 2HQRA 1U8BA 2L01A 3HJEA 3G3ZA 1S5LC 1WJBA 2QZ8A 2XGCA 1ZH5A 2KRHA 2L2OA 2ZC2A 3QYEA 2KIFA 2RN7A 1N78A 3LSHA 2DPDA 5EGOA 1YRNB 3HSRA 1R71A 2LDUA 2HYJA 2IXSA 2GXBA 1JGSA 3KP3A 2XAHA 4W97A 4C2TA 4WF2A 4B3XA 2DBBA 2IA0A 2M7AA 1XDUA 3ERED 1GT0C 1IAWA 4G12A 4A2UA 1ETVA 2VPLA 3WU2C 1GV5A 2FF4A 1JKQC 1BI1A 3DQVC 4HNTA 5FB2A 1R58A 2W7NA 2HXOA 5EEGA 4B44A 2P7VB 2B0LA 1KZHA 3LSGA 2JQ7A 3DTKA 3ZN1A 5GPAA 1BOBA 2MH9A 1B8IB 4LK0F 1IUYA 5C3EJ 1PUFB 1FOXA 1RNLA 2O5RA 1VF9A 1ZLKA 2CQKA 2QCOA 1X3ZB 1WPKA 1H88C 3HRMA 1R23A 1MJAA 1ZELA 1MBGA 1X3WB 4HEA2 2EZHA 4I76A 5CVUA 2VBXA 2DOFA 3CCQI 3QP5A 3S2WA 2Z16A 3HC7A 3HRTA 3H0DA 1ZG5A 2JA5J 3QP6A 4DOZA 4DBRA 4Y3OA 2ZXHA 1ZR2A 5DUKA 3ZMZA 3SZPA 1GUUA 2JTVA 1UZCA 1OJLA 1YLFA 2IS1A 1TTYA 3I3LA 3TW7A 4FISA 1DDNA 1Y8QB 4YIFA 2QKMB 2HPMA 3OSGA 3MEXA 4S0HB 3ZMUA 1ITYA 3TP0A 3HDDA 3OR2C 3HGGA 3QWLA 4ZYHA 2JMWA 3BR3A 3BP8A 3J7ZI 1FSHA 1SAUA 1WH7A 3DBHB 2EK5A 3B02A 5CLSA 3RKXA 5BQTA 2IS6A 2GIZA 1EKEA 2E7WA 2RKHA 1HDPA 3IP4B 4L9JA 1YW8A 3BLYA 2LREA 3H92A 3GEZA 3HOYJ 5FKLA 2K3PA 3OOUA 3BTCA 2KJBA 2R7RA 1FSEA 4LOCA 3BG3A 5B1AH 3MCZA 1W5SA 5HODA 4E7HA 2TRTA 2M0CA 3SFIA 2VJ5A 4AIDA 3EDPA 5CKTA 5KAIC 1YJ9I 3OIQA 4M3EA 2K9NA 1IZ1A 2D2WA 3FXJA 4ITVA 3JRBA 4KMUX 2XRNA 1DGRM 1V5GA 4JX4A 3SEZA 2IAIA 3KP6A 5D6FA 5EGOB 3D5SC 2XROA 3DKWA 3A1YA 3S32A 2YU9J 1F9NA 1Z7UA 1ZREA 3GBGA 4DIQA 4BQQA 4M6XA 2XC7A 1OLTA 2PFBA 2LY1A 1ZN2A 3CDLA 3HHHA 2D1HA 1OKRA 1U3EM 3DLLF 1FIAA 1VFCA 2KIMA 3P5JA 1ERDA 1QVUA 4U0VA 5M5WJ 4IX7A 2KIUA 2BBYA 3TP3A 4ZYEA 4WCGA 5E3OA 1Z05A 5DCFA 2OC6A 4MQVA 2YS9A 3OYEA 3WU1B 3GTLJ 3OS0A 2V6EA 1X1DA 2DJIA 2X51A 3L00A 1E17A 1YE9A 5M5YJ 1MSEC 3EUHA 3R0JA 2EFPA 1FYKA 2KKOA 2X6WA 1FYLA 2CQQA 2H1KA 1VQ9I 1RRJA 3CMMA 4A93J 3V8JA 4CCNA 5FLXZ 2NVQJ 1MMDA 3ML6A 3RPUD 1CF7A 1EH6A 2DK8A 2CUEA 3LSMA 3MKLA 3O6BB 3V7CA 1FJLA 2K86A 1BW6A 3LQRA 4M74A 1XC5A 4XM3A 2MD0A 2VKDA 4Z2YA 5C4XJ 2JK3A 3IWFA 6PAXA 4KIBA 3DCFA 2EH3A 5K7HA 3IH4A 2RDPA 4JX5A 1G8XA 3ERMA 3EUKL 3S2DJ 4XR6A 3K69A 1IJWC 1UCRA 1R4NB 1EA3A 1TW2A 3MWMA 4F92B 3G73A 1APLC 2E2IJ 4CXFA 3W6KB 1BL0A 2A5WA 3KX2A 3DPUA 2IT0A 5ERIA 4HV5A 4HX7A 4AM3A 5B5EC 1V55H 2DT5A 4BJTA 3OOPA 3I59A 4D7NA 4HW0A 4BDYA 4L5IA 2WY7Q 2NVYJ 3KETA 4CH7A 3I4MJ 1ZRFA 4L5EA 2LKSA 1CQTA 1YS6A 4S04A 4XLFA 2OD5A 2HVQA 3ABTA 2XPWA 1ZKGA 2OCEA 1P4AA 1LEAA 1IF1A 2UV1A 5EJCA 1VQ8I 2W25A 2WY8Q 5M3FJ 1QA6A 4LG0A 1IN5A 2M7BA 4O3MA 2H27A 5CPRB 2KPMA 3HHGA 4OAYA 2VJJA 1T95A 2CQXA 3RPQA 1YITI 2RQQA 2QWWA 2HZTA 4IJAA 1YOVB 5LRRA 2K27A 5B66C 2DLLA 2X9DA 5CVJA 2DDBA 2M4KA 4PCQA 4C3HJ 4A6DA 5J1YA 2P6TA 3GTGJ 3C18A 5EG0A 2VQLA 2NNNA 1HF0A 2ZFUA 2R0QC 1B1BA 1P9QC 2OTLI 5DD8A 1U6GA 2R7QA 3BR5A 3ASOH 3HOSA 3BG5A 3R0AA 1QHHD 5E3LA 4Y33A 1A5JA 3HZJA 2Y30A 1VQMI 1I50J 1VQPI 1XMKA 1CF7B 1D5VA 1U9OA 1L3LA 4CCJA 3B6CA 5FROA 1VQ5I 3ZMTA 4NHJA 2OQRA 2L9RA 3I0TA 4XQFA 1QRYA 5IYBJ 1WKMA 4ENKA 2O8XA 2YX4A 3NEUA 4LLGF 4D0PA 4GYGA 2O6GE 2R5ZA 3OYLA 2L02A 4QWQA 2ZJPF 3CCJI 4HDUA 1FMWA 1ETOA 3FKIJ 3M8FA 3AKZA 2DFEA 2HYFA 3S17J 3F8NA 2GQQA 4AC0A 2MGQA 5KCMA 5CVVA 3OYCA 4YG2F 3OYDA 5BPDA 4BBSJ 4ANJA 3LSRA 3MKZA 3I59B 3HXLA 1OCZH 1WHUA 1X58A 4BE0A 3PFIA 2K02A 3H5NA 4ESJA 3E6CC 3G1MA 4RA2A 4Y15A 2X1CA 4UHTA 4YFXF 5HOOA 2ZB9A 1V3FA 4MTDA 1K78A 3BPVA 2ID3A 3F23A 4XLAA 3AL0C 2VASA 3QPTA 1AWCA 3FX3A 4V2GA 5FD6A 1R9TJ 4LG0B 5EF6A 2G9WA 1FWZA 1WH5A 2HXIA 2AXLA 3KCCA 1X1BA 1RR7A 1T38A 4PK4A 1TL8A 3T1BA 4U7BA 2DO7A 2KIQA 3L2VA 2F6CA 2JA8J 3K4CA 4XONA 1Z6TA 3CMYA 4HF1A 3IC7A 4H4KC 1BBYA 3JTGA 2VE9A 1DP3A 2H1LA 1LNWA 3HOWJ 2JSPA 2MH2A 4ASNA 4I2OA 2E35A 4AIJA 2OUMA 4HLYA 4BNCA 2DW4A 5EG0B 4DQ2A 4G6DA 1WJ5A 2CFXA 4HQEA 3S3OA 1TP4A 3QOPA 1F5TA 1MW7A 4ZJZA 4E7IA 5K5QA 4QLCU 2BGCA 2DT6A 1USTA 2XGEA 2KRFA 2B7EA 4UY8I 3OYFA 4KISA 1UFMA 2L4AA 4A3BJ 4OMYA 2GZWA 2DDAA 3DXJF 3RZOJ 2VQHA 3ULQB 3SZGA 3OYIA 2MBFA 2QSFX 1Z21A 4ABZA 4IPAA 2KZGA 4A69C 3DPLC 4PGHA 2PJRA 5KHDA 4UUTA 4BYYA 1OYWA 3ZMVA 2XV4S 4BACA 3OYHA 3IWZA 1K7AA 3NQOA 3HSFA 1K4TA 3JRHA 3LWFA 2R5ZB 2J5PA 1HLVA 3HRUA 4HRIA 3RQ4A 4DYRA 2NAZA 4HQMA 4ZYGA 2G0EA 4LIVA 1T39A 1NG6A 1FOWA 4XKVA 1P4XA 4S05A 3S15J 2Y0SN 4XOPA 4M73A 4XLCA 4BHBA 3K1MA 4M3BA 1VTNC 2EIJH 4WWCA 3S1NJ 1D1CA 1NHAA 4XN0A 1VQOI 4XICA 4MLOA 2FD5A 3JRFA 1JGGA 2XKOA 3F6OA 3CJNA 3OYJA 2VODA 1K78B 2XHKA 2ME6A 2EV5A 4UNOA 3PIOF 2EFOA 5GAGJ 3S3NA 4E6KG 4JQFA 4A3LJ 2ELKA 1XDSA 3CJQB 1IRFA 1ZK8A 2ZSIB 3A2KA 1W0TA 4Y52J 3BWGA 2X4HA 4NBQA 3Q5FA 1Y1VJ 3BZ6A 3ASNH 5E1XA 3K6GA 2E5NA 4L9VA 1E3OC 2PX9A 2COBA 3BROA 5FFZA 2D5VA 5JLWA 3GLXA 4N4OB 3EYIA 2LH9A 1Z91A 5KVRA 9ANTA 2RQPA 2JZYA 2Y0MA 1D1BA 2WA0A 3CF5F 4GXOA 1ETKA 3ZQFA 4IHTA 5E1WA 1J5YA 2YUSA 3U1KA 2D45A 3W6VA 3HG9A 1I6HJ 5EEHA 3CP8A 4G9YA 4GDFA 1F1ZA 3WGHA 2K3FA 2XAGA 3EYYA 3WG7H 1C0WA 4W1UA 3SEQA 4MHGA 4L5JA 4V2FA 2BXYA 3ZGKA 3HOTA 4KIGA 1VQLI 3WU0A 1SANA 1UJ8A 3CC7I 2ZJ2A 1O3SA 1WFXA 2ZNZA 2E2JJ 1HKQA 1D0XA 1BA5A 4AU7A 5JLXA 3W3CA 3VYTB 1DUXC 1JKOC 2FQ3A 3C2HA 2P5LC 3BG9A 4XRFA 2HFHA 3C7JA 5B1BH 5JVGF 3HOUJ 3TEDA 2R4GA 5F6FA 1IRZA 4HNVA 2PJRB 1VQNI 3FXRA 2JA2A 5TISC 5D5XB 3C2GA 3ELKA 3FBNB 2QBYB 2ZXJA 3HL2A 3HPGA 2D1VA 1FT9A 5FLVA 4RB3C 1MIJA 3FISA 1OCCH 3WGIA 3RYPA 4C2UA 2EIMH 3LOCA 4N9IA 1OCTC 2ZFWA 1Z9CA 4IHWA 3T0YA 2XSJC 2IEKA 2AQFA 4HPQA 3ZCOA 3E6BA 4KT5C 1A31A 1Q1VA 2Z99A 1I5ZA 3K4BA 1FOKA 4PZJA 3U1DA 3S93A 1BW5A 5HNHA 