3ESWB

Complex of yeast pngase with glcnac2-iac.
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
55
structure length
55
Chain Sequence
SIGLTVEDLLSLRQVVSGNPEALAPLLENISARYPQLREHIMANPEVFVSMLLEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and mutational studies on the importance of oligosaccharide binding for the activity of yeast PNGase.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
molecule keywords Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine amidase
total genus 19
structure length 55
sequence length 55
ec nomenclature
pdb deposition date 2008-10-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 3eswB00
1PVEA 2QSFX 2QSGX 1QZEA 1OQYA 2F4OB 1X3WB 4YIRX 3ESWB 2F4MB 1X3ZB 1TP4A 2QSHX
chains in the Genus database with same CATH superfamily
5HLIA 5K5RA 3PSFA 3S32A 3E7LA 5L3CA 3FK7A 3H3VK 1OLTA 3LFKA 1YS6A 3I55I 1S3JA 3FK6A 4A2UA 1YRNA 4XOTA 2OZ6A 5C4XJ 2X1CA 3CQZJ 2BZTA 1VQ4I 4U0WA 2LY2A 2W85A 3MQ0A 2HWVA 2VOPA 3IH4A 1YG2A 2PMHA 2DMTA 2DFEA 2LFBA 3C1DA 2DA3A 2Q2EB 3CC7I 3MKWB 2F5DA 3I58A 5EZHA 1ZRCA 4HDUA 2ZSHB 2B0LA 4RM3A 2A6EF 1D8KA 1D5YA 4R79A 1J59A 1AKHB 4G6QA 3LSGA 3ZPLA 1ON2A 2A5WA 2DW4A 2R5YB 5J47A 2DU9A 3FXOA 5LLQA 2KP6A 2VE8A 2A61A 3M9AA 3I0TA 1X1CA 2DOFA 3KIOA 5D6EA 2QKLB 3IH3A 3DCFA 2IJLA 4M3BA 2KRFA 3UKGA 3OOUA 1QA6A 3GBGA 3WG7H 4DBQA 5E1WA 1BR4A 3RZOJ 1XMXA 4BXXJ 3F23A 5IP9J 2R7RA 3LSJA 2DTZA 1CF7B 3VDXA 2EFOA 1R00A 4A3DJ 2XAFA 2CU7A 2BVLA 2M7AA 3KPHA 2IS1A 1R7JA 2C6YA 2X6YA 2QUFA 4KN7X 3R61A 3FXJA 2KLOA 2WB1A 3LQQA 5B3SH 2CS3A 3DPTA 3RDIA 3L1PA 1FSHA 4NQWB 5KK1A 2ZFWA 2LTPA 4JYKA 2V1XA 1HCRA 1JKPC 1W7PA 4BHCA 3CDLA 3CMEI 1GV5A 5FB2A 2QBYB 1ETKA 2JSCA 2OU2A 2L4AA 1DPRA 4ESBA 2VBXA 4WCGA 2HZDA 2W48A 4ENJA 3V8LA 3CJTB 5EEHA 3PIPF 3HJEA 4A5NA 1DGWY 4AD9A 1JTXA 3I9V2 3OIPA 4II2A 3DEEA 3BTCA 2X6OA 1E3OC 4OMYA 3SZGA 1IRFA 1R6RA 2ZKZA 1W36C 3OSGA 3DTEA 2R7TA 5GTHC 4DJAA 1SANA 3OYEA 2DYRH 2V4JC 3WODF 2B63J 1WCMJ 2FJ1A 5M3FJ 4P5OA 1TWHJ 1OMIA 3TMOA 3LAJA 3UR3C 3KFWX 3AL0C 3Q0UA 5CQGA 3CJQB 1EA3A 2J5PA 2ESNA 3CO6C 4X6AJ 3LSMA 2XVCA 2VJ5A 3ASNH 1T38A 3LQRA 2XSJC 1K83J 2R93J 3PFYA 4N9HA 5H6QA 4AYBA 4O6JA 1NG6A 3KE2A 2V9KA 2OV7A 2L5QA 2DA7A 3TO6A 5HLGA 2ZXIA 1R23A 3QPLA 4CGZA 4BY1J 3LSHA 1TWGJ 2QQBA 2JJ7A 3AG3H 2WV1A 1VQLI 2BV6A 1UFMA 3M1EA 1WSUA 3BR0A 2E7XA 3LA2A 1D0YA 4CDGA 3LNQA 4AM3A 1C0WA 4YIFA 2XHKA 1YQAA 4KMFA 3M07A 1SAUA 5TISC 1JUSA 4Y33A 3L2CA 1Z05A 2CUJA 3KP6A 2UZKA 2X0LA 5LD2C 3TGNA 1P2FA 1SVLA 2WAQA 3ML6A 1HXDA 1HW5A 3FXQA 1TQMA 4XONA 1T95A 2HXIA 4KDPA 3J7AY 4J19A 4KYWA 4M9SA 4RAZA 2JA7J 4WXHA 3J7YJ 2JRMA 2M8GX 1TT5B 2FUG2 2KRCA 1R58A 4NDLA 3RSNA 4BEHB 1TC3C 2OA4A 2RV8A 2KIQA 1IRGA 2WY7Q 2IS4A 4GDFA 5LGUA 3FMQA 1GHCA 4Y4RA 2E2JJ 1FYKA 2DOAA 4M74A 2O8KA 2X4HA 5IPAA 2RQQA 3BG5A 2IVMA 1MMAA 1YTYA 4FCYA 1JTYA 2JQ7A 2VC1A 1UG2A 3QYBA 3E6DA 1G3TA 1ZREA 5HLHA 2BXZA 5J4VA 1MD0A 3K70D 1LQ1A 1IF1A 2CQ7A 4B47A 2DA5A 2W82A 4L0ZB 1ETWA 3K2AA 5DS9A 2OJED 3CDIA 2BE5F 4PJ0C 4RAGA 2ZXJA 1X1BA 1K61A 4D0PA 2HQRA 4KIFA 4PJJA 4RAFA 4I2OA 2FRHA 3MD2A 4CHUA 1T98A 3CCYA 3A01A 3EYYA 3RQIA 1O57A 3OY9A 2FNAA 4UXNA 2QENA 3ZMVA 4WK8F 2HGCA 3G1LA 2GQQA 2XAUA 1FOWA 2HS5A 1YIOA 3VYTB 5GAGJ 1APLC 4MNUA 2MLGA 2K9QA 3V42A 4E7LA 3HM5A 2FMLA 6PAXA 2RDPA 1VQ8I 1TQIA 5FRNA 2D1HA 2MFZA 2E1CA 1B4AA 4CUGA 2IS6A 2I8DA 4A3KJ 2DOEA 5BPIA 4EJUA 1WZ2A 1BR2A 2RC4A 1HOMA 4I0AA 2IP2A 4B8XA 2MA3A 4MIMA 4U7BA 2CJJA 3BQZA 4DZJA 2OBPA 2PG4A 4HX8A 4DGWB 2KISA 5FKOA 4HNVA 2QBYA 3ZQIA 1P6RA 2IEKA 4MLOA 4XKBA 4L18B 2F5FA 3KETA 3ZR8X 1W5CC 1U0JA 1T39A 3HHHA 1G8XA 2ME0A 3LSRA 4NB5A 2E36A 5CQEA 2GXGA 3F6OA 4B3AA 4AIKA 4A0YA 2H6BA 1W0TA 1KONA 3W6KB 3PQJA 3OOPA 1FMVA 5FD6A 3GFMA 1OCZH 3JCUC 5ERIA 3V7SA 2DJIA 3FMRA 2NS0A 4ZYDA 2ACJA 3S1NJ 2CUFA 2AXLA 3M8JA 5F0HA 4BS9A 3ABKH 1W0UA 2OZUA 2A6HF 2L4MA 4EGYA 5E3OA 2W25A 2N8GA 2ETHA 1ZK8A 3EDPA 4ZDLA 2H8WA 3RI4A 5EGOB 1IJWC 3RPUD 1CF7A 4M71A 1IC8A 4LB5A 3TDZC 4CZZA 1TL8A 1K79A 3SDGA 4XORA 4XRSA 4C30A 5K7FA 4GCVA 3ZQ7A 1QVUA 3E1SA 1AHDP 3OL3A 3K4KA 1B72A 3ERMA 1LKXA 3E97A 3I54A 4U0VA 5L3GA 2NOGA 4XN0A 2LKSA 4HDVA 2DMUA 4B09A 2XF7A 2HXOA 4E7IA 4P9UA 5KAFC 1DDNA 4N9IA 1SD4A 2TCTA 2IA2A 4B44A 3CF5F 3V7CA 5FRMA 3NEUA 2HQNA 3AKZA 2Z1DA 5JHUA 2WV0A 5ILVA 4LD5A 1RR7A 2MD5A 3DU5A 4J00A 3R6SA 2WWYA 2DBBA 3WU2C 3K4CA 2LBFB 4DYRA 5IYBJ 1LEBA 1BIAA 2BHYA 2G9WA 2O5RA 2M2EA 3ABMH 5FKLA 3I64A 1WJFA 1QBJA 3H36A 2ZJRF 2PJRB 3S17J 1ETYA 2QLZA 1S72I 4ZJZA 2W4SA 3AL0B 1ZLKA 4FX0A 2CRGA 1BR1A 1SD6A 1MBHA 2Y30A 4NHJA 3GLXA 2R0QC 3HYIA 2M45A 3PSIA 1LUJB 3H5AA 1YLFA 3COAC 2EH3A 4E7JA 2QKMB 1PVEA 2ID3A 4BDYA 4PZJA 4LLLA 1ZH5A 1H9GA 2YUSA 4A3IJ 5FFZA 3HOWJ 4DYCA 5CVUA 2IPQX 4LFUA 2Y2ZA 3CO7C 4BE1A 3EETA 1YS7A 1RR8C 3DU6A 5DEQA 1SFOJ 2EK5A 5IT9K 3OS1A 3G1MA 3T5XA 1H8AC 1FOXA 4G8XA 1EF4A 3WGIA 1N77A 1MNMC 3BOQA 3WTYC 1IG7A 4XNFA 2ZMEC 4ABZA 1LVAA 3HEFA 1DPUA 5DDGA 3FX3A 1Z67A 2OTLI 1IXSB 1YE9A 4NBQA 5D6FA 1LE8A 2MW8A 3A01B 2XUBA 5JVGF 2CSOA 4Y17A 1LFUP 1BC7C 2ZC2A 1VNDA 1LB2A 3WE2A 3IWZA 3I3LA 1OR7A 4OIRF 4A0ZA 2F6CA 1KGSA 3P9CA 1UZCA 4G6TB 3SXYA 3ASOH 4EV0A 4LK1F 4YIRX 1YJ9I 2CFOA 3DWLE 3F8FA 2VQCA 2W00A 1TBXA 2KT0A 3PNVA 4G9YA 3W3CA 2PX9A 1Q1HA 1T56A 3GEZA 4CH7A 1RZ4A 3QPHA 1Z91A 3IKTA 2L7MP 4MEYF 4C3IJ 4BJ5C 3BG6A 2VIXA 4I02A 1J2XA 4HEA2 1D0ZA 1A6IA 2E60A 1B8IB 2DLLA 3HSRA 1H88C 2J5OA 4M6VA 4I76A 1TQPA 1FBSA 5BQTA 5LFAA 2E1OA 3O6BB 4MQ9F 2COBA 3T8TA 4LG0B 3CCMI 4UUSB 1QZYA 4NNJA 2KIUA 3JRIA 2UXNA 4BBRJ 3DPUA 4UY8I 1BI3A 5DM6F 1Z6RA 2M0MA 1IV8A 1E3PA 2OQRA 3F0CA 3D5RC 3A0HC 3AG2H 2ECCA 4DIQA 4AIDA 5EJCA 3SHFA 1R9TJ 4M3FA 3BWGA 1QHGA 5F27A 1VTNC 1VF9A 4XLNF 1H9TA 2WAEA 2XB0X 3MN2A 1Z21A 3KYDB 3L09A 3PUFA 2LY1A 4RGSA 2F5CA 2KPMA 2NS8A 3IAS2 5DM7F 2M7BA 4EJOA 1Y0UA 4A3EJ 5A2QK 2UUZA 3GX4X 1ITYA 3M8FA 1KZHA 3OS2A 3CCJI 3FF5A 2DK8A 1TNTA 3CESA 1QVTA 5ILSA 1MSEC 4LG0A 4ZDPA 3G71I 5D8LB 3BP8A 3FKIJ 1NK3P 4M6XA 3DQVC 1A6QA 2OF7A 2BOLA 4IRIA 4L5JA 1JJ6C 2Y0SN 5H20A 1IO2A 4P9FA 5B1AH 1E2XA 4ASNA 3OYNA 4CYCA 1MGTA 3DKYA 1U5TC 1LE8B 4BQOA 2OUMA 1F43A 1YIJI 5GPAA 1MDMA 1ZGWA 1MNEA 3E6MA 4IEJA 1XPXA 1RC9A 3CMMA 1ONVA 5FLMJ 