3ESWB

Complex of yeast pngase with glcnac2-iac.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
SIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 19
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 3eswB00
1OQYA 4YIRX 1PVEA 2F4OB 1X3ZB 1QZEA 1X3WB 2QSFX 2QSHX 2F4MB 2QSGX 1TP4A 3ESWB
chains in the Genus database with same CATH superfamily
5F0HA 3P7NA 4WK8F 3IWZA 4F7ZA 2FMYA 3CJQB 2NVYJ 4TV7A 3CCVI 3ABLH 2HQRA 2V6EA 2M7BA 2DMTA 3GUDA 3IUOA 1WJ5A 1CF7A 3PFYA 4L5EA 5FKNA 1ZLKA 3KLOA 4JYKA 3BR2A 1VZ0A 4UNOA 4AVPA 4A12A 4J00A 2LF7A 3ABTA 2HQNA 1SD6A 3S15J 1IDZA 1U8BA 2YUSA 3WTTC 1FPQA 5LRSA 5LFAA 3OYDA 2CMPA 2LH9A 3H3ZA 3QOEA 4LLGF 3ZQGA 1Y1WJ 1EH8A 3KETA 5E3LA 4FASD 2AS5F 1G3YA 2M3AA 2FNPA 1XX5A 4IKFA 1X3WB 1Z3XA 2RGVA 4A5MA 2ACJA 3BWGA 3TKYA 3S2WA 4ANJA 3FK7A 2VXDA 3E97A 1K6OA 5BOXA 4IRHA 4F55A 2OBPA 4A3JJ 3HHHA 2QGUA 1SVLA 3E5QA 1Y0NA 2J5PA 3EUHC 4BXUA 2STTA 4G6DA 2XRLA 1FYLA 2MFZA 2K86A 3TP0A 4UY8I 4P96A 1I6HJ 3E6MA 4A3FJ 4H0EA 3M8JA 2OD5A 2DMPA 3SEZA 4CCOA 1QU3A 2CRGA 1T56A 2ECBA 4A3BJ 3K69A 3GF2A 4E7KA 1ETWA 1D0ZA 2LF8A 2QZ8A 2A3SA 2V9PA 2VC1A 1MDMA 1Z91A 2R93J 4IL6C 1T38A 2VB6A 1R5ID 1Y0UA 2K5CA 5KCMA 1EV7A 4EJVA 2K3FA 3OOPA 2EFWA 2Q8KA 2FD5A 1JGSA 2LBFB 3K70D 2JPCA 3F8CA 4UV8A 3SZPA 2EFOA 4D7NA 2PQ8A 2HDWA 5M5YJ 4ESJA 3MKZA 1E3HA 2GAUA 4FE4A 5AIPA 3D5LA 1TNSA 1WJCA 4HF0A 2HFHA 1G8XA 1JUMA 3I58A 3OS2A 3SHFA 2EINH 2F5FA 2BZTA 2V26A 4X6AJ 5GTHC 2VPRA 4G94A 4MLOA 2EB7A 2L02A 4EJUA 1JKQC 3QRFF 1G59A 3UR3C 1ZARA 3PSIA 3WGIA 2CQ7A 3LSRA 1K4TA 1IUFA 2ZMEA 5GAGJ 1VQPI 2LREA 3N4MA 1WJAA 4HAMA 4YRVA 1I3AA 2CW0F 4BJ6C 2A68F 2H94A 2STWA 2DO7A 2JPBA 1RESA 3M8EA 5CVJA 2LKSA 5FKKA 4ZTFA 4IQJA 4XONA 1SAXA 2MGQA 2L7MP 2R4GA 3FK6A 4OMZA 3F8NA 2Y0SA 3DWLE 2E5NA 2ZBKA 4ZDOA 2FBHA 3MQ0A 3TL4X 3F6OA 1MGTA 1U2WA 1W0UA 3EYYA 1WZ2A 9ANTA 3KX2A 4G7HF 5DCMA 1ZREA 1MNEA 2QVOA 3C2GA 4BDYA 1TWHJ 1P4WA 2DMUA 3ASOH 2EZKA 1BR2A 2G0EA 2ZXIA 3S14J 2NNNA 2OC6A 2F48A 3CJTB 5L3FA 2CQQA 2KL4A 2NRAC 1FOKA 3DTEA 3IHUA 1R22A 2XROA 3PNTA 5IOYA 2HYGD 5H6RA 2MW8A 3A03A 4P9FA 4YEJA 3R60A 3CCLI 1X1CA 2PMUA 1OCZH 3AG2H 2VKHA 2AQFA 3OV8A 1V5GA 3ZN1A 4S04A 5EGOA 2DA1A 4G12A 1Z0XA 4M9XA 5IT3A 3I64A 2Y30A 1HQCA 1FEXA 1K61A 1R58A 2WC2A 4V2GA 5IYDJ 3BQYA 3BZCA 2XPVA 4ZYEA 1ZLJA 1IV8A 4B4CA 1OCPA 2PI0A 4A93J 4GO1A 1ZKGA 2KJBA 3EPZA 1NHAA 3QPTA 2R5YB 2EH3A 3VEPA 2DA5A 2WWYA 1KU7A 4JX4A 3RKWA 2ZJPF 3JCUC 3DPLC 2V1UA 1J09A 2QM3A 1S9HA 1J5YA 2DN0A 2OUMA 2X85A 1IDYA 4E7HA 3EUAA 3G73A 1FLIA 4LB5A 1U5TB 3KP3A 4HX7A 1IO2A 4P5OA 4HF1A 1XN7A 4G6QA 5DDGA 1MSFC 2K40A 4I7HA 2YX7A 3VSKA 1BJZA 2CW7A 5A2QZ 3S1QJ 2VJ5A 2X9DA 2UXXA 1TTYA 3ZQCA 4XL9A 5CJ9A 4KICA 1XSXA 5CVUA 1ETOA 3LSHA 4O5VA 5F6FA 2JRTA 3LA7A 3HOTA 3QWLA 2HNHA 1Z6TA 3DFGA 3BOQA 4EEFG 2O5RA 1TT5B 3KZYA 5ICCA 2VJJA 3EYIA 2ISYA 1FBUA 3BZKA 2V1NA 1T2KA 1AKHB 2NVQJ 1ODDA 5KHDA 3DKWA 1UG0A 5DUKA 2XGEA 2DW4A 3FHNA 3JRDA 3VODA 1O4XA 2M9HA 4A3KJ 1REPC 1VQ7I 2L9SA 1FIPA 1OFCX 3HUGA 1W7PB 3TOBA 2Z1DA 3HPGA 4A3GJ 3HM5A 2W84A 1F4KA 3DF8A 3JRFA 2P8TA 4A3IJ 1BW6A 3H0DA 3BTIA 2E2JJ 4YFXF 4Y4RA 3RZDJ 2CV1A 3ABUA 1W4MA 3K1NA 4CYDA 1Y39A 3OYHA 2LSOA 2BVLA 1P6RA 2XKOA 2CO5A 2O8XA 4PJNA 3ZCOA 2L4MA 3HKZN 2X0LA 2GQQA 3ECHA 3CMYA 1LJ9A 4LMYA 3OYIA 3RKQA 4RAZA 2IGKA 5D5WB 1U8RA 1ZAOA 2B7EA 3BDDA 2BE5F 2LKXA 1RZ4A 1T08B 3KZZA 4MTEA 4QSHA 4EM0B 4YIIA 1GV2A 3G1OA 5GP9A 3F23A 2O3FA 4RB0A 4MEXF 4BE1A 2B9SA 1JGGA 3VYUB 4IRGA 1LPQA 2TDXA 3ZMVA 2XHKA 4XBFA 2M30A 4PK4A 1D1BA 4YFNF 2FE3A 3F8MA 1ZH5A 1VQ5I 1XC5A 2RDPA 3J81Z 3F22A 2KT0A 1BC7C 1B4AA 3S1RJ 1QPIA 1JKPC 3I71A 2WA0A 4XICA 4BYYA 3HSEA 3IL2A 2H27A 3L00A 1UHMA 2DK5A 3SFIA 3E6DA 1MMNA 2HVRA 2MABA 1D3YA 4LK1F 4XIDA 1YFHA 1RI7A 4XQFA 2E5ZA 3DPTA 3SQNA 4UUTA 3LA2A 4CXFA 3L9FA 3I56I 5FLXZ 2LK2A 2H1KA 3M9AA 3MEXA 4Y33A 2IA0A 4Q48A 2V79A 1T0FA 1DQUA 2DPUA 5J8FA 3OYNA 5EJCA 2KHMA 3CTAA 1RNLA 3T8RA 3HKZA 5FB2A 4F93B 2UV1A 2MA3A 4XN3A 4YIFA 4EGZA 1X4PA 2KQRA 5F0CA 1MIJA 4G9YA 3J80Z 2NNYA 5J6XA 4A0XA 1DU6A 1D0YA 1WKMA 2PX9A 4I98B 4OIPF 3DBRB 2ZO4A 1Q1VA 2FXAA 3G71I 4ZYGA 1KONA 3LSJA 5D5VB 1A36A 3VYSB 1H8AC 2PG4A 1X1PA 1ETXA 2K9QA 2WAQN 2NVTJ 2R5ZA 4UV9A 4HYEA 1OYYA 3IAS2 1IJWC 1FYMA 2QBYB 2CQNA 4II2A 5B1BH 4BXFA 4BS9A 2EV5A 5CQEA 2QENA 4C2MJ 1FC3A 3CUQC 1E2XA 4E7SA 2ME0A 2L2OA 1T33A 1LKXA 1ZHFA 3WHCA 3JAMK 1ZGJA 3PO2J 3I9V2 3BTJA 5GPCA 1DGRM 3QODA 3CF5F 4M3FA 1WSUA 3WE3A 3SYTA 4RM3A 2GBYA 2HXOA 2L54A 2JTVA 1W5SA 4CYCB 2GXBA 2VJ4A 5FGMA 2P7CB 2DDAA 2IEKA 5DD8A 1HC8A 4M3DA 3V8JA 2FOWA 4D5CA 1PUFA 1KU2A 5DEQA 2EIKH 3RIRA 4EJTA 2FNAA 1G3WA 5JLXA 5KAIC 1HSJA 3ERED 3CMMA 3TP3A 2D2WA 1BOBA 1Z7LA 4JOMA 5CVRA 1MBJA 1KYZA 2JRMA 3Q9VA 1YE9A 4XKCA 4CA0A 2V1XA 1O57A 1B6AA 4AD9A 3FX3A 4ZYAA 2ZJRF 3GMEA 3HC7A 1LFBA 3WE2A 1WJEA 4AU7A 3I55I 4LB6B 3KE2A 2IVMA 2MH9A 2M34A 1ON2A 3RQ4A 1AA7A 1LE8A 2XRNA 3QOPA 5LGUA 4ZTJA 2LOOA 4HF2A 1L0OC 1EKEA 2VUMJ 1HDPA 1OR7A 2L3DA 4JK1X 2X6WA 4HW0A 3CP8A 3HOVJ 1LVKA 4ENJA 2X6XA 2KPMA 3ZMZA 3IKVA 3BP8A 3GCMA 5H2FC 3P9KA 2IA2A 5E3OA 3U1KA 2JWTA 2O03A 1I1SA 2QA4I 1K78A 4YIRX 1IN7A 1ENHA 4RM2A 2CUEA 4XMYA 2OU2A 3VYRB 2E19A 1U5TC 2MSYA 5K7HA 3LSIA 1VQKI 1K6YA 2DMNA 3LSTA 4IJAA 4UVAA 4XLAA 4KT6A 3U2RA 4N0BA 2VKEA 5TRDA 1MDMB 1TZLA 2EJRA 3RPUD 3LNQA 3GZ6A 2E1NA 4CH7A 1R9TJ 2RV8A 2A6TA 1IG7A 4IOCF 2F5VA 1VFCA 2E1MC 2MC4A 1UZCA 2M4KA 3JRAA 3IH2A 2HS5A 4XSXF 3NARA 3S3MA 3K1MA 1SVMA 2M1BA 5LBQA 1W7PD 1LEAA 5EEGA 3CC4I 2Y48A 3HYIA 1OCOH 4FX4A 3K0LA 1MH3A 3WG7H 2W48A 4DGWB 3MN2A 5FKLA 3HSFA 4IPAA 4FE7A 1IN6A 3TO7A 2ZSHB 2OJED 4OU0A 1FTTA 2CUJA 1D0XA 1S72I 2EILH 2DJIA 1E17A 5D5XB 3FXKA 3PNVA 3FXMA 5DCFA 2E7WA 3U21A 2O61A 3R6SA 3PNYA 4BH9A 2DPDA 4LK0F 1WI3A 5IP9J 4PJMA 1IRXA 2LG4A 4KIFA 3MD2A 1YYVA 3UNGC 1I27A 1YX3A 2EFQA 4D0PA 2DMQA 3BG3A 4HV5A 5E8IA 3BZ6A 3K4NA 4W97A 3NQOA 2PMZA 4LLNA 4RGSA 3GX4X 3F72A 4CCLA 3V8LA 2P7VB 4MHGA 4RMNA 1RPWA 2DU9A 2EWNA 4L9TA 2M2EA 2XGXA 3H9GA 1WJFA 4WCGA 3OYBA 1SEUA 4A0YA 1B72B 2JUGA 2Z2SB 1D5VA 3FBNB 4BHPA 2M87A 5D6EA 4NBQA 2R7OA 4L5JA 3CCYA 3D5RC 2M0CA 1Z1DA 4Y17A 3HL2A 1AU7A 5IOZA 2KMUA 