3DLAA 5B3SH 3CCRI 4F55A 1OFCX 3KP7A 1V5EA 1WSUA 3VFZA 3O8GA 1XGNA 1YJNI 3CD6I 3K4KA 1IN4A 2VONA 1F36A 1B4AA 2P81A 4UUSA 5HLGA 3BR2A 4LGWA 3FXOA 2KZVA 1KA8A 3KYLA 1IN7A 1OCOH 3N97A 4LLNA 2V9KA 2UWMA 2NOGA 4NDLA 1Z3YA 2KMUA 4C3JJ 2EV6A 2LR8A 3UNGC 1YO5C 3GTKJ 4IRHA 4BHCA 1X1AA 5D6EA 5BNGA 1QQIA 2QSGX 4BGDA 1SAXA 3C1DA 2HQNA 1TQMA 3RI4A 3CMEI 4HLXA 2BZTA 3L2RA 1MSFC 2R93J 1FYMA 4I01A 2BXZA 2COMA 2ZMEC 3E5QA 5IP9J 1GLNA 4MO7A 1MNEA 4IQ4A 4G7HF 1PP8F 1FP2A 1RC9A 4C9YA 2RV8A 3DU6A 4L0ZB 5L3CA 4M3DA 1E3HA 2ESHA 1J75A 3DTIA 3SYTA 4J00A 2VI6A 5AIQA 5D5WB 4J01A 4XIDA 2A3SA 4ENNA 1WJEA 3A0BC 2O3FA 3KPHA 1UG2A 2QQAA 3GUDA 1OR7C 4HAMA 2A05A 2BEOA 3AG1H 2L54A 3FDYA 4AWXB 1EF4A 4BE2A 1GHCA 2CGPA 3ECHA 5E79C 5IT9K 4CICA 3ZR8X 3H5AA 2BHYA 3KP4A 3DFGA 3WODF 1RIOH 5HLIA 3R60A 2L4MA 4L9NA 4CCOA 4XLHA 1QVTA 2OAZA 3V8KA 2KP6A 4A12A 3JRGA 1R5HA 3JCUC 4FTHA 4IQJA 1G3YA 4QPOA 3FKJA 2PI0A 3BQYA 1X1PA 5EZHA 4CA0A 3N4MA 3FM5A 3IL2A 1KU7A 3ZQGA 1DP7P 2W00A 3F3XA 2HQAA 5AIPA 1XSXA 3PUBA 1UAAA 3REOA 1HA8A 2OCCH 4I0BA 1NK2P 3CDHA 1YJWI 2H8RA 2ZKZA 4KYWA 3BDDA 4BQOA 4UUSB 3G1LA 3K2AA 3T5XA 2FRHA 2V26A 4MIMA 1S29A 1AHDP 1HKSA 2QF7A 3RZDJ 1IGNA 4JYKA 4QPQA 1XMXA 3J7AY 4XBFA 2GA2A 3ZRGA 3GMEA 2Q0OA 3DP7A 1HXDA 3K9TA 4ZZDA 2LP0A 5FLXK 4KNYA 3BCAA 2XAUA 1Z7LA 4B47A 4LMYA 1J09A 2JWTA 1M1EB 2UXXA 2VB6A 1IDZA 2R7VA 1JJ8C 2P7CB 1E2XA 3S14J 2R5YA 2LBFB 2XAQA 1V54H 4BL0B 1MNMC 1GVJA 1Z1DA 2CYYA 4BEHA 5HLTA 3JSPA 3JSOA 2A6TA 2G7HA 2RNGA 2XVCA 4HX8A 4XKBA 1JUPA 2HGCA 4J19A 2V1UA 3C2BA 1FTTA 2VT3A 5GTHC 1O4XA 2K9QA 3GFJA 4II3A 4CHUA 3HOVJ 1FMVA 2FA5A 2HQ5A 1RI7A 5ED4A 1XGOA 3MZ8A 5D8KB 4QTRA 2R7TA 2DQLA 3K4JA 5J40A 3JRIA 3OYAA 2NNYA 3BCBA 1SD5A 5EZGA 3M8EA 3TMOA 1P6RA 2CSOA 3VYUB 1XSVA 4RGUA 1TWFJ 2K9MA 3S1QJ 2EFWA 2JVHA 1MBEA 2V79A 3OS2A 1MBHA 2LNBA 4NNJA 2BHZA 1Y39A 1TWCJ 2FBKA 1R22A 1WWXA 1SFEA 2K40A 2VUMJ 1WCMJ 1LFPA 1D0ZA 5J47A 3DTEA 5LGTA 5E18F 3IAS2 2DJNA 1O57A 2JN6A 1SVLA 1VQKI 4A6EA 3JR9A 2WADA 3M3YJ 4E7KA 4EEFG 2CUZA 5CVRA 2ZJRF 3F6VA 2CWEA 2OZ6A 5IT9Z 3ESWB 3MZYA 2OU2A 4DZJA 1JKPC 2E34A 3F8CA 4A5NA 4BQAA 1A36A 3VB2A 5EYRA 2ACJA 1XN7A 4BHPA 2VXZA 1QZEA 3QU6A 4KA4A 4AVPA 2JVGA 1HW2A 5CYVA 5JVTA 2DQRA 2V6CA 4CUGA 4XSXF 1T33A 4MFEA 4O6JA 4BY1J 4IHSA 4MFDA 3P7NA 1ON2A 2E60A 1O3TA 2VN2A 1D8JA 3S1MJ 3J80K 2R5YB 1IXSB 1ZYRF 3PNYA 4RB2C 2E1OA 1ZGJA 4AVZA 4AYBA 4BEHB 5LEKA 2FBHA 4D5CA 4LIUA 1BR1A 1R7JA 4RGSA 3L2QA 3VYRB 3GTJJ 2E1MC 5FRNA 4KT6A 2L7FP 4RS8A 4C30A 2PEXA 3OSFA 4XKWA 1FLIA 2JUCA 5E3NA 3IKVA 3CJRB 2IVMA 2KISA 3OR1C 2W24A 3MKWB 2ESNA 1REPC 4F7ZA 2KHMA 3BR6A 1RUNA 1SD7A 2K9LA 3AL0B 2F5CA 5DYMA 4B43A 2R92J 1JI8A 3GF2A 4EATA 2BY3A 2BY0A 3ONQA 1RKTA 1T56A 2DA3A 1PVEA 3GLLA 2EQRA 2K4BA 1S7EA 5LGNA 3D1NI 2CV1A 5D5VB 1W0UA 4KFCA 5BMZA 2FEZA 4KIFA 4ZH4F 2FSWA 3S3MA 3H9GA 4OAZA 1HSJA 2NVTJ 4BJ5C 5GAEJ 2M34A 1XX5A 2MABA 3M8JA 2DMQA 5CVIA 3LQQA 3F21A 2HS5A 2O0YA 1LDJA 2HVRA 3FM3A 3H0GJ 2A6EF 4EGYA 4XL9A 1MMNA 1R1VA 3PL8A 4D9JA 5IP6A 4CCKA 1X4OA 1KU2A 3MMYB 2WWYA 2ID6A 2JRTA 4XRSA 3GW2A 5E8GA 3CO6C 5HS7A 5TRDA 2QA4I 2V4JC 2E36A 3I58A 1V5FA 3IKTA 2QSHX 2UXNA 4E7JA 2CG4A 3GWZA 4KUMA 4RAGA 1MMAA 3KYDB 4DBQA 3KE2A 3IRQA 5D8LB 3VSKA 4X1EA 2Z5UA 3K0LA 3T8RA 4ESBA 4CZCA 1F4KA 4BXXJ 2HZDA 2CUJA 2F4MB 4NB5A 4A3EJ 4P9FA 5LBQA 2ZCWA 5E1ZB 5F64A 1PUEE 1WRJA 1H9TA 3S16J 1JXSA 4KN4X 4B09A 3V7RA 1XSDA 2V1DA 1BC7C 2MW8A 2NXNB 5L3BA 2EINH 4WK8F 2X85A 4PJMA 4U7DA 1TNSA 2P0WA 1WI9A 2GWRA 2IGKA 4UVBA 3WTXC 3KIOA 5J4YA 3IH3A 4FETA 5DTDA 2FBIA 4PJNA 2DU9A 3IH2A 3BQZA 4WXHA 1R6RA 1ZR4A 4DZPA 4WXCA 3RSNA 2M0MA 4M6YA 3E6MA 2QQ9A 4IZZA 4C2MJ 2M4GA 1LVAA 2DK5A 2NS0A 4MGRA 4DYCA 2NOJB 3DEUA 3MN2A 5F1JA 5JR3A 3I53A 3BY6A 2XF5A 3DF8A 5E20A 2L3DA 2DFFA 4X6AJ 1H89C 4R79A 2XASA 1K6YA 4I09A 1JT6A 1LDKB 3MFKA 1TBXA 2QEXI 3P9CA 4F91B 1P2FA 3RPUA 4XN3A 4IOCF 2ZSHB 4M3FA 1TNTA 1USSA 3NWSA 3J80Z 4UVCA 5K7FA 3CP2A 4I02A 2LY2A 5DCMA 5H2FC 2FNPA 3GYHX 4JBAA 3WTYC 1Z67A 2KFDA 3LNQA 1P4WA 3V7SA 1J0RA 4TV7A 2QQ8A 2Z2SB 1FX7A 4U87A 3SQNA 3DPTA 4FE4A 4HA8A 1H8AC 2F5EA 2EFQA 4R1HA 4XOTA 5E8IA 2DMPA 3ZQ7A 1S72I 2GM4A 5ILVA 1PYVA 3LA3A 4P96A 4QIWN 3TOAA 5ICCA 1OQYA 1KGSA 2ZMEA 5LHIA 1ON1A 1HW1A 1I39A 1OYYA 1VQ7I 1QZYA 4XRMA 1U2WA 4HF0A 2LC2A 4RM3A 4XSZF 2ECBA 4Y4RA 1YTYA 1O7FA 2E5ZA 5IPAA 2DYRH 1JHFA 1HQCA 2QM3A 3V42A 2GOMA 1W1WE 4FQGA 4GFBA 1X19A 2EILH 1UB9A 2XRLA 1VQ4I 3GZ6A 2IBDA 1OR7A 1XGSA 2XB0X 5FKNA 1OPCA 2FOKA 1IC8A 2DTZA 2QKLB 4OMZA 1IN8A 3OIOA 3I64A 4C3IJ 2O61A 2GIVA 3QAHA 1FBQA 3MZHA 3I56I 4GO1A 3N05A 2W82A 2LY9A 1SFUA 3J7AO 3OL4A 2IA1A 2P6SA 2HPIA 4BJ6C 4MEXF 2EZLA 2DFHA 5IOYA 4YIIA 2DI3A 5J3LA 3LSTA 2G7UA 1KQ0A 2HDWA 3X2QH 3CMAI 5JFRA 3SXYA 2C6YA 4LFUA 2FQ4A 4N4NB 2EJRA 1K61A 1JKRC 2NVXJ 2MA3A 2XKPA 3F8BA 4G6QA 5DUIA 1BR4A 1JHHA 4UXNA 5DS9A 5TGTA 1NH3A 2PMZN 3CCEI 3OYKA 4A3DJ 3LSKA 2I8DA 3I5UA 1B9NA 3DU5A 1LUJB 5HS9A 2VKVA 3WTTC 4B4CA 2QBYA 1TQPA 1FP1D 3NRVA 1J9IA 5K5RA 2VPRA 5DCMB 3TDZC 3B73A 2JSCA 1UHSA 4R8HA 5GADJ 4BQNA 3G1OA 1QU3A 4CYCA 5K5OA 1SC7A 3E5XA 4ZDOA 2X6YA 5KNLA 2BVLA 2JA7J 3VWBA 3ZOBA 1MDMA 2IGNA 4P55A 3S1RJ 3CLQA 2R3SA 5A2QZ 3COAC 1YG2A 3TO6A 5L3GA 2ZMEB 1RR8C 2IW5A 3NAUA 4NUBA 2VBWA 1T0FC 1QBJA 1SD4A 4M9ZA 4PSXA 2ETHA 2XB5A 4PDKA 3AG3H 3G6EI 2HTSA 2VQGA 2VC1A 3CUOA 4L0YB 2Q1ZB 3R61A 2GXAA 1LDDA 2CW8A 4A0YA 3HRSA 2EPFA 4FASD 1WZ2A 4RGRA 