5EEAA 4EGZA 1OCPA 3V4GA 5FJ8J 3H5RA 1YJWI 4NC7A 4A5MA 2ZO4A 3PNYA 2XGDA 2XPWA 2GIVA 3CUQB 1W5TA 4KUMA 1MIJA 4BJTA 3GTLJ 1G6NA 5GADJ 2R7SA 2AHQA 2IBDA 4FETA 2L9RA 2QZ8A 4DYQA 5E1ZB 3LSPA 3BG3A 2EJRA 5L3DA 1SMYF 4Y15A 5IT3A 2JA8J 3KEOA 1BI1A 3VSLA 3J81K 3NRVA 2DAOA 1OYWA 4JK1X 3KLNA 1SEUA 1MW7A 2DT6A 4QIWN 3DV8A 1Z3XA 1R4MB 4X0GA 4I09A 4BACA 2CV0A 1HW2A 1HKQA 3L2VA 3CJRB 2ICWG 4XSZF 4AWXB 4S05A 3TL4X 2F48A 2L9NA 2RREA 5M5YJ 2QQAA 1V3FA 1OJLA 2Z9OA 3HIFA 4W97A 1VZ0A 1ETXA 1QPIA 2PJPA 3IUOA 1R36A 3CCUI 5LHHA 2JTVA 3REOA 3OYDA 3SZPA 3KZYA 2LKPA 1WGXA 1JUMA 4BJ6C 4M6YA 4H0EA 3CC2I 3F6VA 5DCFA 1OCOH 4ON0A 5E3MA 1LJ9A 2D1VA 3FKJA 1SC7A 1LDDA 5EF6A 5M5WJ 1Z9CA 1QZEA 1DQUA 3C2GA 1L0OC 4JX5A 4M3EA 2XGXA 1V5FA 4PFPA 1X1AA 3H1CA 3CCVI 2DJNA 4O3MA 3BZ6A 2PMUA 1WJDA 2L9SA 1X19A 2CUZA 2E34A 2VL8A 2VXDA 3CC4I 2NAZA 4C2UA 1O3RA 1E17A 1HKTA 4CYCB 2ELJA 4EVIA 1Y6IA 3OYKA 1K6OA 2DQRA 4OIPF 1TWCJ 2JN6A 2KKOA 2FSWA 4BDZA 3PJRA 4L9NA 2VT2A 3WU0A 4WF2A 4HV6A 3RCOA 2QF7A 5J40A 4I6ZA 3AG1H 5F0CA 2VLAA 2QSFX 1WH5A 4HG2A 1I5ZA 5K7ZA 3HG9A 5B66C 4UUSA 1J75A 2WAQN 4N4OB 1FBUA 3QOPA 1N75A 2DFIA 2MG4A 1WJCA 3MVPA 4ITVA 3SFIA 3VWBA 3JRBA 4GXOA 1ZGAA 2M34A 4IJAA 4E6KG 4E70A 1YHQI 3S2HJ 3T8RA 1R1UA 1FOYA 2VXZA 2KDZA 5CKTA 3O2PE 4CICA 3P9KA 1ODDA 2XPVA 5FROA 1KYWA 1ETOA 3EYIA 5C4JJ 4X1EA 1STZA 2W24A 4HF1A 3KYLA 1MJBA 2Y0SA 3NARA 4I7HA 4OU0A 2X9DA 2X6XA 4V19K 2AQFA 3A4CA 3OL4A 2JA2A 1OKRA 1O7FA 1TP4A 4QPOA 3S8PA 4F52A 3CP8A 2FX0A 4EJVA 3CCRI 1ZKGA 1LFBA 3Q5FA 5A2QZ 3HL2A 5ILUA 4AIHA 2FOKA 2HOTA 3ZP5A 3TDUC 1JHFA 1XB4A 3DPLC 3LSKA 5JR3A 3DBLB 2KMUA 4XRMA 4D7MA 1K6YA 4IHWA 4BHPA 3BJAA 3KCCA 5JLWA 5B5EC 3I5UA 3TW7A 3GTGJ 1NH3A 2DTRA 2ZNZA 1POGA 3HSFA 1A35A 2FNPA 4PSXA 1I1SA 1Y8RB 4OAYA 4LJZF 1PP7U 2K3PA 3K6GA 3ROUA 1O3SA 4KISA 2KJBA 3OYAA 4ENKA 3QYEA 3CDHA 2OCEA 3F22A 4A3LJ 3H0GJ 4E7KA 3EPZA 4G7ZF 1TWFJ 1Y8QB 4JQFA 2M9HA 3Q0WA 3EUHC 1UELB 1AU7A 1WJBA 1VI0A 2BVMA 1IUYA 4XMYA 3L9FA 4OMZA 1I3AA 4JX4A 5DYMA 3W2AA 3WTVC 1R5GA 5F04A 2DCEA 3ZMUA 3IH2A 1FT9A 3RKWA 1S6LA 1JHHA 2L7ZA 1ZLJA 3TQNA 2OC6A 2XRNA 1OISA 1G3WA 5E8GA 4AC0A 2YX7A 4C2MJ 4LIVA 1YYVA 1W36D 1I6XA 1P7JA 2MH9A 2L02A 2R7OA 3CP2A 3QYFA 3P5JA 1O4XA 4DBRA 3GCMA 3S2DJ 2FEZA 2BW3A 5F6FA 4AVPA 1W4MA 3FXRA 4FX4A 1Z7LA 2A68F 2G7HA 2PN6A 1WJEA 3RZDJ 3N05A 3HZJA 5DD8A 1Y0NA 1B6AA 4CZCA 3J7ZI 2JRTA 3HOUJ 2HNHA 1B59A 2VB6A 2PQ8A 1OFCX 1YW7A 2F2EA 3GF2A 2RKHA 5HDGA 2MH2A 3LA7A 3E3VA 4D7NA 4FQGA 1LDKB 3QOEA 2X1DA 3PQKA 1FIAA 3JTGA 1BBYA 1X4PA 4HAMA 2O8XA 5J3LA 3MZ8A 4GGGA 2JVGA 4WXDA 2PLYA 1KQ0A 5CVIA 3JRHA 4KJZA 2LYCA 4I01A 5H2FC 3JAMK 2CQKA 1MSFC 3A1YA 1RUOA 2NYXA 3KP2A 3H9QA 4OINF 1N78A 1SAXA 4RLFA 5AONA 2CQXA 4HLXA 4LLGF 5IOYA 1TT0A 3PUBA 4XSXF 3OYGA 2I5UA 1WKMA 2Y75A 5DUIA 1REPC 1U6GA 1HW1A 1ZYRF 4ZYAA 5GAEJ 5HNHA 2X85A 3KLOA 4B43A 4A12A 2K4JA 4HOBA 2WA0A 1SFKA 4B3XA 4EATA 1CGPA 4XR6A 4K2EA 1FIPA 1LVKA 4HZFA 4E7ZA 2LC2A 4Q47A 1UMQA 4YFXF 1BOBA 4BY7J 2YX4A 1ETQA 3WGGA 3WTXC 2JMWA 1Z0XA 3QODA 4QLCU 3BPXA 2X6WA 2JA6J 3K69A 5FKNA 1XDUA 1X58A 4NQWA 1P4WA 3JSOA 1YITI 2UXXA 2NVYJ 1NG7A 3EUKL 3FBIB 3PO3J 5FLXZ 4WWCA 1IXCA 2QSGX 2G0EA 1XN7A 3CJNA 2AQEA 2HTJA 3OS0A 1ZRDA 2CW0F 3MZYA 3W2WA 3RJPA 3SDBA 3HOXJ 1S29A 4W1UA 1P4XA 4HBLA 2XASA 4D9JA 3GZNB 2HYFA 3JRFA 1HF0A 5LRSA 4ESFA 2L7FP 3NWTA 5BNGA 1JKRC 2F4MB 2AXTC 3Q3SA 2OTJI 5FGMA 4C3JJ 1X2NA 4CCOA 4MFDA 2BY3A 4PCQA 4RGXA 4XOPA 3PO2J 4M72A 1MBGA 4XKWA 3AAFA 3RPUA 3ZRGA 4BAYA 2MD0A 3F8CA 4XLCA 3S3MA 3M8EA 5E1XA 1AA7A 4C2TA 1VQPI 4UNOA 5FO5A 4LK0F 3WHCA 2IGKA 1A04A 5HDKA 2ADUA 5JFRA 2STTA 1YW9A 5HNFA 2IS2A 2JUGA 3K1NA 3G2BA 1QQIA 2E2HJ 1OQYA 4OIQF 2E71A 3HTUA 1U9OA 1K4TA 4EQQA 4Q48A 3O3KA 2NVTJ 2V9VA 4A3GJ 1Z7UA 5L3FA 3N97A 5TRDA 1D3YA 4HF0A 4AVZA 2NVQJ 1ERDA 3BDDA 4HX7A 1FEXA 1XMAA 2R7WA 1JGSA 4KITB 5HVQC 2HFHA 1I27A 3BT9A 4IO9F 1LNWA 4EJTA 2VKEA 2HZTA 3BR2A 2E1NA 2FF4A 2XRLA 4CCJA 4XICA 4L9TA 1HSTA 3MKLA 3R60A 3HUGB 3PM1A 1X2MA 1FWZA 2LSOA 2ZB9A 1WRJA 4RB0A 3C3WA 4JP0A 4LLNA 4UHTA 2ZSIB 4LOCA 2HI3A 5CVRA 4CSWA 1AKHA 2WBMA 4MFEA 1FNNA 4EM0B 2R5YA 1OYIA 1HLVA 1A5JA 3D5SC 3IAM2 2F4IA 1F5TA 2GLOA 1ZN2A 3MKYB 3TO7A 4XLPF 5IT9Z 2H27A 3HGGA 4HNUA 2VKDA 3OR1C 4HRIA 4MTDA 1S5LC 2LLKA 1XS9A 1IXRC 5E3NA 2UWMA 4KIGA 3I4MJ 2K9SA 4LMYA 5D5UB 4IHSA 2ME6A 5JHFA 4IQJA 1DGRM 1M1EB 3LSIA 4N4NB 5CVVA 1TW2A 1ZELA 2P6TA 3M1CA 4A3FJ 5LGNA 3O8HA 2EV0A 1T6SA 2R7QA 4HSRA 5C44J 3F8MA 3K4LA 1EH8A 1XCBA 2ZNYA 4ENMA 1QU3A 2M30A 3HB9A 3H35A 2P7VB 5HS9A 4KT6A 2K9MA 4LGWA 2GM4A 5EG0B 2R7XA 3IRRA 2LP0A 5DCMB 3BG9A 3TO9A 1UAAA 1QO0D 3DLLF 5D4RA 2KQRA 5L3BA 1QNTA 4PJNA 2BGCA 3H5NA 1IDZA 1FJLA 1Z1DA 2V1NA 4YG2F 3OYLA 3B73A 2A5YB 5J4YA 2JWTA 2MYSA 4QTRA 2MBFA 1X3WB 1ZARA 4PGHA 2P5LC 2XKOA 2ELKA 2E5NA 4L5EA 2EZHA 4G6DA 4F93B 5BMZA 2Q2EA 1JI8A 1EH6A 2MC3A 3DXJF 3AG4H 1ZTRA 2V79A 3G1OA 4ZYEA 2KJCA 5HS8A 5K1YA 3FXKA 4DOZA 5JLXA 2DPUA 5DTDA 4KN4X 3CMAI 3SFZA 2FA5A 2A05A 2PBIA 1I39A 3FMSA 3ZQGA 3EUHA 1WI3A 3RYPA 4PFOA 1FZPB 4IZZA 2YSRA 3KP7A 2XAHA 3L7WA 1BN5A 4FISA 1Y1VJ 2LF7A 2JVHA 4JX6A 1OYYA 3FIWA 3CD6I 3RIRA 4RB2C 5DUKA 4FT8A 4BQAA 1I6HJ 1EKEA 3LOCA 5TJJA 3IP4B 2E1MC 1FPQA 2V26A 2Y69H 3CCSI 4V2GA 5J1RA 2Y31A 2O6GE 1KYZA 3G6EI 4RB3C 4RAYA 5DV5A 1S7AA 3OSFA 1Z3YA 2Y9YA 2LVSA 1Y1WJ 3ECOA 4XM3A 4D5FA 1WHUA 1GV2A 1GXQA 3H0DA 3RKYA 2VASA 3OR2C 1MH3A 2DA6A 3OYMA 2ZJ2A 2NS7A 2EWNA 2GXAA 4YIIA 2BY2A 5LBQA 2L0KA 5D4SA 2STWA 4Y3OA 1FTTA 1USTA 1QRYA 2P5KA 2CQNA 2KRHA 1U8BA 4JOMA 1VQMI 3NWSA 3JRDA 1LEAA 1R22A 1MZBA 4XLAA 4XK4A 2ZFUA 4KT5C 1J09A 2H94A 2EIKH 1SMTA 1D1CA 2HDCA 2BXYA 1JXSA 4IX7A 1J9IA 4NC8A 3BR1A 1G3YA 2VKVA 5BOXA 2IA1A 4KA4A 1PUFB 4OAZA 1FSEA 1XGSA 1S7EA 3FXLA 3MWMA 1TWAJ 3DKWA 2PFBA 2EA2A 1FMWA 4LITA 1ETVA 1R1TA 4XKVA 2QQ8A 4E4HA 3H92A 3OYFA 2ZMEA 5AIPA 3U9GA 4BQQA 5M5XJ 2DODA 2L2OA 1I50J 4GYGA 1R4NB 4AIJA 2R3SA 3S3NA 4U87A 1IAWA 3HXLA 2VODA 5IYCJ 3DBHB 3FWEA 3CUQC 3ZMZA 2L54A 2WTEA 3HHGA 1WJ5A 1YRNB 3BQYA 2JPBA 2FD5A 4IKFA 2QA4I 3WGHA 1YI2I 2M0CA 3JREA 4PSWA 2PJRA 4UB6C 3GZ5A 3LAPA 3C2BA 2A07F 2BEOA 1FOKA 1JKOC 4XLHA 1U3EM 1G3SA 3JAMZ 2EV6A 3IC7A 2H1KA 2CW7A 4ETSA 4Q4ZF 1SFUA 1E0EA 4FTHA 