5LHGA 2LP0A 2R7SA 3CCQI 2VPLA 1V55H 4CCKA 4B47A 3E7LA 2IXSA 3T0YA 2ESNA 2A61A 2ID6A 2GA1A 3E5UA 3JTHA 4KJZA 1MJAA 5FFZA 1QVTA 2WB1N 3ASNH 1UAAA 3LQQA 1V54H 1YHQI 2WY8Q 5LD2C 4EJOA 4U0YA 4U87A 4EM2A 2LLKA 4CUGA 4HSTA 4PZJA 2QF7A 2HU9A 3BROA 2YU9J 5E20A 1NG7A 2MG4A 3CQZJ 2KRFA 3QYEA 1ERDA 4FTHA 5EF6A 5FFXA 1LVAA 1BIAA 2VL8A 4ITVA 2DTZA 3I4PA 3E0JB 1HOMA 2VT3A 3WTVC 4PUSA 5LRRA 4GFBA 2F5EA 4AM3A 3F6VA 2QUFA 4C2TA 1PYVA 3H3VK 5ICFA 2QQBA 1VTNC 3BCAA 2KRCA 3KYLA 4ENKA 3A4CA 4HG2A 3GTMJ 1R1TA 2K27A 2E36A 3S3OA 1O3SA 5HS8A 4HX4A 3SZTA 4RGUA 3BG7A 4XRMA 2A5YB 2BHZA 2ECCA 3R0AA 4GRIA 3PM1A 2ZNYA 5FD6A 3FHZA 3K10A 3LOCA 1FMVA 1VQ4I 1MH4A 2EZIA 1UFMA 3TO9A 4RLFA 1I1GA 4E70A 4LG0A 4ZYHA 5CLSA 2F5DA 2H6BA 1FSHA 2ZXWH 4UVCA 2A69F 3WGHA 1S7EA 3HDDA 3KEOA 5EDNA 1QHHD 3BTLA 1UJ8A 2QQAA 2K85A 2AQEA 1VNDA 2WB1A 2GWRA 5HNFA 1D8JA 3BG9A 2GXGA 2M4GA 1DUXC 1MMAA 5DM7F 2KJCA 3DTKA 3J7YJ 1G3SA 2XSJC 1MKMA 3BR6A 3S17J 2BV6A 4ZDPA 3AG1H 1TQIA 2PLYA 3BJ6A 1U78A 2HTJA 5CVIA 4DBQA 1I6XA 4ZC3A 5KAFC 1F43A 4JQFA 4L5IA 5IT9K 1R36A 2KIUA 2DA2A 1HW2A 3EUHA 3MKWB 3PL8A 1BI0A 2I5UA 1VQMI 4KISA 1ZTRA 3GW2A 2BW3A 4LFUA 3WTSC 2NYXA 4U7BA 4E7ZA 1IN8A 5K7ZA 3MFKA 1O7LA 3A02A 2YU3A 2VASA 2A05A 4GCVA 4RB3C 3FXUA 2EA2A 4ESBA 3JSPA 1X4OA 3RI4A 1GT0C 4YELA 1PVEA 5JFRA 4BE2A 1E0EA 4AIHA 4I99C 5FKMA 4AVZA 2JJ7A 1KA8A 2RAEA 2VN2A 1LDJA 2FUG2 4N4NB 2Y0SN 4RLQA 2IP2A 3A2KA 1OCCH 2XF7A 2RNJA 1KZHA 5BPDA 1J7KA 2GOMA 4HLXA 2VKVA 4BACA 1PP8F 3BR5A 3HOSA 3CCUI 1AWCA 3S93A 4OIOF 4S0HB 3F8FA 3K7AJ 4MO7A 1UHWA 5J40A 3MZYA 4AIJA 2A5WA 3HOZJ 2XAGA 3BC8A 3OR1C 3DKXA 3E6CC 3DKYA 3Q9SA 2XAHA 5F1JA 4IHVA 1H9TA 3CDIA 2MLGA 2IBDA 1YJWI 1IZ1A 4NDLA 5E17F 4UUVA 2A6EF 3HBLA 3ONQA 4DYCA 2Y9YA 4NQWA 2IJLA 1Z77A 3OYAA 3GTGJ 4MGRA 3I59B 3K70C 2Q0OA 3IWFA 1N77A 1G6NA 3H3UA 2CQXA 4RBOA 2EIJH 3A01A 4RGRA 1SD4A 2O9LA 2QSFX 1FIAA 5BS6A 2DOFA 1JTXA 2XIGA 5F04A 2L5QA 3ZGKA 3W2WA 2OF7A 3LMMA 1MSEC 4HZFA 1XGMA 5BPIA 3OY9A 4KIGA 2HR3A 3NWTA 2V9KA 3F0CA 4V2FA 4IHWA 4IHXA 2E71A 2KISA 1P7IA 3ZMTA 2KIQA 4AWXB 2ZXJA 5GADJ 1T8IA 4KNYA 2JA2A 2VLAA 1OJLA 4L9JA 1GVJA 2L7FP 3K4JA 2QSGX 3HOUJ 2KDZA 4BJTA 3CC7I 5FJ8J 2ZFWA 3IV5A 2KZVA 1M1EB 1YW9A 2AXLA 2ZKZA 2D45A 2EV6A 2JUCA 1BI2A 5FRNA 4IHSA 1MD0A 1JJ8C 5L3DA 2F2EA 2GA2A 1BIBA 3I0TA 3AL0B 3H9QA 1MMDA 2L4AA 1N75A 3ULQB 1R4NB 5L3GA 3KYDB 3M1EA 3TMOA 1B8IB 3F21A 1BL0A 5HDGA 4KA4A 5CQGA 5M3FJ 1TQMA 3OSGA 3K4MA 4RB2C 3JAMZ 4XSZF 4DJAA 2P6SA 3QYFA 2CUFA 3RTRA 4DQ2A 1XS9A 1XDSA 4UVBA 5IP6A 5CKTA 1R5GA 4N9HA 1PP7U 2R0QC 5CPRB 4CCJA 2K7LA 1ZQ3P 2HDCA 1ZN2A 2CFXA 1WVRA 2IS2A 2XAJA 4CZZA 5AONA 2XKPA 2XB5A 3GTQJ 4HPQA 5F1RA 2DDBA 3P5JA 2ZNZA 2BY3A 2L9VA 3PQKA 1QQIA 4EQQA 2LY1A 2Z99A 1MBFA 1LNWA 3ZQIA 4YG2F 2Q2EB 4BL0B 5EG0B 5C4JJ 4UUSB 5EZGA 2BY0A 1UCRA 2MYSA 5DV5A 4HDUA 1SFUA 4ENNA 4MNUA 2M0MA 1QZZA 3RQIA 4BHBA 3RKXA 2V7FA 4ESFA 5ICGA 4F91B 1RKWA 3EQLF 2QYOA 4BQAA 2HVQA 4LD5A 3C2BA 2E60A 2HKOA 2VE8A 2K4JA 1A6IA 4UB8C 4O3MA 3GLXA 1BW5A 4J19A 2EIMH 2HTSA 5IY5H 2KP6A 3CMAI 4WF2A 1SD5A 3MCZA 3BJOA 4DW6A 1YO5C 2BY2A 1VQOI 3M07A 5DD4A 3V4GA 3FWEA 3DXJF 4M72A 1TQPA 4XRSG 2CV0A 4C3HJ 5JHFA 1HBXG 2DJNA 4HSRA 3GXOA 5J1YA 1U9OA 2M8EA 1EF4A 4DYRA 2FMLA 1VF9A 5EEHA 2MH2A 1V4RA 4I01A 5LHIA 4B1RA 3CCMI 3HOYJ 4BEHB 4IQ4A 2LTPA 4H4KC 3G1MA 3M1CA 3KP5A 1XGSA 3FZVA 3WG9A 1APLC 2NVXJ 5E79C 2CGPA 4A5NA 4KIBA 3HJEA 5IPAA 4HDVA 1OQYA 3GFMA 2H8RA 2FEZA 3ISPA 3DU6A 2A07F 1DDNA 2BYVE 3FKJA 5J1UA 2KIFA 2FA5A 2P6TA 3OL3A 4G7ZF 2R7DA 1GHCA 3R0JA 1C0WA 1FX7A 2GZWA 3CDLA 1ACIA 4XLCA 3ZQFA 3ZP5A 1O7FA 3J7ZI 3CESA 1IXCA 3HRSA 4PSWA 1U0JA 1WFXA 4XLEA 2VBWA 3GVAA 4DNCA 5D5UB 3DEUA 3KP2A 1W5TA 4W1UA 2AHQA 2GIZA 1R1UA 2DYSH 4BJ5C 4C3IJ 3B6AA 1TWGJ 2ZCWA 1YW7A 5DYMA 1V5FA 3OIQA 2IS4A 2HPIA 1NTCA 2OPTA 4PCQA 1UB9A 5E3NA 3K4KA 5TJJA 2N8GA 2VQLA 4M71A 1P9QC 1WI9A 4QPOA 1RR7A 3X2QH 5FRMA 1UG2A 3Q0WA 3AG4H 4I0BA 2DXIA 1IXSB 3ZRGA 2DFIA 3M7GA 4XLPF 2QSHX 5LLQA 3CLQA 2LBFA 3QPSA 4XKBA 2G7HA 3G3ZA 2ETHA 1MZBA 4PDKA 4D1QA 3KP6A 1LDDA 4FX0A 3FXLA 1NK3P 3ERMA 2HQ5A 2BXYA 3ZN0A 5ILUA 3V7SA 1V5EA 3ZQQA 2DT6A 1K4SA 2O0YA 4XLHA 1WJBA 2O6GE 2DBBA 4XK4A 2YR2A 3FKIJ 1TWAJ 1CQTA 2EQRA 3OOUA 1TNTA 2OA4A 3VWBA 3PUBA 4B09A 3OWTA 2TCTA 3CCEI 5E8GA 2LR8A 2H1LA 4M9ZA 3Q5FA 3CUQA 1HW5A 1TWCJ 3HHGA 5KNLA 2R7XA 3B02A 3GBGA 3K2AA 5BMZA 1B9NA 5KVRA 3DLAA 1RRJA 3EUKL 3LSMA 1J75A 2HYJA 1HKTA 2K4BA 3BY6A 5F64A 1NG6A 3ECOA 2YSRA 2PMHA 3K1PA 4LOCA 5H6QA 2UZKA 1BI3A 1XB4A 1GXPA 2QEXI 2Y31A 3V8KA 2Q1ZB 2VODA 2EA4A 2L9NA 2Z5UA 2D1HA 3ABMH 3ZOBA 1Z6RA 4CSWA 2V4JC 1J0RA 4HX8A 4GYIA 2XAUA 4I02A 3ZMUA 2HOSA 2R7VA 2FOKA 2HYFA 3K4BA 5HLIA 5EEAA 4BNCA 3FMQA 3KEYA 4MTDA 3I4NJ 3ML6A 3ABKH 4LG0B 3E6BA 4QIWN 1RETA 3W3CA 2ZC2A 3GTPJ 1YIOA 1ONVA 3TBIA 4DBRA 2XV4S 1OYIA 1QGPA 2HXIA 5HLTA 3QQAA 2PJRA 1CF7B 4GXOA 4PGGA 3S16J 2O7OA 3AL0C 2WAFA 4G6TB 4Y7NJ 3BLYA 4OAYA 1JKRC 2H8WA 5LEKA 4HQEA 2ELJA 1ZRFA 2OCCH 2R7ZJ 4E7LA 2L0KA 2X6OA 3HRTA 5GAHJ 3D0SA 2BEOA 2E2HJ 2ADUA 3ZR8X 4MQ9F 3MWMA 3CZ6A 3A1YA 1YIJI 2D1VA 5CVVA 3K6GA 4CCMA 2R5YA 1STZA 5J3LA 1IN5A 4BUPA 3IP4B 1MMSA 2PBIA 2QCOA 1R5HA 2BW3B 2K9SA 4NNJA 4BQOA 1TT0A 1P4AA 4A2UA 1FOXA 2BOLA 3SDBA 1GV5A 4KN7X 2RC4A 1U5TA 1HSTA 3SDGA 5E18F 3WTYC 3C18A 3LL7A 5IT9Z 2DOEA 1SFEA 1Z9CA 1TC3C 5DS9A 2PMZN 4P9UA 2R92J 1GVDA 4OIQF 3U1DA 1W1WE 1QO0D 3F3XA 3LAJA 2CQKA 3ZPLA 4LLLA 2LYCA 3L2UA 1ZG5A 3QPHA 4I0AA 1DP7P 2K9NA 1E3PA 2OZUA 4XM3A 4KN4X 4A0ZA 4WXDA 4D7MA 4R79A 4OOIA 3OS0A 2X4HA 1XCBA 2JK3A 4XKVA 4O6JA 3I53A 2B0LA 4NC6A 4Y13A 3LSPA 2HOEA 1AKHA 5HOOA 3RZOJ 2FBKA 3H9JA 2X1CA 1WRJA 4PJLA 4QWQA 3CMEI 5ERIA 4WWCA 3OYGA 3AAFA 4LIVA 1YTYA 2HGCA 4KFCA 1OLTA 4CDGA 4HLYA 5TISC 4HA8A 4S05A 1W7PA 3REOA 2EFPA 3SFZA 1YX5A 5HVQC 3OYJA 4AIKA 2R7QA 3OYEA 2K9MA 4BQNA 2CJJA 5ICEA 2LKPA 1G3TA 1O3RA 1FBQA 3E3VA 3S3NA 3IH3A 1BR4A 2BVMA 2OQRA 1HW1A 1RC9A 2LC2A 3BJAA 2ZMEB 4KMUX 4Q4ZF 4HEA2 5HS9A 1BJAA 3OIPA 4ETSA 5JVTA 1IRFA 4CGZA 1W0TA 3ZXSA 4PJ0C 3MMYB 3GYHX 1T98A 1RKTA 3HGYA 5JVGF 3C7JA 1SFKA 4R1HA 1TBXA 1FMWA 4JBAA 1R23A 2DQLA 4E4HA 4E6KG 2F4IA 3QU6A 1O3QA 3HOXJ 2I10A 4UHTA 