3ESWB

Complex of yeast pngase with glcnac2-iac.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
SIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
total genus 19
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 3eswB00
2QSFX 2F4OB 2QSHX 1PVEA 3ESWB 1X3ZB 1OQYA 2QSGX 1X3WB 1QZEA 2F4MB 1TP4A 4YIRX
chains in the Genus database with same CATH superfamily
3OL3A 1FSEA 4HQMA 2HEOA 2ZFUA 3FX3A 3IUOA 2OTLI 1YO5C 1SD7A 2MD5A 1R4NB 4ETSA 1MMNA 3PM1A 5B1BH 3VB2A 3CC7I 2GXGA 2XPVA 1XDSA 3KZZA 3C1DA 3RDIA 2F6CA 2DXIA 3F21A 3OYNA 2VC1A 3PFIA 1TWCJ 2E7WA 3I55I 2E5NA 2PMHA 3LFUA 3F23A 4V2GA 4ZDLA 1UCRA 3ZN1A 1P7JA 3CC2I 4ANJA 2JPCA 2YU3A 3EDPA 3RZDJ 2VQLA 5F08A 3K4CA 2X6XA 5LGUA 1DPUA 4RA2A 3JRGA 1TLHB 4QSHA 4A2UA 4GYGA 4P1WA 3H9GA 1DU0A 1VF9A 3K9TA 2KLOA 2UXXA 4LLNA 4L9VA 3OYFA 4L9NA 4PK4A 1D5YA 1A35A 2ZKZA 5JHUA 2XAQA 4MO7A 4RLQA 5IT3A 1YLFA 1A31A 3BG9A 1EH7A 4XLHA 4MLOA 3K4KA 2QQAA 4A0ZA 4LFUA 2VT2A 3RIRA 1BL0A 2F5DA 3ZQLA 2KRHA 5CVIA 2ZB9A 5GTHC 2DA6A 1NH3A 4A3GJ 3WG7H 3W6VA 1ON2A 3DBLB 2VPRA 2GA2A 2M8EA 2L01A 1LUJB 2MBFA 2ZXWH 2Y69H 2UV1A 3MEXA 1SEUA 1YFHA 1PUFA 2DBBA 3S16J 2STWA 1ERDA 1NG7A 1O4XA 1G3SA 2L7MP 2ECBA 5AIQA 5L3EA 4GXOA 3ABLH 3WU2C 2HQAA 1T0FA 2I5UA 2P6SA 3DTIA 4YIIA 4A0YA 4LB5A 3FXUA 4I98B 5CKTA 3E6CC 3DPLC 4Y13A 5ICCA 5K7HA 3HIFA 1I27A 3F6OA 4CCJA 3ZXSA 2P5LC 1SC7A 1OQYA 3H3VK 5F04A 5IP6A 3MKYB 4BNCA 2LSOA 3J7ZI 4FTHA 3EUKL 4ENMA 1ODDA 1RKTA 2XUBA 4CYCB 2VC0A 4BE0A 2QBYA 5ED4A 5FFXA 2IS4A 1K61A 2WTEA 2A07F 1ZH5A 3K70C 3BT9A 1Z91A 4GGGA 5E1XA 3BQYA 1OISA 1XTAA 2IP2A 2QQBA 2ZMEA 4BL0B 2COMA 4GO1A 4I6ZA 2Q0OA 1D1AA 5E17F 1WJCA 1MBFA 2LOOA 5GAGJ 2E71A 2ZJPF 3CCSI 1O3RA 1Z6TA 2RNGA 4FE7A 3SFZA 4L0YB 4F55A 3GTLJ 3VPRA 4OMZA 1X2NA 3VEPA 3L9FA 3B73A 5DUKA 4U0WA 5CLSA 3FBIB 3CDHA 4HDVA 3CZ6A 2F4MB 3JR9A 2M45A 2K9MA 1KZHA 2M1BA 2R7FA 1J9IA 2M0CA 2XHKA 4CXFA 2VB6A 1X1PA 3CMMA 4X1EA 3D5SC 4PFOA 3SZGA 4EV0A 3ULQB 3OY9A 2LC2A 1HKQA 1W0TA 1GV5A 3EYIA 1MBJA 1S72I 2K7LA 1U8RA 3E1SA 2M87A 1LFPA 1SAUA 4FX4A 2ZJRF 1YW7A 4YEJA 3DU6A 3N4MA 4UVCA 2IXSA 2K40A 3ASNH 5J1RA 3FWEA 1H0MA 3A1YA 3M8JA 1WVRA 2LNBA 2OBPA 4PGHA 1CGPA 4F92B 3LA2A 3IKTA 4I2OA 3F3XA 1ETYA 3KZYA 1T98A 2CWEA 1HLVA 1E0EA 1QA6A 5CVJA 4NNJA 2RREA 3QPSA 3E97A 4BACA 4BY1J 1IRXA 3ELKA 2FEZA 1QO0D 2CUJA 1KQ8A 2JUCA 3HUGB 3RJPA 3UNGC 3HHHA 1X1AA 2WA0A 3FXJA 1RNLA 1WJBA 4DW6A 1IJWC 2VKEA 2WB1N 4OWRB 3HSEA 3ZGKA 5FKOA 4IJAA 2VT3A 2MLGA 2DDBA 2F5FA 1M1EB 2Y75A 5HDNA 1R4MB 3E6MA 1LNWA 3MZ8A 3NEUA 2MGQA 1EJ9A 3BR5A 4N9IA 4X0GA 3KP3A 1S9HA 4RB2C 2R7XA 1K78B 2DFFA 2KPMA 3Q9VA 1IC8A 3BJOA 1DGWY 4D7MA 4E70A 4RGUA 3H0DA 2OC6A 3B6AA 3VYUB 4CA0A 4KJZA 4K2EA 2V6EA 2L0KA 3M4OJ 1X58A 1N75A 2LRDA 2VBWA 3K4NA 1D5VA 2BGCA 5FKKA 1FOKA 1OJLA 4IO9F 2E34A 1SVLA 2K3PA 2R4GA 2OD5A 2NOJB 3CLQA 2XAGA 2FBKA 4XMYA 5F64A 1U5TC 1XCBA 1Z7LA 5HLIA 2K85A 2MYSA 5K1YA 3GTOJ 4WF2A 5K5OA 1WJEA 2FSWA 3I4NJ 1HSJA 3I5UA 2M30A 1JI8A 1QQIA 1G8XA 3T8RA 4CSWA 3CCUI 1F4KA 2V79A 3HOZJ 2A6EF 3K4MA 4I7HA 2AS5F 3KLOA 3K70D 1IGNA 3ZMZA 4V19K 5FFZA 4XSXF 2XB0X 1BJZA 1G3YA 3C18A 2JN6A 3ZPLA 3QPTA 3WU0A 2WAFA 3RTRA 3T5XA 5ICGA 2F2EA 1WJFA 3BROA 3BWGA 5D5XB 3MKWB 3JRCA 5CPRB 1HDPA 4M3GA 1TWHJ 4UB8C 4KN4X 3ERMA 2K27A 3DWLE 4PSXA 1VNDA 2M5WA 2O8XA 2A6HF 2Z99A 1RKWA 3SZPA 3I54A 2DFIA 3QPHA 4RM2A 4IRIA 2QLZA 3HEFA 5KCMA 2L9VA 2X1DA 4QIWN 1FSHA 2HQ5A 4OIQF 3MQ0A 2HKOA 2GAUA 2FD5A 3ZR8X 4I0AA 1RI7A 4ZZLA 4ZTJA 4F91B 1JT6A 3KE2A 4EATA 4ZTFA 4XRSG 3E5QA 2OCCH 4BXXJ 4XR6A 2XRNA 1XMKA 1HOMA 3K10A 1W7PD 2WAEA 3HRSA 1RC9A 1V54H 3FKJA 5C3EJ 1WGXA 2HDDA 2WV0A 4RB1A 2ISYA 3NWSA 1QRYA 3UKGA 3BDDA 4Y52J 3H0GJ 4Y3OA 1W7PB 2HZDA 3MAJA 4UUSA 2KIUA 1KU7A 3NARA 1ZARA 3RKQA 1OFCX 3JTHA 3LQQA 4MFEA 4OAYA 3ABKH 2IT0A 1GVDA 2F48A 1GXPA 2WC2A 2CUFA 2AQEA 3RQ4A 5GPAA 1FNNA 3BR1A 1OR7C 1IO2A 5DYMA 2HNHA 2XGEA 5HDKA 1Y0NA 2HGCA 3BOQA 3QYBA 4MGRA 1K4TA 2LREA 1TWFJ 1ORKA 3PUFA 5C44J 2DT5A 3L7WA 4RB0A 1OCRH 2NVUB 5LRRA 3DFGA 4ESBA 4PJLA 4IZZA 5D6EA 4DBRA 3OOPA 1FMWA 2JWTA 4AC0A 4HV5A 2PN6A 4I76A 4D9JA 3G2BA 4CCOA 2EK5A 3CJTB 4BEHA 2E1MB 1LDDA 1J09A 1EV7A 2FU4A 3J81Z 2CRGA 3FHNA 3G1MA 4J00A 2AHQA 2JVGA 3HRTA 4XNFA 3Q5FA 2D5VA 5DCMB 5AIPA 2BBYA 3ZMTA 4A3CJ 5E1WA 2ZO4A 1XPXA 5E3LA 4B48A 2DK5A 1O3TA 4E7HA 4RB3C 2JMWA 4Q47A 2R5ZB 2E1CA 2R7UA 4RGXA 4BUPA 2BY1A 3GTPJ 4L18B 1E2XA 3HKZA 5M3MJ 1RIOH 3RQIA 2M3AA 2D1HA 3SEZA 2V1UA 4TV7A 2NRAC 4CCLA 5BQTA 2IA0A 2XPWA 3KEOA 3WTXC 3HOSA 2Z33A 4NDLA 2XF5A 1ETWA 5E79C 4EM2A 2IGOA 4HDUA 2M7BA 2EZIA 1AU7A 3H92A 3BG3A 1DP3A 2ZMEC 4IXAA 1IN7A 5H2FC 3G73A 4Z2YA 3S1RJ 2B0LA 2D45A 1T0FC 2P5KA 2XB5A 3E6DA 4M6VA 5EYRA 4DYQA 3OR2C 2ETHA 3CQZJ 4CUGA 5DTDA 3BCBA 5HS8A 1U2WA 3LQRA 4M73A 4XLFA 3I56I 3BG5A 1BI0A 2VKDA 3BTLA 4A3LJ 3HZJA 4BQNA 5DDGA 3VSLA 1V5FA 3TW6A 5BS6A 2QVOA 3LL7A 1IG7A 3S17J 5D5WB 2PG4A 2CV1A 2X48A 4ZDOA 4BY7J 4A3DJ 2QEXI 1PJRA 1ZG1A 2DK8A 2H8RA 1CQTA 5J1YA 3E7LA 1TC3C 1ENHA 2L4MA 3H5NA 3FF5A 3PFYA 2EQRA 2KIMA 3AFHA 4M6XA 2BW3B 2TCTA 2JSPA 1J0RA 1MJBA 1IV6A 4M3FA 3V4GA 3SZTA 2ELKA 4YFKF 2XC7A 5GTIC 3CUQC 1OCTC 3K1PA 2DYSH 2ZNZA 4BHPA 2R92J 4D5CA 1XMAA 2E1NA 1X2MA 3JAMK 5E18F 3J7AO 1FY7A 3DCFA 4DYRA 2NS0A 3ZOBA 1FC3A 3L2RA 4Y4RA 1SFOJ 2VN2A 2AXTC 4HRIA 1MD0A 4BAYA 3WTYC 4LG0B 3JAMZ 3BP8A 2M8GX 1BM9A 3WTSC 3H35A 4KIGA 2L02A 1KQ0A 2DU9A 1B1BA 2FNAA 2X0LA 2MLKA 5M3FJ 3HYIA 3CDLA 1S6LA 1D8JA 2I8DA 2RKHA 2FA5A 2MD0A 2XPUA 1V5GA 4YIRX 3PQJA 4PUSA 1U9NA 3CF2A 5E3MA 3QP6A 2XSDC 2E35A 4IHXA 1IUYA 2DYRH 1VTNC 3GX4X 3AL0B 4EEFG 2W24A 1ZK8A 4II2A 4XOTA 4A93J 3S32A 2H94A 1SD5A 5EEHA 2E2IJ 2FBIA 3HRUA 1DQUA 2QZ8A 4NQWB 3P9KA 4KT6A 1VFCA 1KU2A 4C2TA 1W4MA 3A02A 3Q0WA 1D1CA 4XL9A 5LGNA 2FUG2 4G6DA 1VQ8I 3CCRI 3TP0A 2JT1A 4ASNA 5C4JJ 2XGCA 3A01B 1F1ZA 3QRFF 3GW2A 3KEYA 2K02A 5EGOB 2HKXA 4F93B 5HLHA 2EV6A 2LF8A 1UHMA 4P9FA 5CVUA 2IA1A 4WXDA 4XIDA 3WGHA 1TNTA 1ZREA 1K6YA 2BHYA 4AIJA 1APLC 2R3SA 4XOPA 1O57A 3VDXA 2XF7A 1ZYRF 1XSDA 2H1LA 2MA3A 2W25A 5H20A 1D0XA 1WQ2A 5FROA 4XN0A 4UV8A 2HPIA 5J8CA 1V55H 5EEAA 3KYDB 3DKWA 3O8GA 1FLIA 1U5TA 1ZKGA 4XLEA 2A69F 1MMSA 3TMOA 