2CH0A 1TC3C 2WAEA 3W6JB 3A01A 2VT2A 2W1OA 4CYDA 1XG1A 2IGOA 2E19A 1X1CA 4RLFA 4I99C 4E7SA 3QPSA 1HC8A 4N0BA 3ZMSA 3QOEA 2E1CA 3CCYA 2IS4A 3K4LA 3PO2J 2NS8A 2KLOA 5IYDJ 1GV2A 5HS8A 1R4MB 5LGUA 3W2AA 2H6BA 5HDGA 1LE8A 4OOIA 1BR2A 3Q0UA 3TKYA 5F0CA 3U9GA 3OMYA 2GA1A 4MNUA 1MBFA 1D8KA 1ZARA 3JTHA 4DW6A 2CS3A 3FHZA 1AKHA 3K4NA 3A03A 1XS9A 3H36A 3F22A 4IHXA 1IO2A 3HB9A 5HNFA 2RC4A 2KT0A 2DOEA 3KZIC 2JPBA 2XPUA 3BG6A 2VJIA 1T6SA 1WJFA 3DEWA 3PM1A 3PO3J 2J5OA 3H3ZA 4DYQA 1D3YA 4UB8C 4CYCB 5K1YA 2RNJA 3WHCA 2HDDA 2R7OA 1Z0XA 2VL8A 2V1XA 4GGGA 2X6OA 1MDMB 2XF6A 2LF7A 2XIGA 1ZG3A 3OYBA 2F4IA 5IT3A 2MD5A 4U0YA 1MBJA 1O7LA 2RAEA 3HTUA 5GPCA 2RGVA 1G4DA 5D5UB 4YIRX 3S8PA 1R49A 1UG0A 3LAPA 1B72A 2BY2A 3GTOJ 1N77A 1YX3A 3K1PA 3KEQA 3ZN0A 4JK1X 1T8IA 3RKYA 2DODA 4A3IJ 1W36D 2M8EA 2EBIA 2B63J 3I4PA 1Y0NA 2K4JA 3L09A 3GTMJ 5GTIC 3ABMH 3CJTB 3O3KA 3A01B 3OS1A 2MG4A 2B9SA 2AQEA 1U5TC 5H6RA 2L7KA 3VYSB 3ZPLA 3HBLA 1OYIA 3TGNA 4F93B 1QPIA 4HG2A 3H9JA 4A3FJ 1TW3A 3BZCA 3FIWA 4M72A 3BG7A 2WAQA 4OIPF 2A07F 1WI3A 4IRIA 5IY5H 2VQCA 1P7IA 1ORKA 2PMHA 2XAFA 2YSRA 1G3SA 4IHVA 1FEXA 2WB1A 3CF2A 1UMQA 3WTVC 5D4SA 1LE8B 3F72A 3HUGA 2LBFA 2X0LA 2W57A 4P1WA 3CCUI 1J59A 3CUQC 2VOPA 3JREA 1LJ9A 3RJPA 2Y9ZA 2IPQX 3BJ6A 2OZUA 1LVKA 4K2EA 3HKZN 3H35A 2LG4A 5E3MA 1AKHB 2LF8A 3GXOA 4OINF 2M3AA 2LVSA 3ZQIA 3ECOA 3GVAA 1TWGJ 1YW7A 2ELJA 1FPQA 2JJ7A 3ABUA 4CCLA 1EV7A 4LK1F 2CQNA 2LKXA 3GTPJ 2AS5F 2PQ8A 2CO5A 3G4SI 3L9FA 1TT5B 1U0JA 1E0EA 2MLKA 2F48A 4H0EA 3HOZJ 2H8WA 1X2NA 4EJVA 2BVMA 2Q2EA 3CESA 2HKOA 3QU3A 1KQ8A 3QRFF 4U0WA 3K70D 1W5TA 1KONA 4L9TA 2FXAA 3ROUA 3H5RA 4XLNF 1QO0D 5ICFA 2EIKH 4NC6A 3W2WA 3BR0A 4EM2A 2A69F 4X0GA 1FTZA 3HYIA 2FMYA 2MC3A 2HYGD 1B72B 3FHNA 2OTJI 3RKQA 2DXIA 1ZQ3P 2R7SA 1DPRA 1UELB 1T08B 1OCPA 3ZP5A 5DV5A 3WG9A 3MD2A 3NARA 4CDGA 3BTJA 2TCTA 1LFBA 4ZYAA 4M71A 1B59A 3E3VA 1R5ID 2E1MB 1MJBA 5ICEA 1IG7A 2DTRA 4BKXA 1YX5A 4EM0B 4BE1A 3FF5A 3ISPA 4RGXA 3VSLA 1UHWA 3LFKA 2HVSA 4UUVA 1W4MA 4WXDA 3DBRB 1R00A 3K7AJ 4PFOA 1XGMA 4ZZLA 2KDOA 2K9SA 2WTEA 1I27A 4IVNA 2DOAA 4IL6C 4RAYA 3TO9A 1HOMA 1BI3A 1IW7F 3K4MA 2XPVA 3ABLH 3L2UA 2IA2A 3HTSB 4PJ0C 2ELHA 2O03A 4HSTA 5J1RA 5E17F 3L2CA 1N25A 2FOWA 4EGZA 3HUGB 4D5FA 4ON0A 2VKEA 2XAJA 3SZTA 1MH3A 4IHYA 3TBIA 1P92A 1IUFA 2QYOA 4RAZA 5LLQA 4BU2A 5C4JJ 1H0MA 1LQ1A 2R7FA 4ZC3A 4CGZA 4MEYF 2H6CA 2LSOA 2X48A 4HYEA 1ODDA 1N75A 2ZXIA 2XF7A 2OBPA 4IF4A 2HNHA 1LEBA 2KRCA 4P9UA 1YS7A 3DWLE 1I3AA 3UR3C 3SJMA 2I10A 4LD5A 2O8KA 1BJAA 1P7JA 2Y48A 2Q8KA 3ZQCA 2V1NA 2UZKA 1Y1WJ 3FXMA 1TQIA 4XMYA 1PDNC 2JPCA 1MJ9A 4IEJA 3C3WA 4HF2A 2QGUA 2BW3A 3OYGA 5FRMA 3D5RC 3K1NA 2CQ7A 3GCMA 5DEQA 1IV8A 4E70A 1L0OC 3R6SA 1JE8A 5IYCJ 2CMPA 2Q2EB 3VOEA 4XNFA 3CLOA 4RLQA 2CU7A 2DN0A 1O3RA 5L3EA 1IRXA 5F0FA 3HSEA 4E7LA 1MNDA 2FU4A 1SMTA 2FNAA 4GYIA 3GTQJ 1ETQA 1LPQA 2WAFA 2Y9YA
chains in the Genus database with same CATH topology
2QSHX 2F4OB 1PVEA 2QSFX 2QSGX 1X3WB 1TP4A 4YIRX 2F4MB 1OQYA 3ESWB 1X3ZB 1QZEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSH X;  2F4O B;  1PVE A;  2QSF X;  2QSG X;  1X3W B;  1TP4 A;  4YIR X;  2F4M B;  1OQY A;  3ESW B;  1X3Z B;  1QZE A; 
#chains in the Genus database with same CATH topology
 3Q3S A;  1F43 A;  1H9G A;  2L9V A;  3PSI A;  5F1R A;  3M1C A;  1LB2 A;  1U9N A;  3E97 A;  3PQJ A;  3A4C A;  4AYB N;  3ZXS A;  1V4R A;  3D5L A;  2WC2 A;  1EH8 A;  4NQW A;  3BTI A;  3LSI A;  2HU9 A;  1FOY A;  1K83 J;  4AIK A;  3BJO A;  4G7Z F;  4EV0 A;  1ZGW A;  2CUF A;  3CCM I;  2DCE A;  2XGX A;  3JRD A;  4EM1 A;  1FBU A;  1FY7 A;  4XRS G;  2F4O B;  3V4G A;  3HEF A;  4JP0 A;  4DJA A;  1XCV A;  3CC4 I;  1I3Q J;  2DPU A;  3SDB A;  1IV6 A;  1WQ2 A;  4JOM A;  2DMN A;  2R7D A;  2OV7 A;  3AAF A;  1YHQ I;  2DMU A;  4RDU A;  3L2W A;  2E1N A;  2UUZ A;  2BYV E;  2LYC A;  4ZDP A;  3A0H C;  1K79 A;  3DKY A;  2A68 F;  1SVM A;  2VXD A;  3BJA A;  2DA6 A;  3P9K A;  1JUS A;  3J81 K;  1HST A;  2EFN A;  1YIJ I;  3FZV A;  3RDI A;  2BE5 F;  2IRF G;  4UV9 A;  3OY9 A;  3CDI A;  2K5C A;  2Y69 H;  4UVA A;  5J1U A;  5ICG A;  3FMR A;  2EZI A;  3PSF A;  3BOQ A;  2EZK A;  4EJO A;  3M4O J;  1MD0 A;  1SD6 A;  4Y17 A;  3LAJ A;  2DA5 A;  4QSH A;  3CO7 C;  1T0F A;  3U2R A;  4B48 A;  2PJP A;  4JX6 A;  3PFY A;  4XK4 A;  4F3Q A;  2CW7 A;  2K7L A;  2QLZ A;  4U88 A;  1U8R A;  1IN6 A;  2BW3 B;  1S7A A;  1W5C C;  3VEP A;  5FFX A;  4XKC A;  2CRG A;  4B1R A;  2O9L A;  1BI2 A;  2KL4 A;  3Q9V A;  3E6D A;  5FKK A;  1SFO J;  1NG7 A;  1MH4 A;  4BAY A;  5CQG A;  2L5Q A;  1D1A A;  4IO9 F;  4Q47 A;  1HW5 A;  3IRR A;  3QOD A;  3CTA A;  2AXT C;  3JAM K;  3WE2 A;  5JHF A;  4EJU A;  5ILU A;  3M1E A;  1AOY A;  2YPR A;  4GRI A;  4LLL A;  3OIP A;  1EH7 A;  4HSR A;  2PN6 A;  3CC2 I;  2ZNY A;  3BTL A;  3GO5 A;  3CZ6 A;  2QEN A;  1DGW Y;  2YX7 A;  1BJZ A;  4RMN A;  5HDN A;  4NQW B;  1J7K A;  2OPT A;  2CJJ A;  4BXU A;  2E2H J;  2HOE A;  2P4W A;  4FHT A;  4ENJ A;  1PJR A;  1XD7 A;  4NC7 A;  4PSW A;  3KEY A;  1KQ9 A;  1S9H A;  1HBX G;  1IXC A;  1Z77 A;  2M8G X;  4FX0 A;  5BOX A;  2ME0 A;  3LA7 A;  2HOT A;  3BR1 A;  1RKW A;  4HBL A;  1BN5 A;  3HOX J;  1QGP A;  2WV1 A;  4LIT A;  4EVI A;  3TOB A;  3TW6 A;  2CV2 A;  2VBZ A;  1O3Q A;  3LMM A;  3KEO A;  1SEU A;  5J8F A;  2XDV A;  5AON A;  4D1Q A;  2VKH A;  1TWH J;  3FXQ A;  3Q9S A;  3BZK