1S7AA 3WTWC 4MEYF 2M45A 4M3EA 3WTUC 2DAOA 4A3MJ 1USTA 2XPWA 2JVHA 1ZR2A 2L7ZA 4XOPA 5F08A 5D6FA 2BBYA 1S5LC 1POGA 1ULYA 4PFPA 5DCMB 2CYYA 1IC8A 4R8HA 4F52A 3LAPA 4M73A 3W6KB 2E1OA 1WCMJ 2FU4A 1WH5A 3GTOJ 1R6RA 3QP5A 4Y52J 3AFHA 2IT0A 3PUFA 1TW2A 4A3LJ 1X3ZB 1J59A 4OMYA 2DLLA 3TEDA 2TRTA 3SJMA 1MNMC 1W5CC 1VQNI 3KEQA 4AYBN 4AUXA 2CV2A 1ETYA 3WU1B 3GTKJ 4C2UA 3PJRA 2COMA 1X2NA 3L2WA 2PJPA 5EGOB 1BN5A 3CDHA 3VDXA 2EPFA 4EM1A 3Q3SA 1LB2A 1A31A 1YRNA 3O2PE 4NUBA 1SMTA 4EATA 3VSLA 3BQZA 5DM6F 3L1PA 3HEFA 3HG9A 3DTIA 1JKOC 2L9RA 5J1RA 3JSOA 2HEOA 1GLNA 2Y9ZA 1X58A 2E34A 2BXZA 2RN7A 3RJPA 1D5YA 2E2IJ 1OPCA 2HWVA 3F9KA 2ZXHA 4ZH4F 3GEZA 4L9VA 2OTLI 2EFNA 4IOAF 3PIOF 1K7AA 2K02A 1RR8C 4CZCA 1MBKA 2GM4A 4JX5A 2DFFA 1SD7A 4KDPA 4IF4A 5E1ZB 1BC8C 4RAFA 4G8XA 1QHGA 1FZPB 2GXAA 2DTRA 1IN4A 3HRMA 1MBHA 5D4SA 1IF1A 1EA3A 4C3JJ 1KU3A 5L3BA 1ON1A 1XCVA 2YX4A 4HOBA 2FRHA 1JTYA 5BQTA 4P1WA 4HRIA 2ESHA 3OSFA 2CH0A 1VQLI 3T8TA 3H5AA 1YOVB 4FT8A 4BE0A 1I39A 4C9YA 3FISA 1T39A 3OMYA 3VPRA 3L7WA 5D8KB 4E7JA 1U9NA 1R7JA 3VOEA 1LUJB 3DBLB 5B3SH 2GIVA 1Z3YA 3H5RA 4CYCA 4AYBA 3A0HC 3JR9A 1X1BA 1SMYF 4BBSJ 4YFKF 1WPKA 2G7UA 2DOAA 3FF5A 1IRGA 1DP3A 2P4WA 4KMFA 4HBLA 2IS6A 1QRYA 1FP2A 2V6CA 4ZYDA 1P2FA 3HUGB 1YI2I 4B48A 4I2OA 1OCRH 4I76A 5IP7J 1WH7A 3RDIA 1R1VA 4II3A 2R7UA 4M6XA 3ZQHA 4CHUA 4A3DJ 4EGYA 2XVCA 1MBEA 2D5VA 2AO9A 1KQ9A 5FO5A 3O8GA 2MD0A 4A69C 2HQAA 2ELHA 2VBXA 2VOOA 4Q5SF 2PFBA 3MZHA 1LEBA 4LJZF 2W25A 4XN0A 1D1AA 2DYRH 3CLOA 3FIWA 2ICWG 4HNUA 1WJDA 1B1BA 4Y3OA 3QU3A 4BQQA 4N4OB 1H0MA 2CW8A 1QPMA 1YJNI 1R71A 1QA6A 3WODF 2HZTA 4XLFA 4L0ZB 5FROA 4FETA 1SVOA 2XGDA 4MIMA 4NB5A 3W6JB 1MMGA 3K4CA 2WBMA 5K5RA 1DU0A 3VB2A 4J01A 2OZ6A 1ZGWA 1RUNA 1Y1VJ 4LG3A 5B66C 5JLWA 3HTSB 3KYCB 4NHJA 1ETKA 1ETVA 2QWWA 1MW7A 2CG4A 2X6YA 4JP0A 1XMXA 2DFEA 3FXRA 1K83J 3GO5A 3HZJA 2QQ8A 4B3AA 3PIPF 1KGSA 4M9SA 2CUZA 3FXQA 2B63J 3AKZA 4B43A 2CS3A 3BTCA 3GZNB 1AOYA 2R7WA 2ELKA 2ME6A 2KKOA 2W82A 1OKRA 4BGDA 2DA3A 3OYLA 4M3BA 3L2QA 2JVGA 3GFIA 3T5XA 5C4XJ 5HLGA 3FXOA 4IRIA 3BT9A 3BPVA 5LHHA 3CO7C 3BG5A 1I50J 3WGGA 2BGCA 3W2VA 3HOWJ 5TGTA 1QNTA 4IHTA 2EV0A 4OIRF 2A6HF 3J7AO 2LNBA 2X1DA 4FCYA 5K1YA 5ILSA 2PN6A 1RUOA 3I3LA 1Y6IA 2VBZA 3EDPA 2MC3A 1IAWA 2Y0MA 1XG1A 3HGGA 1EH7A 3CUQB 2H6CA 2E1CA 3PO3J 1R4MB 5AIQA 5C3EJ 3R61A 2V9VA 3JRBA 1P4XA 2R5ZB 4X0GA 1GDTA 2HZDA 5GAEJ 3L2CA 3KP7A 1F1ZA 3CP2A 2ZMEC 3HIFA 5GPAA 1FBSA 3S8PA 1AHDP 1VI0A 3TW6A 2IW5A 1TL8A 1QBJA 3GWZA 1Q1HA 1SAUA 3O6BB 3VYTB 4EVIA 4ZZDA 3SEQA 1D8KA 4I09A 2CSOA 2W1OA 3G6EI 1B72A 2VQHA 1IRZA 1YS7A 4B44A 3CCJI 3P9IA 4BY1J 1XMKA 3CJRB 1Z21A 3DU5A 2EBIA 4U88A 1WWXA 2EZHA 2W00A 4B3XA 2W57A 4OAZA 2P0WA 4ZJZA 1PUEE 3K9TA 1PUFB 1NH3A 2R3SA 4AIDA 4CCNA 2FBIA 4ENMA 3P9CA 3HB9A 2IGNA 3S32A 1Y56A 1FNNA 3PQJA 1FTZA 1BOAA 3LSGA 4LGWA 2PJRB 1V3FA 4Y15A 1JUPA 1JI8A 2HOAA 4BXXJ 2Y75A 2HOTA 2CFOA 2JSPA 3S1MJ 3M8FA 3MKLA 2H09A 4IEJA 2XC7A 4M6VA 4RGXA 1HA8A 1PJRA 5K5QA 3PFIA 2BY1A 4FHTA 5F0FA 1RIOH 5DUIA 3IKTA 1JUSA 4BAYA 3HRUA 5EZHA 2K9LA 1L3LA 1LE8B 1DPUA 1HCRA 1G4DA 1LFUP 1G2HA 1KQ0A 3IC7A 2DK8A 4I6ZA 1JT6A 2V1DA 4ON0A 3N05A 3GTJJ 2Z33A 2JA5J 3G4SI 4F92B 3ELKA 4KT5C 4QTRA 3SXYA 3TQNA 3GZ5A 3TOAA 2WADA 1IGNA 1I5ZA 3K2ZA 2XUBA 4EMSA 1JJ6C 1S6LA 3JTGA 3OYCA 2BHYA 3R4KA 3MAJA 2DODA 4M6YA 1ZYRF 1K78B 1FP1D 3DCFA 2JSCA 1SFOJ 2LD5A 2XSDC 2EZLA 2FX0A 2X1EA 3GFJA 5FKOA 4PJJA 5GTIC 4A3CJ 1LFPA 1IXRC 3OL4A 5B5EC 3DLLF 2QQ9A 3JRIA 5E1WA 1F36A 2E1MB 4RB1A 4Z2YA 1HKQA 3E5XA 1YJ9I 4IXAA 4NC8A 1ZR4A 1XGOA 1YQAA 3H1CA 4UB6C 2VT2A 2NVUB 3BPXA 5H20A 1F5TA 4XR6A 2F5CA 5JI6A 2E7XA 3ZMDA 2JA7J 3KFWX 2VOPA 2COBA 1ZG3A 1S29A 5M3MJ 4KUMA 1HXDA 3ZMSA 3DBHB 4BHCA 3SZGA 2Y2ZA 4U0WA 2WAEA 4D9JA 3Q0VA 3OR2C 1SANA 3CF2A 3O8HA 3WHBA 1YLFA 2MD5A 2ZFUA 3J7AY 2DFHA 5J47A 3TO6A 5L3EA 4JX6A 3BG6A 2P81A 3F8BA 2J5OA 2P5LC 4WXCA 2X51A 4RAGA 1TWFJ 3PSFA 2KLOA 1GUUA 3FMRA 3RPQA 1J9IA 1JHHA 1B9MA 2WTEA 5BNGA 5C44J 4KYWA 2E35A 3DPUA 1TP4A 4XOTA 3NAUA 1B59A 2I8DA 1MJBA 5J4YA 3M4OJ 4XLNF 4ZZLA 3QP6A 3O3KA 1A35A 2RQPA 4OWRB 2ID3A 5E3MA 2RQQA 1QZEA 5ILVA 4DZJA 4L18B 2QKLB 5E1XA 1LQ1A 3V42A 1H9GA 2P5VA 4RA2A 1IV6A 3H0GJ 1MBGA 3TW7A 3HPHA 1F9NA 2OAZA 4BDZA 3I5UA 2XAQA 2XB0X 2LY9A 1HKSA 1HLVA 3RYRA 3LFKA 4CICA 3HTUA 1JE8A 2HI3A 1H89C 4V19K 1OCTC 2NAZA 4C30A 2LRDA 1UHSA 4E7IA 2VONA 1X1AA 3VFZA 2Z3YA 4ZDLA 1ITYA 1Y8RB 2FQ3A 3KCCA 3U9GA 1VQ9I 1FOWA 3CD6I 1KU9A 3I59A 4WXHA 1ETQA 2CWEA 2EK5A 3C3WA 5HDKA 2YPRA 1NK2P 4EV0A 2ZB9A 3FXJA 1BM9A 2P5KA 2LY2A 1GXQA 2JMWA 4XRFA 1ZELA 1Y8QB 2IRFG 3H35A 1BR1A 2DT7B 1YRNB 3S2DJ 2WV1A 1XDUA 1EH6A 4ABZA 4BBRJ 2ISZA 2XDVA 2VBYA 4OINF 1UELB 4PFOA 1YG2A 1Z7UA 5FD5A 3RKYA 1T0FC 1HF0A 1IUYA 3WU0A 2WV0A 5IYCJ 3HXLA 1HDDC 1DGWY 4Q47A 1YW8A 4LIUA 4DIQA 1W36D 2W7NA 4DOZA 2XF6A 2M8GX 2X48A 5M5WJ 4RDUA 3AG3H 2FF4A 3H92A 3BCBA 3IH4A 1FWZA 4N9IA 2ZJ2A 1IW7F 1U3EM 5J8CA 2KZGA 4GGGA 2G9WA 2VQGA 2IA1A 1KQ8A 3QYBA 2F4MB 6PAXA 4BKXA 1JHFA 3GTLJ 1YS6A 2O8KA 1W36C 3H36A 3TDUC 2DA7A 2F6CA 2KDOA 1Z05A 2NS7A 3CCSI 1B8IA 2HVSA 4IHYA 3V7CA 2HPMA 3FDYA 1JXSA 4L0YB 2MLKA 1DPRA 2W85A 1R00A 3E1SA 3NRVA 4PGHA 1FSEA 3UKGA 2ZJQF 4A6DA 3D5SC 4XORA 4A3EJ 1T95A 1TW3A 4UXNA 3CJNA 2IS1A 2LDUA 5DTDA 2VQCA 5F27A 1LDKB 3LQRA 3A0BC 4QLCU 2DT5A 3L2VA 1Z67A 5A2QK 1VQ6I 5D4RA 4MFDA 3WTXC 1BBYA 4M74A 1A5JA 3W2AA 2KIMA 4AC0A 5HS7A 2LFBA 4ASNA 1X2MA 5LEJA 2XPUA 2NS0A 1FT9A 4U7DA 3KIOA 1XTAA 5KK1A 4DYQA 1O3TA 1USSA 2RREA 1T6SA 1N25A 2UXNA 3RYPA 2Q2EA 2DI3A 1CGPA 3TGNA 2DCEA 3HSRA 1KYWA 5EG0A 4UUSA 3W6VA 1FYKA 2AXTC 5B1AH 1U6GA 2CU7A 2MBFA 2WAQA 1X3UA 3T1BA 5CYVA 2DA4A 2UUZA 3B73A 3NEUA 3KPHA 2HDDA 4MFEA 1X19A 3IAM2 3DV8A 1WGXA 4KITB 4XKWA 1OR7C 2NOGA 4B8XA 1XSVA 1SFXA 1VQ8I 3ROUA 3MVPA 2XAFA 3ZQLA 3RPUA 2NOJB 1ZRCA 2FSWA 4IZZA 2L01A 1D1CA 2UWMA 3GFLA 2QLZA 3FBIB 2IPQX 4EJWA 5JR3A 3I4MJ 2VXZA 2JA8J 3M3YJ 1FY7A 4XNFA 4U0VA 3C1DA 2VC0A 3OS1A 1BI1A 4QPQA 4DZPA 4IX7A 2VKDA 3S2HJ 1J2XA 1OMIA 2R7FA 3IRRA 4L9NA 2F4OB 3NWSA 4NQWB 2QKMB 5FLVA 3DEEA 3KZIC 3MZ8A 3G2BA 1S3JA 3COAC 4HNVA 2NS8A 2WY7Q 3MKYB 3D1NI 3RSNA 4GYGA 3A01B 2Z16A 4GDFA 