2YUSA 3V7RA 4PCQA 2OQRA 1X4PA 2LKSA 2HVRA 4R8HA 4UHTA 3J80K 5FRMA 1MSFC 3S2DJ 3R61A 4NC7A 5HLTA 1LVAA 4A3BJ 4ENJA 3H1CA 3KCCA 5L3CA 2IRFG 4B4CA 2UZKA 3A03A 3HSRA 4XLNF 1ZGAA 2DMNA 1SVMA 1BA5A 2ZJQF 2DT6A 3E5XA 5FJ8J 1R5ID 1C0WA 2DA3A 3OWTA 1RPWA 1B4AA 3WHBA 4QTRA 2IA2A 4DBQA 2HU9A 2OZ6A 2XGXA 4NUBA 3TL4X 4RM3A 2F4OB 3GFIA 2PQ8A 3CO6C 3DPTA 1YYVA 4WXHA 2DPUA 2VOOA 4IHTA 3D5LA 3SDBA 3LWFA 4A3EJ 2A5YB 5F1RA 2LKXA 2JPBA 3W6JB 4ZH4F 4F52A 5L3GA 3GUDA 5FRNA 3I58A 3D0SA 1X4OA 1BBYA 4I09A 2IAIA 1OYIA 3P7NA 3TOAA 4HPQA 4LLGF 3IL2A 2DDAA 2CQQA 4FT8A 3HOTA 3JRFA 1YITI 2GQQA 1WZ2A 4H0EA 3RZOJ 2KMUA 3UR3C 2ESNA 1HXDA 2FNPA 3A0HC 4HQEA 4IX7A 2UWMA 1P9QC 2Q1ZB 1RUOA 3ESWB 4ZYEA 4Q5SF 4LITA 4KYWA 2QENA 3JCUC 3CLOA 2K5CA 3WTZA 3QODA 4BHCA 3HM5A 1AA7A 2DTRA 1VZ0A 4EJTA 3O6BB 3H5RA 1SFUA 1HC8A 1IXSB 2KRCA 2Y48A 3EUHA 1OMIA 5H6QA 3SQNA 3VODA 1FIAA 4LIUA 3BQZA 3CD6I 4IVNA 4BE2A 2VJIA 4AIDA 1PP7U 1Q1HA 1N78A 4L9TA 2TRTA 4Y33A 3H9QA 1XGSA 2HOEA 1U9OA 3GWZA 3MMYB 1P6RA 2DMTA 4CZCA 2RQPA 3ZQCA 2IS6A 5GAHJ 1U3EM 1P4WA 2XVCA 3GFMA 4G7OF 3TP3A 5F0HA 3LAJA 1H89C 2E7XA 3HL2A 1LVKA 2EV0A 1UELB 5CVVA 1FYLA 3PNYA 3CESA 1S5LC 2HI3A 4KFCA 1JTYA 4RAGA 2Z9OA 3GTMJ 2OQGA 2VQGA 1Z3YA 4IRHA 1LPQA 1ZGJA 3C3WA 3WTVC 5F6FA 2COBA 3AKZA 2XKOA 1R22A 3HB9A 3HC7A 3K4JA 4PJJA 3WG9A 2DFHA 1SAXA 4UUSB 2HTSA 1HBXG 4CYDA 3G6EI 1QPIA 4BQAA 2VKHA 5JFRA 2JJ7A 1I5ZA 5IOZA 1UZCA 1VQKI 2VIXA 3L09A 4A3JJ 2ISZA 3F0CA 4DZPA 2CV2A 3FXMA 1BC7C 4HSRA 2CS3A 4UV9A 3K4BA 3FK6A 2DQLA 4MEYF 3CCVI 2VL8A 3CUQA 1UHSA 1L3LA 3TO7A 1LKXA 1AWCA 5IT9K 2D1VA 1KU3A 1W36C 3MKLA 1BI2A 4HEA2 2DLLA 3WE3A 2ZC2A 4HA8A 5K5QA 1ZR2A 1OYYA 1X1DA 2NYXA 4A5MA 5B5EC 4IF4A 3QPLA 2O8KA 3RCOA 2W1OA 5HS9A 2E1MC 2P6TA 1D0ZA 3HXLA 4IOCF 1RR7A 2CW0F 4LK0F 4C3IJ 1F9NA 5LEJA 3HGGA 4HAMA 3MKZA 3TW7A 2R5YA 3RI4A 2LD5A 1J5YA 1PUFB 2BEOA 5DD8A 2AO9A 3PL8A 3R0JA 4O5VA 1YOVB 3ZQHA 4OMYA 1ZHFA 5DCMA 1ZAOA 1QZYA 2RV8A 2B7EA 4E7SA 4BE1A 2R7QA 3H5AA 1R49A 2K86A 2R5ZA 2LFBA 3I59B 1EKEA 1MNMC 3CP2A 3FK7A 2B9SA 4I02A 4WCGA 3D1NI 4J19A 5ICFA 2V1DA 5B66C 2O61A 4Y15A 2N8GA 5J4YA 3LSRA 1BC8C 2X4HA 4M3DA 3TDUC 3JRBA 1LDKB 5ERIA 3ZQQA 2H09A 2NOGA 2FX0A 5CYVA 4A6DA 4M3BA 3ZQGA 5DS9A 3Q0VA 4YFNF 3HDDA 1IZ1A 2Z5UA 3G3ZA 2LTPA 2E19A 2OU2A 1VQ6I 3T0YA 3M1CA 3PIOF 1O7LA 3IAM2 5JI6A 4UVBA 1UG0A 4B1RA 3DEEA 5L3BA 2M4GA 1K83J 1EA3A 1BR2A 2WADA 3GTGJ 1JXSA 2KZGA 3O2PE 5E8IA 3HGYA 3CP8A 1XC5A 3FMSA 2RNJA 1VQ7I 1D0YA 1ZTRA 1YQAA 3RPUA 2O9LA 4PGGA 1WPKA 2BY0A 2PMZN 1H9TA 2LP0A 3S3MA 3GFLA 3HJEA 3KP6A 5LBQA 3HHGA 1XMXA 5E8GA 1YJNI 4GDFA 1BN5A 2XAJA 2A6TA 2GA1A 4WX9A 1LDJA 5F0FA 3DKXA 4YIFA 2G9WA 3JSPA 1OCPA 4RAYA 2OCEA 1UHWA 1S7OA 2IW5A 2QWWA 3H9JA 1W5TA 4CDGA 2F5EA 5ICEA 3FDYA 5FKNA 1QVUA 5GP9A 4G6TB 1KA8A 4IL6C 3ERED 2HDCA 3Q9SA 3WE2A 4G7ZF 4KDPA 3JREA 3OIPA 2JA7J 2IVMA 3OR1C 1TWGJ 3S1MJ 3LSHA 2OAZA 3BZ6A 2B63J 1YX3A 2DA2A 1S8NA 2E60A 3FZVA 3SDGA 2JA8J 2QM3A 1MBHA 1S29A 3KLNA 4FX0A 3T1BA 2GXBA 1TT0A 3M8EA 4C9YA 2BV6A 4ZDPA 4Q4ZF 4DOZA 1I6XA 3S3NA 2DAOA 3WTWC 2V9KA 3ZRGA 3M07A 5IY5H 3EQLF 1WFXA 1TBXA 5ILVA 3EUHC 2M9HA 5LHHA 2PJRB 4UUTA 1T95A 1WH7A 2L2OA 4RMNA 5GPCA 1G4DA 4YELA 2JRMA 4PJMA 5FD6A 1YRNA 2XASA 4J01A 1HA8A 3LFKA 3T8TA 1ITYA 3PO2J 3G1LA 4XONA 1D3YA 1PDNC 1STZA 2FMYA 1YS7A 2RQQA 2VJJA 2W84A 3AG3H 1JGGA 2FF4A 2DT7B 3F8NA 2HTJA 2X1EA 2M2EA 3DLLF 4S04A 4N4NB 4PJNA 5EGOA 3ZP5A 2EZLA 5BNGA 1X1BA 1FTTA 1YG2A 3TO9A 5IYBJ 2A68F 5D8KB 2NS8A 4G8XA 1HW1A 1JHHA 4LLLA 1VQPI 1XD7A 2XKPA 2BXYA 5KK1A 1UAAA 3GTJJ 3OMYA 4BBRJ 2IPQX 3ZMUA 3GLLA 4BDZA 3AG2H 4NBQA 5LD2C 3A0BC 3N05A 4A69C 5FLVA 4N9HA 2L9NA 4XKWA 4IPAA 3GZNB 1JUMA 1R5GA 4ESFA 4ENKA 1R5HA 1MNEA 1DU6A 1BOAA 1DGRM 3TEDA 1A36A 1IXRC 2Y9YA 3EYYA 3WTTC 2M0MA 1QPMA 5HDGA 3FXOA 2ZSIB 4IHYA 3L1PA 1Z3XA 2VI6A 1WJDA 4D7NA 3OYKA 2HPMA 3ZMDA 3DEWA 4E6KG 4D5FA 5L3FA 2KZVA 3LSPA 2EIKH 1BR1A 4U88A 2K3FA 1IN6A 2GM4A 2NS7A 3LA7A 3AL0C 1MZBA 2HQNA 1ZG3A 4M6YA 5E20A 3BG7A 4II3A 5IPAA 1HCRA 4PSWA 2P8TA 2WBMA 2HOTA 5IYDJ 5JHFA 1TNSA 3OIOA 4FISA 1J2XA 4RGSA 4I0BA 3RPUD 1HQCA 1G59A 1R1VA 2W7NA 1MDMB 2H1KA 1QVTA 4CGZA 4OIRF 3FXQA 2XSJC 1J59A 3HBLA 1YW8A 2CQXA 3FIWA 4KN7X 3IH3A 5FKLA 4X6AJ 4XKBA 2Y30A 4ON0A 2EA4A 4HBLA 4RBOA 2EV5A 1R58A 3OYCA 2KIFA 1HDDC 2BY2A 1LQ1A 4DGWB 3U9GA 3COAC 4QWQA 4LIVA 2R7VA 2C6YA 3ZQIA 3E5UA 3J80Z 2JA5J 4A5NA 4E7ZA 4XRMA 4GRIA 3K1NA 1R00A 1QU3A 3HSFA 1MNDA 3BTJA 5J40A 2LF7A 3V42A 5L3DA 3MVPA 3SYTA 4RLFA 3CMAI 2QSHX 1V5EA 2RC4A 5BPIA 4BQOA 2WAQA 2BY3A 5TGTA 3M1EA 2L54A 3SEQA 2WWYA 5DEQA 3KX2A 1EF4A 2ZNYA 5TISC 1ZG5A 1FWZA 5LLQA 3FM3A 1Z6RA 4B3XA 3BCAA 2PX9A 3F72A 2ESHA 1O7FA 2CYYA 1OCZH 3EPZA 2GOMA 2LY2A 2GOXB 2EFWA 3CC4I 2BYVE 3R4KA 1B9NA 2O7OA 1A04A 2DOFA 2XAHA 4BDYA 1AOYA 3GYHX 3RKYA 2CUEA 1LEAA 1MGTA 1W0UA 5H6RA 2ZXIA 1PP8F 3WGGA 1QNTA 4IHVA 3KEQA 3PQKA 2Q2EB 4EVIA 4G12A 2RVCA 4LG3A 3B02A 2DO7A 1GDTA 3BLYA 4H4KC 3W2VA 3KYLA 2X6OA 1VQLI 3PJRA 1NK3P 1X1CA 3BC8A 1TTYA 3BZKA 4XRFA 3V7SA 4ZYGA 4EM1A 4KITB 1MBEA 1Z0XA 2KHMA 5E3NA 2DN0A 2EILH 4G6QA 2RN7A 3FISA 3GTKJ 2VXDA 3FXKA 4ESJA 2PJPA 4DIQA 3QYEA 2CV0A 2GBYA 3GF2A 4RGRA 4ITVA 2Q8KA 4PJ0C 1AHDP 3RKWA 3FXLA 1DPRA 3PNVA 1YI2I 4S0HB 2X85A 2VQHA 3QU3A 2YSRA 2DOAA 4P9UA 2NVTJ 3G71I 2DPDA 2IS2A 1RUNA 1F43A 3OYLA 2JUGA 2R7DA 2ZJ2A 1XS9A 4YFXF 2DI3A 2LVSA 3JTGA 1E3OC 5LEKA 2NNNA 4KICA 1Z21A 1JUSA 2Z3YA 3CUQB 3RSNA 1JJ6C 2BVMA 1HKSA 2F4IA 5GADJ 3HG9A 4W97A 5HNHA 2CQKA 2KIQA 2O3FA 5KNLA 3DPUA 1IRFA 3L2CA 1I1SA 1E3PA 3OIQA 4B09A 2NVYJ 2HXOA 3OYBA 3S8PA 2CW8A 4HZFA 4JP0A 2KDZA 3GFJA 3IWFA 1H9GA 5EG0A 2LH9A 2CH0A 1K6OA 3OL4A 9ANTA 2BW3A 4NC8A 3FM5A 1U78A 1R71A 1WI9A 2NNYA 4AWXB 1ONVA 2BOLA 2LDUA 2OJED 3HRMA 3HOVJ 3BPVA 1FTZA 2VASA 2X6YA 3LMMA 3I59A 3NQOA 3DF8A 3M7GA 2K4BA 3V8JA 2HFHA 3SXYA 1OPCA 5HODA 3BR6A 2YR2A 5FLXK 1BJAA 1X3ZB 3LSIA 4AVZA 2G0EA 3AG4H 5A2QZ 2JA6J 2FJ1A 3IHUA 2JRTA 1B9MA 4LG0A 3HKZN 5FLXZ 1Y56A 4EJWA 5LHIA 1B6AA 5CQGA 1R9TJ 1Y8RB 4RAZA 2DODA 2XAUA 1JJ8C 4ZYDA 1SFKA 3H3UA 5KAIC 3QYFA 1LJ9A 3BY6A 1T56A 2CQ7A 2VXZA 4HLXA 4MIMA 4I01A 4W1UA 1T08B 4PDKA 4HF1A 1I50J 2IEKA 1FOXA 