1S9HA 2ZMEB 2HVSA 3KEYA 1TW3A 3ZQFA 2VQHA 3HOZJ 4A93J 5K5OA 1JT6A 1X1DA 3B6CA 2NVUB 2HDWA 5LEJA 3R4KA 4R8HA 3TOAA 3BLYA 5FD5A 1FX7A 1MMGA 1IN4A 4YFKF 1SD7A 2Z3YA 4IOCF 3K0LA 1VFCA 1J0RA 4HX4A 1T08B 5EEGA 3F9KA 4RLQA 3JRGA 4MGRA 5DCMA 1X3UA 2XIGA 1BM9A 2QCOA 3L2UA 2K27A 3P7NA 4LB6B 4M9ZA 3E6BA 3EUAA 5ICGA 2ZCWA 3GTJJ 1N25A 4C3HJ 5CJ9A 1PDNC 3WTZA 1G4DA 1V4RA 2ELHA 3BY6A 1IN8A 2K7LA 3A0BC 4S0HB 3VYUB 5GAHJ 5IYDJ 1MKMA 2GAUA 2DQLA 4KICA 1S8NA 2Q1ZB 2VQLA 3GXOA 4A3MJ 2Z33A 2E5ZA 2FXAA 2HOEA 2DT5A 3ZN0A 1V54H 2Z16A 4EJWA 5FLXK 3QPTA 1W7PB 2OPTA 3RKQA 4L9VA 1UHSA 4IOAF 1Z6TA 1WFXA 2QWWA 2XF6A 4EMSA 2HTSA 3TEDA 4Z6YA 2VKHA 1LPQA 4JBAA 5ED4A 2LOOA 4L0YB 3F8BA 3ZOBA 3ZN1A 3BC8A 2LBFA 3KP5A 1MJ9A 1WH7A 3GFLA 3IV5A 3K70C 3ZMTA 3WTWC 2VT3A 5AIQA 4PK4A 1F36A 2X51A 3BZKA 3DFGA 3VYRB 5BPDA 4UUVA 5CYVA 3UNGC 3RYRA 1T0FC 1MMNA 1RI7A 2LNBA 2W84A 4HQEA 1RIOH 2VUMJ 4HYEA 3D5LA 2H1LA 3VODA 1HDPA 2HOAA 3ISPA 3LA3A 3E5UA 3H9JA 2HOSA 5K7HA 3GW2A 4XLEA 4ZC3A 1XCVA 2FBIA 5F0FA 3GTKJ 2WAFA 2DDAA 1VQ6I 4ZDOA 3HRTA 3K4NA 3S15J 3GWZA 2NVXJ 2EFPA 2ZXWH 3JRAA 2DN0A 3BG7A 2HVQA 5KAIC 5J1YA 2B9SA 1PJRA 2Q0OA 3B02A 2VPLA 3HPHA 4G7OF 3CUOA 3ZQCA 2F5EA 1A36A 2Q8KA 3GTPJ 1JKQC 3CLOA 2W7NA 1NTCA 3ECHA 5LHGA 1ZAOA 1MNDA 2JUCA 4AYBN 2ISYA 4GRIA 1IGNA 3Q0VA 2KZVA 2EZKA 3HSEA 1KU3A 1U2WA 3C18A 5E3LA 1B9NA 2VBZA 3GVAA 9ANTA 1IUFA 4IVNA 3DTKA 3VOEA 1K7AA 4QWQA 2EBIA 1MDMB 3FISA 1ZR2A 3MMYB 4RM2A 5M3MJ 1FP1D 1XSXA 2VONA 2YS9A 5J1UA 1FLIA 2EV5A 1UCRA 1ZQ3P 3HKZA 4P55A 5FKKA 2X1EA 2ESHA 3S93A 1GUUA 4O5VA 5HOOA 3SYTA 4RGRA 1HC8A 2LF8A 1YW8A 3I53A 2M3AA 3MZHA 1IN6A 2OQGA 3PIOF 3JSPA 4IXAA 3CCQI 1K78B 1RKTA 1G59A 1HDDC 4MTEA 2MSYA 2TRTA 1I1GA 2NNNA 1VQNI 3OMYA 1HA8A 2V1UA 1DU0A 2P7CB 2RN7A 3ZCOA 4ENNA 3B6AA 1R5HA 2XAGA 4Y7NJ 3G4SI 3OWTA 3MCZA 2NXNB 2BBYA 1UHMA 1SVOA 1ORKA 3VFZA 2HDDA 2KDOA 3DBRB 4P96A 1TNSA 1MBJA 2YR2A 4PDKA 4TV7A 3VSKA 2K5CA 4S04A 4RA2A 3L2WA 2CYYA 5KHDA 2JA5J 5L3EA 1IRZA 2EQRA 4YFNF 2CFXA 3PFIA 4ANJA 4EM2A 2HQ5A 1MMDA 3F21A 4Q5SF 2DFHA 2XV4S 3TOBA 1OCCH 3OIQA 2MGQA 3GO5A 2M87A 3LSTA 2EFWA 2IXSA 3ONQA 1BA5A 3ZMSA 2K9NA 5FFXA 1VQ9I 2EIMH 2KIMA 2NOJB 4FASD 1NK2P 4ZH4F 1Q1VA 2GA2A 4YEJA 1D1AA 1P7IA 1YO5C 1HSJA 1PUFA 2QYOA 1ZG3A 3FXMA 4UVCA 4DW6A 1TZLA 3C7JA 2JSPA 1IV6A 3K10A 2M5WA 1ZG5A 5F1JA 1U78A 2M4KA 4B1RA 1X1PA 4IRGA 3BR5A 2DA2A 2CG4A 2IW5A 3ZMDA 3AFHA 1RETA 1B8IA 2ISZA 1JUPA 4G94A 1ULYA 2CV2A 4UVAA 2QQ9A 3U1KA 3OYCA 2FBHA 2K9LA 3H9GA 4EEFG 4C9YA 3BJ6A 3WE3A 3QU6A 4HNTA 2R92J 4IQ4A 3DEUA 1WWXA 2RAEA 3J80Z 1BI2A 2D5VA 2Y0MA 1R49A 3SQNA 4MHGA 1RNLA 3OYHA 2FOWA 1OR7C 3BPVA 5HS7A 4PGGA 4M9XA 3OYIA 2D45A 2GA1A 3BZCA 3RTRA 2EB7A 2DA1A 5HLTA 2AO9A 3HOSA 1GT0C 1UG0A 2CO5A 1RPWA 1SVMA 2IGOA 4RB1A 2V1DA 2JPCA 3I71A 5D5VB 1X3ZB 3GYHX 4CCLA 4WXCA 5GPCA 1ZGJA 3KZIC 3DTIA 3OV8A 2EIJH 5HDNA 3IL2A 3ZXSA 5CPRB 4ZTJA 2IAIA 1IRXA 5GP9A 4HLYA 3C2HA 1H89C 4LIUA 4XKCA 1BC8C 3SJMA 1W5SA 3MEXA 1ZG1A 2BYVE 3GZ6A 2V6EA 1BL0A 3BCAA 3FM5A 1JJ8C 5F08A 1EH7A 1QGPA 3HRMA 3VEPA 3TW6A 4XQFA 2IGMA 1WI9A 2OD5A 1HBXG 2DMNA 3K4MA 3R0JA 2K3FA 1U9NA 2P0WA 3I59A 3R0AA 4U88A 4OIOF 1IN5A 2O61A 2Z5UA 2EPFA 3WTSC 1PUEE 1MBKA 1FYMA 3CUQA 2K86A 4MO7A 5ICFA 3F8NA 1ZR4A 2OAZA 2P81A 1JE8A 1B1BA 2XPUA 1FC3A 4KFCA 3H3UA 4A6DA 2M1BA 2V6CA 2P8TA 1IDYA 3QP6A 1WPKA 1TTYA 1D0XA 5D8KB 1IZ1A 2IGNA 4I99C 3WTUC 3QRFF 4L5IA 3KP3A 4KIBA 5IP7J 1F1ZA 1BJAA 1WVRA 4BYYA 2QSHX 5FLVA 2QVOA 3A02A 4CCKA 2OCCH 3QAHA 3DLAA 1KU2A 2M8EA 2DK5A 3S3OA 2L01A 3E5XA 5EDNA 4DZPA 1T0FA 2XSDC 5LEKA 4A69C 1MMSA 3HOVJ 2RNJA 4H4KC 3HOYJ 1XGMA 2EA4A 2HQAA 2DYSH 5B1BH 1P4AA 2GOXB 2DDBA 2IRFG 1BIBA 2LY9A 3LL7A 4UVBA 5J8CA 2ID6A 1WJAA 2QGUA 3ABLH 4A6EA 3F72A 1KU7A 3GFIA 2HVRA 3K1MA 4FE4A 1R1VA 2CH0A 4DNCA 1CQTA 2BY1A 3U1DA 4M3DA 4M73A 1RRJA 4ZTFA 1ENHA 2RGVA 4KNYA 3KEQA 4IF4A 3MKZA 4AUXA 4DQ2A 3E0JB 1QPMA 1KQ8A 1USSA 3D1NI 2V7FA 2K02A 2KFDA 2VBYA 1T2KA 4N0BA 3Q9VA 3BR6A 2CQQA 5F64A 2EFQA 3K9TA 1WQ2A 4FE7A 2P4WA 3MFKA 1GDTA 2FU4A 2P5VA 5E8IA 1Z77A 3M7GA 3T1BA 2RQPA 1HQCA 5IY5H 3BTJA 2HR3A 1GVJA 4BHBA 3ELKA 4U7DA 3FHZA 4A3JJ 1U8RA 1Y56A 3E5QA 3WG9A 3QU3A 1X4OA 2VPRA 1XG1A 2GIZA 2HKOA 1XGNA 2CUEA 4XL9A 3T0YA 3IKVA 1W1WE 1I3QJ 5LGTA 2LR8A 5H6RA 1KA8A 4YELA 3JRCA 1EV7A 4E7SA 3OYBA 2VN2A 2W1OA 3IWFA 1ON1A 3P9IA 3U21A 2LKXA 1XX5A 3HOTA 1FYLA 4GYIA 3HGYA 1PP8F 2HYJA 2RVCA 1RKWA 1A31A 3CZ6A 2LRDA 2E7WA 2PEXA 3RPQA 2DT7B 5D5WB 3S2WA 4G7HF 4BKXA 4HA8A 3W6JB 3DKXA 2YU9J 2EZIA 3VYSB 1XDSA 2L9VA 3JR9A 2CWEA 2LG4A 1S7OA 3K7AJ 4RGUA 2R7FA 3GTQJ 2VOOA 2HEOA 1D8JA 3HPGA 3Q9SA 3OIOA 4HSTA 4OOIA 4XN3A 3KZZA 2HKXA 3G3ZA 4HQMA 3ZGKA 1Y39A 4IHTA 2VJIA 4B48A 4Z2YA 3RQ4A 4F7ZA 2FMYA 4HF2A 3HDDA 1TLHB 2M4GA 4D1QA 2WC2A 2GBYA 1BI0A 1D5VA 2VJJA 3F3XA 2XGCA 3FZVA 2O3FA 3K2ZA 2QEXI 1AOYA 1B9MA 2A69F 2H6CA 2YU3A 4RS8A 1MJAA 2LREA 1RUNA 2FE3A 2K85A 1P9QC 2PMZN 3M3YJ 2MABA 5J8FA 4V2FA 5EG0A 3GTOJ 2FQ3A 2B7EA 5J6XA 3CMYA 4E7HA 3HBLA 4XRFA 1VQ5I 1FY7A 2DMQA 5ICEA 3CF2A 2R7DA 1P92A 2MC4A 2WB1N 4CXFA 5K5QA 5E18F 2FBKA 2EFNA 5JI6A 2GWRA 1XGOA 4HW0A 2HYGD 5KVRA 1GXPA 3CLQA 3L2RA 2PI0A 3ERED 3QWLA 1XD7A 3WU1B 4RDUA 4I0BA 2HPMA 3ABTA 4BE2A 2XB5A 2R5ZA 2DPDA 1VQKI 1XC5A 1RESA 4GFBA 1HKSA 1MBEA 2XDVA 4M3GA 3E6CC 5CVJA 3ZQHA 2BW3B 2XC7A 4OWRB 3TKYA 5KNLA 2IT0A 4BNCA 4ZZDA 2O03A 2UV1A 5E79C 2FQ4A 1XMKA 3ULQB 1BJZA 2R4GA 1QZZA 1F9NA 1D1BA 3W2VA 2VE9A 3CCLI 3V8JA 1UJ8A 3A2KA 3V8KA 3U2RA 5DD4A 2E35A 4IPAA 1K4SA 5EZGA 3TBIA 5EGOA 1XTAA 2O0YA 1G2HA 2QM3A 2KHMA 3KYCB 1YX3A 4ZYHA 1O3TA 2CGPA 1QHHD 1FTZA 2F5VA 2H8RA 2X48A 4PUSA 4BUPA 4BQNA 5C3EJ 3ZQLA 3W6VA 2BHZA 3K4BA 1IW7F 1V5GA 3V7RA 2ZXHA 4XBFA 1FP2A 4II3A 3BJOA 1O3QA 3DEWA 3MAJA 2ZJPF 2JT1A 1DP3A 3N4MA 4IHYA 1O7LA 3FBNB 1E3HA 1BW6A 4IHVA 1OPCA 2ECBA 2ZBKA 1VQOI 4R1HA 4IHXA 5FKMA 1U5TA 3CTAA 2XKPA 4HV5A 2DXIA 3BTLA 2A6TA 5E20A 2VQGA 3TP0A 2CMPA 1JT0A 3LWFA 2O7OA 3I56I 1DP7P 5TGTA 4A0XA 2BY0A 5IP6A 3GTMJ 2PMZA 3VB2A 3GLLA 1KQ9A 3QP5A 2A3SA 5E17F 5BS6A 5KCMA 1ZHFA 5LHIA 3PNTA 3J7AO 1F4KA 4F55A 3M4OJ 3RKXA 2K40A 2E1MB 2MLKA 3O8GA 4CCMA 4BE0A 3BCBA 1H0MA 3S1QJ 1GVDA 3FXUA 2XROA 3FM3A 1PYVA 2LH9A 3WHBA 3KX2A 2KIFA 1YJNI 2XGEA 