1ORKA 3EETA 2KRHA 3FM3A 4IO9F 2JA6J 3G1LA 4BEHA 2HKXA 2JT1A 1BA5A 3QPLA 1A6QA 2FJ1A 2VJIA 5EYRA 2VI6A 2VIXA 4Z6YA 3KP4A 3ESWB 3OYFA 3CCRI 2Z9OA 1I3QJ 4BY7J 3CO6C 3CUOA 4WX9A 3I54A 5ED4A 4NC7A 1QVUA 2IGMA 2R7RA 1FJLA 3CC2I 1FOYA 2K3PA 3DEWA 5HNHA 3GLLA 1MNDA 3C2HA 5K5OA 2LMDA 5IYBJ 4HNTA 5HODA 2M5WA 3J81K 3BR3A 2DQRA 3DQVC 1S8NA 2RNGA 3JRHA 1XGNA 3OYMA 2Y69H 2DA6A 4PSXA 3OYKA 1XPXA 5JHUA 1XSDA 3L09A 4IVNA 5FLXK 2OCEA 3S1NJ 3LWFA 2PEXA 1WQ2A 3QAHA 1P92A 4LITA 3TDZC 2OV7A 4CO8A 1K79A 1ZK8A 2KFDA 4D5FA 3WU2C 2RKHA 2R7TA 3JW4A 1XMAA 4A6EA 3L2RA 5M5XJ 4MQVA 2FQ4A 3J80K 1WHUA 3V7RA 5L3CA 4HV6A 2C6YA 1XD7A 2RVCA 2L7KA 1ZGAA 4G7OF 4M3GA 1A04A 4X1EA 3B6CA 3LA3A 2XGCA 4RS8A 1TLHB 3RCOA 1H88C 4XRSA 2OQGA 3WTZA 2GOXB 3JREA 3Q0UA 3OIOA 2NXNB 1SC7A 2XASA 5FLMJ 4FISA 4P55A 2IAIA 2JZYA 4K2EA 3FMSA 5LGTA 1QZYA 2LVSA 3JRGA 1PDNC 2QBYA 4F3QA 2OTJI 2IGOA 2JQ7A 3JRCA 1N78A 4RAYA 5HDNA 4FQGA 1UMQA 3N97A 3LSKA 1P7JA 4BU2A 2VE9A 1ZRDA 3K4LA 1E3OC 2YS9A 1YITI 3DP7A 5J4VA 1ZG1A 1S7OA 1X1DA 5HLHA 2M7AA 3LFUA 1MJ9A 3FM5A 2W4SA 1OYWA 3BR0A 3IRQA 2JN6A 3ZQ7A 5K7FA 2W24A 4HQMA 5LGNA 3BR1A 1EJ9A 2GLOA 1JT0A 5D8LB 2ZSIB 3KLNA 3H5NA 1R49A 2XF5A 1OISA
chains in the Genus database with same CATH topology
1OQYA 4YIRX 1PVEA 2F4OB 1X3ZB 1QZEA 1X3WB 2QSFX 2QSHX 2F4MB 2QSGX 1TP4A 3ESWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQY A;  4YIR X;  1PVE A;  2F4O B;  1X3Z B;  1QZE A;  1X3W B;  2QSF X;  2QSH X;  2F4M B;  2QSG X;  1TP4 A;  3ESW B; 
#chains in the Genus database with same CATH topology
 5F0H A;  3P7N A;  4WK8 F;  3IWZ A;  4F7Z A;  2FMY A;  3CJQ B;  2NVY J;  4TV7 A;  3CCV I;  3ABL H;  2HQR A;  2V6E A;  2M7B A;  2DMT A;  3GUD A;  3IUO A;  1WJ5 A;  1CF7 A;  3PFY A;  4L5E A;  5FKN A;  1ZLK A;  3KLO A;  4JYK A;  3BR2 A;  1VZ0 A;  4UNO A;  4AVP A;  4A12 A;  4J00 A;  2LF7 A;  3ABT A;  2HQN A;  1SD6 A;  3S15 J;  1IDZ A;  1U8B A;  2YUS A;  3WTT C;  1FPQ A;  5LRS A;  5LFA A;  3OYD A;  2CMP A;  2LH9 A;  3H3Z A;  3QOE A;  4LLG F;  3ZQG A;  1Y1W J;  1EH8 A;  3KET A;  5E3L A;  4FAS D;  2AS5 F;  1G3Y A;  2M3A A;  2FNP A;  1XX5 A;  4IKF A;  1X3W B;  1Z3X A;  2RGV A;  4A5M A;  2ACJ A;  3BWG A;  3TKY A;  3S2W A;  4ANJ A;  3FK7 A;  2VXD A;  3E97 A;  1K6O A;  5BOX A;  4IRH A;  4F55 A;  2OBP A;  4A3J J;  3HHH A;  2QGU A;  1SVL A;  3E5Q A;  1Y0N A;  2J5P A;  3EUH C;  4BXU A;  2STT A;  4G6D A;  2XRL A;  1FYL A;  2MFZ A;  2K86 A;  3TP0 A;  4UY8 I;  4P96 A;  1I6H J;  3E6M A;  4A3F J;  4H0E A;  3M8J A;  2OD5 A;  2DMP A;  3SEZ A;  4CCO A;  1QU3 A;  2CRG A;  1T56 A;  2ECB A;  4A3B J;  3K69 A;  3GF2 A;  4E7K A;  1ETW A;  1D0Z A;  2LF8 A;  2QZ8 A;  2A3S A;  2V9P A;  2VC1 A;  1MDM A;  1Z91 A;  2R93 J;  4IL6 C;  1T38 A;  2VB6 A;  1R5I D;  1Y0U A;  2K5C A;  5KCM A;  1EV7 A;  4EJV A;  2K3F A;  3OOP A;  2EFW A;  2Q8K A;  2FD5 A;  1JGS A;  2LBF B;  3K70 D;  2JPC A;  3F8C A;  4UV8 A;  3SZP A;  2EFO A;  4D7N A;  2PQ8 A;  2HDW A;  5M5Y J;  4ESJ A;  3MKZ A;  1E3H A;  2GAU A;  4FE4 A;  5AIP A;  3D5L A;  1TNS A;  1WJC A;  4HF0 A;  2HFH A;  1G8X A;  1JUM A;  3I58 A;  3OS2 A;  3SHF A;  2EIN H;  2F5F A;  2BZT A;  2V26 A;  4X6A J;  5GTH C;  2VPR A;  4G94 A;  4MLO A;  2EB7 A;  2L02 A;  4EJU A;  1JKQ C;  3QRF F;  1G59 A;  3UR3 C;  1ZAR A;  3PSI A;  3WGI A;  2CQ7 A;  3LSR A;  1K4T A;  1IUF A;  2ZME A;  5GAG J;  1VQP I;  2LRE A;  3N4M A;  1WJA A;  4HAM A;  4YRV A;  1I3A A;  2CW0 F;  4BJ6 C;  2A68 F;  2H94 A;  2STW A;  2DO7 A;  2JPB A;  1RES A;  3M8E A;  5CVJ A;  2LKS A;  5FKK A;  4ZTF A;  4IQJ A;  4XON A;  1SAX A;  2MGQ A;  2L7M P;  2R4G A;  3FK6 A;  4OMZ A;  3F8N A;  2Y0S A;  3DWL E;  2E5N A;  2ZBK A;  4ZDO A;  2FBH A;  3MQ0 A;  3TL4 X;  3F6O A;  1MGT A;  1U2W A;  1W0U A;  3EYY A;  1WZ2 A;  9ANT A;  3KX2 A;  4G7H F;  5DCM A;  1ZRE A;  1MNE A;  2QVO A;  3C2G A;  4BDY A;  1TWH J;  1P4W A;  2DMU A;  3ASO H;  2EZK A;  1BR2 A;  2G0E A;  2ZXI A;  3S14 J;  2NNN A;  2OC6 A;  2F48 A;  3CJT B;  5L3F A;  2CQQ A;  2KL4 A;  2NRA C;  1FOK A;  3DTE A;  3IHU A;  1R22 A;  2XRO A;  3PNT A;  5IOY A;  2HYG D;  5H6R A;  2MW8 A;  3A03 A;  4P9F A;  4YEJ A;  3R60 A;  3CCL I;  1X1C A;  2PMU A;  1OCZ H;  3AG2 H;  2VKH A;  2AQF A;  3OV8 A;  1V5G A;  3ZN1 A;  4S04 A;  5EGO A;  2DA1 A;  4G12 A;  1Z0X A;  4M9X A;  5IT3 A;  3I64 A;  2Y30 A;  1HQC A;  1FEX A;  1K61 A;  1R58 A;  2WC2 A;  4V2G A;  5IYD J;  3BQY A;  3BZC A;  2XPV A;  4ZYE A;  1ZLJ A;  1IV8 A;  4B4C A;  1OCP A;  2PI0 A;  4A93 J;  4GO1 A;  1ZKG A;  2KJB A;  3EPZ A;  1NHA A;  3QPT A;  2R5Y B;  2EH3 A;  3VEP A;  2DA5 A;  2WWY A;  1KU7 A;  4JX4 A;  3RKW A;  2ZJP F;  3JCU C;  3DPL C;  2V1U A;  1J09 A;  2QM3 A;  1S9H A;  1J5Y A;  2DN0 A;  2OUM A;  2X85 A;  1IDY A;  4E7H A;  3EUA A;  3G73 A;  1FLI A;  4LB5 A;  1U5T B;  3KP3 A;  4HX7 A;  1IO2 A;  4P5O A;  4HF1 A;  1XN7 A;  4G6Q A;  5DDG A;  1MSF C;  2K40 A;  4I7H A;  2YX7 A;  3VSK A;  1BJZ A;  2CW7 A;  5A2Q Z;  3S1Q J;  2VJ5 A;  2X9D A;  2UXX A;  1TTY A;  3ZQC A;  4XL9 A;  5CJ9 A;  4KIC A;  1XSX A;  5CVU A;  1ETO A;  3LSH A;  4O5V A;  5F6F A;  2JRT A;  3LA7 A;  3HOT A;  3QWL A;  2HNH A;  1Z6T A;  3DFG A;  3BOQ A;  4EEF G;  2O5R A;  1TT5 B;  3KZY A;  5ICC A;  2VJJ A;  3EYI A;  2ISY A;  1FBU A;  3BZK A;  2V1N A;  1T2K A;  1AKH B;  2NVQ J;  1ODD A;  5KHD A;  3DKW A;  1UG0 A;  5DUK A;  2XGE A;  2DW4 A;  3FHN A;  3JRD A;  3VOD A;  1O4X A;  2M9H A;  4A3K J;  1REP C;  1VQ7 I;  2L9S A;  1FIP A;  1OFC X;  3HUG A;  1W7P B;  3TOB A;  2Z1D A;  3HPG A;  4A3G J;  3HM5 A;  2W84 A;  1F4K A;  3DF8 A;  3JRF A;  2P8T A;  4A3I J;  1BW6 A;  3H0D A;  3BTI A;  2E2J J;  4YFX F;  4Y4R A;  3RZD J;  2CV1 A;  3ABU A;  1W4M A;  3K1N A;  4CYD A;  1Y39 A;  3OYH A;  2LSO A;  2BVL A;  1P6R A;  2XKO A;  2CO5 A;  2O8X A;  4PJN A;  3ZCO A;  2L4M A;  3HKZ N;  2X0L A;  2GQQ A;  3ECH A;  3CMY A;  1LJ9 A;  4LMY A;  3OYI A;  3RKQ A;  4RAZ A;  2IGK A;  5D5W B;  1U8R A;  1ZAO A;  2B7E A;  3BDD A;  2BE5 F;  2LKX A;  1RZ4 A;  1T08 B;  3KZZ A;  4MTE A;  4QSH A;  4EM0 B;  4YII A;  1GV2 A;  3G1O