5EEGA 3CUOA 1FT9A 2EH3A 1P4XA 2MFZA 3GCMA 3S1QJ 1R1UA 4M72A 1VQOI 1RZ4A 3P9CA 3QP5A 1LEBA 1MBKA 2G7HA 1MW7A 4DJAA 2EA2A 2ACJA 5KHDA 2HQRA 1N77A 3A01A 1FOYA 1P2FA 2IS1A 4AIKA 2BE5F 4HF2A 4FHTA 1VI0A 2R0QC 2CSOA 5F1JA 3KFWX 4P96A 2STTA 4IEJA 4PZJA 3IH4A 3S1NJ 2VODA 1H8AC 1VQMI 1VQ4I 4FCYA 1CF7B 3I9V2 1OR7A 3MWMA 1JUPA 3HOYJ 3I53A 3V8LA 2DW4A 4BBSJ 3W3CA 2GXAA 1KGSA 1GT0C 1U5TB 4RS8A 2O0YA 4OIOF 1YE9A 3SHFA 2L9RA 1MKMA 4AIHA 2KKOA 2OF7A 1G3WA 1Z67A 3RKXA 3J7AY 2JQ7A 1MBGA 2GLOA 3CCEI 1IXCA 1Z05A 2VUMJ 1KQ9A 4AVPA 2K9QA 3I0TA 2EJRA 2HZTA 1X3WB 2W57A 5FKMA 2H27A 1PYVA 1IRZA 3HOUJ 1USSA 1XGNA 2VJ4A 3E0JB 2FMLA 3BTCA 2KJCA 2E36A 1I6HJ 4IRGA 1T39A 3L2UA 4LK1F 1FBUA 4BJTA 5AONA 4UNOA 5JVTA 1RETA 2VQCA 2R7WA 4ZYAA 5GAEJ 3QOEA 3DP7A 1J7KA 3D5RC 3CCQI 1WCMJ 4LMYA 3U1DA 1GHCA 3CCYA 1ZGWA 2LKPA 2M34A 3MFKA 2K9NA 3KP7A 2DA1A 4OAZA 3W2AA 1QZEA 2ELJA 4JX4A 3W6KB 1OCCH 5E1ZB 2HWVA 2MH2A 1X19A 3E6BA 3KYCB 4GYIA 1EH6A 4S05A 4KUMA 2D2WA 2DA5A 1I3AA 4Y7NJ 1FYKA 3K2AA 3C2GA 5JR3A 2LBFB 2CMPA 3GLXA 1W36D 2ME0A 4E7LA 5F0CA 2VE9A 2OPTA 4IQ4A 4YG2F 2JSCA 3QAHA 2JA2A 4M74A 2HVQA 1MMDA 2CO5A 2WY8Q 2O03A 3L2VA 2Y9ZA 3ZMVA 3I3LA 3WHCA 1ACIA 4XBFA 5J6XA 4A3FJ 4HF0A 3IKVA 2XRLA 3DKYA 2KFDA 4DZJA 1SFEA 4HX7A 3VWBA 2F5VA 2XROA 3OYJA 2QKMB 2QF7A 1U0JA 4E7KA 1NK2P 1IV8A 2MW8A 2QSGX 1FIPA 3CDIA 1FJLA 4I99C 1LFBA 5DUIA 1B8IA 3FMQA 3QOPA 2PLYA 4HX8A 2V7FA 4FASD 1LFUP 4XLCA 2LK2A 3U21A 3LSGA 3FXRA 2CUZA 1TQIA 2XAFA 1OYWA 4XSZF 4U7DA 4A12A 3MCZA 4CHUA 1L0OC 3HPHA 1YJWI 2PEXA 4CYCA 2FRHA 2QBYB 2Y0MA 2VKVA 2DTZA 4HLYA 1YX5A 4P55A 4XQFA 2DJNA 4BXFA 4GCVA 2X1CA 2O5RA 2P7CB 4EM0B 3O3KA 3F6VA 4R1HA 1MSEC 4B43A 1KYZA 3K4LA 2K9SA 1DP7P 4CICA 3DEUA 2YX7A 5HLGA 1E17A 5A2QK 1T33A 4RDUA 1JTXA 2E2HJ 1NG6A 4A3MJ 1I3QJ 2VPLA 1UB9A 4BU2A 1IAWA 1B59A 3GO5A 1T8IA 1W1WE 2R7OA 4EJVA 3BR0A 1RRJA 1YS6A 1JHFA 2ID3A 3BTIA 3OYEA 2FQ4A 2W85A 3IRRA 2F5CA 2KP6A 1IDZA 3X2QH 2QCOA 5EDNA 5FB2A 2VONA 3DTKA 1FYMA 1T38A 4XRSA 3MZHA 2DQRA 5HOOA 1IN4A 5J47A 5LGTA 2L3DA 2EFNA 1S3JA 3KP4A 2EBIA 3WGIA 3CJRB 2VOPA 2P4WA 3DU5A 5JLXA 4LD5A 1IRGA 1S7AA 2ID6A 2P81A 4N0BA 3PIPF 3LAPA 3HPGA 5JVGF 3QWLA 4V2FA 2R5YB 2R7RA 1XSXA 2K9LA 4IKFA 3LSJA 4FE4A 1I39A 4B3AA 3K1MA 1JT0A 4XLPF 4CCMA 1ON1A 4OIPF 2V4JC 3ECHA 2GWRA 4MFDA 1OCOH 3VYTB 1TQPA 4C3JJ 1NTCA 3HOXJ 4G94A 2HR3A 5EJCA 3N97A 2OTJI 1SD4A 4QLCU 2JTVA 1JE8A 1IF1A 2LY1A 5JLWA 1AKHB 3GEZA 4C2UA 1IUFA 3OS2A 1ULYA 3B6CA 1XSVA 1Y1VJ 4L5JA 4XKCA 1FZPB 2KRFA 2ADUA 2XGDA 3M8FA 2L7ZA 2HOAA 3FKIJ 3IV5A 1TW3A 2P0WA 4JOMA 3U1KA 4AUXA 1G2HA 5IP9J 5K7ZA 3ISPA 2LR8A 2ZXHA 1K78A 4L5IA 1GUUA 2MABA 3ZCOA 1MJ9A 4O3MA 2DJIA 2Z16A 1KONA 4JK1X 2BXZA 4YRVA 2QQ8A 4LGWA 2HS5A 1MJAA 1Y0UA 2GIVA 3JRAA 2O6GE 2YPRA 4U87A 3REOA 2CJJA 2XV4S 3TBIA 4ZYHA 1YHQI 4HOBA 2VE8A 5D6FA 3C2HA 2XDVA 1W5SA 1T2KA 1A6IA 2MSYA 2RAEA 4MTDA 1JKQC 3LA3A 3BR2A 5M5WJ 2M4KA 2HDWA 3K2ZA 1W5CC 1ZLKA 4BKXA 4BJ5C 1D1BA 4M3EA 3F9KA 4EJUA 3ZQ7A 4JBAA 2R7ZJ 3TKYA 4E7IA 1B72B 2EB7A 2V26A 1ZRFA 1HW2A 4KT5C 2P5VA 4G7HF 3P9IA 2OV7A 4MNUA 4G9YA 4XICA 1OLTA 2Z2SB 1TQMA 3KP2A 4IHWA 4HV6A 1QHGA 2KISA 3EUAA 4UY8I 1O3SA 3G1OA 5EG0B 3OYDA 3BZCA 5FD5A 3IP4B 3CMYA 3IC7A 2MC3A 1BW6A 3FMRA 5B1AH 1LE8A 3OYAA 4WXCA 1FX7A 1R23A 3VYSB 3GMEA 4C30A 2IJLA 1PVEA 4XN3A 3H36A 3CO7C 3M9AA 4JYKA 2WV1A 3R60A 1DUXC 4XM3A 4EQQA 3RYPA 3I71A 3WTUC 1HKTA 1SD6A 3F8CA 5DM6F 2ZSHB 3OYMA 2LLKA 4EMSA 4A0XA 1Z77A 4A6EA 5TRDA 3MZYA 3OYHA 3C2BA 3ZMSA 4CCKA 2E5ZA 4D1QA 5ILSA 4LOCA 2Y31A 1ZN2A 4E7JA 5EF6A 1R36A 2J5PA 3P5JA 2UUZA 4Y17A 5HNFA 2GIZA 3BPXA 3CTAA 5J4VA 3VYRB 2BHZA 3ML6A 4UB6C 3A4CA 2FOWA 3GTQJ 2L4AA 3PO3J 2K4JA 2M7AA 4MTEA 3DBRB 1USTA 1XG1A 2VLAA 1WJAA 4AM3A 5CQEA 1OKRA 4LB6B 3J7YJ 4R79A 2ICWG 5CVRA 4Z6YA 5D4RA 2V9PA 1Z7UA 1WSUA 2PBIA 2PJRA 2ECCA 1TT5B 4OOIA 4L9JA 2IGMA 1YRNB 4DQ2A 5D4SA 4HG2A 3CJQB 3S2HJ 1ZLJA 1K7AA 3NRVA 4RAFA 3KETA 2DFEA 4HSTA 4BJ6C 4MHGA 3JRIA 2GZWA 4B8XA 3DTEA 1V4RA 1JKRC 2EFQA 3OSGA 2H6BA 5J8FA 3OS1A 1VQ9I 2CGPA 5IT9Z 4JQFA 4KIFA 2DA4A 3GVAA 3I64A 4DYCA 2DMPA 2H6CA 1IN5A 1WKMA 3K7AJ 4HNUA 1BOBA 1GLNA 4BGDA 1O3QA 1A6QA 1Z1DA 2Z1DA 2MC4A 2PMZA 2CG4A 4XORA 3CF5F 4P5OA 1TW2A 3LNQA 4KISA 3OS0A 4CH7A 1F5TA 4U0YA 3L2WA 1Y39A 4CO8A 3NWTA 3GXOA 4BEHB 1K4SA 2PI0A 5FO5A 1IDYA 3TDZC 4DNCA 5D5VB 2QQ9A 3S93A 2EINH 4BH9A 2LYCA 5BPDA 1REPC 4AYBN 2HOSA 5ILUA 4EGYA 2ME6A 3R6SA 3ROUA 2V9VA 2XF6A 4M9SA 3F22A 1XGMA 2J5OA 3FBNB 4LJZF 1D8KA 5LRSA 5EZGA 1TP4A 5LFAA 1BR4A 3RYRA 1RESA 4NHJA 2WY7Q 5TJJA 2NVQJ 4FQGA 3NAUA 1Y6IA 2QGUA 1WI3A 2EZKA 2HXIA 2QUFA 1YIOA 5E3OA 4D0PA 4UXNA 1MDMA 1SFXA 2EFOA 4KA4A 3HTSB 4IHSA 2TDXA 5D5UB 4XK4A 2ZMEB 4NB5A 1QGPA 2RDPA 3F8BA 3ONQA 1JGSA 4XLAA 3EETA 3PNTA 5KAFC 2W4SA 4A3IJ 1BIBA 3MN2A 4C2MJ 2L9SA 5K5RA 4MEXF 3KIOA 1ETOA 5FGMA 4HNTA 2EFPA 1XN7A 3LOCA 1UFMA 1U8BA 5C4XJ 1Z9CA 1WWXA 2LBFA 1E3HA 2KQRA 4HYEA 4U0VA 2HVSA 2KT0A 3OSFA 2A61A 5F27A 5BOXA 2EIMH 3TO6A 3JRDA 1YIJI 1JKPC 4UVAA 3M3YJ 4L5EA 1R1TA 2CU7A 3O8HA 3PSFA 3TGNA 2FE3A 4FETA 2QSFX 3DXJF 5J1UA 4ZC3A 2FXAA 3ECOA 1YW9A 1EH8A 5HVQC 4HNVA 3CCLI 1UMQA 1BI1A 3QQAA 2HYGD 1U6GA 2CFOA 2ZFWA 3GZ6A 4BS9A 2ELHA 2DMQA 2X6WA 2PFBA 5J3LA 2Y0SN 1NHAA 5KVRA 3OYGA 1RR8C 2IBDA 1B8IB 1MH3A 1N25A 2LG4A 4EJOA 3IWZA 4KIBA 3WODF 2Q2EA 1XDUA 5M5YJ 4ZZDA 5IOYA 1BIAA 3BR3A 3HUGA 3LSMA 4KMFA 5DCFA 1XGOA 3I4MJ 3CCMI 3L00A 3V8KA 3K69A 3F8MA 2HYJA 4JX6A 2OUMA 4UUVA 2V6CA 1ETVA 5DD4A 3S2WA 4U7BA 2CQNA 3RPQA 3C7JA 4NC6A 3BJ6A 4M9ZA 1HF0A 1R7JA 1KYWA 1G3TA 2W82A 3ABTA 1ZRCA 1K79A 2DCEA 2BVLA 2MG4A 1LB2A 1SANA 4AD9A 3R0AA 4HX4A 1BI3A 4EGZA 2QYOA 1P4AA 1MMGA 2BZTA 3LSTA 3ABUA 1TL8A 3AAFA 4QPQA 1IN8A 2FBHA 2Y0SA 4QPOA 4BHBA 3HTUA 4IQJA 1KU9A 3BG6A 1FOWA 3DBHB 3JW4A 2NVXJ 1VQNI 2HYFA 3MD2A 2JVHA 2L7KA 2X51A 2G7UA 2CFXA 3AG1H 1QZZA 2AXLA 4NQWA 4CCNA 6PAXA 5FLMJ 1XCVA 3CMEI 3W2WA 1VQ5I 3J81K 5IP7J 4HW0A 3OOUA 4O6JA 1Q1VA 1Y8QB 1WHUA 4OINF 1SMTA 2EIJH 2YX4A 2I10A 2IGNA 3K0LA 5IYCJ 1J75A 4PFPA 1X3UA 3ZN0A 1WH5A 2NXNB 4ZJZA 3U2RA 4WK8F 3JRHA 3G4SI 3CJNA 5BMZA 1I1GA 3A2KA 2OA4A 2VBYA 2X9DA 2Y2ZA 1YJ9I 1MMAA 1ETKA 1QHHD 3CCJI 2V1XA 