A;  4G8X A;  2IS2 A;  5LFA A;  5J8C A;  1HDD C;  4Q4Z F;  1HCR A;  3EQL F;  3HIF A;  3EUA A;  2YU3 A;  5LEJ A;  3LSP A;  5FKM A;  2L0K A;  4E4H A;  3WTS C;  3I55 I;  2VIX A;  5F27 A;  5M3M J;  2BV6 A;  2ZO4 A;  1D5Y A;  1VQ6 I;  5FJ8 J;  1VND A;  4M3G A;  2LD5 A;  4FCY A;  2WBM A;  4A3M J;  3CCS I;  3FBI B;  1ETW A;  1ETY A;  1RET A;  1YYV A;  3PNV A;  2NRA C;  4A3G J;  2MC4 A;  4HNU A;  2JT1 A;  4O5V A;  5A2Q K;  4ZTF A;  2AO9 A;  3D0S A;  2FML A;  1W36 C;  1I1S A;  3U21 A;  4DGW B;  1ACI A;  2M87 A;  4I7H A;  2K85 A;  3O8H A;  5GP9 A;  3JRC A;  5LRS A;  3RTR A;  2FX0 A;  2HWV A;  1JT0 A;  2WV0 A;  2OJE D;  2STW A;  4BXF A;  1RES A;  3UKG A;  2LLK A;  3J81 Z;  3VDX A;  3PJR A;  1ENH A;  1U5T A;  2RRE A;  1G3T A;  5LHG A;  4EJT A;  3ABK H;  3PIP F;  1T98 A;  1YQA A;  1KYW A;  3F0C A;  1BIA A;  3KYC B;  1KYZ A;  2Y2Z A;  1BIB A;  2L9S A;  4KMF A;  3ZMD A;  3KFW X;  1Y8R B;  4RB0 A;  4KDP A;  1IRG A;  2OA4 A;  1Z6R A;  2DT7 B;  3T8T A;  2FUG 2;  5JI6 A;  5C44 J;  2DA2 A;  3IUO A;  2MYS A;  1G59 A;  4A0Z A;  1G6N A;  2M45 A;  3B6A A;  3CUQ A;  3GFL A;  5L3F A;  3FXL A;  1AU7 A;  4HX4 A;  1D0Y A;  2L9N A;  4XLP F;  3SFZ A;  4AIH A;  4Q5S F;  4KN7 X;  2PG4 A;  3FMQ A;  2GBY A;  1SMY F;  3OYM A;  3E7L A;  1W7P D;  2QQB A;  5FLM J;  1IDY A;  2JUG A;  2ECC A;  5J4V A;  3JAM Z;  2ZBK A;  1YIO A;  3TDU C;  1IXR C;  4P5O A;  5BS6 A;  2DA7 A;  1XTA A;  1QPM A;  3G71 I;  4A3K J;  3S2H J;  1WJD A;  2BY1 A;  4F52 A;  2W4S A;  3P9I A;  2HOS A;  1SVO A;  2DA1 A;  4OWR B;  3K70 C;  1DU6 A;  2HEO A;  2M1B A;  5DM6 F;  4G6T B;  3O2P E;  3PNT A;  4BY7 J;  4RAF A;  4I6Z A;  4MQ9 F;  1ZAO A;  5FD5 A;  5L3D A;  4Y13 A;  5EDN A;  1GDT A;  1QNT A;  5H20 A;  3LA2 A;  2F5F A;  1GXQ A;  1ZRD A;  3Q0V A;  4XOR A;  3ZQL A;  4A0X A;  3BT9 A;  2ADU A;  2EA4 A;  2XUB A;  2E71 A;  2FJ1 A;  2L7M P;  3H1C A;  3IAM 2;  3HGY A;  1FNN A;  2ZJQ F;  3L1P A;  2Y31 A;  1QZZ A;  4PGG A;  4BDZ A;  4B3A A;  5HVQ C;  2P5K A;  4KIC A;  4LG3 A;  4RM2 A;  3ZQQ A;  5IOZ A;  3GFI A;  2EV0 A;  2CV0 A;  1YW9 A;  1TZL A;  2M30 A;  1B9M A;  4IXA A;  4DNC A;  1FZP B;  1ZRC A;  3GX4 X;  2A6H F;  3M9A A;  3QPL A;  1ONV A;  4ENM A;  1U5T B;  3HM5 A;  3K2Z A;  2AHQ A;  5F0H A;  4PUS A;  4PFP A;  3VPR A;  3DBL B;  1U78 A;  5ILS A;  2F5V A;  4M6V A;  4CO8 A;  3L7W A;  4OIQ F;  3JW4 A;  2M5W A;  2GOX B;  3TL4 X;  3JRA A;  2W84 A;  3FMS A;  5KK1 A;  3EPZ A;  1MZB A;  3WTZ A;  2Z9O A;  3H3V K;  1Y56 A;  3I9V 2;  3I54 A;  4M9X A;  1LFU P;  3EET A;  1ZLJ A;  3W2V A;  1OMI A;  1ZHF A;  3CUQ B;  2HTJ A;  2GAU A;  5HDK A;  4XLE A;  4BUP A;  2W85 A;  1X3U A;  4ZDL A;  1SFX A;  2EB7 A;  2LK2 A;  1S8N A;  3AFH A;  4EMS A;  4UB6 C;  2DFI A;  2LRD A;  3EUH C;  2YR2 A;  2ISY A;  1BC8 C;  3FK6 A;  2KJC A;  1Z3X A;  2LFB A;  2ZXW H;  4OU0 A;  1A6Q A;  2XGD A;  3FXU A;  4BS9 A;  2OF7 A;  3WTW C;  2V9V A;  3R4K A;  1B6A A;  4OIR F;  2Z3Y A;  2A61 A;  3TO7 A;  4LB5 A;  1W7P A;  3FWE A;  1FBS A;  4M9S A;  2PMZ A;  2X6X A;  3F8M A;  2P8T A;  1E3P A;  4II2 A;  3WGG A;  4LJZ F;  3H3U A;  2HI3 A;  2X1D A;  3OL3 A;  3M7G A;  1TLH B;  4I98 B;  3WTU C;  1DPU A;  5FGM A;  1BOA A;  5K7Z A;  4KIT B;  4N9H A;  3M07 A;  3PQK A;  1SFK A;  2DMT A;  1POG A;  5FKO A;  3CCL I;  1Y0U A;  1G3W A;  4G94 A;  2EA2 A;  5DD4 A;  4RB1 A;  1XCB A;  1T2K A;  1MMS A;  2HR3 A;  5F08 A;  2NYX A;  1FIP A;  2IGM A;  2VOO A;  1OCR H;  3QYB A;  3SHF A;  2R7W A;  4RBO A;  4B8X A;  3CCV I;  2BOL A;  2Y0S A;  5M5X J;  3QPH A;  1R5G A;  3GFM A;  4YEL A;  3BC8 A;  3PUF A;  1R1U A;  2V7F A;  2CW0 F;  1JTY A;  3TQN A;  4EJW A;  2X1E A;  2N8G A;  3KP5 A;  4AD9 A;  4KJZ A;  5IP7 J;  1A04 A;  1MMG A;  1UHM A;  2PMU A;  5D4R A;  5F04 A;  2R7Z J;  4G7O F;  3A02 A;  2TDX A;  4V19 K;  3AG2 H;  2W48 A;  2CFO A;  1STZ A;  1WGX A;  2JRM A;  3LSJ A;  1DU0 A;  3K10 A;  3KLN A;  4IRG A;  1HKT A;  2WAQ N;  4HV6 A;  4FX4 A;  1MBK A;  3KZY A;  2MSY A;  1OIS A;  2ICW G;  1MKM A;  3GZ5 A;  2WB1 N;  2QUF A;  3KLO A;  1S3J A;  1QHG A;  3J7Y J;  3E5U A;  3E0J B;  4A3C J;  4Z6Y A;  2V9P A;  2Z1D A;  1JJ6 C;  1BI0 A;  3GZN B;  5KAF C;  5DM7 F;  5J6X A;  3MVP A;  2RVC A;  4D7M A;  3VOD A;  2O7O A;  2Z33 A;  1G2H A;  3F9K A;  1ETX A;  3WHB A;  1Q1H A;  1S6L A;  1GXP A;  3SDG A;  1ZG1 A;  4WX9 A;  4HOB A;  3E1S A;  4NC8 A;  1Y6I A;  2MFZ A;  5H6Q A;  3ZQH A;  1W7P B;  3AG4 H;  3FK7 A;  1NTC A;  4CSW A;  2NVU B;  3WE3 A;  3RYR A;  3HPH A;  1EJ9 A;  2IP2 A;  2VC0 A;  1ZTR A;  5TJJ A;  1J2X A;  4UV8 A;  2VLA A;  1RPW A;  1RZ4 A;  5EEA A;  1XMA A;  3BPX A;  1I1G A;  1KU9 A;  2LMD A;  2KDZ A;  3RQI A;  3KZZ A;  3Q0W A;  1YRN A;  4YFN F;  2F2E A;  4A3J J;  2LOO A;  1XPX A;  1ZGA A;  1VZ0 A;  2OQG A;  2HDC A;  1NK3 P;  2R7X A;  4AUX A;  1CGP A;  4PJL A;  1A6I A;  5FO5 A;  3CQZ J;  2E7X A;  2PBI A;  3QQA A;  4IKF A;  1I6X A;  3V8L A;  3DKX A;  4CZZ A;  1S7O A;  3DEE A;  4E7Z A;  2H94 A;  3IHU A;  2DYS H;  2M9H A;  4FT8 A;  1JUM A;  2I5U A;  3DV8 A;  3G2B A;  4FE7 A;  2HOA A;  3MKY B;  1B8I A;  3I4N J;  1WVR A;  1GVD A;  5HLH A;  4ETS A;  1PUF A;  4MTE A;  4PJJ A;  4BH9 A;  4EQQ A;  2R7U A;  5LHH A;  2A5Y B;  4Q48 A;  4IOA F;  2VE8 A;  2LTP A;  1K4S A;  2GXG A;  2FE3 A;  3QYF A;  2MLG A;  2L7Z A;  4L18 B;  2KQR A;  2Y75 