3ET6A

The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
187
structure length
182
Chain Sequence
SAPAQEHPEATVLFSDIVGFTEIASRSSPLEVSLLDELYQRFDAAIEEYPQLYKVETIGDAYMVVCNVTVPCDDHADVLLEFALRMHEEASRVASSPVRIRVGMHSGPVVAGVVGRKMPRFLFGDTVNTASRMESHGEAGQIHISEACYCCLRSKERFEIRERGNITVKGKGTMRTYLLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Soluble guanylyl cyclase beta
publication title The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Lyase
total genus 43
structure length 182
sequence length 187
ec nomenclature
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3et6A00
1YBTA 4OYIA 1WC0A 4OZ2A 1WC1A 1YBUA 1CJTB 1CJUB 3MAAB 1WC6A 3MR7A 1CS4A 5D0HA 4CLZA 3UVJB 1Y11A 3G82A 5IV4A 4OYXA 1U0HB 1CS4B 3C16B 3G82B 2GVDA 4CLLA 4WP9A 4CM0A 4CLKA 2GVDB 2W01A 4USTA 1WC5A 2GVZA 5D0EA 1AZSA 4USUA 1FX4A 4CLYA 1FX2A 1YK9A 4P2XA 3ET6A 1TL7A 4USWA 4OYOA 4WP3A 4CLUA 4CLWA 1AB8A 5D15A 4USVA 4OYPA 3C15A 4CM2A 4OZ3A 1CULA 4WPAA 3C15B 1CJVA 2GVZB 1AZSB 1CJVB 5IV3A 4WP8A 1WC3A 3C14A 3R5GA 3ET6B 1CJTA 1CJUA 3MAAA 1TL7B 2QV6A 4NI2A 1CJKA 4CLFA 3UVJA 4OYZA 1WC4A 1Y10A 3C14B 4OYMA 5D0GA 2BW7A 5D0RA 4NI2B 1CJKB 1U0HA 4OYAA 4P2FA 3C16A 4CLSA 4P2MA 4CLTA 4OYWA 4OYBA 4CLPA 1CULB 2WZ1A
chains in the Genus database with same CATH superfamily
4TU8A 4M8LA 2XS5A 4L76A 3D68A 3CSKA 4ZPTR 5IZHA 3OFGA 2AZ3A 5K8NA 3AAWB 1SIZA 2ADCA 1S9GA 3RJMB 2JSXA 2JDJA 4ED7A 4ZVUB 3GCWP 3C8YA 4BDPA 3HHLA 2ILYA 3KMSA 4OLPA 3CD7A 2UXCJ 2QL9B 2JOQA 2B9EA 4B9UA 1JLQA 3IGVA 1Y9OA 1S7IA 4Q44A 4J9VA 2B9XA 2OGUA 4J37A 2QLWA 2HHPA 4KIAA 2G1HA 3D2WA 1GX6A 2LA6A 1D8ZA 1V5VA 1R6YA 5D8HB 4DV7F 2P5VA 3H40A 1N5YA 3MMAA 2ZBIA 2E9RX 1FE0A 2CPEA 1OQ3A 4TKTA 2VG5B 2N4DA 4FF2A 2J8AA 4YB5A 4P2MA 1BLUA 2WB4A 4JYAJ 1JLGB 1T05B 2LA4A 2HNYA 2JC1A 2J9DA 4DUZF 2BQ3A 2HHSA 3TARA 3MFHA 3I0RA 4MKBA 2BACA 2FY8A 4CCHA 2CQ4A 3TOQA 3NGKA 3UFCX 2XMKA 4NXNJ 2MZRA 4PABA 4WJBA 4FP9A 4ECZA 3ETOA 3FBEA 1ZH5A 3C6UB 2ZDPA 5D0EA 4USKA 1UPPA 2NR0A 3IM8A 3PR4A 3MFIA 2ZBRA 5HVHA 6FDRA 3DHXA 1UFKA 4F2RA 2GHVC 3OR2B 4FF4A 4DL0C 3JS9A 4LFAF 