3PUBA 2KL4A 2UXNA 2PMUA 1P7IA 3V7CA 1SVOA 4L0ZB 1XB4A 3GZ5A 2W00A 1POGA 3BJAA 1JKOC 2E1OA 3S15J 3H3ZA 1ZELA 2VJ5A 3LSKA 3S3OA 1ETXA 2YS9A 2DMUA 1DDNA 2YU9J 5EZHA 4M9XA 3L2QA 1V3FA 2VBZA 1AKHA 1FPQA 2P7VB 1UJ8A 2L5QA 1HW5A 4CZZA 2KJBA 3Q3SA 1ETQA 1MH4A 5LHGA 3FHZA 1FBSA 1P92A 4ENNA 3TOBA 2EPFA 4BXUA 3QU6A 5K7FA 3VOEA 3F8FA 1ZR4A 2A05A 1IW7F 1FP1D 2EWNA 5CJ9A 2LY9A 2LMDA 4WWCA 3DV8A 1ZRDA 1UG2A 3WU1B 2A5WA 4KNYA 1GV2A 4C3HJ 3DQVC 3ZQFA 3OYIA 1SMYF 4KMUX 4XKVA 2MH9A 2WB1A 4MQ9F 2DOEA 2W48A 4B47A 1WJ5A 2ZCWA 2AQFA 4N4OB 2R7TA 2H8WA 1FMVA 3SJMA 4AYBA 2ZBKA 2XIGA 2QKLB 3I4PA 4BYYA 4AU7A 4MQVA 5DM7F 1QBJA 1FP2A 2FQ3A 4IOAF 1R6RA 3PSIA 4GFBA 4F7ZA 3VSKA 1HSTA 4A3KJ 3DLAA 2DA7A 4ABZA 4B44A 2KDOA 1W7PA 2QA4I 3TQNA 2JK3A 1GVJA 1B72A 2A3SA 1FBQA 3JSOA 5D8LB 2JZYA 3SFIA 5M5XJ 5B3SH 1S7EA 5HS7A 2L7FP 3ASOH 1YTYA 4F3QA 4JX5A 4OU0A 4E4HA 3S14J 1G6NA 2CW7A 3Q0UA 1TWAJ 1BW5A 2E2JJ 1A5JA 1H88C 1T6SA 2EZHA 1LE8B 1FEXA 3IRQA 1CF7A 1ZQ3P 2IGKA 2WAQN 3K6GA 2VBXA 3HOWJ 1XX5A 4Q48A 2NAZA 1PUEE 2V1NA 2FOKA 3OV8A 1TZLA 2R93J 2ZXJA 2RGVA 5DV5A 3E3VA 2R7SA 1WRJA 3GBGA 1GXQA 3IAS2 3VFZA 3KP5A 2OZUA 1F36A 3ABMH 3KZIC 3IH2A 3KPHA 1MIJA 4M71A 1Y1WJ 4BQQA
chains in the Genus database with same CATH topology
2QSFX 2F4OB 2QSHX 1PVEA 3ESWB 1X3ZB 1OQYA 2QSGX 1X3WB 1QZEA 2F4MB 1TP4A 4YIRX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QSF X;  2F4O B;  2QSH X;  1PVE A;  3ESW B;  1X3Z B;  1OQY A;  2QSG X;  1X3W B;  1QZE A;  2F4M B;  1TP4 A;  4YIR X; 
#chains in the Genus database with same CATH topology
 3OL3 A;  1FSE A;  4HQM A;  2HEO A;  2ZFU A;  3FX3 A;  3IUO A;  2OTL I;  1YO5 C;  1SD7 A;  2MD5 A;  1R4N B;  4ETS A;  1MMN A;  3PM1 A;  5B1B H;  3VB2 A;  3CC7 I;  2GXG A;  2XPV A;  1XDS A;  3KZZ A;  3C1D A;  3RDI A;  2F6C A;  2DXI A;  3F21 A;  3OYN A;  2VC1 A;  3PFI A;  1TWC J;  2E7W A;  3I55 I;  2E5N A;  2PMH A;  3LFU A;  3F23 A;  4V2G A;  4ZDL A;  1UCR A;  3ZN1 A;  1P7J A;  3CC2 I;  4ANJ A;  2JPC A;  2YU3 A;  3EDP A;  3RZD J;  2VQL A;  5F08 A;  3K4C A;  2X6X A;  5LGU A;  1DPU A;  4RA2 A;  3JRG A;  1TLH B;  4QSH A;  4A2U A;  4GYG A;  4P1W A;  3H9G A;  1DU0 A;  1VF9 A;  3K9T A;  2KLO A;  2UXX A;  4LLN A;  4L9V A;  3OYF A;  4L9N A;  4PK4 A;  1D5Y A;  1A35 A;  2ZKZ A;  5JHU A;  2XAQ A;  4MO7 A;  4RLQ A;  5IT3 A;  1YLF A;  1A31 A;  3BG9 A;  1EH7 A;  4XLH A;  4MLO A;  3K4K A;  2QQA A;  4A0Z A;  4LFU A;  2VT2 A;  3RIR A;  1BL0 A;  2F5D A;  3ZQL A;  2KRH A;  5CVI A;  2ZB9 A;  5GTH C;  2DA6 A;  1NH3 A;  4A3G J;  3WG7 H;  3W6V A;  1ON2 A;  3DBL B;  2VPR A;  2GA2 A;  2M8E A;  2L01 A;  1LUJ B;  2MBF A;  2ZXW H;  2Y69 H;  2UV1 A;  3MEX A;  1SEU A;  1YFH A;  1PUF A;  2DBB A;  3S16 J;  2STW A;  1ERD A;  1NG7 A;  1O4X A;  1G3S A;  2L7M P;  2ECB A;  5AIQ A;  5L3E A;  4GXO A;  3ABL H;  3WU2 C;  2HQA A;  1T0F A;  2I5U A;  2P6S A;  3DTI A;  4YII A;  4A0Y A;  4LB5 A;  3FXU A;  4I98 B;  5CKT A;  3E6C C;  3DPL C;  4Y13 A;  5ICC A;  5K7H A;  3HIF A;  1I27 A;  3F6O A;  4CCJ A;  3ZXS A;  2P5L C;  1SC7 A;  1OQY A;  3H3V K;  5F04 A;  5IP6 A;  3MKY B;  4BNC A;  2LSO A;  3J7Z I;  4FTH A;  3EUK L;  4ENM A;  1ODD A;  1RKT A;  2XUB A;  4CYC B;  2VC0 A;  4BE0 A;  2QBY A;  5ED4 A;  5FFX A;  2IS4 A;  1K61 A;  2WTE A;  2A07 F;  1ZH5 A;  3K70 C;  3BT9 A;  1Z91 A;  4GGG A;  5E1X A;  3BQY A;  1OIS A;  1XTA A;  2IP2 A;  2QQB A;  2ZME A;  4BL0 B;  2COM A;  4GO1 A;  4I6Z A;  2Q0O A;  1D1A A;  5E17 F;  1WJC A;  1MBF A;  2LOO A;  5GAG J;  2E71 A;  2ZJP F;  3CCS I;  1O3R A;  1Z6T A;  2RNG A;  4FE7 A;  3SFZ A;  4L0Y B;  4F55 A;  3GTL J;  3VPR A;  4OMZ A;  1X2N A;  3VEP A;  3L9F A;  3B73 A;  5DUK A;  4U0W A;  5CLS A;  3FBI B;  3CDH A;  4HDV A;  3CZ6 A;  2F4M B;  3JR9 A;  2M45 A;  2K9M A;  1KZH A;  2M1B A;  2R7F A;  1J9I A;  2M0C A;  2XHK A;  4CXF A;  2VB6 A;  1X1P A;  3CMM A;  4X1E A;  3D5S C;  4PFO A;  3SZG A;  4EV0 A;  3ULQ B;  3OY9 A;  2LC2 A;  1HKQ A;  1W0T A;  1GV5 A;  3EYI A;  1MBJ A;  1S72 I;  2K7L A;  1U8R A;  3E1S A;  2M87 A;  1LFP A;  1SAU A;  4FX4 A;  2ZJR F;  1YW7 A;  4YEJ A;  3DU6 A;  3N4M A;  4UVC A;  2IXS A;  2K40 A;  3ASN H;  5J1R A;  3FWE A;  1H0M A;  3A1Y A;  3M8J A;  1WVR A;  2LNB A;  2OBP A;  4PGH A;  1CGP A;  4F92 B;  3LA2 A;  3IKT A;  4I2O A;  3F3X A;  1ETY A;  3KZY A;  1T98 A;  2CWE A;  1HLV A;  1E0E A;  1QA6 A;  5CVJ A;  4NNJ A;  2RRE A;  3QPS A;  3E97 A;  4BAC A;  4BY1 J;  1IRX A;  3ELK A;  2FEZ A;  1QO0 D;  2CUJ A;  1KQ8 A;  2JUC A;  3HUG B;  3RJP A;  3UNG C;  3HHH A;  1X1A A;  2WA0 A;  3FXJ A;  1RNL A;  1WJB A;  4DW6 A;  1IJW C;  2VKE A;  2WB1 N;  4OWR B;  3HSE A;  3ZGK A;  5FKO A;  4IJA A;  2VT3 A;  2MLG A;  2DDB A;  2F5F A;  1M1E B;  2Y75 A;  5HDN A;  1R4M B;  3E6M A;  1LNW A;  3MZ8 A;  3NEU A;  2MGQ A;  1EJ9 A;  3BR5 A;  4N9I A;  4X0G A;  3KP3 A;  1S9H A;  4RB2 C;  2R7X A;  1K78 B;  2DFF A;  2KPM A;  3Q9V A;  1IC8 A;  3BJO A;  1DGW Y;  4D7M A;  4E70 A;  4RGU A;  3H0D A;  2OC6 A;  3B6A A;  3VYU B;  4CA0 A;  4KJZ A;  4K2E A;  2V6E A;  2L0K A;  3M4O J;  1X58 A;  1N75 A;  2LRD A;  2VBW A;  3K4N A;  1D5V A;  2BGC A;  5FKK A;  1FOK A;  1OJL A;  4IO9 F;  2E34 A;  1SVL A;  2K3P A;  2R4G A;  2OD5 A;  2NOJ B;  3CLQ A;  2XAG A;  2FBK A;  4XMY A;  5F64 A;  1U5T C;  1XCB A;  1Z7L A;  5HLI A;  2K85 A;  2MYS A;  5K1Y A;  3GTO J;  4WF2 A;  5K5O A;  1WJE A;  2FSW A;  3I4N J;  1HSJ A;  3I5U A;  2M30 A;  1JI8 A;  1QQI A;  1G8X A;  3T8R A;  4CSW A;  3CCU I;  1F4K A;  2V79 A;  3HOZ J;  2A6E F;  3K4M A;  4I7H A;  2AS5 F;  3KLO A;  3K70 D;  1IGN A;  3ZMZ A;  4V19 K;  5FFZ A;  4XSX F;  2XB0 X;  1BJZ A;  1G3Y A;  3C18 A;  2JN6 A;  3ZPL A;  3QPT A;  3WU0 A;  2WAF A;  3RTR A;  3T5X A;  5ICG A;  2F2E A;  1WJF A;  3BRO A;  3BWG A;  5D5X B;  3MKW B;  3JRC A;  5CPR B;  1HDP A;  4M3G A;  1TWH J;  4UB8 C;  4KN4 X;  3ERM A;  2K27 A;  3DWL E;  4PSX A;  1VND A;  2M5W A;  2O8X A;  2A6H F;  2Z99 A;  1RKW A;  3SZP A;  3I54 A;  2DFI A;  3QPH A;  4RM2 A;  4IRI A;  2QLZ A;  3HEF A;  5KCM A;  2L9V A;  2X1D A;  4QIW N;  1FSH A;  2HQ5 A;  4OIQ F;  