A;  1BM9 A;  4Y7N J;  5GAH J;  4LB6 B;  3OV8 A;  3RKW A;  4ZTJ A;  2GLO A;  3IV5 A;  1YFH A;  3OYN A;  2VJ4 A;  2DA4 A;  1KU3 A;  4ESF A;  2QVO A;  4OIO F;  4YRV A;  1RUO A;  4CCM A;  5LD2 C;  5CJ9 A;  2H09 A;  2ISZ A;  4BBR J;  1WJC A;  4I0A A;  1ULY A;  1VI0 A;  3LFU A;  3MQ0 A;  2PLY A;  3FXK A;  2VBY A;  1FC3 A;  4ZYD A;  1TT0 A;  5CQE A;  1PP7 U;  4HZF A;  4YEJ A;  4GCV A;  3H9Q A;  1TWA J;  1K6O A;  1X2M A;  3I71 A;  3LL7 A;  3F8F A;  1WJA A;  2EWN A;  2XSD C;  2F5D A;  1YI2 I;  1XB4 A;  4HDV A;  1R1T A;  1AA7 A;  3OWT A;  2HKX A;  1X4P A;  2DAO A;  5DDG A;  2STT A;  5JHU A;  2NS7 A;  3KP2 A;  1JTX A;  3HKZ A;  2M2E A;  2IJL A;  3MAJ A;  1MGT A;  2P5V A;  4A5M A;  3RIR A;  3NWT A;  2LKP A;  5BPI A;  3RCO A;  4YFK F;  1R36 A;  1A35 A;  1DQU A;  1LKX A;  2JA6 J;  2HQR A;  1U8B A;  2L01 A;  3HJE A;  3G3Z A;  1S5L C;  1WJB A;  2QZ8 A;  2XGC A;  1ZH5 A;  2KRH A;  2L2O A;  2ZC2 A;  3QYE A;  2KIF A;  2RN7 A;  1N78 A;  3LSH A;  2DPD A;  5EGO A;  1YRN B;  3HSR A;  1R71 A;  2LDU A;  2HYJ A;  2IXS A;  2GXB A;  1JGS A;  3KP3 A;  2XAH A;  4W97 A;  4C2T A;  4WF2 A;  4B3X A;  2DBB A;  2IA0 A;  2M7A A;  1XDU A;  3ERE D;  1GT0 C;  1IAW A;  4G12 A;  4A2U A;  1ETV A;  2VPL A;  3WU2 C;  1GV5 A;  2FF4 A;  1JKQ C;  1BI1 A;  3DQV C;  4HNT A;  5FB2 A;  1R58 A;  2W7N A;  2HXO A;  5EEG A;  4B44 A;  2P7V B;  2B0L A;  1KZH A;  3LSG A;  2JQ7 A;  3DTK A;  3ZN1 A;  5GPA A;  1BOB A;  2MH9 A;  1B8I B;  4LK0 F;  1IUY A;  5C3E J;  1PUF B;  1FOX A;  1RNL A;  2O5R A;  1VF9 A;  1ZLK A;  2CQK A;  2QCO A;  1X3Z B;  1WPK A;  1H88 C;  3HRM A;  1R23 A;  1MJA A;  1ZEL A;  1MBG A;  1X3W B;  4HEA 2;  2EZH A;  4I76 A;  5CVU A;  2VBX A;  2DOF A;  3CCQ I;  3QP5 A;  3S2W A;  2Z16 A;  3HC7 A;  3HRT A;  3H0D A;  1ZG5 A;  2JA5 J;  3QP6 A;  4DOZ A;  4DBR A;  4Y3O A;  2ZXH A;  1ZR2 A;  5DUK A;  3ZMZ A;  3SZP A;  1GUU A;  2JTV A;  1UZC A;  1OJL A;  1YLF A;  2IS1 A;  1TTY A;  3I3L A;  3TW7 A;  4FIS A;  1DDN A;  1Y8Q B;  4YIF A;  2QKM B;  2HPM A;  3OSG A;  3MEX A;  4S0H B;  3ZMU A;  1ITY A;  3TP0 A;  3HDD A;  3OR2 C;  3HGG A;  3QWL A;  4ZYH A;  2JMW A;  3BR3 A;  3BP8 A;  3J7Z I;  1FSH A;  1SAU A;  1WH7 A;  3DBH B;  2EK5 A;  3B02 A;  5CLS A;  3RKX A;  5BQT A;  2IS6 A;  2GIZ A;  1EKE A;  2E7W A;  2RKH A;  1HDP A;  3IP4 B;  4L9J A;  1YW8 A;  3BLY A;  2LRE A;  3H92 A;  3GEZ A;  3HOY J;  5FKL A;  2K3P A;  3OOU A;  3BTC A;  2KJB A;  2R7R A;  1FSE A;  4LOC A;  3BG3 A;  5B1A H;  3MCZ A;  1W5S A;  5HOD A;  4E7H A;  2TRT A;  2M0C A;  3SFI A;  2VJ5 A;  4AID A;  3EDP A;  5CKT A;  5KAI C;  1YJ9 I;  3OIQ A;  4M3E A;  2K9N A;  1IZ1 A;  2D2W A;  3FXJ A;  4ITV A;  3JRB A;  4KMU X;  2XRN A;  1DGR M;  1V5G A;  4JX4 A;  3SEZ A;  2IAI A;  3KP6 A;  5D6F A;  5EGO B;  3D5S C;  2XRO A;  3DKW A;  3A1Y A;  3S32 A;  2YU9 J;  1F9N A;  1Z7U A;  1ZRE A;  3GBG A;  4DIQ A;  4BQQ A;  4M6X A;  2XC7 A;  1OLT A;  2PFB A;  2LY1 A;  1ZN2 A;  3CDL A;  3HHH A;  2D1H A;  1OKR A;  1U3E M;  3DLL F;  1FIA A;  1VFC A;  2KIM A;  3P5J A;  1ERD A;  1QVU A;  4U0V A;  5M5W J;  4IX7 A;  2KIU A;  2BBY A;  3TP3 A;  4ZYE A;  4WCG A;  5E3O A;  1Z05 A;  5DCF A;  2OC6 A;  4MQV A;  2YS9 A;  3OYE A;  3WU1 B;  3GTL J;  3OS0 A;  2V6E A;  1X1D A;  2DJI A;  2X51 A;  3L00 A;  1E17 A;  1YE9 A;  5M5Y J;  1MSE C;  3EUH A;  3R0J A;  2EFP A;  1FYK A;  2KKO A;  2X6W A;  1FYL A;  2CQQ A;  2H1K A;  1VQ9 I;  1RRJ A;  3CMM A;  4A93 J;  3V8J A;  4CCN A;  5FLX Z;  2NVQ J;  1MMD A;  3ML6 A;  3RPU D;  1CF7 A;  1EH6 A;  2DK8 A;  2CUE A;  3LSM A;  3MKL A;  3O6B B;  3V7C A;  1FJL A;  2K86 A;  1BW6 A;  3LQR A;  4M74 A;  1XC5 A;  4XM3 A;  2MD0 A;  2VKD A;  4Z2Y A;  5C4X J;  2JK3 A;  3IWF A;  6PAX A;  4KIB A;  3DCF A;  2EH3 A;  5K7H A;  3IH4 A;  2RDP A;  4JX5 A;  1G8X A;  3ERM A;  3EUK L;  3S2D J;  4XR6 A;  3K69 A;  1IJW C;  1UCR A;  1R4N B;  1EA3 A;  1TW2 A;  3MWM A;  4F92 B;  3G73 A;  1APL C;  2E2I J;  4CXF A;  3W6K B;  1BL0 A;  2A5W A;  3KX2 A;  3DPU A;  2IT0 A;  5ERI A;  4HV5 A;  4HX7 A;  4AM3 A;  5B5E C;  1V55 H;  2DT5 A;  4BJT A;  3OOP A;  3I59 A;  4D7N A;  4HW0 A;  4BDY A;  4L5I A;  2WY7 Q;  2NVY J;  3KET A;  4CH7 A;  3I4M J;  1ZRF A;  4L5E A;  2LKS A;  1CQT A;  1YS6 A;  4S04 A;  4XLF A;  2OD5 A;  2HVQ A;  3ABT A;  2XPW A;  1ZKG A;  2OCE A;  1P4A A;  1LEA A;  1IF1 A;  2UV1 A;  5EJC A;  1VQ8 I;  2W25 A;  2WY8 Q;  5M3F J;  1QA6 A;  4LG0 A;  1IN5 A;  2M7B A;  4O3M A;  2H27 A;  5CPR B;  2KPM A;  3HHG A;  4OAY A;  2VJJ A;  1T95 A;  2CQX A;  3RPQ A;  1YIT I;  2RQQ A;  2QWW A;  2HZT A;  4IJA A;  1YOV B;  5LRR A;  2K27 A;  5B66 C;  2DLL A;  2X9D A;  5CVJ A;  2DDB A;  2M4K A;  4PCQ A;  4C3H J;  4A6D A;  5J1Y A;  2P6T A;  3GTG J;  3C18 A;  5EG0 A;  2VQL A;  2NNN A;  1HF0 A;  2ZFU A;  2R0Q C;  1B1B A;  1P9Q C;  2OTL I;  5DD8 A;  1U6G A;  2R7Q A;  3BR5 A;  3ASO H;  3HOS A;  3BG5 A;  3R0A A;  1QHH D;  5E3L A;  4Y33 A;  1A5J A;  3HZJ A;  2Y30 A;  1VQM I;  1I50 J;  1VQP I;  1XMK A;  1CF7 B;  1D5V A;  1U9O A;  1L3L A;  4CCJ A;  3B6C A;  5FRO A;  1VQ5 I;  3ZMT A;  4NHJ A;  2OQR A;  2L9R A;  3I0T A;  4XQF A;  1QRY A;  5IYB J;  1WKM A;  4ENK A;  2O8X A;  2YX4 A;  3NEU A;  4LLG F;  4D0P A;  4GYG A;  2O6G E;  2R5Z A;  3OYL A;  2L02 A;  4QWQ A;  2ZJP F;  3CCJ I;  4HDU A;  1FMW A;  1ETO A;  3FKI J;  3M8F A;  3AKZ A;  