4I98B 2I10A 2Y9ZA 4XIDA 2E2IJ 1DUXC 2Z2SB 3QPSA 3LFUA 1VQ7I 3DF8A 4BU2A 1R5ID 1EJ9A 1J7KA 1V55H 5IOZA 2P6SA 3S16J 2F4OB 2R7UA 2LK2A 4MQVA 4UUTA 4UV8A 4F92B 4BXFA 4IL6C 4ZZLA 4YRVA 1V5EA 3SEZA 3SEQA 3DP7A 5LRRA 5EYRA 4BBSJ 2VC0A 2VJ4A 2WADA 2IA0A 1KU9A 4BGDA 1L3LA 4F3QA 4RMNA 4CA0A 3VPRA 2TDXA 1GLNA 3IHUA 1SD5A 3I4NJ 3BR3A 3HRSA 3X2QH 2DO7A 2G7UA 3FDYA 2LDUA 2Z99A 4MEXF 3H3ZA 5F1RA 3HTSB 4XLFA 2KZGA 5D5XB 3HUGA 1J5YA 1FBQA 1UB9A 2XF5A 1OCTC 3BROA 2GOMA 4PJLA 4ZYGA 2K4BA 4QSHA 1OCRH 3L00A 2AS5F 2R7ZJ 3TP3A 3G73A 3PL8A 4BXUA 1T8IA 2GZWA 3S1MJ 4ESJA 2NNYA 3HC7A 1W7PD 3NQOA 3L2QA 4KMUX 1BW5A 1MBFA 1MH4A 2EILH 1YFHA 4PJMA 2L7KA 5GTIC 3ESWB 4U0YA 1JGGA 3WTTC 2KL4A 3NAUA 2EZLA 4F91B 4EM1A 3LMMA 4IRHA 4QPQA 4XRSG 2R5ZB 2GXBA 2XAJA 2Y48A 1ZRFA 2DMPA 2R7VA 2VBWA 3J80K 3BTIA 4HPQA 3S1RJ 2L3DA 2D2WA 4A3CJ 1B72B 4Y52J 3SZTA 4J01A 5CLSA 2LMDA 4GO1A 2V9PA 3EQLF 4NUBA 1UHWA 1XSDA 3OYJA 4BEHA 4CCNA 5HODA 2DFFA 3K4JA 3FHNA 3D0SA 3J81Z 1SFXA 2CV1A 3I4PA 3I59B 4B4CA 3JW4A 1LFPA 1YOVB 4LG3A 2HU9A 4BH9A 1ACIA 5JVTA 2JZYA 1DU6A 4D5CA 1K78A 2NRAC 1YX5A 1IN7A 2RNGA 4WX9A 1XSVA 4AU7A 2JK3A 2WY8Q 2YPRA 2E19A 4UB8C 4A3BJ 1R71A 2DI3A 1T33A 2XAQA 2CW8A 1BOAA 4NC6A 3ABUA 3CCEI 2VI6A 3KP4A 4RBOA 3HKZN 1SFEA 3HRUA 4L9JA 4P1WA 4FHTA 4BL0B 3GFJA 2ZJQF 1U5TB 2EINH 3K1PA 3QQAA 1LDJA 2COMA 3JTHA 2HPIA 2DA4A 4CYDA 2W57A 4UV9A 4CO8A 2H09A 3S14J 3GUDA 3A03A 5ICCA 3IRQA 3ZQQA 4Y13A 3GMEA 2LD5A 2O9LA 4G12A 1AWCA 1NHAA
chains in the Genus database with same CATH topology
1PVEA 2QSFX 2QSGX 1QZEA 1OQYA 2F4OB 1X3WB 4YIRX 3ESWB 2F4MB 1X3ZB 1TP4A 2QSHX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PVE A;  2QSF X;  2QSG X;  1QZE A;  1OQY A;  2F4O B;  1X3W B;  4YIR X;  3ESW B;  2F4M B;  1X3Z B;  1TP4 A;  2QSH X; 
#chains in the Genus database with same CATH topology
 5HLI A;  5K5R A;  3PSF A;  3S32 A;  3E7L A;  5L3C A;  3FK7 A;  3H3V K;  1OLT A;  3LFK A;  1YS6 A;  3I55 I;  1S3J A;  3FK6 A;  4A2U A;  1YRN A;  4XOT A;  2OZ6 A;  5C4X J;  2X1C A;  3CQZ J;  2BZT A;  1VQ4 I;  4U0W A;  2LY2 A;  2W85 A;  3MQ0 A;  2HWV A;  2VOP A;  3IH4 A;  1YG2 A;  2PMH A;  2DMT A;  2DFE A;  2LFB A;  3C1D A;  2DA3 A;  2Q2E B;  3CC7 I;  3MKW B;  2F5D A;  3I58 A;  5EZH A;  1ZRC A;  4HDU A;  2ZSH B;  2B0L A;  4RM3 A;  2A6E F;  1D8K A;  1D5Y A;  4R79 A;  1J59 A;  1AKH B;  4G6Q A;  3LSG A;  3ZPL A;  1ON2 A;  2A5W A;  2DW4 A;  2R5Y B;  5J47 A;  2DU9 A;  3FXO A;  5LLQ A;  2KP6 A;  2VE8 A;  2A61 A;  3M9A A;  3I0T A;  1X1C A;  2DOF A;  3KIO A;  5D6E A;  2QKL B;  3IH3 A;  3DCF A;  2IJL A;  4M3B A;  2KRF A;  3UKG A;  3OOU A;  1QA6 A;  3GBG A;  3WG7 H;  4DBQ A;  5E1W A;  1BR4 A;  3RZO J;  1XMX A;  4BXX J;  3F23 A;  5IP9 J;  2R7R A;  3LSJ A;  2DTZ A;  1CF7 B;  3VDX A;  2EFO A;  1R00 A;  4A3D J;  2XAF A;  2CU7 A;  2BVL A;  2M7A A;  3KPH A;  2IS1 A;  1R7J A;  2C6Y A;  2X6Y A;  2QUF A;  4KN7 X;  3R61 A;  3FXJ A;  2KLO A;  2WB1 A;  3LQQ A;  5B3S H;  2CS3 A;  3DPT A;  3RDI A;  3L1P A;  1FSH A;  4NQW B;  5KK1 A;  2ZFW A;  2LTP A;  4JYK A;  2V1X A;  1HCR A;  1JKP C;  1W7P A;  4BHC A;  3CDL A;  3CME I;  1GV5 A;  5FB2 A;  2QBY B;  1ETK A;  2JSC A;  2OU2 A;  2L4A A;  1DPR A;  4ESB A;  2VBX A;  4WCG A;  2HZD A;  2W48 A;  4ENJ A;  3V8L A;  3CJT B;  5EEH A;  3PIP F;  3HJE A;  4A5N A;  1DGW Y;  4AD9 A;  1JTX A;  3I9V 2;  3OIP A;  4II2 A;  3DEE A;  3BTC A;  2X6O A;  1E3O C;  4OMY A;  3SZG A;  1IRF A;  1R6R A;  2ZKZ A;  1W36 C;  3OSG A;  3DTE A;  2R7T A;  5GTH C;  4DJA A;  1SAN A;  3OYE A;  2DYR H;  2V4J C;  3WOD F;  2B63 J;  1WCM J;  2FJ1 A;  5M3F J;  4P5O A;  1TWH J;  1OMI A;  3TMO A;  3LAJ A;  3UR3 C;  3KFW X;  3AL0 C;  3Q0U A;  5CQG A;  3CJQ B;  1EA3 A;  2J5P A;  2ESN A;  3CO6 C;  4X6A J;  3LSM A;  2XVC A;  2VJ5 A;  3ASN H;  1T38 A;  3LQR A;  2XSJ C;  1K83 J;  2R93 J;  3PFY A;  4N9H A;  5H6Q A;  4AYB A;  4O6J A;  1NG6 A;  3KE2 A;  2V9K A;  2OV7 A;  2L5Q A;  2DA7 A;  3TO6 A;  5HLG A;  2ZXI A;  1R23 A;  3QPL A;  4CGZ A;  4BY1 J;  3LSH A;  1TWG J;  2QQB A;  2JJ7 A;  3AG3 H;  2WV1 A;  1VQL I;  2BV6 A;  1UFM A;  3M1E A;  1WSU A;  3BR0 A;  2E7X A;  3LA2 A;  1D0Y A;  4CDG A;  3LNQ A;  4AM3 A;  1C0W A;  4YIF A;  2XHK A;  1YQA A;  4KMF A;  3M07 A;  1SAU A;  5TIS C;  1JUS A;  4Y33 A;  3L2C A;  1Z05 A;  2CUJ A;  3KP6 A;  2UZK A;  2X0L A;  5LD2 C;  3TGN A;  1P2F A;  1SVL A;  2WAQ A;  3ML6 A;  1HXD A;  1HW5 A;  3FXQ A;  1TQM A;  4XON A;  1T95 A;  2HXI A;  4KDP A;  3J7A Y;  4J19 A;  4KYW A;  4M9S A;  4RAZ A;  2JA7 J;  4WXH A;  3J7Y J;  2JRM A;  2M8G X;  1TT5 B;  2FUG 2;  2KRC A;  1R58 A;  4NDL A;  3RSN A;  4BEH B;  1TC3 C;  2OA4 A;  2RV8 A;  2KIQ A;  1IRG A;  2WY7 Q;  2IS4 A;  4GDF A;  5LGU A;  3FMQ A;  1GHC A;  4Y4R A;  2E2J J;  1FYK A;  2DOA A;  4M74 A;  2O8K A;  2X4H A;  5IPA A;  2RQQ A;  3BG5 A;  2IVM A;  1MMA A;  1YTY A;  4FCY A;  1JTY A;  2JQ7 A;  2VC1 A;  1UG2 A;  3QYB A;  3E6D A;  1G3T A;  1ZRE A;  5HLH A;  2BXZ A;  5J4V A;  1MD0 A;  3K70 D;  1LQ1 A;  1IF1 A;  2CQ7 A;  4B47 A;  2DA5 A;  2W82 A;  4L0Z B;  1ETW A;  3K2A A;  5DS9 A;  2OJE D;  3CDI A;  2BE5 F;  4PJ0 C;  4RAG A;  2ZXJ A;  1X1B A;  1K61 A;  4D0P A;  2HQR A;  4KIF A;  4PJJ A;  4RAF A;  4I2O A;  2FRH A;  3MD2 A;  4CHU A;  1T98 A;  3CCY A;  3A01 A;  3EYY A;  3RQI A;  1O57 A;  3OY9 A;  2FNA A;  4UXN A;  2QEN A;  3ZMV A;  4WK8 F;  2HGC A;  3G1L A;  2GQQ A;  2XAU A;  1FOW A;  2HS5 A;  1YIO A;  3VYT B;  5GAG J;  1APL C;  4MNU A;  2MLG A;  2K9Q A;  3V42 A;  4E7L A;  3HM5 A;  2FML A;  6PAX A;  2RDP A;  1VQ8 I;  1TQI A;  5FRN A;  2D1H A;  2MFZ A;  2E1C A;  1B4A A;  4CUG A;  2IS6 A;  2I8D A;  4A3K J;  2DOE A;  5BPI A;  4EJU A;  1WZ2 A;  1BR2 A;  2RC4 A;  1HOM A;  4I0A A;  2IP2 A;  4B8X A;  2MA3 A;  4MIM A;  4U7B A;  2CJJ A;  3BQZ A;  4DZJ A;  2OBP A;  2PG4 A;  4HX8 A;  4DGW B;  2KIS A;  5FKO A;  4HNV A;  2QBY A;  3ZQI A;  1P6R A;  2IEK A;  4MLO A;  4XKB A;  4L18 B;  2F5F A;  3KET A;  3ZR8 X;  1W5C C;  1U0J A;  1T39 A;  3HHH A;  1G8X A;  2ME0 A;  3LSR A;  4NB5 A;  2E36 A;  5CQE A;  2GXG A;  3F6O A;  4B3A A;  4AIK A;  4A0Y A;  2H6B A;  1W0T A;  1KON A;  