3MQ0 A;  2HKO A;  2GAU A;  2FD5 A;  3ZR8 X;  4I0A A;  1RI7 A;  4ZZL A;  4ZTJ A;  4F91 B;  1JT6 A;  3KE2 A;  4EAT A;  4ZTF A;  4XRS G;  3E5Q A;  2OCC H;  4BXX J;  4XR6 A;  2XRN A;  1XMK A;  1HOM A;  3K10 A;  1W7P D;  2WAE A;  3HRS A;  1RC9 A;  1V54 H;  3FKJ A;  5C3E J;  1WGX A;  2HDD A;  2WV0 A;  4RB1 A;  2ISY A;  3NWS A;  1QRY A;  3UKG A;  3BDD A;  4Y52 J;  3H0G J;  4Y3O A;  1W7P B;  2HZD A;  3MAJ A;  4UUS A;  2KIU A;  1KU7 A;  3NAR A;  1ZAR A;  3RKQ A;  1OFC X;  3JTH A;  3LQQ A;  4MFE A;  4OAY A;  3ABK H;  2IT0 A;  1GVD A;  2F48 A;  1GXP A;  2WC2 A;  2CUF A;  2AQE A;  3RQ4 A;  5GPA A;  1FNN A;  3BR1 A;  1OR7 C;  1IO2 A;  5DYM A;  2HNH A;  2XGE A;  5HDK A;  1Y0N A;  2HGC A;  3BOQ A;  3QYB A;  4MGR A;  1K4T A;  2LRE A;  1TWF J;  1ORK A;  3PUF A;  5C44 J;  2DT5 A;  3L7W A;  4RB0 A;  1OCR H;  2NVU B;  5LRR A;  3DFG A;  4ESB A;  4PJL A;  4IZZ A;  5D6E A;  4DBR A;  3OOP A;  1FMW A;  2JWT A;  4AC0 A;  4HV5 A;  2PN6 A;  4I76 A;  4D9J A;  3G2B A;  4CCO A;  2EK5 A;  3CJT B;  4BEH A;  2E1M B;  1LDD A;  1J09 A;  1EV7 A;  2FU4 A;  3J81 Z;  2CRG A;  3FHN A;  3G1M A;  4J00 A;  2AHQ A;  2JVG A;  3HRT A;  4XNF A;  3Q5F A;  2D5V A;  5DCM B;  5AIP A;  2BBY A;  3ZMT A;  4A3C J;  5E1W A;  2ZO4 A;  1XPX A;  5E3L A;  4B48 A;  2DK5 A;  1O3T A;  4E7H A;  4RB3 C;  2JMW A;  4Q47 A;  2R5Z B;  2E1C A;  2R7U A;  4RGX A;  4BUP A;  2BY1 A;  3GTP J;  4L18 B;  1E2X A;  3HKZ A;  5M3M J;  1RIO H;  3RQI A;  2M3A A;  2D1H A;  3SEZ A;  2V1U A;  4TV7 A;  2NRA C;  4CCL A;  5BQT A;  2IA0 A;  2XPW A;  3KEO A;  3WTX C;  3HOS A;  2Z33 A;  4NDL A;  2XF5 A;  1ETW A;  5E79 C;  4EM2 A;  2IGO A;  4HDU A;  2M7B A;  2EZI A;  1AU7 A;  3H92 A;  3BG3 A;  1DP3 A;  2ZME C;  4IXA A;  1IN7 A;  5H2F C;  3G73 A;  4Z2Y A;  3S1R J;  2B0L A;  2D45 A;  1T0F C;  2P5K A;  2XB5 A;  3E6D A;  4M6V A;  5EYR A;  4DYQ A;  3OR2 C;  2ETH A;  3CQZ J;  4CUG A;  5DTD A;  3BCB A;  5HS8 A;  1U2W A;  3LQR A;  4M73 A;  4XLF A;  3I56 I;  3BG5 A;  1BI0 A;  2VKD A;  3BTL A;  4A3L J;  3HZJ A;  4BQN A;  5DDG A;  3VSL A;  1V5F A;  3TW6 A;  5BS6 A;  2QVO A;  3LL7 A;  1IG7 A;  3S17 J;  5D5W B;  2PG4 A;  2CV1 A;  2X48 A;  4ZDO A;  4BY7 J;  4A3D J;  2QEX I;  1PJR A;  1ZG1 A;  2DK8 A;  2H8R A;  1CQT A;  5J1Y A;  3E7L A;  1TC3 C;  1ENH A;  2L4M A;  3H5N A;  3FF5 A;  3PFY A;  2EQR A;  2KIM A;  3AFH A;  4M6X A;  2BW3 B;  2TCT A;  2JSP A;  1J0R A;  1MJB A;  1IV6 A;  4M3F A;  3V4G A;  3SZT A;  2ELK A;  4YFK F;  2XC7 A;  5GTI C;  3CUQ C;  1OCT C;  3K1P A;  2DYS H;  2ZNZ A;  4BHP A;  2R92 J;  4D5C A;  1XMA A;  2E1N A;  1X2M A;  3JAM K;  5E18 F;  3J7A O;  1FY7 A;  3DCF A;  4DYR A;  2NS0 A;  3ZOB A;  1FC3 A;  3L2R A;  4Y4R A;  1SFO J;  2VN2 A;  2AXT C;  4HRI A;  1MD0 A;  4BAY A;  3WTY C;  4LG0 B;  3JAM Z;  3BP8 A;  2M8G X;  1BM9 A;  3WTS C;  3H35 A;  4KIG A;  2L02 A;  1KQ0 A;  2DU9 A;  1B1B A;  2FNA A;  2X0L A;  2MLK A;  5M3F J;  3HYI A;  3CDL A;  1S6L A;  1D8J A;  2I8D A;  2RKH A;  2FA5 A;  2MD0 A;  2XPU A;  1V5G A;  4YIR X;  3PQJ A;  4PUS A;  1U9N A;  3CF2 A;  5E3M A;  3QP6 A;  2XSD C;  2E35 A;  4IHX A;  1IUY A;  2DYR H;  1VTN C;  3GX4 X;  3AL0 B;  4EEF G;  2W24 A;  1ZK8 A;  4II2 A;  4XOT A;  4A93 J;  3S32 A;  2H94 A;  1SD5 A;  5EEH A;  2E2I J;  2FBI A;  3HRU A;  1DQU A;  2QZ8 A;  4NQW B;  3P9K A;  4KT6 A;  1VFC A;  1KU2 A;  4C2T A;  1W4M A;  3A02 A;  3Q0W A;  1D1C A;  4XL9 A;  5LGN A;  2FUG 2;  4G6D A;  1VQ8 I;  3CCR I;  3TP0 A;  2JT1 A;  4ASN A;  5C4J J;  2XGC A;  3A01 B;  1F1Z A;  3QRF F;  3GW2 A;  3KEY A;  2K02 A;  5EGO B;  2HKX A;  4F93 B;  5HLH A;  2EV6 A;  2LF8 A;  1UHM A;  4P9F A;  5CVU A;  2IA1 A;  4WXD A;  4XID A;  3WGH A;  1TNT A;  1ZRE A;  1K6Y A;  2BHY A;  4AIJ A;  1APL C;  2R3S A;  4XOP A;  1O57 A;  3VDX A;  2XF7 A;  1ZYR F;  1XSD A;  2H1L A;  2MA3 A;  2W25 A;  5H20 A;  1D0X A;  1WQ2 A;  5FRO A;  4XN0 A;  4UV8 A;  2HPI A;  5J8C A;  1V55 H;  5EEA A;  3KYD B;  3DKW A;  3O8G A;  1FLI A;  1U5T A;  1ZKG A;  4XLE A;  2A69 F;  1MMS A;  3TMO A;  2YUS A;  3V7R A;  4PCQ A;  2OQR A;  1X4P A;  2LKS A;  2HVR A;  4R8H A;  4UHT A;  3J80 K;  5FRM A;  1MSF C;  3S2D J;  3R61 A;  4NC7 A;  5HLT A;  1LVA A;  4A3B J;  4ENJ A;  3H1C A;  3KCC A;  5L3C A;  2IRF G;  4B4C A;  2UZK A;  3A03 A;  3HSR A;  4XLN F;  1ZGA A;  2DMN A;  1SVM A;  1BA5 A;  2ZJQ F;  2DT6 A;  3E5X A;  5FJ8 J;  1R5I D;  1C0W A;  2DA3 A;  3OWT A;  1RPW A;  1B4A A;  3WHB A;  4QTR A;  2IA2 A;  4DBQ A;  2HU9 A;  2OZ6 A;  2XGX A;  4NUB A;  3TL4 X;  4RM3 A;  2F4O B;  3GFI A;  2PQ8 A;  3CO6 C;  3DPT A;  1YYV A;  4WXH A;  2DPU A;  2VOO A;  4IHT A;  3D5L A;  3SDB A;  3LWF A;  4A3E J;  2A5Y B;  5F1R A;  2LKX A;  2JPB A;  3W6J B;  4ZH4 F;  4F52 A;  5L3G A;  3GUD A;  5FRN A;  3I58 A;  3D0S A;  1X4O A;  1BBY A;  4I09 A;  2IAI A;  1OYI A;  3P7N A;  3TOA A;  4HPQ A;  4LLG F;  3IL2 A;  2DDA A;  2CQQ A;  4FT8 A;  3HOT A;  3JRF A;  1YIT I;  2GQQ A;  1WZ2 A;  4H0E A;  3RZO J;  2KMU A;  3UR3 C;  2ESN A;  1HXD A;  2FNP A;  3A0H C;  4HQE A;  4IX7 A;  2UWM A;  1P9Q C;  2Q1Z B;  1RUO A;  3ESW B;  4ZYE A;  4Q5S F;  4LIT A;  4KYW A;  2QEN A;  3JCU C;  3CLO A;  2K5C A;  3WTZ A;  3QOD A;  4BHC A;  3HM5 A;  1AA7 A;  2DTR A;  1VZ0 A;  4EJT A;  3O6B B;  3H5R A;  1SFU A;  1HC8 A;  1IXS B;  2KRC A;  2Y48 A;  3EUH A;  1OMI A;  5H6Q A;  3SQN A;  3VOD A;  1FIA A;  4LIU A;  3BQZ A;  3CD6 I;  4IVN A;  4BE2 A;  2VJI A;  4AID A;  1PP7 U;  1Q1H A;  1N78 A;  4L9T A;  2TRT A;  4Y33 A;  3H9Q A;  1XGS A;  2HOE A;  1U9O A;  3GWZ A;  3MMY B;  1P6R A;  2DMT A;  4CZC A;  2RQP A;  3ZQC A;  2IS6 A;  5GAH J;  1U3E M;  1P4W A;  2XVC A;  3GFM A;  4G7O F;  3TP3 A;  5F0H A;  3LAJ A;  1H89 C;  2E7X A;  3HL2 A;  1LVK A;  2EV0 A;  1UEL B;  5CVV A;  1FYL A;  3PNY A;  3CES A;  1S5L C;  2HI3 A;  4KFC A;  1JTY A;  4RAG A;  2Z9O A;  3GTM J;  2OQG A;  2VQG A;  1Z3Y A;  4IRH A;  1LPQ A;  1ZGJ A;  3C3W A;  3WTV C;  5F6F A;  2COB A;  3AKZ A;  2XKO A;  1R22 A;  3HB9 A;  3HC7 A;  3K4J A;  4PJJ A;  3WG9 A;  2DFH A;  1SAX A;  4UUS B;  2HTS A;  1HBX G;  4CYD A;  