A;  5GP9 A;  3F23 A;  2O3F A;  4RB0 A;  4MEX F;  4BE1 A;  2B9S A;  1JGG A;  3VYU B;  4IRG A;  1LPQ A;  2TDX A;  3ZMV A;  2XHK A;  4XBF A;  2M30 A;  4PK4 A;  1D1B A;  4YFN F;  2FE3 A;  3F8M A;  1ZH5 A;  1VQ5 I;  1XC5 A;  2RDP A;  3J81 Z;  3F22 A;  2KT0 A;  1BC7 C;  1B4A A;  3S1R J;  1QPI A;  1JKP C;  3I71 A;  2WA0 A;  4XIC A;  4BYY A;  3HSE A;  3IL2 A;  2H27 A;  3L00 A;  1UHM A;  2DK5 A;  3SFI A;  3E6D A;  1MMN A;  2HVR A;  2MAB A;  1D3Y A;  4LK1 F;  4XID A;  1YFH A;  1RI7 A;  4XQF A;  2E5Z A;  3DPT A;  3SQN A;  4UUT A;  3LA2 A;  4CXF A;  3L9F A;  3I56 I;  5FLX Z;  2LK2 A;  2H1K A;  3M9A A;  3MEX A;  4Y33 A;  2IA0 A;  4Q48 A;  2V79 A;  1T0F A;  1DQU A;  2DPU A;  5J8F A;  3OYN A;  5EJC A;  2KHM A;  3CTA A;  1RNL A;  3T8R A;  3HKZ A;  5FB2 A;  4F93 B;  2UV1 A;  2MA3 A;  4XN3 A;  4YIF A;  4EGZ A;  1X4P A;  2KQR A;  5F0C A;  1MIJ A;  4G9Y A;  3J80 Z;  2NNY A;  5J6X A;  4A0X A;  1DU6 A;  1D0Y A;  1WKM A;  2PX9 A;  4I98 B;  4OIP F;  3DBR B;  2ZO4 A;  1Q1V A;  2FXA A;  3G71 I;  4ZYG A;  1KON A;  3LSJ A;  5D5V B;  1A36 A;  3VYS B;  1H8A C;  2PG4 A;  1X1P A;  1ETX A;  2K9Q A;  2WAQ N;  2NVT J;  2R5Z A;  4UV9 A;  4HYE A;  1OYY A;  3IAS 2;  1IJW C;  1FYM A;  2QBY B;  2CQN A;  4II2 A;  5B1B H;  4BXF A;  4BS9 A;  2EV5 A;  5CQE A;  2QEN A;  4C2M J;  1FC3 A;  3CUQ C;  1E2X A;  4E7S A;  2ME0 A;  2L2O A;  1T33 A;  1LKX A;  1ZHF A;  3WHC A;  3JAM K;  1ZGJ A;  3PO2 J;  3I9V 2;  3BTJ A;  5GPC A;  1DGR M;  3QOD A;  3CF5 F;  4M3F A;  1WSU A;  3WE3 A;  3SYT A;  4RM3 A;  2GBY A;  2HXO A;  2L54 A;  2JTV A;  1W5S A;  4CYC B;  2GXB A;  2VJ4 A;  5FGM A;  2P7C B;  2DDA A;  2IEK A;  5DD8 A;  1HC8 A;  4M3D A;  3V8J A;  2FOW A;  4D5C A;  1PUF A;  1KU2 A;  5DEQ A;  2EIK H;  3RIR A;  4EJT A;  2FNA A;  1G3W A;  5JLX A;  5KAI C;  1HSJ A;  3ERE D;  3CMM A;  3TP3 A;  2D2W A;  1BOB A;  1Z7L A;  4JOM A;  5CVR A;  1MBJ A;  1KYZ A;  2JRM A;  3Q9V A;  1YE9 A;  4XKC A;  4CA0 A;  2V1X A;  1O57 A;  1B6A A;  4AD9 A;  3FX3 A;  4ZYA A;  2ZJR F;  3GME A;  3HC7 A;  1LFB A;  3WE2 A;  1WJE A;  4AU7 A;  3I55 I;  4LB6 B;  3KE2 A;  2IVM A;  2MH9 A;  2M34 A;  1ON2 A;  3RQ4 A;  1AA7 A;  1LE8 A;  2XRN A;  3QOP A;  5LGU A;  4ZTJ A;  2LOO A;  4HF2 A;  1L0O C;  1EKE A;  2VUM J;  1HDP A;  1OR7 A;  2L3D A;  4JK1 X;  2X6W A;  4HW0 A;  3CP8 A;  3HOV J;  1LVK A;  4ENJ A;  2X6X A;  2KPM A;  3ZMZ A;  3IKV A;  3BP8 A;  3GCM A;  5H2F C;  3P9K A;  2IA2 A;  5E3O A;  3U1K A;  2JWT A;  2O03 A;  1I1S A;  2QA4 I;  1K78 A;  4YIR X;  1IN7 A;  1ENH A;  4RM2 A;  2CUE A;  4XMY A;  2OU2 A;  3VYR B;  2E19 A;  1U5T C;  2MSY A;  5K7H A;  3LSI A;  1VQK I;  1K6Y A;  2DMN A;  3LST A;  4IJA A;  4UVA A;  4XLA A;  4KT6 A;  3U2R A;  4N0B A;  2VKE A;  5TRD A;  1MDM B;  1TZL A;  2EJR A;  3RPU D;  3LNQ A;  3GZ6 A;  2E1N A;  4CH7 A;  1R9T J;  2RV8 A;  2A6T A;  1IG7 A;  4IOC F;  2F5V A;  1VFC A;  2E1M C;  2MC4 A;  1UZC A;  2M4K A;  3JRA A;  3IH2 A;  2HS5 A;  4XSX F;  3NAR A;  3S3M A;  3K1M A;  1SVM A;  2M1B A;  5LBQ A;  1W7P D;  1LEA A;  5EEG A;  3CC4 I;  2Y48 A;  3HYI A;  1OCO H;  4FX4 A;  3K0L A;  1MH3 A;  3WG7 H;  2W48 A;  4DGW B;  3MN2 A;  5FKL A;  3HSF A;  4IPA A;  4FE7 A;  1IN6 A;  3TO7 A;  2ZSH B;  2OJE D;  4OU0 A;  1FTT A;  2CUJ A;  1D0X A;  1S72 I;  2EIL H;  2DJI A;  1E17 A;  5D5X B;  3FXK A;  3PNV A;  3FXM A;  5DCF A;  2E7W A;  3U21 A;  2O61 A;  3R6S A;  3PNY A;  4BH9 A;  2DPD A;  4LK0 F;  1WI3 A;  5IP9 J;  4PJM A;  1IRX A;  2LG4 A;  4KIF A;  3MD2 A;  1YYV A;  3UNG C;  1I27 A;  1YX3 A;  2EFQ A;  4D0P A;  2DMQ A;  3BG3 A;  4HV5 A;  5E8I A;  3BZ6 A;  3K4N A;  4W97 A;  3NQO A;  2PMZ A;  4LLN A;  4RGS A;  3GX4 X;  3F72 A;  4CCL A;  3V8L A;  2P7V B;  4MHG A;  4RMN A;  1RPW A;  2DU9 A;  2EWN A;  4L9T A;  2M2E A;  2XGX A;  3H9G A;  1WJF A;  4WCG A;  3OYB A;  1SEU A;  4A0Y A;  1B72 B;  2JUG A;  2Z2S B;  1D5V A;  3FBN B;  4BHP A;  2M87 A;  5D6E A;  4NBQ A;  2R7O A;  4L5J A;  3CCY A;  3D5R C;  2M0C A;  1Z1D A;  4Y17 A;  3HL2 A;  1AU7 A;  5IOZ A;  2KMU A;  5LHG A;  2LP0 A;  2R7S A;  3CCQ I;  2VPL A;  1V55 H;  4CCK A;  4B47 A;  3E7L A;  2IXS A;  3T0Y A;  2ESN A;  2A61 A;  2ID6 A;  2GA1 A;  3E5U A;  3JTH A;  4KJZ A;  1MJA A;  5FFZ A;  1QVT A;  2WB1 N;  3ASN H;  1UAA A;  3LQQ A;  1V54 H;  1YHQ I;  2WY8 Q;  5LD2 C;  4EJO A;  4U0Y A;  4U87 A;  4EM2 A;  2LLK A;  4CUG A;  4HST A;  4PZJ A;  2QF7 A;  2HU9 A;  3BRO A;  2YU9 J;  5E20 A;  1NG7 A;  2MG4 A;  3CQZ J;  2KRF A;  3QYE A;  1ERD A;  4FTH A;  5EF6 A;  5FFX A;  1LVA A;  1BIA A;  2VL8 A;  4ITV A;  2DTZ A;  3I4P A;  3E0J B;  1HOM A;  2VT3 A;  3WTV C;  4PUS A;  5LRR A;  4GFB A;  2F5E A;  4AM3 A;  3F6V A;  2QUF A;  4C2T A;  1PYV A;  3H3V K;  5ICF A;  2QQB A;  1VTN C;  3BCA A;  2KRC A;  3KYL A;  4ENK A;  3A4C A;  4HG2 A;  3GTM J;  1R1T A;  2K27 A;  2E36 A;  3S3O A;  1O3S A;  5HS8 A;  4HX4 A;  3SZT A;  4RGU A;  3BG7 A;  4XRM A;  2A5Y B;  2BHZ A;  2ECC A;  3R0A A;  4GRI A;  3PM1 A;  2ZNY A;  5FD6 A;  3FHZ A;  3K10 A;  3LOC A;  1FMV A;  1VQ4 I;  1MH4 A;  2EZI A;  1UFM A;  3TO9 A;  4RLF A;  1I1G A;  4E70 A;  4LG0 A;  4ZYH A;  5CLS A;  2F5D A;  2H6B A;  1FSH A;  2ZXW H;  4UVC A;  2A69 F;  3WGH A;  1S7E A;  3HDD A;  3KEO A;  5EDN A;  1QHH D;  3BTL A;  1UJ8 A;  2QQA A;  2K85 A;  2AQE A;  1VND A;  2WB1 A;  2GWR A;  5HNF A;  1D8J A;  3BG9 A;  2GXG A;  2M4G A;  1DUX C;  1MMA A;  5DM7 F;  2KJC A;  3DTK A;  3J7Y J;  1G3S A;  2XSJ C;  1MKM A;  3BR6 A;  3S17 J;  2BV6 A;  4ZDP A;  3AG1 H;  1TQI A;  2PLY A;  3BJ6 A;  1U78 A;  2HTJ A;  5CVI A;  4DBQ A;  1I6X A;  4ZC3 A;  5KAF C;  1F43 A;  4JQF A;  4L5I A;  5IT9 K;  1R36 A;  2KIU A;  2DA2 A;  1HW2 A;  3EUH A;  3MKW B;  3PL8 A;  1BI0 A;  2I5U A;  1VQM I;  4KIS A;  1ZTR A;  3GW2 A;  2BW3 A;  4LFU A;  3WTS C;  2NYX A;  4U7B A;  4E7Z A;  1IN8 A;  5K7Z A;  3MFK A;  1O7L A;  3A02 A;  2YU3 A;  2VAS A;  2A05 A;  4GCV A;  4RB3 C;  3FXU A;  2EA2 A;  4ESB A;  3JSP A;  1X4O A;  3RI4 A;  1GT0 C;  4YEL A;  1PVE A;  5JFR A;  4BE2 A;  1E0E A;  4AIH A;  4I99 C;  5FKM A;  4AVZ A;  2JJ7 A;  1KA8 