3W6K B;  3PQJ A;  3OOP A;  1FMV A;  5FD6 A;  3GFM A;  1OCZ H;  3JCU C;  5ERI A;  3V7S A;  2DJI A;  3FMR A;  2NS0 A;  4ZYD A;  2ACJ A;  3S1N J;  2CUF A;  2AXL A;  3M8J A;  5F0H A;  4BS9 A;  3ABK H;  1W0U A;  2OZU A;  2A6H F;  2L4M A;  4EGY A;  5E3O A;  2W25 A;  2N8G A;  2ETH A;  1ZK8 A;  3EDP A;  4ZDL A;  2H8W A;  3RI4 A;  5EGO B;  1IJW C;  3RPU D;  1CF7 A;  4M71 A;  1IC8 A;  4LB5 A;  3TDZ C;  4CZZ A;  1TL8 A;  1K79 A;  3SDG A;  4XOR A;  4XRS A;  4C30 A;  5K7F A;  4GCV A;  3ZQ7 A;  1QVU A;  3E1S A;  1AHD P;  3OL3 A;  3K4K A;  1B72 A;  3ERM A;  1LKX A;  3E97 A;  3I54 A;  4U0V A;  5L3G A;  2NOG A;  4XN0 A;  2LKS A;  4HDV A;  2DMU A;  4B09 A;  2XF7 A;  2HXO A;  4E7I A;  4P9U A;  5KAF C;  1DDN A;  4N9I A;  1SD4 A;  2TCT A;  2IA2 A;  4B44 A;  3CF5 F;  3V7C A;  5FRM A;  3NEU A;  2HQN A;  3AKZ A;  2Z1D A;  5JHU A;  2WV0 A;  5ILV A;  4LD5 A;  1RR7 A;  2MD5 A;  3DU5 A;  4J00 A;  3R6S A;  2WWY A;  2DBB A;  3WU2 C;  3K4C A;  2LBF B;  4DYR A;  5IYB J;  1LEB A;  1BIA A;  2BHY A;  2G9W A;  2O5R A;  2M2E A;  3ABM H;  5FKL A;  3I64 A;  1WJF A;  1QBJ A;  3H36 A;  2ZJR F;  2PJR B;  3S17 J;  1ETY A;  2QLZ A;  1S72 I;  4ZJZ A;  2W4S A;  3AL0 B;  1ZLK A;  4FX0 A;  2CRG A;  1BR1 A;  1SD6 A;  1MBH A;  2Y30 A;  4NHJ A;  3GLX A;  2R0Q C;  3HYI A;  2M45 A;  3PSI A;  1LUJ B;  3H5A A;  1YLF A;  3COA C;  2EH3 A;  4E7J A;  2QKM B;  1PVE A;  2ID3 A;  4BDY A;  4PZJ A;  4LLL A;  1ZH5 A;  1H9G A;  2YUS A;  4A3I J;  5FFZ A;  3HOW J;  4DYC A;  5CVU A;  2IPQ X;  4LFU A;  2Y2Z A;  3CO7 C;  4BE1 A;  3EET A;  1YS7 A;  1RR8 C;  3DU6 A;  5DEQ A;  1SFO J;  2EK5 A;  5IT9 K;  3OS1 A;  3G1M A;  3T5X A;  1H8A C;  1FOX A;  4G8X A;  1EF4 A;  3WGI A;  1N77 A;  1MNM C;  3BOQ A;  3WTY C;  1IG7 A;  4XNF A;  2ZME C;  4ABZ A;  1LVA A;  3HEF A;  1DPU A;  5DDG A;  3FX3 A;  1Z67 A;  2OTL I;  1IXS B;  1YE9 A;  4NBQ A;  5D6F A;  1LE8 A;  2MW8 A;  3A01 B;  2XUB A;  5JVG F;  2CSO A;  4Y17 A;  1LFU P;  1BC7 C;  2ZC2 A;  1VND A;  1LB2 A;  3WE2 A;  3IWZ A;  3I3L A;  1OR7 A;  4OIR F;  4A0Z A;  2F6C A;  1KGS A;  3P9C A;  1UZC A;  4G6T B;  3SXY A;  3ASO H;  4EV0 A;  4LK1 F;  4YIR X;  1YJ9 I;  2CFO A;  3DWL E;  3F8F A;  2VQC A;  2W00 A;  1TBX A;  2KT0 A;  3PNV A;  4G9Y A;  3W3C A;  2PX9 A;  1Q1H A;  1T56 A;  3GEZ A;  4CH7 A;  1RZ4 A;  3QPH A;  1Z91 A;  3IKT A;  2L7M P;  4MEY F;  4C3I J;  4BJ5 C;  3BG6 A;  2VIX A;  4I02 A;  1J2X A;  4HEA 2;  1D0Z A;  1A6I A;  2E60 A;  1B8I B;  2DLL A;  3HSR A;  1H88 C;  2J5O A;  4M6V A;  4I76 A;  1TQP A;  1FBS A;  5BQT A;  5LFA A;  2E1O A;  3O6B B;  4MQ9 F;  2COB A;  3T8T A;  4LG0 B;  3CCM I;  4UUS B;  1QZY A;  4NNJ A;  2KIU A;  3JRI A;  2UXN A;  4BBR J;  3DPU A;  4UY8 I;  1BI3 A;  5DM6 F;  1Z6R A;  2M0M A;  1IV8 A;  1E3P A;  2OQR A;  3F0C A;  3D5R C;  3A0H C;  3AG2 H;  2ECC A;  4DIQ A;  4AID A;  5EJC A;  3SHF A;  1R9T J;  4M3F A;  3BWG A;  1QHG A;  5F27 A;  1VTN C;  1VF9 A;  4XLN F;  1H9T A;  2WAE A;  2XB0 X;  3MN2 A;  1Z21 A;  3KYD B;  3L09 A;  3PUF A;  2LY1 A;  4RGS A;  2F5C A;  2KPM A;  2NS8 A;  3IAS 2;  5DM7 F;  2M7B A;  4EJO A;  1Y0U A;  4A3E J;  5A2Q K;  2UUZ A;  3GX4 X;  1ITY A;  3M8F A;  1KZH A;  3OS2 A;  3CCJ I;  3FF5 A;  2DK8 A;  1TNT A;  3CES A;  1QVT A;  5ILS A;  1MSE C;  4LG0 A;  4ZDP A;  3G71 I;  5D8L B;  3BP8 A;  3FKI J;  1NK3 P;  4M6X A;  3DQV C;  1A6Q A;  2OF7 A;  2BOL A;  4IRI A;  4L5J A;  1JJ6 C;  2Y0S N;  5H20 A;  1IO2 A;  4P9F A;  5B1A H;  1E2X A;  4ASN A;  3OYN A;  4CYC A;  1MGT A;  3DKY A;  1U5T C;  1LE8 B;  4BQO A;  2OUM A;  1F43 A;  1YIJ I;  5GPA A;  1MDM A;  1ZGW A;  1MNE A;  3E6M A;  4IEJ A;  1XPX A;  1RC9 A;  3CMM A;  1ONV A;  5FLM J;  5EEA A;  4EGZ A;  1OCP A;  3V4G A;  5FJ8 J;  3H5R A;  1YJW I;  4NC7 A;  4A5M A;  2ZO4 A;  3PNY A;  2XGD A;  2XPW A;  2GIV A;  3CUQ B;  1W5T A;  4KUM A;  1MIJ A;  4BJT A;  3GTL J;  1G6N A;  5GAD J;  2R7S A;  2AHQ A;  2IBD A;  4FET A;  2L9R A;  2QZ8 A;  4DYQ A;  5E1Z B;  3LSP A;  3BG3 A;  2EJR A;  5L3D A;  1SMY F;  4Y15 A;  5IT3 A;  2JA8 J;  3KEO A;  1BI1 A;  3VSL A;  3J81 K;  3NRV A;  2DAO A;  1OYW A;  4JK1 X;  3KLN A;  1SEU A;  1MW7 A;  2DT6 A;  4QIW N;  3DV8 A;  1Z3X A;  1R4M B;  4X0G A;  4I09 A;  4BAC A;  2CV0 A;  1HW2 A;  1HKQ A;  3L2V A;  3CJR B;  2ICW G;  4XSZ F;  4AWX B;  4S05 A;  3TL4 X;  2F48 A;  2L9N A;  2RRE A;  5M5Y J;  2QQA A;  1V3F A;  1OJL A;  2Z9O A;  3HIF A;  4W97 A;  1VZ0 A;  1ETX A;  1QPI A;  2PJP A;  3IUO A;  1R36 A;  3CCU I;  5LHH A;  2JTV A;  3REO A;  3OYD A;  3SZP A;  3KZY A;  2LKP A;  1WGX A;  1JUM A;  4BJ6 C;  4M6Y A;  4H0E A;  3CC2 I;  3F6V A;  5DCF A;  1OCO H;  4ON0 A;  5E3M A;  1LJ9 A;  2D1V A;  3FKJ A;  1SC7 A;  1LDD A;  5EF6 A;  5M5W J;  1Z9C A;  1QZE A;  1DQU A;  3C2G A;  1L0O C;  4JX5 A;  4M3E A;  2XGX A;  1V5F A;  4PFP A;  1X1A A;  3H1C A;  3CCV I;  2DJN A;  4O3M A;  3BZ6 A;  2PMU A;  1WJD A;  2L9S A;  1X19 A;  2CUZ A;  2E34 A;  2VL8 A;  2VXD A;  3CC4 I;  2NAZ A;  4C2U A;  1O3R A;  1E17 A;  1HKT A;  4CYC B;  2ELJ A;  4EVI A;  1Y6I A;  3OYK A;  1K6O A;  2DQR A;  4OIP F;  1TWC J;  2JN6 A;  2KKO A;  2FSW A;  4BDZ A;  3PJR A;  4L9N A;  2VT2 A;  3WU0 A;  4WF2 A;  4HV6 A;  3RCO A;  2QF7 A;  5J40 A;  4I6Z A;  3AG1 H;  5F0C A;  2VLA A;  2QSF X;  1WH5 A;  4HG2 A;  1I5Z A;  5K7Z A;  3HG9 A;  5B66 C;  4UUS A;  1J75 A;  2WAQ N;  4N4O B;  1FBU A;  3QOP A;  1N75 A;  2DFI A;  2MG4 A;  1WJC A;  3MVP A;  4ITV A;  3SFI A;  3VWB A;  3JRB A;  4GXO A;  1ZGA A;  2M34 A;  4IJA A;  4E6K G;  4E70 A;  1YHQ I;  3S2H J;  3T8R A;  1R1U A;  1FOY A;  2VXZ A;  2KDZ A;  5CKT A;  3O2P E;  4CIC A;  3P9K A;  1ODD A;  2XPV A;  5FRO A;  1KYW A;  1ETO A;  3EYI A;  5C4J J;  4X1E A;  1STZ A;  2W24 A;  4HF1 A;  3KYL A;  1MJB A;  2Y0S A;  3NAR A;  4I7H A;  4OU0 A;  2X9D A;  2X6X A;  4V19 K;  2AQF A;  3A4C A;  3OL4 A;  2JA2 A;  1OKR A;  1O7F A;  1TP4 A;  4QPO A;  3S8P A;  4F52 A;  3CP8 A;  2FX0 A;  4EJV A;  3CCR I;  1ZKG A;  1LFB A;  3Q5F A;  5A2Q Z;  3HL2 A;  5ILU A;  4AIH A;  2FOK A;  2HOT A;  3ZP5 A;  3TDU C;  1JHF A;  1XB4 A;  3DPL C;  3LSK A;  5JR3 A;  3DBL B;  2KMU A;  4XRM A;  4D7M A;  