3G6E I;  1QPI A;  4BQA A;  2VKH A;  5JFR A;  2JJ7 A;  1I5Z A;  5IOZ A;  1UZC A;  1VQK I;  2VIX A;  3L09 A;  4A3J J;  2ISZ A;  3F0C A;  4DZP A;  2CV2 A;  3FXM A;  1BC7 C;  4HSR A;  2CS3 A;  4UV9 A;  3K4B A;  3FK6 A;  2DQL A;  4MEY F;  3CCV I;  2VL8 A;  3CUQ A;  1UHS A;  1L3L A;  3TO7 A;  1LKX A;  1AWC A;  5IT9 K;  2D1V A;  1KU3 A;  1W36 C;  3MKL A;  1BI2 A;  4HEA 2;  2DLL A;  3WE3 A;  2ZC2 A;  4HA8 A;  5K5Q A;  1ZR2 A;  1OYY A;  1X1D A;  2NYX A;  4A5M A;  5B5E C;  4IF4 A;  3QPL A;  2O8K A;  3RCO A;  2W1O A;  5HS9 A;  2E1M C;  2P6T A;  1D0Z A;  3HXL A;  4IOC F;  1RR7 A;  2CW0 F;  4LK0 F;  4C3I J;  1F9N A;  5LEJ A;  3HGG A;  4HAM A;  3MKZ A;  3TW7 A;  2R5Y A;  3RI4 A;  2LD5 A;  1J5Y A;  1PUF B;  2BEO A;  5DD8 A;  2AO9 A;  3PL8 A;  3R0J A;  4O5V A;  1YOV B;  3ZQH A;  4OMY A;  1ZHF A;  5DCM A;  1ZAO A;  1QZY A;  2RV8 A;  2B7E A;  4E7S A;  4BE1 A;  2R7Q A;  3H5A A;  1R49 A;  2K86 A;  2R5Z A;  2LFB A;  3I59 B;  1EKE A;  1MNM C;  3CP2 A;  3FK7 A;  2B9S A;  4I02 A;  4WCG A;  3D1N I;  4J19 A;  5ICF A;  2V1D A;  5B66 C;  2O61 A;  4Y15 A;  2N8G A;  5J4Y A;  3LSR A;  1BC8 C;  2X4H A;  4M3D A;  3TDU C;  3JRB A;  1LDK B;  5ERI A;  3ZQQ A;  2H09 A;  2NOG A;  2FX0 A;  5CYV A;  4A6D A;  4M3B A;  3ZQG A;  5DS9 A;  3Q0V A;  4YFN F;  3HDD A;  1IZ1 A;  2Z5U A;  3G3Z A;  2LTP A;  2E19 A;  2OU2 A;  1VQ6 I;  3T0Y A;  3M1C A;  3PIO F;  1O7L A;  3IAM 2;  5JI6 A;  4UVB A;  1UG0 A;  4B1R A;  3DEE A;  5L3B A;  2M4G A;  1K83 J;  1EA3 A;  1BR2 A;  2WAD A;  3GTG J;  1JXS A;  2KZG A;  3O2P E;  5E8I A;  3HGY A;  3CP8 A;  1XC5 A;  3FMS A;  2RNJ A;  1VQ7 I;  1D0Y A;  1ZTR A;  1YQA A;  3RPU A;  2O9L A;  4PGG A;  1WPK A;  2BY0 A;  2PMZ N;  1H9T A;  2LP0 A;  3S3M A;  3GFL A;  3HJE A;  3KP6 A;  5LBQ A;  3HHG A;  1XMX A;  5E8G A;  1YJN I;  4GDF A;  1BN5 A;  2XAJ A;  2A6T A;  2GA1 A;  4WX9 A;  1LDJ A;  5F0F A;  3DKX A;  4YIF A;  2G9W A;  3JSP A;  1OCP A;  4RAY A;  2OCE A;  1UHW A;  1S7O A;  2IW5 A;  2QWW A;  3H9J A;  1W5T A;  4CDG A;  2F5E A;  5ICE A;  3FDY A;  5FKN A;  1QVU A;  5GP9 A;  4G6T B;  1KA8 A;  4IL6 C;  3ERE D;  2HDC A;  3Q9S A;  3WE2 A;  4G7Z F;  4KDP A;  3JRE A;  3OIP A;  2JA7 J;  2IVM A;  3OR1 C;  1TWG J;  3S1M J;  3LSH A;  2OAZ A;  3BZ6 A;  2B63 J;  1YX3 A;  2DA2 A;  1S8N A;  2E60 A;  3FZV A;  3SDG A;  2JA8 J;  2QM3 A;  1MBH A;  1S29 A;  3KLN A;  4FX0 A;  3T1B A;  2GXB A;  1TT0 A;  3M8E A;  4C9Y A;  2BV6 A;  4ZDP A;  4Q4Z F;  4DOZ A;  1I6X A;  3S3N A;  2DAO A;  3WTW C;  2V9K A;  3ZRG A;  3M07 A;  5IY5 H;  3EQL F;  1WFX A;  1TBX A;  5ILV A;  3EUH C;  2M9H A;  5LHH A;  2PJR B;  4UUT A;  1T95 A;  1WH7 A;  2L2O A;  4RMN A;  5GPC A;  1G4D A;  4YEL A;  2JRM A;  4PJM A;  5FD6 A;  1YRN A;  2XAS A;  4J01 A;  1HA8 A;  3LFK A;  3T8T A;  1ITY A;  3PO2 J;  3G1L A;  4XON A;  1D3Y A;  1PDN C;  1STZ A;  2FMY A;  1YS7 A;  2RQQ A;  2VJJ A;  2W84 A;  3AG3 H;  1JGG A;  2FF4 A;  2DT7 B;  3F8N A;  2HTJ A;  2X1E A;  2M2E A;  3DLL F;  4S04 A;  4N4N B;  4PJN A;  5EGO A;  3ZP5 A;  2EZL A;  5BNG A;  1X1B A;  1FTT A;  1YG2 A;  3TO9 A;  5IYB J;  2A68 F;  5D8K B;  2NS8 A;  4G8X A;  1HW1 A;  1JHH A;  4LLL A;  1VQP I;  1XD7 A;  2XKP A;  2BXY A;  5KK1 A;  1UAA A;  3GTJ J;  3OMY A;  4BBR J;  2IPQ X;  3ZMU A;  3GLL A;  4BDZ A;  3AG2 H;  4NBQ A;  5LD2 C;  3A0B C;  3N05 A;  4A69 C;  5FLV A;  4N9H A;  2L9N A;  4XKW A;  4IPA A;  3GZN B;  1JUM A;  1R5G A;  4ESF A;  4ENK A;  1R5H A;  1MNE A;  1DU6 A;  1BOA A;  1DGR M;  3TED A;  1A36 A;  1IXR C;  2Y9Y A;  3EYY A;  3WTT C;  2M0M A;  1QPM A;  5HDG A;  3FXO A;  2ZSI B;  4IHY A;  3L1P A;  1Z3X A;  2VI6 A;  1WJD A;  4D7N A;  3OYK A;  2HPM A;  3ZMD A;  3DEW A;  4E6K G;  4D5F A;  5L3F A;  2KZV A;  3LSP A;  2EIK H;  1BR1 A;  4U88 A;  2K3F A;  1IN6 A;  2GM4 A;  2NS7 A;  3LA7 A;  3AL0 C;  1MZB A;  2HQN A;  1ZG3 A;  4M6Y A;  5E20 A;  3BG7 A;  4II3 A;  5IPA A;  1HCR A;  4PSW A;  2P8T A;  2WBM A;  2HOT A;  5IYD J;  5JHF A;  1TNS A;  3OIO A;  4FIS A;  1J2X A;  4RGS A;  4I0B A;  3RPU D;  1HQC A;  1G59 A;  1R1V A;  2W7N A;  1MDM B;  2H1K A;  1QVT A;  4CGZ A;  4OIR F;  3FXQ A;  2XSJ C;  1J59 A;  3HBL A;  1YW8 A;  2CQX A;  3FIW A;  4KN7 X;  3IH3 A;  5FKL A;  4X6A J;  4XKB A;  2Y30 A;  4ON0 A;  2EA4 A;  4HBL A;  4RBO A;  2EV5 A;  1R58 A;  3OYC A;  2KIF A;  1HDD C;  2BY2 A;  1LQ1 A;  4DGW B;  3U9G A;  3COA C;  4QWQ A;  4LIV A;  2R7V A;  2C6Y A;  3ZQI A;  3E5U A;  3J80 Z;  2JA5 J;  4A5N A;  4E7Z A;  4XRM A;  4GRI A;  3K1N A;  1R00 A;  1QU3 A;  3HSF A;  1MND A;  3BTJ A;  5J40 A;  2LF7 A;  3V42 A;  5L3D A;  3MVP A;  3SYT A;  4RLF A;  3CMA I;  2QSH X;  1V5E A;  2RC4 A;  5BPI A;  4BQO A;  2WAQ A;  2BY3 A;  5TGT A;  3M1E A;  2L54 A;  3SEQ A;  2WWY A;  5DEQ A;  3KX2 A;  1EF4 A;  2ZNY A;  5TIS C;  1ZG5 A;  1FWZ A;  5LLQ A;  3FM3 A;  1Z6R A;  4B3X A;  3BCA A;  2PX9 A;  3F72 A;  2ESH A;  1O7F A;  2CYY A;  1OCZ H;  3EPZ A;  2GOM A;  2LY2 A;  2GOX B;  2EFW A;  3CC4 I;  2BYV E;  3R4K A;  1B9N A;  2O7O A;  1A04 A;  2DOF A;  2XAH A;  4BDY A;  1AOY A;  3GYH X;  3RKY A;  2CUE A;  1LEA A;  1MGT A;  1W0U A;  5H6R A;  2ZXI A;  1PP8 F;  3WGG A;  1QNT A;  4IHV A;  3KEQ A;  3PQK A;  2Q2E B;  4EVI A;  4G12 A;  2RVC A;  4LG3 A;  3B02 A;  2DO7 A;  1GDT A;  3BLY A;  4H4K C;  3W2V A;  3KYL A;  2X6O A;  1VQL I;  3PJR A;  1NK3 P;  1X1C A;  3BC8 A;  1TTY A;  3BZK A;  4XRF A;  3V7S A;  4ZYG A;  4EM1 A;  4KIT B;  1MBE A;  1Z0X A;  2KHM A;  5E3N A;  2DN0 A;  2EIL H;  4G6Q A;  2RN7 A;  3FIS A;  3GTK J;  2VXD A;  3FXK A;  4ESJ A;  2PJP A;  4DIQ A;  3QYE A;  2CV0 A;  2GBY A;  3GF2 A;  4RGR A;  4ITV A;  2Q8K A;  4PJ0 C;  1AHD P;  3RKW A;  3FXL A;  1DPR A;  3PNV A;  1YI2 I;  4S0H B;  2X85 A;  2VQH A;  3QU3 A;  2YSR A;  2DOA A;  4P9U A;  2NVT J;  3G71 I;  2DPD A;  2IS2 A;  1RUN A;  1F43 A;  3OYL A;  2JUG A;  2R7D A;  2ZJ2 A;  1XS9 A;  4YFX F;  2DI3 A;  2LVS A;  3JTG A;  1E3O C;  5LEK A;  2NNN A;  4KIC A;  1Z21 A;  1JUS A;  2Z3Y A;  3CUQ B;  3RSN A;  1JJ6 C;  2BVM A;  1HKS A;  2F4I A;  5GAD J;  3HG9 A;  4W97 A;  5HNH A;  2CQK A;  