2DFE A;  2HYF A;  3S17 J;  3F8N A;  2GQQ A;  4AC0 A;  2MGQ A;  5KCM A;  5CVV A;  3OYC A;  4YG2 F;  3OYD A;  5BPD A;  4BBS J;  4ANJ A;  3LSR A;  3MKZ A;  3I59 B;  3HXL A;  1OCZ H;  1WHU A;  1X58 A;  4BE0 A;  3PFI A;  2K02 A;  3H5N A;  4ESJ A;  3E6C C;  3G1M A;  4RA2 A;  4Y15 A;  2X1C A;  4UHT A;  4YFX F;  5HOO A;  2ZB9 A;  1V3F A;  4MTD A;  1K78 A;  3BPV A;  2ID3 A;  3F23 A;  4XLA A;  3AL0 C;  2VAS A;  3QPT A;  1AWC A;  3FX3 A;  4V2G A;  5FD6 A;  1R9T J;  4LG0 B;  5EF6 A;  2G9W A;  1FWZ A;  1WH5 A;  2HXI A;  2AXL A;  3KCC A;  1X1B A;  1RR7 A;  1T38 A;  4PK4 A;  1TL8 A;  3T1B A;  4U7B A;  2DO7 A;  2KIQ A;  3L2V A;  2F6C A;  2JA8 J;  3K4C A;  4XON A;  1Z6T A;  3CMY A;  4HF1 A;  3IC7 A;  4H4K C;  1BBY A;  3JTG A;  2VE9 A;  1DP3 A;  2H1L A;  1LNW A;  3HOW J;  2JSP A;  2MH2 A;  4ASN A;  4I2O A;  2E35 A;  4AIJ A;  2OUM A;  4HLY A;  4BNC A;  2DW4 A;  5EG0 B;  4DQ2 A;  4G6D A;  1WJ5 A;  2CFX A;  4HQE A;  3S3O A;  1TP4 A;  3QOP A;  1F5T A;  1MW7 A;  4ZJZ A;  4E7I A;  5K5Q A;  4QLC U;  2BGC A;  2DT6 A;  1UST A;  2XGE A;  2KRF A;  2B7E A;  4UY8 I;  3OYF A;  4KIS A;  1UFM A;  2L4A A;  4A3B J;  4OMY A;  2GZW A;  2DDA A;  3DXJ F;  3RZO J;  2VQH A;  3ULQ B;  3SZG A;  3OYI A;  2MBF A;  2QSF X;  1Z21 A;  4ABZ A;  4IPA A;  2KZG A;  4A69 C;  3DPL C;  4PGH A;  2PJR A;  5KHD A;  4UUT A;  4BYY A;  1OYW A;  3ZMV A;  2XV4 S;  4BAC A;  3OYH A;  3IWZ A;  1K7A A;  3NQO A;  3HSF A;  1K4T A;  3JRH A;  3LWF A;  2R5Z B;  2J5P A;  1HLV A;  3HRU A;  4HRI A;  3RQ4 A;  4DYR A;  2NAZ A;  4HQM A;  4ZYG A;  2G0E A;  4LIV A;  1T39 A;  1NG6 A;  1FOW A;  4XKV A;  1P4X A;  4S05 A;  3S15 J;  2Y0S N;  4XOP A;  4M73 A;  4XLC A;  4BHB A;  3K1M A;  4M3B A;  1VTN C;  2EIJ H;  4WWC A;  3S1N J;  1D1C A;  1NHA A;  4XN0 A;  1VQO I;  4XIC A;  4MLO A;  2FD5 A;  3JRF A;  1JGG A;  2XKO A;  3F6O A;  3CJN A;  3OYJ A;  2VOD A;  1K78 B;  2XHK A;  2ME6 A;  2EV5 A;  4UNO A;  3PIO F;  2EFO A;  5GAG J;  3S3N A;  4E6K G;  4JQF A;  4A3L J;  2ELK A;  1XDS A;  3CJQ B;  1IRF A;  1ZK8 A;  2ZSI B;  3A2K A;  1W0T A;  4Y52 J;  3BWG A;  2X4H A;  4NBQ A;  3Q5F A;  1Y1V J;  3BZ6 A;  3ASN H;  5E1X A;  3K6G A;  2E5N A;  4L9V A;  1E3O C;  2PX9 A;  2COB A;  3BRO A;  5FFZ A;  2D5V A;  5JLW A;  3GLX A;  4N4O B;  3EYI A;  2LH9 A;  1Z91 A;  5KVR A;  9ANT A;  2RQP A;  2JZY A;  2Y0M A;  1D1B A;  2WA0 A;  3CF5 F;  4GXO A;  1ETK A;  3ZQF A;  4IHT A;  5E1W A;  1J5Y A;  2YUS A;  3U1K A;  2D45 A;  3W6V A;  3HG9 A;  1I6H J;  5EEH A;  3CP8 A;  4G9Y A;  4GDF A;  1F1Z A;  3WGH A;  2K3F A;  2XAG A;  3EYY A;  3WG7 H;  1C0W A;  4W1U A;  3SEQ A;  4MHG A;  4L5J A;  4V2F A;  2BXY A;  3ZGK A;  3HOT A;  4KIG A;  1VQL I;  3WU0 A;  1SAN A;  1UJ8 A;  3CC7 I;  2ZJ2 A;  1O3S A;  1WFX A;  2ZNZ A;  2E2J J;  1HKQ A;  1D0X A;  1BA5 A;  4AU7 A;  5JLX A;  3W3C A;  3VYT B;  1DUX C;  1JKO C;  2FQ3 A;  3C2H A;  2P5L C;  3BG9 A;  4XRF A;  2HFH A;  3C7J A;  5B1B H;  5JVG F;  3HOU J;  3TED A;  2R4G A;  5F6F A;  1IRZ A;  4HNV A;  2PJR B;  1VQN I;  3FXR A;  2JA2 A;  5TIS C;  5D5X B;  3C2G A;  3ELK A;  3FBN B;  2QBY B;  2ZXJ A;  3HL2 A;  3HPG A;  2D1V A;  1FT9 A;  5FLV A;  4RB3 C;  1MIJ A;  3FIS A;  1OCC H;  3WGI A;  3RYP A;  4C2U A;  2EIM H;  3LOC A;  4N9I A;  1OCT C;  2ZFW A;  1Z9C A;  4IHW A;  3T0Y A;  2XSJ C;  2IEK A;  2AQF A;  4HPQ A;  3ZCO A;  3E6B A;  4KT5 C;  1A31 A;  1Q1V A;  2Z99 A;  1I5Z A;  3K4B A;  1FOK A;  4PZJ A;  3U1D A;  3S93 A;  1BW5 A;  5HNH A;  3DLA A;  5B3S H;  3CCR I;  4F55 A;  1OFC X;  3KP7 A;  1V5E A;  1WSU A;  3VFZ A;  3O8G A;  1XGN A;  1YJN I;  3CD6 I;  3K4K A;  1IN4 A;  2VON A;  1F36 A;  1B4A A;  2P81 A;  4UUS A;  5HLG A;  3BR2 A;  4LGW A;  3FXO A;  2KZV A;  1KA8 A;  3KYL A;  1IN7 A;  1OCO H;  3N97 A;  4LLN A;  2V9K A;  2UWM A;  2NOG A;  4NDL A;  1Z3Y A;  2KMU A;  4C3J J;  2EV6 A;  2LR8 A;  3UNG C;  1YO5 C;  3GTK J;  4IRH A;  4BHC A;  1X1A A;  5D6E A;  5BNG A;  1QQI A;  2QSG X;  4BGD A;  1SAX A;  3C1D A;  2HQN A;  1TQM A;  3RI4 A;  3CME I;  4HLX A;  2BZT A;  3L2R A;  1MSF C;  2R93 J;  1FYM A;  4I01 A;  2BXZ A;  2COM A;  2ZME C;  3E5Q A;  5IP9 J;  1GLN A;  4MO7 A;  1MNE A;  4IQ4 A;  4G7H F;  1PP8 F;  1FP2 A;  1RC9 A;  4C9Y A;  2RV8 A;  3DU6 A;  4L0Z B;  5L3C A;  4M3D A;  1E3H A;  2ESH A;  1J75 A;  3DTI A;  3SYT A;  4J00 A;  2VI6 A;  5AIQ A;  5D5W B;  4J01 A;  4XID A;  2A3S A;  4ENN A;  1WJE A;  3A0B C;  2O3F A;  3KPH A;  1UG2 A;  2QQA A;  3GUD A;  1OR7 C;  4HAM A;  2A05 A;  2BEO A;  3AG1 H;  2L54 A;  3FDY A;  4AWX B;  1EF4 A;  4BE2 A;  1GHC A;  2CGP A;  3ECH A;  5E79 C;  5IT9 K;  4CIC A;  3ZR8 X;  3H5A A;  2BHY A;  3KP4 A;  3DFG A;  3WOD F;  1RIO H;  5HLI A;  3R60 A;  2L4M A;  4L9N A;  4CCO A;  4XLH A;  1QVT A;  2OAZ A;  3V8K A;  2KP6 A;  4A12 A;  3JRG A;  1R5H A;  3JCU C;  4FTH A;  4IQJ A;  1G3Y A;  4QPO A;  3FKJ A;  2PI0 A;  3BQY A;  1X1P A;  5EZH A;  4CA0 A;  3N4M A;  3FM5 A;  3IL2 A;  1KU7 A;  3ZQG A;  1DP7 P;  2W00 A;  3F3X A;  2HQA A;  5AIP A;  1XSX A;  3PUB A;  1UAA A;  3REO A;  1HA8 A;  2OCC H;  4I0B A;  1NK2 P;  3CDH A;  1YJW I;  2H8R A;  2ZKZ A;  4KYW A;  3BDD A;  4BQO A;  4UUS B;  3G1L A;  3K2A A;  3T5X A;  2FRH A;  2V26 A;  4MIM A;  1S29 A;  1AHD P;  1HKS A;  2QF7 A;  3RZD J;  1IGN A;  4JYK A;  4QPQ A;  1XMX A;  3J7A Y;  4XBF A;  2GA2 A;  3ZRG A;  