1K6Y A;  4IHW A;  4BHP A;  3BJA A;  3KCC A;  5JLW A;  5B5E C;  3I5U A;  3TW7 A;  3GTG J;  1NH3 A;  2DTR A;  2ZNZ A;  1POG A;  3HSF A;  1A35 A;  2FNP A;  4PSX A;  1I1S A;  1Y8R B;  4OAY A;  4LJZ F;  1PP7 U;  2K3P A;  3K6G A;  3ROU A;  1O3S A;  4KIS A;  2KJB A;  3OYA A;  4ENK A;  3QYE A;  3CDH A;  2OCE A;  3F22 A;  4A3L J;  3H0G J;  4E7K A;  3EPZ A;  4G7Z F;  1TWF J;  1Y8Q B;  4JQF A;  2M9H A;  3Q0W A;  3EUH C;  1UEL B;  1AU7 A;  1WJB A;  1VI0 A;  2BVM A;  1IUY A;  4XMY A;  3L9F A;  4OMZ A;  1I3A A;  4JX4 A;  5DYM A;  3W2A A;  3WTV C;  1R5G A;  5F04 A;  2DCE A;  3ZMU A;  3IH2 A;  1FT9 A;  3RKW A;  1S6L A;  1JHH A;  2L7Z A;  1ZLJ A;  3TQN A;  2OC6 A;  2XRN A;  1OIS A;  1G3W A;  5E8G A;  4AC0 A;  2YX7 A;  4C2M J;  4LIV A;  1YYV A;  1W36 D;  1I6X A;  1P7J A;  2MH9 A;  2L02 A;  2R7O A;  3CP2 A;  3QYF A;  3P5J A;  1O4X A;  4DBR A;  3GCM A;  3S2D J;  2FEZ A;  2BW3 A;  5F6F A;  4AVP A;  1W4M A;  3FXR A;  4FX4 A;  1Z7L A;  2A68 F;  2G7H A;  2PN6 A;  1WJE A;  3RZD J;  3N05 A;  3HZJ A;  5DD8 A;  1Y0N A;  1B6A A;  4CZC A;  3J7Z I;  2JRT A;  3HOU J;  2HNH A;  1B59 A;  2VB6 A;  2PQ8 A;  1OFC X;  1YW7 A;  2F2E A;  3GF2 A;  2RKH A;  5HDG A;  2MH2 A;  3LA7 A;  3E3V A;  4D7N A;  4FQG A;  1LDK B;  3QOE A;  2X1D A;  3PQK A;  1FIA A;  3JTG A;  1BBY A;  1X4P A;  4HAM A;  2O8X A;  5J3L A;  3MZ8 A;  4GGG A;  2JVG A;  4WXD A;  2PLY A;  1KQ0 A;  5CVI A;  3JRH A;  4KJZ A;  2LYC A;  4I01 A;  5H2F C;  3JAM K;  2CQK A;  1MSF C;  3A1Y A;  1RUO A;  2NYX A;  3KP2 A;  3H9Q A;  4OIN F;  1N78 A;  1SAX A;  4RLF A;  5AON A;  2CQX A;  4HLX A;  4LLG F;  5IOY A;  1TT0 A;  3PUB A;  4XSX F;  3OYG A;  2I5U A;  1WKM A;  2Y75 A;  5DUI A;  1REP C;  1U6G A;  1HW1 A;  1ZYR F;  4ZYA A;  5GAE J;  5HNH A;  2X85 A;  3KLO A;  4B43 A;  4A12 A;  2K4J A;  4HOB A;  2WA0 A;  1SFK A;  4B3X A;  4EAT A;  1CGP A;  4XR6 A;  4K2E A;  1FIP A;  1LVK A;  4HZF A;  4E7Z A;  2LC2 A;  4Q47 A;  1UMQ A;  4YFX F;  1BOB A;  4BY7 J;  2YX4 A;  1ETQ A;  3WGG A;  3WTX C;  2JMW A;  1Z0X A;  3QOD A;  4QLC U;  3BPX A;  2X6W A;  2JA6 J;  3K69 A;  5FKN A;  1XDU A;  1X58 A;  4NQW A;  1P4W A;  3JSO A;  1YIT I;  2UXX A;  2NVY J;  1NG7 A;  3EUK L;  3FBI B;  3PO3 J;  5FLX Z;  4WWC A;  1IXC A;  2QSG X;  2G0E A;  1XN7 A;  3CJN A;  2AQE A;  2HTJ A;  3OS0 A;  1ZRD A;  2CW0 F;  3MZY A;  3W2W A;  3RJP A;  3SDB A;  3HOX J;  1S29 A;  4W1U A;  1P4X A;  4HBL A;  2XAS A;  4D9J A;  3GZN B;  2HYF A;  3JRF A;  1HF0 A;  5LRS A;  4ESF A;  2L7F P;  3NWT A;  5BNG A;  1JKR C;  2F4M B;  2AXT C;  3Q3S A;  2OTJ I;  5FGM A;  4C3J J;  1X2N A;  4CCO A;  4MFD A;  2BY3 A;  4PCQ A;  4RGX A;  4XOP A;  3PO2 J;  4M72 A;  1MBG A;  4XKW A;  3AAF A;  3RPU A;  3ZRG A;  4BAY A;  2MD0 A;  3F8C A;  4XLC A;  3S3M A;  3M8E A;  5E1X A;  1AA7 A;  4C2T A;  1VQP I;  4UNO A;  5FO5 A;  4LK0 F;  3WHC A;  2IGK A;  1A04 A;  5HDK A;  2ADU A;  5JFR A;  2STT A;  1YW9 A;  5HNF A;  2IS2 A;  2JUG A;  3K1N A;  3G2B A;  1QQI A;  2E2H J;  1OQY A;  4OIQ F;  2E71 A;  3HTU A;  1U9O A;  1K4T A;  4EQQ A;  4Q48 A;  3O3K A;  2NVT J;  2V9V A;  4A3G J;  1Z7U A;  5L3F A;  3N97 A;  5TRD A;  1D3Y A;  4HF0 A;  4AVZ A;  2NVQ J;  1ERD A;  3BDD A;  4HX7 A;  1FEX A;  1XMA A;  2R7W A;  1JGS A;  4KIT B;  5HVQ C;  2HFH A;  1I27 A;  3BT9 A;  4IO9 F;  1LNW A;  4EJT A;  2VKE A;  2HZT A;  3BR2 A;  2E1N A;  2FF4 A;  2XRL A;  4CCJ A;  4XIC A;  4L9T A;  1HST A;  3MKL A;  3R60 A;  3HUG B;  3PM1 A;  1X2M A;  1FWZ A;  2LSO A;  2ZB9 A;  1WRJ A;  4RB0 A;  3C3W A;  4JP0 A;  4LLN A;  4UHT A;  2ZSI B;  4LOC A;  2HI3 A;  5CVR A;  4CSW A;  1AKH A;  2WBM A;  4MFE A;  1FNN A;  4EM0 B;  2R5Y A;  1OYI A;  1HLV A;  1A5J A;  3D5S C;  3IAM 2;  2F4I A;  1F5T A;  2GLO A;  1ZN2 A;  3MKY B;  3TO7 A;  4XLP F;  5IT9 Z;  2H27 A;  3HGG A;  4HNU A;  2VKD A;  3OR1 C;  4HRI A;  4MTD A;  1S5L C;  2LLK A;  1XS9 A;  1IXR C;  5E3N A;  2UWM A;  4KIG A;  3I4M J;  2K9S A;  4LMY A;  5D5U B;  4IHS A;  2ME6 A;  5JHF A;  4IQJ A;  1DGR M;  1M1E B;  3LSI A;  4N4N B;  5CVV A;  1TW2 A;  1ZEL A;  2P6T A;  3M1C A;  4A3F J;  5LGN A;  3O8H A;  2EV0 A;  1T6S A;  2R7Q A;  4HSR A;  5C44 J;  3F8M A;  3K4L A;  1EH8 A;  1XCB A;  2ZNY A;  4ENM A;  1QU3 A;  2M30 A;  3HB9 A;  3H35 A;  2P7V B;  5HS9 A;  4KT6 A;  2K9M A;  4LGW A;  2GM4 A;  5EG0 B;  2R7X A;  3IRR A;  2LP0 A;  5DCM B;  3BG9 A;  3TO9 A;  1UAA A;  1QO0 D;  3DLL F;  5D4R A;  2KQR A;  5L3B A;  1QNT A;  4PJN A;  2BGC A;  3H5N A;  1IDZ A;  1FJL A;  1Z1D A;  2V1N A;  4YG2 F;  3OYL A;  3B73 A;  2A5Y B;  5J4Y A;  2JWT A;  2MYS A;  4QTR A;  2MBF A;  1X3W B;  1ZAR A;  4PGH A;  2P5L C;  2XKO A;  2ELK A;  2E5N A;  4L5E A;  2EZH A;  4G6D A;  4F93 B;  5BMZ A;  2Q2E A;  1JI8 A;  1EH6 A;  2MC3 A;  3DXJ F;  3AG4 H;  1ZTR A;  2V79 A;  3G1O A;  4ZYE A;  2KJC A;  5HS8 A;  5K1Y A;  3FXK A;  4DOZ A;  5JLX A;  2DPU A;  5DTD A;  4KN4 X;  3CMA I;  3SFZ A;  2FA5 A;  2A05 A;  2PBI A;  1I39 A;  3FMS A;  3ZQG A;  3EUH A;  1WI3 A;  3RYP A;  4PFO A;  1FZP B;  4IZZ A;  2YSR A;  3KP7 A;  2XAH A;  3L7W A;  1BN5 A;  4FIS A;  1Y1V J;  2LF7 A;  2JVH A;  4JX6 A;  1OYY A;  3FIW A;  3CD6 I;  3RIR A;  4RB2 C;  5DUK A;  4FT8 A;  4BQA A;  1I6H J;  1EKE A;  3LOC A;  5TJJ A;  3IP4 B;  2E1M C;  1FPQ A;  2V26 A;  2Y69 H;  3CCS I;  4V2G A;  5J1R A;  2Y31 A;  2O6G E;  1KYZ A;  3G6E I;  4RB3 C;  4RAY A;  5DV5 A;  1S7A A;  3OSF A;  1Z3Y A;  2Y9Y A;  2LVS A;  1Y1W J;  3ECO A;  4XM3 A;  4D5F A;  1WHU A;  1GV2 A;  1GXQ A;  3H0D A;  3RKY A;  2VAS A;  3OR2 C;  1MH3 A;  2DA6 A;  3OYM A;  2ZJ2 A;  2NS7 A;  2EWN A;  2GXA A;  4YII A;  2BY2 A;  5LBQ A;  2L0K A;  5D4S A;  2STW A;  4Y3O A;  1FTT A;  1UST A;  1QRY A;  2P5K A;  2CQN A;  2KRH A;  1U8B A;  4JOM A;  1VQM I;  3NWS A;  3JRD A;  1LEA A;  1R22 A;  1MZB A;  4XLA A;  4XK4 A;  2ZFU A;  4KT5 C;  1J09 A;  2H94 A;  2EIK H;  1SMT A;  1D1C A;  2HDC A;  2BXY A;  1JXS A;  4IX7 A;  1J9I A;  4NC8 A;  3BR1 A;  1G3Y A;  2VKV A;  5BOX A;  2IA1 A;  4KA4 A;  1PUF B;  4OAZ A;  1FSE A;  1XGS A;  1S7E A;  3FXL A;  3MWM A;  1TWA J;  3DKW A;  2PFB A;  2EA2 A;  1FMW A;  4LIT A;  1ETV A;  1R1T