2KIQ A;  2O3F A;  5KNL A;  3DPU A;  1IRF A;  3L2C A;  1I1S A;  1E3P A;  3OIQ A;  4B09 A;  2NVY J;  2HXO A;  3OYB A;  3S8P A;  2CW8 A;  4HZF A;  4JP0 A;  2KDZ A;  3GFJ A;  3IWF A;  1H9G A;  5EG0 A;  2LH9 A;  2CH0 A;  1K6O A;  3OL4 A;  9ANT A;  2BW3 A;  4NC8 A;  3FM5 A;  1U78 A;  1R71 A;  1WI9 A;  2NNY A;  4AWX B;  1ONV A;  2BOL A;  2LDU A;  2OJE D;  3HRM A;  3HOV J;  3BPV A;  1FTZ A;  2VAS A;  2X6Y A;  3LMM A;  3I59 A;  3NQO A;  3DF8 A;  3M7G A;  2K4B A;  3V8J A;  2HFH A;  3SXY A;  1OPC A;  5HOD A;  3BR6 A;  2YR2 A;  5FLX K;  1BJA A;  1X3Z B;  3LSI A;  4AVZ A;  2G0E A;  3AG4 H;  5A2Q Z;  2JA6 J;  2FJ1 A;  3IHU A;  2JRT A;  1B9M A;  4LG0 A;  3HKZ N;  5FLX Z;  1Y56 A;  4EJW A;  5LHI A;  1B6A A;  5CQG A;  1R9T J;  1Y8R B;  4RAZ A;  2DOD A;  2XAU A;  1JJ8 C;  4ZYD A;  1SFK A;  3H3U A;  5KAI C;  3QYF A;  1LJ9 A;  3BY6 A;  1T56 A;  2CQ7 A;  2VXZ A;  4HLX A;  4MIM A;  4I01 A;  4W1U A;  1T08 B;  4PDK A;  4HF1 A;  1I50 J;  2IEK A;  1FOX A;  5EEG A;  3CUO A;  1FT9 A;  2EH3 A;  1P4X A;  2MFZ A;  3GCM A;  3S1Q J;  1R1U A;  4M72 A;  1VQO I;  1RZ4 A;  3P9C A;  3QP5 A;  1LEB A;  1MBK A;  2G7H A;  1MW7 A;  4DJA A;  2EA2 A;  2ACJ A;  5KHD A;  2HQR A;  1N77 A;  3A01 A;  1FOY A;  1P2F A;  2IS1 A;  4AIK A;  2BE5 F;  4HF2 A;  4FHT A;  1VI0 A;  2R0Q C;  2CSO A;  5F1J A;  3KFW X;  4P96 A;  2STT A;  4IEJ A;  4PZJ A;  3IH4 A;  3S1N J;  2VOD A;  1H8A C;  1VQM I;  1VQ4 I;  4FCY A;  1CF7 B;  3I9V 2;  1OR7 A;  3MWM A;  1JUP A;  3HOY J;  3I53 A;  3V8L A;  2DW4 A;  4BBS J;  3W3C A;  2GXA A;  1KGS A;  1GT0 C;  1U5T B;  4RS8 A;  2O0Y A;  4OIO F;  1YE9 A;  3SHF A;  2L9R A;  1MKM A;  4AIH A;  2KKO A;  2OF7 A;  1G3W A;  1Z67 A;  3RKX A;  3J7A Y;  2JQ7 A;  1MBG A;  2GLO A;  3CCE I;  1IXC A;  1Z05 A;  2VUM J;  1KQ9 A;  4AVP A;  2K9Q A;  3I0T A;  2EJR A;  2HZT A;  1X3W B;  2W57 A;  5FKM A;  2H27 A;  1PYV A;  1IRZ A;  3HOU J;  1USS A;  1XGN A;  2VJ4 A;  3E0J B;  2FML A;  3BTC A;  2KJC A;  2E36 A;  1I6H J;  4IRG A;  1T39 A;  3L2U A;  4LK1 F;  1FBU A;  4BJT A;  5AON A;  4UNO A;  5JVT A;  1RET A;  2VQC A;  2R7W A;  4ZYA A;  5GAE J;  3QOE A;  3DP7 A;  1J7K A;  3D5R C;  3CCQ I;  1WCM J;  4LMY A;  3U1D A;  1GHC A;  3CCY A;  1ZGW A;  2LKP A;  2M34 A;  3MFK A;  2K9N A;  3KP7 A;  2DA1 A;  4OAZ A;  3W2A A;  1QZE A;  2ELJ A;  4JX4 A;  3W6K B;  1OCC H;  5E1Z B;  2HWV A;  2MH2 A;  1X19 A;  3E6B A;  3KYC B;  4GYI A;  1EH6 A;  4S05 A;  4KUM A;  2D2W A;  2DA5 A;  1I3A A;  4Y7N J;  1FYK A;  3K2A A;  3C2G A;  5JR3 A;  2LBF B;  2CMP A;  3GLX A;  1W36 D;  2ME0 A;  4E7L A;  5F0C A;  2VE9 A;  2OPT A;  4IQ4 A;  4YG2 F;  2JSC A;  3QAH A;  2JA2 A;  4M74 A;  2HVQ A;  1MMD A;  2CO5 A;  2WY8 Q;  2O03 A;  3L2V A;  2Y9Z A;  3ZMV A;  3I3L A;  3WHC A;  1ACI A;  4XBF A;  5J6X A;  4A3F J;  4HF0 A;  3IKV A;  2XRL A;  3DKY A;  2KFD A;  4DZJ A;  1SFE A;  4HX7 A;  3VWB A;  2F5V A;  2XRO A;  3OYJ A;  2QKM B;  2QF7 A;  1U0J A;  4E7K A;  1NK2 P;  1IV8 A;  2MW8 A;  2QSG X;  1FIP A;  3CDI A;  1FJL A;  4I99 C;  1LFB A;  5DUI A;  1B8I A;  3FMQ A;  3QOP A;  2PLY A;  4HX8 A;  2V7F A;  4FAS D;  1LFU P;  4XLC A;  2LK2 A;  3U21 A;  3LSG A;  3FXR A;  2CUZ A;  1TQI A;  2XAF A;  1OYW A;  4XSZ F;  4U7D A;  4A12 A;  3MCZ A;  4CHU A;  1L0O C;  3HPH A;  1YJW I;  2PEX A;  4CYC A;  2FRH A;  2QBY B;  2Y0M A;  2VKV A;  2DTZ A;  4HLY A;  1YX5 A;  4P55 A;  4XQF A;  2DJN A;  4BXF A;  4GCV A;  2X1C A;  2O5R A;  2P7C B;  4EM0 B;  3O3K A;  3F6V A;  4R1H A;  1MSE C;  4B43 A;  1KYZ A;  3K4L A;  2K9S A;  1DP7 P;  4CIC A;  3DEU A;  2YX7 A;  5HLG A;  1E17 A;  5A2Q K;  1T33 A;  4RDU A;  1JTX A;  2E2H J;  1NG6 A;  4A3M J;  1I3Q J;  2VPL A;  1UB9 A;  4BU2 A;  1IAW A;  1B59 A;  3GO5 A;  1T8I A;  1W1W E;  2R7O A;  4EJV A;  3BR0 A;  1RRJ A;  1YS6 A;  1JHF A;  2ID3 A;  3BTI A;  3OYE A;  2FQ4 A;  2W85 A;  3IRR A;  2F5C A;  2KP6 A;  1IDZ A;  3X2Q H;  2QCO A;  5EDN A;  5FB2 A;  2VON A;  3DTK A;  1FYM A;  1T38 A;  4XRS A;  3MZH A;  2DQR A;  5HOO A;  1IN4 A;  5J47 A;  5LGT A;  2L3D A;  2EFN A;  1S3J A;  3KP4 A;  2EBI A;  3WGI A;  3CJR B;  2VOP A;  2P4W A;  3DU5 A;  5JLX A;  4LD5 A;  1IRG A;  1S7A A;  2ID6 A;  2P81 A;  4N0B A;  3PIP F;  3LAP A;  3HPG A;  5JVG F;  3QWL A;  4V2F A;  2R5Y B;  2R7R A;  1XSX A;  2K9L A;  4IKF A;  3LSJ A;  4FE4 A;  1I39 A;  4B3A A;  3K1M A;  1JT0 A;  4XLP F;  4CCM A;  1ON1 A;  4OIP F;  2V4J C;  3ECH A;  2GWR A;  4MFD A;  1OCO H;  3VYT B;  1TQP A;  4C3J J;  1NTC A;  3HOX J;  4G94 A;  2HR3 A;  5EJC A;  3N97 A;  2OTJ I;  1SD4 A;  4QLC U;  2JTV A;  1JE8 A;  1IF1 A;  2LY1 A;  5JLW A;  1AKH B;  3GEZ A;  4C2U A;  1IUF A;  3OS2 A;  1ULY A;  3B6C A;  1XSV A;  1Y1V J;  4L5J A;  4XKC A;  1FZP B;  2KRF A;  2ADU A;  2XGD A;  3M8F A;  2L7Z A;  2HOA A;  3FKI J;  3IV5 A;  1TW3 A;  2P0W A;  4JOM A;  3U1K A;  4AUX A;  1G2H A;  5IP9 J;  5K7Z A;  3ISP A;  2LR8 A;  2ZXH A;  1K78 A;  4L5I A;  1GUU A;  2MAB A;  3ZCO A;  1MJ9 A;  4O3M A;  2DJI A;  2Z16 A;  1KON A;  4JK1 X;  2BXZ A;  4YRV A;  2QQ8 A;  4LGW A;  2HS5 A;  1MJA A;  1Y0U A;  2GIV A;  3JRA A;  2O6G E;  2YPR A;  4U87 A;  3REO A;  2CJJ A;  2XV4 S;  3TBI A;  4ZYH A;  1YHQ I;  4HOB A;  2VE8 A;  5D6F A;  3C2H A;  2XDV A;  1W5S A;  1T2K A;  1A6I A;  2MSY A;  2RAE A;  4MTD A;  1JKQ C;  3LA3 A;  3BR2 A;  5M5W J;  2M4K A;  2HDW A;  3K2Z A;  1W5C C;  1ZLK A;  4BKX A;  4BJ5 C;  1D1B A;  4M3E A;  3F9K A;  4EJU A;  3ZQ7 A;  4JBA A;  2R7Z J;  3TKY A;  4E7I A;  1B72 B;  2EB7 A;  2V26 A;  1ZRF A;  1HW2 A;  4KT5 C;  2P5V A;  4G7H F;  3P9I A;  2OV7 A;  4MNU A;  4G9Y A;  4XIC A;  1OLT A;  2Z2S B;  1TQM A;  3KP2 A;  4IHW A;  4HV6 A;  1QHG A;  2KIS A;  3EUA A;  4UY8 I;  1O3S A;  3G1O A;  5EG0 B;  3OYD A;  3BZC A;  5FD5 A;  3IP4 B;  3CMY A;  3IC7 A;  2MC3 A;  1BW6 A;  3FMR A;  5B1A H;  1LE8 A;  3OYA A;  4WXC A;  1FX7 A;  1R23 A;  3VYS B;  3GME A;  4C30 A;  2IJL A;  1PVE A;  4XN3 A;  3H36 A;  3CO7 C;  3M9A A;  4JYK A;  2WV1 A;  3R60 A;  1DUX C;  4XM3 A;  4EQQ A;  3RYP A;  3I71 A;  3WTU C;  1HKT A;  1SD6 A;  3F8C A;  5DM6 F;  2ZSH B;  