A;  2RAE A;  2VN2 A;  1LDJ A;  2FUG 2;  4N4N B;  2Y0S N;  4RLQ A;  2IP2 A;  3A2K A;  1OCC H;  2XF7 A;  2RNJ A;  1KZH A;  5BPD A;  1J7K A;  2GOM A;  4HLX A;  2VKV A;  4BAC A;  1PP8 F;  3BR5 A;  3HOS A;  3CCU I;  1AWC A;  3S93 A;  4OIO F;  4S0H B;  3F8F A;  3K7A J;  4MO7 A;  1UHW A;  5J40 A;  3MZY A;  4AIJ A;  2A5W A;  3HOZ J;  2XAG A;  3BC8 A;  3OR1 C;  3DKX A;  3E6C C;  3DKY A;  3Q9S A;  2XAH A;  5F1J A;  4IHV A;  1H9T A;  3CDI A;  2MLG A;  2IBD A;  1YJW I;  1IZ1 A;  4NDL A;  5E17 F;  4UUV A;  2A6E F;  3HBL A;  3ONQ A;  4DYC A;  2Y9Y A;  4NQW A;  2IJL A;  1Z77 A;  3OYA A;  3GTG J;  4MGR A;  3I59 B;  3K70 C;  2Q0O A;  3IWF A;  1N77 A;  1G6N A;  3H3U A;  2CQX A;  4RBO A;  2EIJ H;  3A01 A;  4RGR A;  1SD4 A;  2O9L A;  2QSF X;  1FIA A;  5BS6 A;  2DOF A;  1JTX A;  2XIG A;  5F04 A;  2L5Q A;  3ZGK A;  3W2W A;  2OF7 A;  3LMM A;  1MSE C;  4HZF A;  1XGM A;  5BPI A;  3OY9 A;  4KIG A;  2HR3 A;  3NWT A;  2V9K A;  3F0C A;  4V2F A;  4IHW A;  4IHX A;  2E71 A;  2KIS A;  1P7I A;  3ZMT A;  2KIQ A;  4AWX B;  2ZXJ A;  5GAD J;  1T8I A;  4KNY A;  2JA2 A;  2VLA A;  1OJL A;  4L9J A;  1GVJ A;  2L7F P;  3K4J A;  2QSG X;  3HOU J;  2KDZ A;  4BJT A;  3CC7 I;  5FJ8 J;  2ZFW A;  3IV5 A;  2KZV A;  1M1E B;  1YW9 A;  2AXL A;  2ZKZ A;  2D45 A;  2EV6 A;  2JUC A;  1BI2 A;  5FRN A;  4IHS A;  1MD0 A;  1JJ8 C;  5L3D A;  2F2E A;  2GA2 A;  1BIB A;  3I0T A;  3AL0 B;  3H9Q A;  1MMD A;  2L4A A;  1N75 A;  3ULQ B;  1R4N B;  5L3G A;  3KYD B;  3M1E A;  3TMO A;  1B8I B;  3F21 A;  1BL0 A;  5HDG A;  4KA4 A;  5CQG A;  5M3F J;  1TQM A;  3OSG A;  3K4M A;  4RB2 C;  3JAM Z;  4XSZ F;  4DJA A;  2P6S A;  3QYF A;  2CUF A;  3RTR A;  4DQ2 A;  1XS9 A;  1XDS A;  4UVB A;  5IP6 A;  5CKT A;  1R5G A;  4N9H A;  1PP7 U;  2R0Q C;  5CPR B;  4CCJ A;  2K7L A;  1ZQ3 P;  2HDC A;  1ZN2 A;  2CFX A;  1WVR A;  2IS2 A;  2XAJ A;  4CZZ A;  5AON A;  2XKP A;  2XB5 A;  3GTQ J;  4HPQ A;  5F1R A;  2DDB A;  3P5J A;  2ZNZ A;  2BY3 A;  2L9V A;  3PQK A;  1QQI A;  4EQQ A;  2LY1 A;  2Z99 A;  1MBF A;  1LNW A;  3ZQI A;  4YG2 F;  2Q2E B;  4BL0 B;  5EG0 B;  5C4J J;  4UUS B;  5EZG A;  2BY0 A;  1UCR A;  2MYS A;  5DV5 A;  4HDU A;  1SFU A;  4ENN A;  4MNU A;  2M0M A;  1QZZ A;  3RQI A;  4BHB A;  3RKX A;  2V7F A;  4ESF A;  5ICG A;  4F91 B;  1RKW A;  3EQL F;  2QYO A;  4BQA A;  2HVQ A;  4LD5 A;  3C2B A;  2E60 A;  2HKO A;  2VE8 A;  2K4J A;  1A6I A;  4UB8 C;  4O3M A;  3GLX A;  1BW5 A;  4J19 A;  2EIM H;  2HTS A;  5IY5 H;  2KP6 A;  3CMA I;  4WF2 A;  1SD5 A;  3MCZ A;  3BJO A;  4DW6 A;  1YO5 C;  2BY2 A;  1VQO I;  3M07 A;  5DD4 A;  3V4G A;  3FWE A;  3DXJ F;  4M72 A;  1TQP A;  4XRS G;  2CV0 A;  4C3H J;  5JHF A;  1HBX G;  2DJN A;  4HSR A;  3GXO A;  5J1Y A;  1U9O A;  2M8E A;  1EF4 A;  4DYR A;  2FML A;  1VF9 A;  5EEH A;  2MH2 A;  1V4R A;  4I01 A;  5LHI A;  4B1R A;  3CCM I;  3HOY J;  4BEH B;  4IQ4 A;  2LTP A;  4H4K C;  3G1M A;  3M1C A;  3KP5 A;  1XGS A;  3FZV A;  3WG9 A;  1APL C;  2NVX J;  5E79 C;  2CGP A;  4A5N A;  4KIB A;  3HJE A;  5IPA A;  4HDV A;  1OQY A;  3GFM A;  2H8R A;  2FEZ A;  3ISP A;  3DU6 A;  2A07 F;  1DDN A;  2BYV E;  3FKJ A;  5J1U A;  2KIF A;  2FA5 A;  2P6T A;  3OL3 A;  4G7Z F;  2R7D A;  1GHC A;  3R0J A;  1C0W A;  1FX7 A;  2GZW A;  3CDL A;  1ACI A;  4XLC A;  3ZQF A;  3ZP5 A;  1O7F A;  3J7Z I;  3CES A;  1IXC A;  3HRS A;  4PSW A;  1U0J A;  1WFX A;  4XLE A;  2VBW A;  3GVA A;  4DNC A;  5D5U B;  3DEU A;  3KP2 A;  1W5T A;  4W1U A;  2AHQ A;  2GIZ A;  1R1U A;  2DYS H;  4BJ5 C;  4C3I J;  3B6A A;  1TWG J;  2ZCW A;  1YW7 A;  5DYM A;  1V5F A;  3OIQ A;  2IS4 A;  2HPI A;  1NTC A;  2OPT A;  4PCQ A;  1UB9 A;  5E3N A;  3K4K A;  5TJJ A;  2N8G A;  2VQL A;  4M71 A;  1P9Q C;  1WI9 A;  4QPO A;  1RR7 A;  3X2Q H;  5FRM A;  1UG2 A;  3Q0W A;  3AG4 H;  4I0B A;  2DXI A;  1IXS B;  3ZRG A;  2DFI A;  3M7G A;  4XLP F;  2QSH X;  5LLQ A;  3CLQ A;  2LBF A;  3QPS A;  4XKB A;  2G7H A;  3G3Z A;  2ETH A;  1MZB A;  4PDK A;  4D1Q A;  3KP6 A;  1LDD A;  4FX0 A;  3FXL A;  1NK3 P;  3ERM A;  2HQ5 A;  2BXY A;  3ZN0 A;  5ILU A;  3V7S A;  1V5E A;  3ZQQ A;  2DT6 A;  1K4S A;  2O0Y A;  4XLH A;  1WJB A;  2O6G E;  2DBB A;  4XK4 A;  2YR2 A;  3FKI J;  1TWA J;  1CQT A;  2EQR A;  3OOU A;  1TNT A;  2OA4 A;  3VWB A;  3PUB A;  4B09 A;  3OWT A;  2TCT A;  3CCE I;  5E8G A;  2LR8 A;  2H1L A;  4M9Z A;  3Q5F A;  3CUQ A;  1HW5 A;  1TWC J;  3HHG A;  5KNL A;  2R7X A;  3B02 A;  3GBG A;  3K2A A;  5BMZ A;  1B9N A;  5KVR A;  3DLA A;  1RRJ A;  3EUK L;  3LSM A;  1J75 A;  2HYJ A;  1HKT A;  2K4B A;  3BY6 A;  5F64 A;  1NG6 A;  3ECO A;  2YSR A;  2PMH A;  3K1P A;  4LOC A;  5H6Q A;  2UZK A;  1BI3 A;  1XB4 A;  1GXP A;  2QEX I;  2Y31 A;  3V8K A;  2Q1Z B;  2VOD A;  2EA4 A;  2L9N A;  2Z5U A;  2D1H A;  3ABM H;  3ZOB A;  1Z6R A;  4CSW A;  2V4J C;  1J0R A;  4HX8 A;  4GYI A;  2XAU A;  4I02 A;  3ZMU A;  2HOS A;  2R7V A;  2FOK A;  2HYF A;  3K4B A;  5HLI A;  5EEA A;  4BNC A;  3FMQ A;  3KEY A;  4MTD A;  3I4N J;  3ML6 A;  3ABK H;  4LG0 B;  3E6B A;  4QIW N;  1RET A;  3W3C A;  2ZC2 A;  3GTP J;  1YIO A;  1ONV A;  3TBI A;  4DBR A;  2XV4 S;  1OYI A;  1QGP A;  2HXI A;  5HLT A;  3QQA A;  2PJR A;  1CF7 B;  4GXO A;  4PGG A;  3S16 J;  2O7O A;  3AL0 C;  2WAF A;  4G6T B;  4Y7N J;  3BLY A;  4OAY A;  1JKR C;  2H8W A;  5LEK A;  4HQE A;  2ELJ A;  1ZRF A;  2OCC H;  2R7Z J;  4E7L A;  2L0K A;  2X6O A;  3HRT A;  5GAH J;  3D0S A;  2BEO A;  2E2H J;  2ADU A;  3ZR8 X;  4MQ9 F;  3MWM A;  3CZ6 A;  3A1Y A;  1YIJ I;  2D1V A;  5CVV A;  3K6G A;  4CCM A;  2R5Y A;  1STZ A;  5J3L A;  1IN5 A;  4BUP A;  3IP4 B;  1MMS A;  2PBI A;  2QCO A;  1R5H A;  2BW3 B;  2K9S A;  4NNJ A;  4BQO A;  1TT0 A;  1P4A A;  4A2U A;  1FOX A;  2BOL A;  3SDB A;  1GV5 A;  4KN7 X;  2RC4 A;  1U5T A;  1HST A;  3SDG A;  5E18 F;  3WTY C;  3C18 A;  3LL7 A;  5IT9 Z;  2DOE A;  1SFE A;  1Z9C A;  1TC3 C;  5DS9 A;  2PMZ N;  4P9U A;  2R92 J;  1GVD A;  4OIQ F;  3U1D A;  1W1W E;  1QO0 D;  3F3X A;  3LAJ A;  2CQK A;  3ZPL A;  4LLL A;  2LYC A;  3L2U A;  1ZG5 A;  3QPH A;  4I0A A;  1DP7 P;  2K9N A;  1E3P A;  2OZU A;  4XM3 A;  