A;  4XKV A;  2QQ8 A;  4E4H A;  3H92 A;  3OYF A;  2ZME A;  5AIP A;  3U9G A;  4BQQ A;  5M5X J;  2DOD A;  2L2O A;  1I50 J;  4GYG A;  1R4N B;  4AIJ A;  2R3S A;  3S3N A;  4U87 A;  1IAW A;  3HXL A;  2VOD A;  5IYC J;  3DBH B;  3FWE A;  3CUQ C;  3ZMZ A;  2L54 A;  2WTE A;  3HHG A;  1WJ5 A;  1YRN B;  3BQY A;  2JPB A;  2FD5 A;  4IKF A;  2QA4 I;  3WGH A;  1YI2 I;  2M0C A;  3JRE A;  4PSW A;  2PJR A;  4UB6 C;  3GZ5 A;  3LAP A;  3C2B A;  2A07 F;  2BEO A;  1FOK A;  1JKO C;  4XLH A;  1U3E M;  1G3S A;  3JAM Z;  2EV6 A;  3IC7 A;  2H1K A;  2CW7 A;  4ETS A;  4Q4Z F;  1SFU A;  1E0E A;  4FTH A;  1S9H A;  2ZME B;  2HVS A;  3KEY A;  1TW3 A;  3ZQF A;  2VQH A;  3HOZ J;  4A93 J;  5K5O A;  1JT6 A;  1X1D A;  3B6C A;  2NVU B;  2HDW A;  5LEJ A;  3R4K A;  4R8H A;  3TOA A;  3BLY A;  5FD5 A;  1FX7 A;  1MMG A;  1IN4 A;  4YFK F;  1SD7 A;  2Z3Y A;  4IOC F;  3K0L A;  1VFC A;  1J0R A;  4HX4 A;  1T08 B;  5EEG A;  3F9K A;  4RLQ A;  3JRG A;  4MGR A;  5DCM A;  1X3U A;  2XIG A;  1BM9 A;  2QCO A;  3L2U A;  2K27 A;  3P7N A;  4LB6 B;  4M9Z A;  3E6B A;  3EUA A;  5ICG A;  2ZCW A;  3GTJ J;  1N25 A;  4C3H J;  5CJ9 A;  1PDN C;  3WTZ A;  1G4D A;  1V4R A;  2ELH A;  3BY6 A;  1IN8 A;  2K7L A;  3A0B C;  4S0H B;  3VYU B;  5GAH J;  5IYD J;  1MKM A;  2GAU A;  2DQL A;  4KIC A;  1S8N A;  2Q1Z B;  2VQL A;  3GXO A;  4A3M J;  2Z33 A;  2E5Z A;  2FXA A;  2HOE A;  2DT5 A;  3ZN0 A;  1V54 H;  2Z16 A;  4EJW A;  5FLX K;  3QPT A;  1W7P B;  2OPT A;  3RKQ A;  4L9V A;  1UHS A;  4IOA F;  1Z6T A;  1WFX A;  2QWW A;  2XF6 A;  4EMS A;  2HTS A;  3TED A;  4Z6Y A;  2VKH A;  1LPQ A;  4JBA A;  5ED4 A;  2LOO A;  4L0Y B;  3F8B A;  3ZOB A;  3ZN1 A;  3BC8 A;  2LBF A;  3KP5 A;  1MJ9 A;  1WH7 A;  3GFL A;  3IV5 A;  3K70 C;  3ZMT A;  3WTW C;  2VT3 A;  5AIQ A;  4PK4 A;  1F36 A;  2X51 A;  3BZK A;  3DFG A;  3VYR B;  5BPD A;  4UUV A;  5CYV A;  3UNG C;  3RYR A;  1T0F C;  1MMN A;  1RI7 A;  2LNB A;  2W84 A;  4HQE A;  1RIO H;  2VUM J;  4HYE A;  3D5L A;  2H1L A;  3VOD A;  1HDP A;  2HOA A;  3ISP A;  3LA3 A;  3E5U A;  3H9J A;  2HOS A;  5K7H A;  3GW2 A;  4XLE A;  4ZC3 A;  1XCV A;  2FBI A;  5F0F A;  3GTK J;  2WAF A;  2DDA A;  1VQ6 I;  4ZDO A;  3HRT A;  3K4N A;  3S15 J;  3GWZ A;  2NVX J;  2EFP A;  2ZXW H;  3JRA A;  2DN0 A;  3BG7 A;  2HVQ A;  5KAI C;  5J1Y A;  2B9S A;  1PJR A;  2Q0O A;  3B02 A;  2VPL A;  3HPH A;  4G7O F;  3CUO A;  3ZQC A;  2F5E A;  1A36 A;  2Q8K A;  3GTP J;  1JKQ C;  3CLO A;  2W7N A;  1NTC A;  3ECH A;  5LHG A;  1ZAO A;  1MND A;  2JUC A;  4AYB N;  2ISY A;  4GRI A;  1IGN A;  3Q0V A;  2KZV A;  2EZK A;  3HSE A;  1KU3 A;  1U2W A;  3C18 A;  5E3L A;  1B9N A;  2VBZ A;  3GVA A;  9ANT A;  1IUF A;  4IVN A;  3DTK A;  3VOE A;  1K7A A;  4QWQ A;  2EBI A;  1MDM B;  3FIS A;  1ZR2 A;  3MMY B;  4RM2 A;  5M3M J;  1FP1 D;  1XSX A;  2VON A;  2YS9 A;  5J1U A;  1FLI A;  2EV5 A;  1UCR A;  1ZQ3 P;  3HKZ A;  4P55 A;  5FKK A;  2X1E A;  2ESH A;  3S93 A;  1GUU A;  4O5V A;  5HOO A;  3SYT A;  4RGR A;  1HC8 A;  2LF8 A;  1YW8 A;  3I53 A;  2M3A A;  3MZH A;  1IN6 A;  2OQG A;  3PIO F;  3JSP A;  4IXA A;  3CCQ I;  1K78 B;  1RKT A;  1G59 A;  1HDD C;  4MTE A;  2MSY A;  2TRT A;  1I1G A;  2NNN A;  1VQN I;  3OMY A;  1HA8 A;  2V1U A;  1DU0 A;  2P7C B;  2RN7 A;  3ZCO A;  4ENN A;  3B6A A;  1R5H A;  2XAG A;  4Y7N J;  3G4S I;  3OWT A;  3MCZ A;  2NXN B;  2BBY A;  1UHM A;  1SVO A;  1ORK A;  3VFZ A;  2HDD A;  2KDO A;  3DBR B;  4P96 A;  1TNS A;  1MBJ A;  2YR2 A;  4PDK A;  4TV7 A;  3VSK A;  2K5C A;  4S04 A;  4RA2 A;  3L2W A;  2CYY A;  5KHD A;  2JA5 J;  5L3E A;  1IRZ A;  2EQR A;  4YFN F;  2CFX A;  3PFI A;  4ANJ A;  4EM2 A;  2HQ5 A;  1MMD A;  3F21 A;  4Q5S F;  2DFH A;  2XV4 S;  3TOB A;  1OCC H;  3OIQ A;  2MGQ A;  3GO5 A;  2M87 A;  3LST A;  2EFW A;  2IXS A;  3ONQ A;  1BA5 A;  3ZMS A;  2K9N A;  5FFX A;  1VQ9 I;  2EIM H;  2KIM A;  2NOJ B;  4FAS D;  1NK2 P;  4ZH4 F;  1Q1V A;  2GA2 A;  4YEJ A;  1D1A A;  1P7I A;  1YO5 C;  1HSJ A;  1PUF A;  2QYO A;  1ZG3 A;  3FXM A;  4UVC A;  4DW6 A;  1TZL A;  3C7J A;  2JSP A;  1IV6 A;  3K10 A;  2M5W A;  1ZG5 A;  5F1J A;  1U78 A;  2M4K A;  4B1R A;  1X1P A;  4IRG A;  3BR5 A;  2DA2 A;  2CG4 A;  2IW5 A;  3ZMD A;  3AFH A;  1RET A;  1B8I A;  2ISZ A;  1JUP A;  4G94 A;  1ULY A;  2CV2 A;  4UVA A;  2QQ9 A;  3U1K A;  3OYC A;  2FBH A;  2K9L A;  3H9G A;  4EEF G;  4C9Y A;  3BJ6 A;  3WE3 A;  3QU6 A;  4HNT A;  2R92 J;  4IQ4 A;  3DEU A;  1WWX A;  2RAE A;  3J80 Z;  1BI2 A;  2D5V A;  2Y0M A;  1R49 A;  3SQN A;  4MHG A;  1RNL A;  3OYH A;  2FOW A;  1OR7 C;  3BPV A;  5HS7 A;  4PGG A;  4M9X A;  3OYI A;  2D45 A;  2GA1 A;  3BZC A;  3RTR A;  2EB7 A;  2DA1 A;  5HLT A;  2AO9 A;  3HOS A;  1GT0 C;  1UG0 A;  2CO5 A;  1RPW A;  1SVM A;  2IGO A;  4RB1 A;  2V1D A;  2JPC A;  3I71 A;  5D5V B;  1X3Z B;  3GYH X;  4CCL A;  4WXC A;  5GPC A;  1ZGJ A;  3KZI C;  3DTI A;  3OV8 A;  2EIJ H;  5HDN A;  3IL2 A;  3ZXS A;  5CPR B;  4ZTJ A;  2IAI A;  1IRX A;  5GP9 A;  4HLY A;  3C2H A;  1H89 C;  4LIU A;  4XKC A;  1BC8 C;  3SJM A;  1W5S A;  3MEX A;  1ZG1 A;  2BYV E;  3GZ6 A;  2V6E A;  1BL0 A;  3BCA A;  3FM5 A;  1JJ8 C;  5F08 A;  1EH7 A;  1QGP A;  3HRM A;  3VEP A;  3TW6 A;  4XQF A;  2IGM A;  1WI9 A;  2OD5 A;  1HBX G;  2DMN A;  3K4M A;  3R0J A;  2K3F A;  1U9N A;  2P0W A;  3I59 A;  3R0A A;  4U88 A;  4OIO F;  1IN5 A;  2O61 A;  2Z5U A;  2EPF A;  3WTS C;  1PUE E;  1MBK A;  1FYM A;  3CUQ A;  2K86 A;  4MO7 A;  5ICF A;  3F8N A;  1ZR4 A;  2OAZ A;  2P81 A;  1JE8 A;  1B1B A;  2XPU A;  1FC3 A;  4KFC A;  3H3U A;  4A6D A;  2M1B A;  2V6C A;  2P8T A;  1IDY A;  3QP6 A;  1WPK A;  1TTY A;  1D0X A;  5D8K B;  1IZ1 A;  2IGN A;  4I99 C;  3WTU C;  3QRF F;  4L5I A;  3KP3 A;  4KIB A;  5IP7 J;  1F1Z A;  1BJA A;  1WVR A;  4BYY A;  2QSH X;  5FLV A;  2QVO A;  3A02 A;  4CCK A;  2OCC H;  3QAH A;  3DLA A;  1KU2 A;  2M8E A;  2DK5 A;  3S3O A;  2L01 A;  3E5X A;  5EDN A;  4DZP A;  1T0F A;  2XSD C;  5LEK A;  4A69 C;  1MMS A;  3HOV J;  2RNJ A;  4H4K C;  3HOY J;  1XGM A;  2EA4 A;  2HQA A;  2DYS H;  5B1B H;  1P4A A;  2GOX B;  2DDB A;  2IRF G;  1BIB A;  2LY9 A;  3LL7 A;  4UVB A;  5J8C A;  2ID6 A;  1WJA A;  2QGU A;  