3OYM A;  2LLK A;  4EMS A;  4A0X A;  1Z77 A;  4A6E A;  5TRD A;  3MZY A;  3OYH A;  3C2B A;  3ZMS A;  4CCK A;  2E5Z A;  4D1Q A;  5ILS A;  4LOC A;  2Y31 A;  1ZN2 A;  4E7J A;  5EF6 A;  1R36 A;  2J5P A;  3P5J A;  2UUZ A;  4Y17 A;  5HNF A;  2GIZ A;  3BPX A;  3CTA A;  5J4V A;  3VYR B;  2BHZ A;  3ML6 A;  4UB6 C;  3A4C A;  2FOW A;  3GTQ J;  2L4A A;  3PO3 J;  2K4J A;  2M7A A;  4MTE A;  3DBR B;  1UST A;  1XG1 A;  2VLA A;  1WJA A;  4AM3 A;  5CQE A;  1OKR A;  4LB6 B;  3J7Y J;  4R79 A;  2ICW G;  5CVR A;  4Z6Y A;  5D4R A;  2V9P A;  1Z7U A;  1WSU A;  2PBI A;  2PJR A;  2ECC A;  1TT5 B;  4OOI A;  4L9J A;  2IGM A;  1YRN B;  4DQ2 A;  5D4S A;  4HG2 A;  3CJQ B;  3S2H J;  1ZLJ A;  1K7A A;  3NRV A;  4RAF A;  3KET A;  2DFE A;  4HST A;  4BJ6 C;  4MHG A;  3JRI A;  2GZW A;  4B8X A;  3DTE A;  1V4R A;  1JKR C;  2EFQ A;  3OSG A;  2H6B A;  5J8F A;  3OS1 A;  1VQ9 I;  2CGP A;  5IT9 Z;  4JQF A;  4KIF A;  2DA4 A;  3GVA A;  3I64 A;  4DYC A;  2DMP A;  2H6C A;  1IN5 A;  1WKM A;  3K7A J;  4HNU A;  1BOB A;  1GLN A;  4BGD A;  1O3Q A;  1A6Q A;  1Z1D A;  2Z1D A;  2MC4 A;  2PMZ A;  2CG4 A;  4XOR A;  3CF5 F;  4P5O A;  1TW2 A;  3LNQ A;  4KIS A;  3OS0 A;  4CH7 A;  1F5T A;  4U0Y A;  3L2W A;  1Y39 A;  4CO8 A;  3NWT A;  3GXO A;  4BEH B;  1K4S A;  2PI0 A;  5FO5 A;  1IDY A;  3TDZ C;  4DNC A;  5D5V B;  2QQ9 A;  3S93 A;  2EIN H;  4BH9 A;  2LYC A;  5BPD A;  1REP C;  4AYB N;  2HOS A;  5ILU A;  4EGY A;  2ME6 A;  3R6S A;  3ROU A;  2V9V A;  2XF6 A;  4M9S A;  3F22 A;  1XGM A;  2J5O A;  3FBN B;  4LJZ F;  1D8K A;  5LRS A;  5EZG A;  1TP4 A;  5LFA A;  1BR4 A;  3RYR A;  1RES A;  4NHJ A;  2WY7 Q;  5TJJ A;  2NVQ J;  4FQG A;  3NAU A;  1Y6I A;  2QGU A;  1WI3 A;  2EZK A;  2HXI A;  2QUF A;  1YIO A;  5E3O A;  4D0P A;  4UXN A;  1MDM A;  1SFX A;  2EFO A;  4KA4 A;  3HTS B;  4IHS A;  2TDX A;  5D5U B;  4XK4 A;  2ZME B;  4NB5 A;  1QGP A;  2RDP A;  3F8B A;  3ONQ A;  1JGS A;  4XLA A;  3EET A;  3PNT A;  5KAF C;  2W4S A;  4A3I J;  1BIB A;  3MN2 A;  4C2M J;  2L9S A;  5K5R A;  4MEX F;  3KIO A;  1ETO A;  5FGM A;  4HNT A;  2EFP A;  1XN7 A;  3LOC A;  1UFM A;  1U8B A;  5C4X J;  1Z9C A;  1WWX A;  2LBF A;  1E3H A;  2KQR A;  4HYE A;  4U0V A;  2HVS A;  2KT0 A;  3OSF A;  2A61 A;  5F27 A;  5BOX A;  2EIM H;  3TO6 A;  3JRD A;  1YIJ I;  1JKP C;  4UVA A;  3M3Y J;  4L5E A;  1R1T A;  2CU7 A;  3O8H A;  3PSF A;  3TGN A;  2FE3 A;  4FET A;  2QSF X;  3DXJ F;  5J1U A;  4ZC3 A;  2FXA A;  3ECO A;  1YW9 A;  1EH8 A;  5HVQ C;  4HNV A;  3CCL I;  1UMQ A;  1BI1 A;  3QQA A;  2HYG D;  1U6G A;  2CFO A;  2ZFW A;  3GZ6 A;  4BS9 A;  2ELH A;  2DMQ A;  2X6W A;  2PFB A;  5J3L A;  2Y0S N;  1NHA A;  5KVR A;  3OYG A;  1RR8 C;  2IBD A;  1B8I B;  1MH3 A;  1N25 A;  2LG4 A;  4EJO A;  3IWZ A;  4KIB A;  3WOD F;  2Q2E A;  1XDU A;  5M5Y J;  4ZZD A;  5IOY A;  1BIA A;  3BR3 A;  3HUG A;  3LSM A;  4KMF A;  5DCF A;  1XGO A;  3I4M J;  3CCM I;  3L00 A;  3V8K A;  3K69 A;  3F8M A;  2HYJ A;  4JX6 A;  2OUM A;  4UUV A;  2V6C A;  1ETV A;  5DD4 A;  3S2W A;  4U7B A;  2CQN A;  3RPQ A;  3C7J A;  4NC6 A;  3BJ6 A;  4M9Z A;  1HF0 A;  1R7J A;  1KYW A;  1G3T A;  2W82 A;  3ABT A;  1ZRC A;  1K79 A;  2DCE A;  2BVL A;  2MG4 A;  1LB2 A;  1SAN A;  4AD9 A;  3R0A A;  4HX4 A;  1BI3 A;  4EGZ A;  2QYO A;  1P4A A;  1MMG A;  2BZT A;  3LST A;  3ABU A;  1TL8 A;  3AAF A;  4QPQ A;  1IN8 A;  2FBH A;  2Y0S A;  4QPO A;  4BHB A;  3HTU A;  4IQJ A;  1KU9 A;  3BG6 A;  1FOW A;  3DBH B;  3JW4 A;  2NVX J;  1VQN I;  2HYF A;  3MD2 A;  2JVH A;  2L7K A;  2X51 A;  2G7U A;  2CFX A;  3AG1 H;  1QZZ A;  2AXL A;  4NQW A;  4CCN A;  6PAX A;  5FLM J;  1XCV A;  3CME I;  3W2W A;  1VQ5 I;  3J81 K;  5IP7 J;  4HW0 A;  3OOU A;  4O6J A;  1Q1V A;  1Y8Q B;  1WHU A;  4OIN F;  1SMT A;  2EIJ H;  2YX4 A;  2I10 A;  2IGN A;  3K0L A;  5IYC J;  1J75 A;  4PFP A;  1X3U A;  3ZN0 A;  1WH5 A;  2NXN B;  4ZJZ A;  3U2R A;  4WK8 F;  3JRH A;  3G4S I;  3CJN A;  5BMZ A;  1I1G A;  3A2K A;  2OA4 A;  2VBY A;  2X9D A;  2Y2Z A;  1YJ9 I;  1MMA A;  1ETK A;  1QHH D;  3CCJ I;  2V1X A;  3PUB A;  2KL4 A;  2UXN A;  2PMU A;  1P7I A;  3V7C A;  1SVO A;  4L0Z B;  1XB4 A;  3GZ5 A;  2W00 A;  1POG A;  3BJA A;  1JKO C;  2E1O A;  3S15 J;  3H3Z A;  1ZEL A;  2VJ5 A;  3LSK A;  3S3O A;  1ETX A;  2YS9 A;  2DMU A;  1DDN A;  2YU9 J;  5EZH A;  4M9X A;  3L2Q A;  1V3F A;  2VBZ A;  1AKH A;  1FPQ A;  2P7V B;  1UJ8 A;  2L5Q A;  1HW5 A;  4CZZ A;  2KJB A;  3Q3S A;  1ETQ A;  1MH4 A;  5LHG A;  3FHZ A;  1FBS A;  1P92 A;  4ENN A;  3TOB A;  2EPF A;  4BXU A;  3QU6 A;  5K7F A;  3VOE A;  3F8F A;  1ZR4 A;  2A05 A;  1IW7 F;  1FP1 D;  2EWN A;  5CJ9 A;  2LY9 A;  2LMD A;  4WWC A;  3DV8 A;  1ZRD A;  1UG2 A;  3WU1 B;  2A5W A;  4KNY A;  1GV2 A;  4C3H J;  3DQV C;  3ZQF A;  3OYI A;  1SMY F;  4KMU X;  4XKV A;  2MH9 A;  2WB1 A;  4MQ9 F;  2DOE A;  2W48 A;  4B47 A;  1WJ5 A;  2ZCW A;  2AQF A;  4N4O B;  2R7T A;  2H8W A;  1FMV A;  3SJM A;  4AYB A;  2ZBK A;  2XIG A;  2QKL B;  3I4P A;  4BYY A;  4AU7 A;  4MQV A;  5DM7 F;  1QBJ A;  1FP2 A;  2FQ3 A;  4IOA F;  1R6R A;  3PSI A;  4GFB A;  4F7Z A;  3VSK A;  1HST A;  4A3K J;  3DLA A;  2DA7 A;  4ABZ A;  4B44 A;  2KDO A;  1W7P A;  2QA4 I;  3TQN A;  2JK3 A;  1GVJ A;  1B72 A;  2A3S A;  1FBQ A;  3JSO A;  5D8L B;  2JZY A;  3SFI A;  5M5X J;  5B3S H;  1S7E A;  5HS7 A;  2L7F P;  3ASO H;  1YTY A;  4F3Q A;  4JX5 A;  4OU0 A;  4E4H A;  3S14 J;  1G6N A;  2CW7 A;  3Q0U A;  1TWA J;  1BW5 A;  2E2J J;  1A5J A;  1H88 C;  1T6S A;  2EZH A;  1LE8 B;  1FEX A;  3IRQ A;  1CF7 A;  1ZQ3 P;  2IGK A;  2WAQ N;  3K6G A;  2VBX A;  3HOW J;  1XX5 A;  4Q48 A;  2NAZ A;  1PUE E;  2V1N A;  2FOK A;  3OV8 A;  1TZL A;  2R93 J;  2ZXJ A;  2RGV A;  5DV5 A;  3E3V A;  2R7S A;  1WRJ A;  3GBG A;  1GXQ A;  3IAS 2;  3VFZ A;  3KP5 A;  2OZU A;  1F36 A;  3ABM H;  3KZI C;  3IH2 A;  3KPH A;  1MIJ A;  4M71 A;  1Y1W J;  4BQQ A; 
#chains in the Genus database with same CATH homology
 2QSF X;  2F4O B;  2QSH X;  1PVE A;  3ESW B;  1X3Z B;  1OQY A;  2QSG X;  1X3W B;  1QZE A;  2F4M B;  1TP4 A;  4YIR X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...