4KN4 X;  4A0Z A;  4WXD A;  4D7M A;  4R79 A;  4OOI A;  3OS0 A;  2X4H A;  1XCB A;  2JK3 A;  4XKV A;  4O6J A;  3I53 A;  2B0L A;  4NC6 A;  4Y13 A;  3LSP A;  2HOE A;  1AKH A;  5HOO A;  3RZO J;  2FBK A;  3H9J A;  2X1C A;  1WRJ A;  4PJL A;  4QWQ A;  3CME I;  5ERI A;  4WWC A;  3OYG A;  3AAF A;  4LIV A;  1YTY A;  2HGC A;  4KFC A;  1OLT A;  4CDG A;  4HLY A;  5TIS C;  4HA8 A;  4S05 A;  1W7P A;  3REO A;  2EFP A;  3SFZ A;  1YX5 A;  5HVQ C;  3OYJ A;  4AIK A;  2R7Q A;  3OYE A;  2K9M A;  4BQN A;  2CJJ A;  5ICE A;  2LKP A;  1G3T A;  1O3R A;  1FBQ A;  3E3V A;  3S3N A;  3IH3 A;  1BR4 A;  2BVM A;  2OQR A;  1HW1 A;  1RC9 A;  2LC2 A;  3BJA A;  2ZME B;  4KMU X;  4Q4Z F;  4HEA 2;  5HS9 A;  1BJA A;  3OIP A;  4ETS A;  5JVT A;  1IRF A;  4CGZ A;  1W0T A;  3ZXS A;  4PJ0 C;  3MMY B;  3GYH X;  1T98 A;  1RKT A;  3HGY A;  5JVG F;  3C7J A;  1SFK A;  4R1H A;  1TBX A;  1FMW A;  4JBA A;  1R23 A;  2DQL A;  4E4H A;  4E6K G;  2F4I A;  3QU6 A;  1O3Q A;  3HOX J;  2I10 A;  4UHT A;  1S7A A;  3WTW C;  4MEY F;  2M45 A;  4M3E A;  3WTU C;  2DAO A;  4A3M J;  1UST A;  2XPW A;  2JVH A;  1ZR2 A;  2L7Z A;  4XOP A;  5F08 A;  5D6F A;  2BBY A;  1S5L C;  1POG A;  1ULY A;  4PFP A;  5DCM B;  2CYY A;  1IC8 A;  4R8H A;  4F52 A;  3LAP A;  4M73 A;  3W6K B;  2E1O A;  1WCM J;  2FU4 A;  1WH5 A;  3GTO J;  1R6R A;  3QP5 A;  4Y52 J;  3AFH A;  2IT0 A;  3PUF A;  1TW2 A;  4A3L J;  1X3Z B;  1J59 A;  4OMY A;  2DLL A;  3TED A;  2TRT A;  3SJM A;  1MNM C;  1W5C C;  1VQN I;  3KEQ A;  4AYB N;  4AUX A;  2CV2 A;  1ETY A;  3WU1 B;  3GTK J;  4C2U A;  3PJR A;  2COM A;  1X2N A;  3L2W A;  2PJP A;  5EGO B;  1BN5 A;  3CDH A;  3VDX A;  2EPF A;  4EM1 A;  3Q3S A;  1LB2 A;  1A31 A;  1YRN A;  3O2P E;  4NUB A;  1SMT A;  4EAT A;  3VSL A;  3BQZ A;  5DM6 F;  3L1P A;  3HEF A;  3HG9 A;  3DTI A;  1JKO C;  2L9R A;  5J1R A;  3JSO A;  2HEO A;  1GLN A;  2Y9Z A;  1X58 A;  2E34 A;  2BXZ A;  2RN7 A;  3RJP A;  1D5Y A;  2E2I J;  1OPC A;  2HWV A;  3F9K A;  2ZXH A;  4ZH4 F;  3GEZ A;  4L9V A;  2OTL I;  2EFN A;  4IOA F;  3PIO F;  1K7A A;  2K02 A;  1RR8 C;  4CZC A;  1MBK A;  2GM4 A;  4JX5 A;  2DFF A;  1SD7 A;  4KDP A;  4IF4 A;  5E1Z B;  1BC8 C;  4RAF A;  4G8X A;  1QHG A;  1FZP B;  2GXA A;  2DTR A;  1IN4 A;  3HRM A;  1MBH A;  5D4S A;  1IF1 A;  1EA3 A;  4C3J J;  1KU3 A;  5L3B A;  1ON1 A;  1XCV A;  2YX4 A;  4HOB A;  2FRH A;  1JTY A;  5BQT A;  4P1W A;  4HRI A;  2ESH A;  3OSF A;  2CH0 A;  1VQL I;  3T8T A;  3H5A A;  1YOV B;  4FT8 A;  4BE0 A;  1I39 A;  4C9Y A;  3FIS A;  1T39 A;  3OMY A;  3VPR A;  3L7W A;  5D8K B;  4E7J A;  1U9N A;  1R7J A;  3VOE A;  1LUJ B;  3DBL B;  5B3S H;  2GIV A;  1Z3Y A;  3H5R A;  4CYC A;  4AYB A;  3A0H C;  3JR9 A;  1X1B A;  1SMY F;  4BBS J;  4YFK F;  1WPK A;  2G7U A;  2DOA A;  3FF5 A;  1IRG A;  1DP3 A;  2P4W A;  4KMF A;  4HBL A;  2IS6 A;  1QRY A;  1FP2 A;  2V6C A;  4ZYD A;  1P2F A;  3HUG B;  1YI2 I;  4B48 A;  4I2O A;  1OCR H;  4I76 A;  5IP7 J;  1WH7 A;  3RDI A;  1R1V A;  4II3 A;  2R7U A;  4M6X A;  3ZQH A;  4CHU A;  4A3D J;  4EGY A;  2XVC A;  1MBE A;  2D5V A;  2AO9 A;  1KQ9 A;  5FO5 A;  3O8G A;  2MD0 A;  4A69 C;  2HQA A;  2ELH A;  2VBX A;  2VOO A;  4Q5S F;  2PFB A;  3MZH A;  1LEB A;  4LJZ F;  2W25 A;  4XN0 A;  1D1A A;  2DYR H;  3CLO A;  3FIW A;  2ICW G;  4HNU A;  1WJD A;  1B1B A;  4Y3O A;  3QU3 A;  4BQQ A;  4N4O B;  1H0M A;  2CW8 A;  1QPM A;  1YJN I;  1R71 A;  1QA6 A;  3WOD F;  2HZT A;  4XLF A;  4L0Z B;  5FRO A;  4FET A;  1SVO A;  2XGD A;  4MIM A;  4NB5 A;  3W6J B;  1MMG A;  3K4C A;  2WBM A;  5K5R A;  1DU0 A;  3VB2 A;  4J01 A;  2OZ6 A;  1ZGW A;  1RUN A;  1Y1V J;  4LG3 A;  5B66 C;  5JLW A;  3HTS B;  3KYC B;  4NHJ A;  1ETK A;  1ETV A;  2QWW A;  1MW7 A;  2CG4 A;  2X6Y A;  4JP0 A;  1XMX A;  2DFE A;  3FXR A;  1K83 J;  3GO5 A;  3HZJ A;  2QQ8 A;  4B3A A;  3PIP F;  1KGS A;  4M9S A;  2CUZ A;  3FXQ A;  2B63 J;  3AKZ A;  4B43 A;  2CS3 A;  3BTC A;  3GZN B;  1AOY A;  2R7W A;  2ELK A;  2ME6 A;  2KKO A;  2W82 A;  1OKR A;  4BGD A;  2DA3 A;  3OYL A;  4M3B A;  3L2Q A;  2JVG A;  3GFI A;  3T5X A;  5C4X J;  5HLG A;  3FXO A;  4IRI A;  3BT9 A;  3BPV A;  5LHH A;  3CO7 C;  3BG5 A;  1I50 J;  3WGG A;  2BGC A;  3W2V A;  3HOW J;  5TGT A;  1QNT A;  4IHT A;  2EV0 A;  4OIR F;  2A6H F;  3J7A O;  2LNB A;  2X1D A;  4FCY A;  5K1Y A;  5ILS A;  2PN6 A;  1RUO A;  3I3L A;  1Y6I A;  2VBZ A;  3EDP A;  2MC3 A;  1IAW A;  2Y0M A;  1XG1 A;  3HGG A;  1EH7 A;  3CUQ B;  2H6C A;  2E1C A;  3PO3 J;  1R4M B;  5AIQ A;  5C3E J;  3R61 A;  2V9V A;  3JRB A;  1P4X A;  2R5Z B;  4X0G A;  1GDT A;  2HZD A;  5GAE J;  3L2C A;  3KP7 A;  1F1Z A;  3CP2 A;  2ZME C;  3HIF A;  5GPA A;  1FBS A;  3S8P A;  1AHD P;  1VI0 A;  3TW6 A;  2IW5 A;  1TL8 A;  1QBJ A;  3GWZ A;  1Q1H A;  1SAU A;  3O6B B;  3VYT B;  4EVI A;  4ZZD A;  3SEQ A;  1D8K A;  4I09 A;  2CSO A;  2W1O A;  3G6E I;  1B72 A;  2VQH A;  1IRZ A;  1YS7 A;  4B44 A;  3CCJ I;  3P9I A;  4BY1 J;  1XMK A;  3CJR B;  1Z21 A;  3DU5 A;  2EBI A;  4U88 A;  1WWX A;  2EZH A;  2W00 A;  4B3X A;  2W57 A;  4OAZ A;  2P0W A;  4ZJZ A;  1PUE E;  3K9T A;  1PUF B;  1NH3 A;  2R3S A;  4AID A;  4CCN A;  2FBI A;  4ENM A;  3P9C A;  3HB9 A;  2IGN A;  3S32 A;  1Y56 A;  1FNN A;  3PQJ A;  1FTZ A;  1BOA A;  3LSG A;  4LGW A;  2PJR B;  1V3F A;  4Y15 A;  1JUP A;  1JI8 A;  2HOA A;  4BXX J;  2Y75 A;  2HOT A;  2CFO A;  2JSP A;  3S1M J;  3M8F A;  3MKL A;  2H09 A;  4IEJ A;  2XC7 A;  4M6V A;  4RGX A;  1HA8 A;  1PJR A;  5K5Q A;  3PFI A;  2BY1 A;  4FHT A;  5F0F A;  1RIO H;  5DUI A;  3IKT A;  1JUS A;  4BAY A;  3HRU A;  5EZH A;  2K9L A;  1L3L A;  1LE8 B;  1DPU A;  1HCR A;  1G4D A;  1LFU P;  1G2H A;  1KQ0 A;  3IC7 A;  2DK8 A;  4I6Z A;  1JT6 A;  2V1D A;  4ON0 A;  3N05 A;  3GTJ J;  2Z33 A;  2JA5 J;  3G4S I;  4F92 B;  3ELK A;  4KT5 C;  4QTR A;  3SXY A;  3TQN A;  3GZ5 A;  3TOA A;  2WAD A;  1IGN A;  1I5Z A;  3K2Z A;  2XUB A;  4EMS A;  1JJ6 C;  1S6L A;  3JTG A;  3OYC A;  2BHY A;  3R4K A;  3MAJ A;  2DOD A;  4M6Y A;  1ZYR F;  1K78 B;  1FP1 D;  3DCF A;  2JSC A;  1SFO J;  2LD5 A;  2XSD C;  2EZL A;  2FX0 A;  2X1E A;  3GFJ A;  