3GME A;  2Q0O A;  3DP7 A;  1HXD A;  3K9T A;  4ZZD A;  2LP0 A;  5FLX K;  4KNY A;  3BCA A;  2XAU A;  1Z7L A;  4B47 A;  4LMY A;  1J09 A;  2JWT A;  1M1E B;  2UXX A;  2VB6 A;  1IDZ A;  2R7V A;  1JJ8 C;  2P7C B;  1E2X A;  3S14 J;  2R5Y A;  2LBF B;  2XAQ A;  1V54 H;  4BL0 B;  1MNM C;  1GVJ A;  1Z1D A;  2CYY A;  4BEH A;  5HLT A;  3JSP A;  3JSO A;  2A6T A;  2G7H A;  2RNG A;  2XVC A;  4HX8 A;  4XKB A;  1JUP A;  2HGC A;  4J19 A;  2V1U A;  3C2B A;  1FTT A;  2VT3 A;  5GTH C;  1O4X A;  2K9Q A;  3GFJ A;  4II3 A;  4CHU A;  3HOV J;  1FMV A;  2FA5 A;  2HQ5 A;  1RI7 A;  5ED4 A;  1XGO A;  3MZ8 A;  5D8K B;  4QTR A;  2R7T A;  2DQL A;  3K4J A;  5J40 A;  3JRI A;  3OYA A;  2NNY A;  3BCB A;  1SD5 A;  5EZG A;  3M8E A;  3TMO A;  1P6R A;  2CSO A;  3VYU B;  1XSV A;  4RGU A;  1TWF J;  2K9M A;  3S1Q J;  2EFW A;  2JVH A;  1MBE A;  2V79 A;  3OS2 A;  1MBH A;  2LNB A;  4NNJ A;  2BHZ A;  1Y39 A;  1TWC J;  2FBK A;  1R22 A;  1WWX A;  1SFE A;  2K40 A;  2VUM J;  1WCM J;  1LFP A;  1D0Z A;  5J47 A;  3DTE A;  5LGT A;  5E18 F;  3IAS 2;  2DJN A;  1O57 A;  2JN6 A;  1SVL A;  1VQK I;  4A6E A;  3JR9 A;  2WAD A;  3M3Y J;  4E7K A;  4EEF G;  2CUZ A;  5CVR A;  2ZJR F;  3F6V A;  2CWE A;  2OZ6 A;  5IT9 Z;  3ESW B;  3MZY A;  2OU2 A;  4DZJ A;  1JKP C;  2E34 A;  3F8C A;  4A5N A;  4BQA A;  1A36 A;  3VB2 A;  5EYR A;  2ACJ A;  1XN7 A;  4BHP A;  2VXZ A;  1QZE A;  3QU6 A;  4KA4 A;  4AVP A;  2JVG A;  1HW2 A;  5CYV A;  5JVT A;  2DQR A;  2V6C A;  4CUG A;  4XSX F;  1T33 A;  4MFE A;  4O6J A;  4BY1 J;  4IHS A;  4MFD A;  3P7N A;  1ON2 A;  2E60 A;  1O3T A;  2VN2 A;  1D8J A;  3S1M J;  3J80 K;  2R5Y B;  1IXS B;  1ZYR F;  3PNY A;  4RB2 C;  2E1O A;  1ZGJ A;  4AVZ A;  4AYB A;  4BEH B;  5LEK A;  2FBH A;  4D5C A;  4LIU A;  1BR1 A;  1R7J A;  4RGS A;  3L2Q A;  3VYR B;  3GTJ J;  2E1M C;  5FRN A;  4KT6 A;  2L7F P;  4RS8 A;  4C30 A;  2PEX A;  3OSF A;  4XKW A;  1FLI A;  2JUC A;  5E3N A;  3IKV A;  3CJR B;  2IVM A;  2KIS A;  3OR1 C;  2W24 A;  3MKW B;  2ESN A;  1REP C;  4F7Z A;  2KHM A;  3BR6 A;  1RUN A;  1SD7 A;  2K9L A;  3AL0 B;  2F5C A;  5DYM A;  4B43 A;  2R92 J;  1JI8 A;  3GF2 A;  4EAT A;  2BY3 A;  2BY0 A;  3ONQ A;  1RKT A;  1T56 A;  2DA3 A;  1PVE A;  3GLL A;  2EQR A;  2K4B A;  1S7E A;  5LGN A;  3D1N I;  2CV1 A;  5D5V B;  1W0U A;  4KFC A;  5BMZ A;  2FEZ A;  4KIF A;  4ZH4 F;  2FSW A;  3S3M A;  3H9G A;  4OAZ A;  1HSJ A;  2NVT J;  4BJ5 C;  5GAE J;  2M34 A;  1XX5 A;  2MAB A;  3M8J A;  2DMQ A;  5CVI A;  3LQQ A;  3F21 A;  2HS5 A;  2O0Y A;  1LDJ A;  2HVR A;  3FM3 A;  3H0G J;  2A6E F;  4EGY A;  4XL9 A;  1MMN A;  1R1V A;  3PL8 A;  4D9J A;  5IP6 A;  4CCK A;  1X4O A;  1KU2 A;  3MMY B;  2WWY A;  2ID6 A;  2JRT A;  4XRS A;  3GW2 A;  5E8G A;  3CO6 C;  5HS7 A;  5TRD A;  2QA4 I;  2V4J C;  2E36 A;  3I58 A;  1V5F A;  3IKT A;  2QSH X;  2UXN A;  4E7J A;  2CG4 A;  3GWZ A;  4KUM A;  4RAG A;  1MMA A;  3KYD B;  4DBQ A;  3KE2 A;  3IRQ A;  5D8L B;  3VSK A;  4X1E A;  2Z5U A;  3K0L A;  3T8R A;  4ESB A;  4CZC A;  1F4K A;  4BXX J;  2HZD A;  2CUJ A;  2F4M B;  4NB5 A;  4A3E J;  4P9F A;  5LBQ A;  2ZCW A;  5E1Z B;  5F64 A;  1PUE E;  1WRJ A;  1H9T A;  3S16 J;  1JXS A;  4KN4 X;  4B09 A;  3V7R A;  1XSD A;  2V1D A;  1BC7 C;  2MW8 A;  2NXN B;  5L3B A;  2EIN H;  4WK8 F;  2X85 A;  4PJM A;  4U7D A;  1TNS A;  2P0W A;  1WI9 A;  2GWR A;  2IGK A;  4UVB A;  3WTX C;  3KIO A;  5J4Y A;  3IH3 A;  4FET A;  5DTD A;  2FBI A;  4PJN A;  2DU9 A;  3IH2 A;  3BQZ A;  4WXH A;  1R6R A;  1ZR4 A;  4DZP A;  4WXC A;  3RSN A;  2M0M A;  4M6Y A;  3E6M A;  2QQ9 A;  4IZZ A;  4C2M J;  2M4G A;  1LVA A;  2DK5 A;  2NS0 A;  4MGR A;  4DYC A;  2NOJ B;  3DEU A;  3MN2 A;  5F1J A;  5JR3 A;  3I53 A;  3BY6 A;  2XF5 A;  3DF8 A;  5E20 A;  2L3D A;  2DFF A;  4X6A J;  1H89 C;  4R79 A;  2XAS A;  1K6Y A;  4I09 A;  1JT6 A;  1LDK B;  3MFK A;  1TBX A;  2QEX I;  3P9C A;  4F91 B;  1P2F A;  3RPU A;  4XN3 A;  4IOC F;  2ZSH B;  4M3F A;  1TNT A;  1USS A;  3NWS A;  3J80 Z;  4UVC A;  5K7F A;  3CP2 A;  4I02 A;  2LY2 A;  5DCM A;  5H2F C;  2FNP A;  3GYH X;  4JBA A;  3WTY C;  1Z67 A;  2KFD A;  3LNQ A;  1P4W A;  3V7S A;  1J0R A;  4TV7 A;  2QQ8 A;  2Z2S B;  1FX7 A;  4U87 A;  3SQN A;  3DPT A;  4FE4 A;  4HA8 A;  1H8A C;  2F5E A;  2EFQ A;  4R1H A;  4XOT A;  5E8I A;  2DMP A;  3ZQ7 A;  1S72 I;  2GM4 A;  5ILV A;  1PYV A;  3LA3 A;  4P96 A;  4QIW N;  3TOA A;  5ICC A;  1OQY A;  1KGS A;  2ZME A;  5LHI A;  1ON1 A;  1HW1 A;  1I39 A;  1OYY A;  1VQ7 I;  1QZY A;  4XRM A;  1U2W A;  4HF0 A;  2LC2 A;  4RM3 A;  4XSZ F;  2ECB A;  4Y4R A;  1YTY A;  1O7F A;  2E5Z A;  5IPA A;  2DYR H;  1JHF A;  1HQC A;  2QM3 A;  3V42 A;  2GOM A;  1W1W E;  4FQG A;  4GFB A;  1X19 A;  2EIL H;  1UB9 A;  2XRL A;  1VQ4 I;  3GZ6 A;  2IBD A;  1OR7 A;  1XGS A;  2XB0 X;  5FKN A;  1OPC A;  2FOK A;  1IC8 A;  2DTZ A;  2QKL B;  4OMZ A;  1IN8 A;  3OIO A;  3I64 A;  4C3I J;  2O61 A;  2GIV A;  3QAH A;  1FBQ A;  3MZH A;  3I56 I;  4GO1 A;  3N05 A;  2W82 A;  2LY9 A;  1SFU A;  3J7A O;  3OL4 A;  2IA1 A;  2P6S A;  2HPI A;  4BJ6 C;  4MEX F;  2EZL A;  2DFH A;  5IOY A;  4YII A;  2DI3 A;  5J3L A;  3LST A;  2G7U A;  1KQ0 A;  2HDW A;  3X2Q H;  3CMA I;  5JFR A;  3SXY A;  2C6Y A;  4LFU A;  2FQ4 A;  4N4N B;  2EJR A;  1K61 A;  1JKR C;  2NVX J;  2MA3 A;  2XKP A;  3F8B A;  4G6Q A;  5DUI A;  1BR4 A;  1JHH A;  4UXN A;  5DS9 A;  5TGT