3ABL H;  4A6E A;  3F72 A;  1KU7 A;  3GFI A;  2HVR A;  3K1M A;  4FE4 A;  1R1V A;  2CH0 A;  4DNC A;  1CQT A;  2BY1 A;  3U1D A;  4M3D A;  4M73 A;  1RRJ A;  4ZTF A;  1ENH A;  2RGV A;  4KNY A;  3KEQ A;  4IF4 A;  3MKZ A;  4AUX A;  4DQ2 A;  3E0J B;  1QPM A;  1KQ8 A;  1USS A;  3D1N I;  2V7F A;  2K02 A;  2KFD A;  2VBY A;  1T2K A;  4N0B A;  3Q9V A;  3BR6 A;  2CQQ A;  5F64 A;  2EFQ A;  3K9T A;  1WQ2 A;  4FE7 A;  2P4W A;  3MFK A;  1GDT A;  2FU4 A;  2P5V A;  5E8I A;  1Z77 A;  3M7G A;  3T1B A;  2RQP A;  1HQC A;  5IY5 H;  3BTJ A;  2HR3 A;  1GVJ A;  4BHB A;  3ELK A;  4U7D A;  3FHZ A;  4A3J J;  1U8R A;  1Y56 A;  3E5Q A;  3WG9 A;  3QU3 A;  1X4O A;  2VPR A;  1XG1 A;  2GIZ A;  2HKO A;  1XGN A;  2CUE A;  4XL9 A;  3T0Y A;  3IKV A;  1W1W E;  1I3Q J;  5LGT A;  2LR8 A;  5H6R A;  1KA8 A;  4YEL A;  3JRC A;  1EV7 A;  4E7S A;  3OYB A;  2VN2 A;  2W1O A;  3IWF A;  1ON1 A;  3P9I A;  3U21 A;  2LKX A;  1XX5 A;  3HOT A;  1FYL A;  4GYI A;  3HGY A;  1PP8 F;  2HYJ A;  2RVC A;  1RKW A;  1A31 A;  3CZ6 A;  2LRD A;  2E7W A;  2PEX A;  3RPQ A;  2DT7 B;  5D5W B;  3S2W A;  4G7H F;  4BKX A;  4HA8 A;  3W6J B;  3DKX A;  2YU9 J;  2EZI A;  3VYS B;  1XDS A;  2L9V A;  3JR9 A;  2CWE A;  2LG4 A;  1S7O A;  3K7A J;  4RGU A;  2R7F A;  3GTQ J;  2VOO A;  2HEO A;  1D8J A;  3HPG A;  3Q9S A;  3OIO A;  4HST A;  4OOI A;  4XN3 A;  3KZZ A;  2HKX A;  3G3Z A;  4HQM A;  3ZGK A;  1Y39 A;  4IHT A;  2VJI A;  4B48 A;  4Z2Y A;  3RQ4 A;  4F7Z A;  2FMY A;  4HF2 A;  3HDD A;  1TLH B;  2M4G A;  4D1Q A;  2WC2 A;  2GBY A;  1BI0 A;  1D5V A;  2VJJ A;  3F3X A;  2XGC A;  3FZV A;  2O3F A;  3K2Z A;  2QEX I;  1AOY A;  1B9M A;  2A69 F;  2H6C A;  2YU3 A;  4RS8 A;  1MJA A;  2LRE A;  1RUN A;  2FE3 A;  2K85 A;  1P9Q C;  2PMZ N;  3M3Y J;  2MAB A;  5J8F A;  4V2F A;  5EG0 A;  3GTO J;  2FQ3 A;  2B7E A;  5J6X A;  3CMY A;  4E7H A;  3HBL A;  4XRF A;  1VQ5 I;  1FY7 A;  2DMQ A;  5ICE A;  3CF2 A;  2R7D A;  1P92 A;  2MC4 A;  2WB1 N;  4CXF A;  5K5Q A;  5E18 F;  2FBK A;  2EFN A;  5JI6 A;  2GWR A;  1XGO A;  4HW0 A;  2HYG D;  5KVR A;  1GXP A;  3CLQ A;  3L2R A;  2PI0 A;  3ERE D;  3QWL A;  1XD7 A;  3WU1 B;  4RDU A;  4I0B A;  2HPM A;  3ABT A;  4BE2 A;  2XB5 A;  2R5Z A;  2DPD A;  1VQK I;  1XC5 A;  1RES A;  4GFB A;  1HKS A;  1MBE A;  2XDV A;  4M3G A;  3E6C C;  5CVJ A;  3ZQH A;  2BW3 B;  2XC7 A;  4OWR B;  3TKY A;  5KNL A;  2IT0 A;  4BNC A;  4ZZD A;  2O03 A;  2UV1 A;  5E79 C;  2FQ4 A;  1XMK A;  3ULQ B;  1BJZ A;  2R4G A;  1QZZ A;  1F9N A;  1D1B A;  3W2V A;  2VE9 A;  3CCL I;  3V8J A;  1UJ8 A;  3A2K A;  3V8K A;  3U2R A;  5DD4 A;  2E35 A;  4IPA A;  1K4S A;  5EZG A;  3TBI A;  5EGO A;  1XTA A;  2O0Y A;  1G2H A;  2QM3 A;  2KHM A;  3KYC B;  1YX3 A;  4ZYH A;  1O3T A;  2CGP A;  1QHH D;  1FTZ A;  2F5V A;  2H8R A;  2X48 A;  4PUS A;  4BUP A;  4BQN A;  5C3E J;  3ZQL A;  3W6V A;  2BHZ A;  3K4B A;  1IW7 F;  1V5G A;  3V7R A;  2ZXH A;  4XBF A;  1FP2 A;  4II3 A;  3BJO A;  1O3Q A;  3DEW A;  3MAJ A;  2ZJP F;  2JT1 A;  1DP3 A;  3N4M A;  4IHY A;  1O7L A;  3FBN B;  1E3H A;  1BW6 A;  4IHV A;  1OPC A;  2ECB A;  2ZBK A;  1VQO I;  4R1H A;  4IHX A;  5FKM A;  1U5T A;  3CTA A;  2XKP A;  4HV5 A;  2DXI A;  3BTL A;  2A6T A;  5E20 A;  2VQG A;  3TP0 A;  2CMP A;  1JT0 A;  3LWF A;  2O7O A;  3I56 I;  1DP7 P;  5TGT A;  4A0X A;  2BY0 A;  5IP6 A;  3GTM J;  2PMZ A;  3VB2 A;  3GLL A;  1KQ9 A;  3QP5 A;  2A3S A;  5E17 F;  5BS6 A;  5KCM A;  1ZHF A;  5LHI A;  3PNT A;  3J7A O;  1F4K A;  4F55 A;  3M4O J;  3RKX A;  2K40 A;  2E1M B;  2MLK A;  3O8G A;  4CCM A;  4BE0 A;  3BCB A;  1H0M A;  3S1Q J;  1GVD A;  3FXU A;  2XRO A;  3FM3 A;  1PYV A;  2LH9 A;  3WHB A;  3KX2 A;  2KIF A;  1YJN I;  2XGE A;  4I98 B;  2I10 A;  2Y9Z A;  4XID A;  2E2I J;  1DUX C;  2Z2S B;  3QPS A;  3LFU A;  1VQ7 I;  3DF8 A;  4BU2 A;  1R5I D;  1EJ9 A;  1J7K A;  1V55 H;  5IOZ A;  2P6S A;  3S16 J;  2F4O B;  2R7U A;  2LK2 A;  4MQV A;  4UUT A;  4UV8 A;  4F92 B;  4BXF A;  4IL6 C;  4ZZL A;  4YRV A;  1V5E A;  3SEZ A;  3SEQ A;  3DP7 A;  5LRR A;  5EYR A;  4BBS J;  2VC0 A;  2VJ4 A;  2WAD A;  2IA0 A;  1KU9 A;  4BGD A;  1L3L A;  4F3Q A;  4RMN A;  4CA0 A;  3VPR A;  2TDX A;  1GLN A;  3IHU A;  1SD5 A;  3I4N J;  3BR3 A;  3HRS A;  3X2Q H;  2DO7 A;  2G7U A;  3FDY A;  2LDU A;  2Z99 A;  4MEX F;  3H3Z A;  5F1R A;  3HTS B;  4XLF A;  2KZG A;  5D5X B;  3HUG A;  1J5Y A;  1FBQ A;  1UB9 A;  2XF5 A;  1OCT C;  3BRO A;  2GOM A;  4PJL A;  4ZYG A;  2K4B A;  4QSH A;  1OCR H;  3L00 A;  2AS5 F;  2R7Z J;  3TP3 A;  3G73 A;  3PL8 A;  4BXU A;  1T8I A;  2GZW A;  3S1M J;  4ESJ A;  2NNY A;  3HC7 A;  1W7P D;  3NQO A;  3L2Q A;  4KMU X;  1BW5 A;  1MBF A;  1MH4 A;  2EIL H;  1YFH A;  4PJM A;  2L7K A;  5GTI C;  3ESW B;  4U0Y A;  1JGG A;  3WTT C;  2KL4 A;  3NAU A;  2EZL A;  4F91 B;  4EM1 A;  3LMM A;  4IRH A;  4QPQ A;  4XRS G;  2R5Z B;  2GXB A;  2XAJ A;  2Y48 A;  1ZRF A;  2DMP A;  2R7V A;  2VBW A;  3J80 K;  3BTI A;  4HPQ A;  3S1R J;  2L3D A;  2D2W A;  4A3C J;  1B72 B;  4Y52 J;  3SZT A;  4J01 A;  5CLS A;  2LMD A;  4GO1 A;  2V9P A;  3EQL F;  4NUB A;  1UHW A;  1XSD A;  3OYJ A;  4BEH A;  4CCN A;  5HOD A;  2DFF A;  3K4J A;  3FHN A;  3D0S A;  3J81 Z;  1SFX A;  2CV1 A;  3I4P A;  3I59 B;  4B4C A;  3JW4 A;  1LFP A;  1YOV B;  4LG3 A;  2HU9 A;  4BH9 A;  1ACI A;  5JVT A;  2JZY A;  1DU6 A;  4D5C A;  1K78 A;  2NRA C;  1YX5 A;  1IN7 A;  2RNG A;  4WX9 A;  1XSV A;  4AU7 A;  2JK3 A;  2WY8 Q;  2YPR A;  2E19 A;  4UB8 C;  4A3B J;  1R71 A;  2DI3 A;  1T33 A;  2XAQ A;  2CW8 A;  1BOA A;  4NC6 A;  3ABU A;  3CCE I;  2VI6 A;  3KP4 A;  4RBO A;  3HKZ N;  1SFE A;  3HRU A;  4L9J A;  4P1W A;  4FHT A;  4BL0 B;  3GFJ A;  2ZJQ F;  1U5T B;  2EIN H;  3K1P A;  3QQA A;  1LDJ A;  2COM A;  3JTH A;  2HPI A;  2DA4 A;  4CYD A;  2W57 A;  4UV9 A;  4CO8 A;  2H09 A;  3S14 J;  3GUD A;  3A03 A;  5ICC A;  3IRQ A;  3ZQQ A;  4Y13 A;  3GME A;  2LD5 A;  2O9L A;  4G12 A;  1AWC A;  1NHA A; 
#chains in the Genus database with same CATH homology
 1PVE A;  2QSF X;  2QSG X;  1QZE A;  1OQY A;  2F4O B;  1X3W B;  4YIR X;  3ESW B;  2F4M B;  1X3Z B;  1TP4 A;  2QSH X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...