5FKO A;  4PJJ A;  5GTI C;  4A3C J;  1LFP A;  1IXR C;  3OL4 A;  5B5E C;  3DLL F;  2QQ9 A;  3JRI A;  5E1W A;  1F36 A;  2E1M B;  4RB1 A;  4Z2Y A;  1HKQ A;  3E5X A;  1YJ9 I;  4IXA A;  4NC8 A;  1ZR4 A;  1XGO A;  1YQA A;  3H1C A;  4UB6 C;  2VT2 A;  2NVU B;  3BPX A;  5H20 A;  1F5T A;  4XR6 A;  2F5C A;  5JI6 A;  2E7X A;  3ZMD A;  2JA7 J;  3KFW X;  2VOP A;  2COB A;  1ZG3 A;  1S29 A;  5M3M J;  4KUM A;  1HXD A;  3ZMS A;  3DBH B;  4BHC A;  3SZG A;  2Y2Z A;  4U0W A;  2WAE A;  4D9J A;  3Q0V A;  3OR2 C;  1SAN A;  3CF2 A;  3O8H A;  3WHB A;  1YLF A;  2MD5 A;  2ZFU A;  3J7A Y;  2DFH A;  5J47 A;  3TO6 A;  5L3E A;  4JX6 A;  3BG6 A;  2P81 A;  3F8B A;  2J5O A;  2P5L C;  4WXC A;  2X51 A;  4RAG A;  1TWF J;  3PSF A;  2KLO A;  1GUU A;  3FMR A;  3RPQ A;  1J9I A;  1JHH A;  1B9M A;  2WTE A;  5BNG A;  5C44 J;  4KYW A;  2E35 A;  3DPU A;  1TP4 A;  4XOT A;  3NAU A;  1B59 A;  2I8D A;  1MJB A;  5J4Y A;  3M4O J;  4XLN F;  4ZZL A;  3QP6 A;  3O3K A;  1A35 A;  2RQP A;  4OWR B;  2ID3 A;  5E3M A;  2RQQ A;  1QZE A;  5ILV A;  4DZJ A;  4L18 B;  2QKL B;  5E1X A;  1LQ1 A;  3V42 A;  1H9G A;  2P5V A;  4RA2 A;  1IV6 A;  3H0G J;  1MBG A;  3TW7 A;  3HPH A;  1F9N A;  2OAZ A;  4BDZ A;  3I5U A;  2XAQ A;  2XB0 X;  2LY9 A;  1HKS A;  1HLV A;  3RYR A;  3LFK A;  4CIC A;  3HTU A;  1JE8 A;  2HI3 A;  1H89 C;  4V19 K;  1OCT C;  2NAZ A;  4C30 A;  2LRD A;  1UHS A;  4E7I A;  2VON A;  1X1A A;  3VFZ A;  2Z3Y A;  4ZDL A;  1ITY A;  1Y8R B;  2FQ3 A;  3KCC A;  3U9G A;  1VQ9 I;  1FOW A;  3CD6 I;  1KU9 A;  3I59 A;  4WXH A;  1ETQ A;  2CWE A;  2EK5 A;  3C3W A;  5HDK A;  2YPR A;  1NK2 P;  4EV0 A;  2ZB9 A;  3FXJ A;  1BM9 A;  2P5K A;  2LY2 A;  1GXQ A;  2JMW A;  4XRF A;  1ZEL A;  1Y8Q B;  2IRF G;  3H35 A;  1BR1 A;  2DT7 B;  1YRN B;  3S2D J;  2WV1 A;  1XDU A;  1EH6 A;  4ABZ A;  4BBR J;  2ISZ A;  2XDV A;  2VBY A;  4OIN F;  1UEL B;  4PFO A;  1YG2 A;  1Z7U A;  5FD5 A;  3RKY A;  1T0F C;  1HF0 A;  1IUY A;  3WU0 A;  2WV0 A;  5IYC J;  3HXL A;  1HDD C;  1DGW Y;  4Q47 A;  1YW8 A;  4LIU A;  4DIQ A;  1W36 D;  2W7N A;  4DOZ A;  2XF6 A;  2M8G X;  2X48 A;  5M5W J;  4RDU A;  3AG3 H;  2FF4 A;  3H92 A;  3BCB A;  3IH4 A;  1FWZ A;  4N9I A;  2ZJ2 A;  1IW7 F;  1U3E M;  5J8C A;  2KZG A;  4GGG A;  2G9W A;  2VQG A;  2IA1 A;  1KQ8 A;  3QYB A;  2F4M B;  6PAX A;  4BKX A;  1JHF A;  3GTL J;  1YS6 A;  2O8K A;  1W36 C;  3H36 A;  3TDU C;  2DA7 A;  2F6C A;  2KDO A;  1Z05 A;  2NS7 A;  3CCS I;  1B8I A;  2HVS A;  4IHY A;  3V7C A;  2HPM A;  3FDY A;  1JXS A;  4L0Y B;  2MLK A;  1DPR A;  2W85 A;  1R00 A;  3E1S A;  3NRV A;  4PGH A;  1FSE A;  3UKG A;  2ZJQ F;  4A6D A;  3D5S C;  4XOR A;  4A3E J;  1T95 A;  1TW3 A;  4UXN A;  3CJN A;  2IS1 A;  2LDU A;  5DTD A;  2VQC A;  5F27 A;  1LDK B;  3LQR A;  3A0B C;  4QLC U;  2DT5 A;  3L2V A;  1Z67 A;  5A2Q K;  1VQ6 I;  5D4R A;  4MFD A;  3WTX C;  1BBY A;  4M74 A;  1A5J A;  3W2A A;  2KIM A;  4AC0 A;  5HS7 A;  2LFB A;  4ASN A;  1X2M A;  5LEJ A;  2XPU A;  2NS0 A;  1FT9 A;  4U7D A;  3KIO A;  1XTA A;  5KK1 A;  4DYQ A;  1O3T A;  1USS A;  2RRE A;  1T6S A;  1N25 A;  2UXN A;  3RYP A;  2Q2E A;  2DI3 A;  1CGP A;  3TGN A;  2DCE A;  3HSR A;  1KYW A;  5EG0 A;  4UUS A;  3W6V A;  1FYK A;  2AXT C;  5B1A H;  1U6G A;  2CU7 A;  2MBF A;  2WAQ A;  1X3U A;  3T1B A;  5CYV A;  2DA4 A;  2UUZ A;  3B73 A;  3NEU A;  3KPH A;  2HDD A;  4MFE A;  1X19 A;  3IAM 2;  3DV8 A;  1WGX A;  4KIT B;  4XKW A;  1OR7 C;  2NOG A;  4B8X A;  1XSV A;  1SFX A;  1VQ8 I;  3ROU A;  3MVP A;  2XAF A;  3ZQL A;  3RPU A;  2NOJ B;  1ZRC A;  2FSW A;  4IZZ A;  2L01 A;  1D1C A;  2UWM A;  3GFL A;  2QLZ A;  3FBI B;  2IPQ X;  4EJW A;  5JR3 A;  3I4M J;  2VXZ A;  2JA8 J;  3M3Y J;  1FY7 A;  4XNF A;  4U0V A;  3C1D A;  2VC0 A;  3OS1 A;  1BI1 A;  4QPQ A;  4DZP A;  4IX7 A;  2VKD A;  3S2H J;  1J2X A;  1OMI A;  2R7F A;  3IRR A;  4L9N A;  2F4O B;  3NWS A;  4NQW B;  2QKM B;  5FLV A;  3DEE A;  3KZI C;  3MZ8 A;  3G2B A;  1S3J A;  3COA C;  4HNV A;  2NS8 A;  2WY7 Q;  3MKY B;  3D1N I;  3RSN A;  4GYG A;  3A01 B;  2Z16 A;  4GDF A;  1ORK A;  3EET A;  2KRH A;  3FM3 A;  4IO9 F;  2JA6 J;  3G1L A;  4BEH A;  2HKX A;  2JT1 A;  1BA5 A;  3QPL A;  1A6Q A;  2FJ1 A;  2VJI A;  5EYR A;  2VI6 A;  2VIX A;  4Z6Y A;  3KP4 A;  3ESW B;  3OYF A;  3CCR I;  2Z9O A;  1I3Q J;  4BY7 J;  3CO6 C;  3CUO A;  4WX9 A;  3I54 A;  5ED4 A;  4NC7 A;  1QVU A;  2IGM A;  2R7R A;  1FJL A;  3CC2 I;  1FOY A;  2K3P A;  3DEW A;  5HNH A;  3GLL A;  1MND A;  3C2H A;  5K5O A;  2LMD A;  5IYB J;  4HNT A;  5HOD A;  2M5W A;  3J81 K;  3BR3 A;  2DQR A;  3DQV C;  1S8N A;  2RNG A;  3JRH A;  1XGN A;  3OYM A;  2Y69 H;  2DA6 A;  4PSX A;  3OYK A;  1XPX A;  5JHU A;  1XSD A;  3L09 A;  4IVN A;  5FLX K;  2OCE A;  3S1N J;  3LWF A;  2PEX A;  1WQ2 A;  3QAH A;  1P92 A;  4LIT A;  3TDZ C;  2OV7 A;  4CO8 A;  1K79 A;  1ZK8 A;  2KFD A;  4D5F A;  3WU2 C;  2RKH A;  2R7T A;  3JW4 A;  1XMA A;  4A6E A;  3L2R A;  5M5X J;  4MQV A;  2FQ4 A;  3J80 K;  1WHU A;  3V7R A;  5L3C A;  4HV6 A;  2C6Y A;  1XD7 A;  2RVC A;  2L7K A;  1ZGA A;  4G7O F;  4M3G A;  1A04 A;  4X1E A;  3B6C A;  3LA3 A;  2XGC A;  4RS8 A;  1TLH B;  3RCO A;  1H88 C;  4XRS A;  2OQG A;  3WTZ A;  2GOX B;  3JRE A;  3Q0U A;  3OIO A;  2NXN B;  1SC7 A;  2XAS A;  5FLM J;  4FIS A;  4P55 A;  2IAI A;  2JZY A;  4K2E A;  3FMS A;  5LGT A;  1QZY A;  2LVS A;  3JRG A;  1PDN C;  2QBY A;  4F3Q A;  2OTJ I;  2IGO A;  2JQ7 A;  3JRC A;  1N78 A;  4RAY A;  5HDN A;  4FQG A;  1UMQ A;  3N97 A;  3LSK A;  1P7J A;  4BU2 A;  2VE9 A;  1ZRD A;  3K4L A;  1E3O C;  2YS9 A;  1YIT I;  3DP7 A;  5J4V A;  1ZG1 A;  1S7O A;  1X1D A;  5HLH A;  2M7A A;  3LFU A;  1MJ9 A;  3FM5 A;  2W4S A;  1OYW A;  3BR0 A;  3IRQ A;  2JN6 A;  3ZQ7 A;  5K7F A;  2W24 A;  4HQM A;  5LGN A;  3BR1 A;  1EJ9 A;  2GLO A;  1JT0 A;  5D8L B;  2ZSI B;  3KLN A;  3H5N A;  1R49 A;  2XF5 A;  1OIS A; 
#chains in the Genus database with same CATH homology
 1OQY A;  4YIR X;  1PVE A;  2F4O B;  1X3Z B;  1QZE A;  1X3W B;  2QSF X;  2QSH X;  2F4M B;  2QSG X;  1TP4 A;  3ESW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...