A;  1NH3 A;  2PMZ N;  3CCE I;  3OYK A;  4A3D J;  3LSK A;  2I8D A;  3I5U A;  1B9N A;  3DU5 A;  1LUJ B;  5HS9 A;  2VKV A;  3WTT C;  4B4C A;  2QBY A;  1TQP A;  1FP1 D;  3NRV A;  1J9I A;  5K5R A;  2VPR A;  5DCM B;  3TDZ C;  3B73 A;  2JSC A;  1UHS A;  4R8H A;  5GAD J;  4BQN A;  3G1O A;  1QU3 A;  4CYC A;  5K5O A;  1SC7 A;  3E5X A;  4ZDO A;  2X6Y A;  5KNL A;  2BVL A;  2JA7 J;  3VWB A;  3ZOB A;  1MDM A;  2IGN A;  4P55 A;  3S1R J;  3CLQ A;  2R3S A;  5A2Q Z;  3COA C;  1YG2 A;  3TO6 A;  5L3G A;  2ZME B;  1RR8 C;  2IW5 A;  3NAU A;  4NUB A;  2VBW A;  1T0F C;  1QBJ A;  1SD4 A;  4M9Z A;  4PSX A;  2ETH A;  2XB5 A;  4PDK A;  3AG3 H;  3G6E I;  2HTS A;  2VQG A;  2VC1 A;  3CUO A;  4L0Y B;  2Q1Z B;  3R61 A;  2GXA A;  1LDD A;  2CW8 A;  4A0Y A;  3HRS A;  2EPF A;  4FAS D;  1WZ2 A;  4RGR A;  2CH0 A;  1TC3 C;  2WAE A;  3W6J B;  3A01 A;  2VT2 A;  2W1O A;  4CYD A;  1XG1 A;  2IGO A;  2E19 A;  1X1C A;  4RLF A;  4I99 C;  4E7S A;  3QPS A;  1HC8 A;  4N0B A;  3ZMS A;  3QOE A;  2E1C A;  3CCY A;  2IS4 A;  3K4L A;  3PO2 J;  2NS8 A;  2KLO A;  5IYD J;  1GV2 A;  5HS8 A;  1R4M B;  5LGU A;  3W2A A;  2H6B A;  5HDG A;  1LE8 A;  4OOI A;  1BR2 A;  3Q0U A;  3TKY A;  5F0C A;  3U9G A;  3OMY A;  2GA1 A;  4MNU A;  1MBF A;  1D8K A;  1ZAR A;  3JTH A;  4DW6 A;  2CS3 A;  3FHZ A;  1AKH A;  3K4N A;  3A03 A;  1XS9 A;  3H36 A;  3F22 A;  4IHX A;  1IO2 A;  3HB9 A;  5HNF A;  2RC4 A;  2KT0 A;  2DOE A;  3KZI C;  2JPB A;  2XPU A;  3BG6 A;  2VJI A;  1T6S A;  1WJF A;  3DEW A;  3PM1 A;  3PO3 J;  2J5O A;  3H3Z A;  4DYQ A;  1D3Y A;  4UB8 C;  4CYC B;  5K1Y A;  2RNJ A;  3WHC A;  2HDD A;  2R7O A;  1Z0X A;  2VL8 A;  2V1X A;  4GGG A;  2X6O A;  1MDM B;  2XF6 A;  2LF7 A;  2XIG A;  1ZG3 A;  3OYB A;  2F4I A;  5IT3 A;  2MD5 A;  4U0Y A;  1MBJ A;  1O7L A;  2RAE A;  3HTU A;  5GPC A;  2RGV A;  1G4D A;  5D5U B;  4YIR X;  3S8P A;  1R49 A;  1UG0 A;  3LAP A;  1B72 A;  2BY2 A;  3GTO J;  1N77 A;  1YX3 A;  3K1P A;  3KEQ A;  3ZN0 A;  4JK1 X;  1T8I A;  3RKY A;  2DOD A;  4A3I J;  1W36 D;  2M8E A;  2EBI A;  2B63 J;  3I4P A;  1Y0N A;  2K4J A;  3L09 A;  3GTM J;  5GTI C;  3ABM H;  3CJT B;  3O3K A;  3A01 B;  3OS1 A;  2MG4 A;  2B9S A;  2AQE A;  1U5T C;  5H6R A;  2L7K A;  3VYS B;  3ZPL A;  3HBL A;  1OYI A;  3TGN A;  4F93 B;  1QPI A;  4HG2 A;  3H9J A;  4A3F J;  1TW3 A;  3BZC A;  3FIW A;  4M72 A;  3BG7 A;  2WAQ A;  4OIP F;  2A07 F;  1WI3 A;  4IRI A;  5IY5 H;  2VQC A;  1P7I A;  1ORK A;  2PMH A;  2XAF A;  2YSR A;  1G3S A;  4IHV A;  1FEX A;  2WB1 A;  3CF2 A;  1UMQ A;  3WTV C;  5D4S A;  1LE8 B;  3F72 A;  3HUG A;  2LBF A;  2X0L A;  2W57 A;  4P1W A;  3CCU I;  1J59 A;  3CUQ C;  2VOP A;  3JRE A;  1LJ9 A;  3RJP A;  2Y9Z A;  2IPQ X;  3BJ6 A;  2OZU A;  1LVK A;  4K2E A;  3HKZ N;  3H35 A;  2LG4 A;  5E3M A;  1AKH B;  2LF8 A;  3GXO A;  4OIN F;  2M3A A;  2LVS A;  3ZQI A;  3ECO A;  3GVA A;  1TWG J;  1YW7 A;  2ELJ A;  1FPQ A;  2JJ7 A;  3ABU A;  4CCL A;  1EV7 A;  4LK1 F;  2CQN A;  2LKX A;  3GTP J;  2AS5 F;  2PQ8 A;  2CO5 A;  3G4S I;  3L9F A;  1TT5 B;  1U0J A;  1E0E A;  2MLK A;  2F48 A;  4H0E A;  3HOZ J;  2H8W A;  1X2N A;  4EJV A;  2BVM A;  2Q2E A;  3CES A;  2HKO A;  3QU3 A;  1KQ8 A;  3QRF F;  4U0W A;  3K70 D;  1W5T A;  1KON A;  4L9T A;  2FXA A;  3ROU A;  3H5R A;  4XLN F;  1QO0 D;  5ICF A;  2EIK H;  4NC6 A;  3W2W A;  3BR0 A;  4EM2 A;  2A69 F;  4X0G A;  1FTZ A;  3HYI A;  2FMY A;  2MC3 A;  2HYG D;  1B72 B;  3FHN A;  2OTJ I;  3RKQ A;  2DXI A;  1ZQ3 P;  2R7S A;  1DPR A;  1UEL B;  1T08 B;  1OCP A;  3ZP5 A;  5DV5 A;  3WG9 A;  3MD2 A;  3NAR A;  4CDG A;  3BTJ A;  2TCT A;  1LFB A;  4ZYA A;  4M71 A;  1B59 A;  3E3V A;  1R5I D;  2E1M B;  1MJB A;  5ICE A;  1IG7 A;  2DTR A;  4BKX A;  1YX5 A;  4EM0 B;  4BE1 A;  3FF5 A;  3ISP A;  4RGX A;  3VSL A;  1UHW A;  3LFK A;  2HVS A;  4UUV A;  1W4M A;  4WXD A;  3DBR B;  1R00 A;  3K7A J;  4PFO A;  1XGM A;  4ZZL A;  2KDO A;  2K9S A;  2WTE A;  1I27 A;  4IVN A;  2DOA A;  4IL6 C;  4RAY A;  3TO9 A;  1HOM A;  1BI3 A;  1IW7 F;  3K4M A;  2XPV A;  3ABL H;  3L2U A;  2IA2 A;  3HTS B;  4PJ0 C;  2ELH A;  2O03 A;  4HST A;  5J1R A;  5E17 F;  3L2C A;  1N25 A;  2FOW A;  4EGZ A;  3HUG B;  4D5F A;  4ON0 A;  2VKE A;  2XAJ A;  3SZT A;  1MH3 A;  4IHY A;  3TBI A;  1P92 A;  1IUF A;  2QYO A;  4RAZ A;  5LLQ A;  4BU2 A;  5C4J J;  1H0M A;  1LQ1 A;  2R7F A;  4ZC3 A;  4CGZ A;  4MEY F;  2H6C A;  2LSO A;  2X48 A;  4HYE A;  1ODD A;  1N75 A;  2ZXI A;  2XF7 A;  2OBP A;  4IF4 A;  2HNH A;  1LEB A;  2KRC A;  4P9U A;  1YS7 A;  3DWL E;  1I3A A;  3UR3 C;  3SJM A;  2I10 A;  4LD5 A;  2O8K A;  1BJA A;  1P7J A;  2Y48 A;  2Q8K A;  3ZQC A;  2V1N A;  2UZK A;  1Y1W J;  3FXM A;  1TQI A;  4XMY A;  1PDN C;  2JPC A;  1MJ9 A;  4IEJ A;  3C3W A;  4HF2 A;  2QGU A;  2BW3 A;  3OYG A;  5FRM A;  3D5R C;  3K1N A;  2CQ7 A;  3GCM A;  5DEQ A;  1IV8 A;  4E70 A;  1L0O C;  3R6S A;  1JE8 A;  5IYC J;  2CMP A;  2Q2E B;  3VOE A;  4XNF A;  3CLO A;  4RLQ A;  2CU7 A;  2DN0 A;  1O3R A;  5L3E A;  1IRX A;  5F0F A;  3HSE A;  4E7L A;  1MND A;  2FU4 A;  1SMT A;  2FNA A;  4GYI A;  3GTQ J;  1ETQ A;  1LPQ A;  2WAF A;  2Y9Y A; 
#chains in the Genus database with same CATH homology
 2QSH X;  2F4O B;  1PVE A;  2QSF X;  2QSG X;  1X3W B;  1TP4 A;  4YIR X;  2F4M B;  1OQY A;  3ESW B;  1X3Z B;  1QZE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...