2O67A 4ZVPB 3E51A 4IKAA 2XZTB 4Y28C 2J0XA 4LSNB 4OI1A 2I5JB 2XO7A 3NGRA 4WE1B 2RS8A 4ZIVA 3AD9C 2MKSA 1BQNA 4ZPCA 3ULHA 4FNHA 1SI9A 2DITA 3C16A 3B6BA 3JQKA 1S4EA 4HI1A 3PRVA 4WU3A 1BY9A 3TVZA 1VRTA 1DRZA 2MXYA 4GKJF 4M5NA 4ZJLA 2ZH5A 4IG3A 4KO0A 2RE1A 4Y2AA 2HQ3A 2H4WB 2Q6BA 2HBYB 2HFSA 2HNZB 1IKWA 4CLKA 3H5SA 3BF4A 1UFWA 4ZVGA 3DLGA 2R42A 1MWYA 1V9OA 4DV2J 1X31C 4HTJA 2FUG9 4IH5A 3IXQA 1TL7A 2BRLA 3DDIA 4XIUA 3QO9B 2B9WA 1IUJA 1UPMB 2GS8A 2DR6A 1NDPA 2VPWB 2RRNA 1FDNA 3OTCA 3BN4A 2B3TB 4OJ1A 4C48A 5KG6A 4HKQA 2RVJA 5AE2A 4QIGA 3RAMA 2O1PA 1O6XA 1BQMB 4KRWA 1YTYA 3L7UA 3IR6B 5A76A 5ETPA 4QYZJ 5F0WA 3BQ1A 5T14A 1HMVA 4L75A 4QPXA 5DM6Q 1NPKA 1T9WA 2V9KA 3CDBA 1HQUA 1VQMS 3NS6A 4U96A 4URGA 3MURP 1U02A 3F44A 2ADBA 2RAQA 4OI4A 2BKNA 1XNQJ 4WP9A 3ZTPA 1AW0A 1ZYQA 2MSTA 1T0TV 4LREA 3MM6B 1YK9A 2GHWA 1JLEA 2H4YB 1HFEL 5J2MA 3LPYA 1VFJA 3M8RA 4IFYA 4XDCA 4DZDA 3LF0A 1WKLA 1H72C 5DZ7A 1U45A 2F65A 1T03A 1YJ9S 1S4FA 5J1EA 4OX6A 2BMBA 4LVNP 4WK1A 2GO9A 1DTTA 1D09B 3DLKA 4JI7F 3M32B 3ENQA 1U0HA 1HNZF 1NK0A 4JI6J 4YB6A 3BR9A 1EQMA 1QLNA 2IA0A 2P9GA 1RHJB 1S1VB 3EVOA 2DGQA 4YN3B 5IWAJ 2DEIA 2M3DA 1G2EA 3IR5B 3DGPA 5IQ6A 3DHWC 2QL7B 2NUUG 2W9BA 2HS4A 4FPRA 2GVDA 2V4RA 3B8HA 1RBAA 3R8YA 2P9CA 1NSPA 2G2ZA 2YKOA 5F8MA 5LXRA 3S1TA 4PUOA 4ZP7A 5IM0B 4DG1B 3KYLA 1VCTA 4DR1J 2IM2A 3CJQA 1VIXA 4KH1B 1PGZA 2IMWP 3G8TA 4NLUA 1OSDA 5L9NA 2IFXA 2OFGX 3BO2A 3Q23A 4F4WA 1X5PA 4RU9A 4AXJA 3LWLA 1HQ2A 2D3ZA 2W24A 5IQQA 2GVZB 2UXDF 3T9ZA 2AV5A 4C8LA 1S6PB 3G71S 3ISNC 3JYTB 1G1XA 1K8AT 3C14A 3UD3P 2FQQB 4FKXA 2D7SA 4UY85 5CCMA 3R5JB 1MN7A 2F8MA 1LW0A 3JSMB 1TK5A 2YKAA 1RT7A 1PYTA 1S0OA 2W7PA 3CMAS 1FEHA 4QWDA 4O3QA 5LXYA 2A6OA 2IVMA 3GJRB 4CO1A 4B3MJ 3MEEA 1GNKA 1RUSA 5B0CA 2YKMB 3D5MA 2R2SA 3B82A 2UUAF 1SKRA 1ZA2B 3UQSA 4ED5A 5LJ5Y 4F36A 2IAJB 1NK5A 4J9MA 3S01A 1H7WA 4H54A 2CJXB 2HEKA 4R0JA 3AQPA 1FKAF 3UNGC 2OIHA 3RBDA 2IJRA 3QT8A 1OJ4A 3QJPA 4ED4A 3T1HJ 1R8PA 2G9OA 2DT9A 3CD5A 5BR8F 3GJSB 1M90T 2G2YA 3TZZA 3HO1A 5F8NA 3CJKA 1NRKA 4DR5J 2FHKA 3M6XA 2RF2A 4TY8A 4WP8A 4EU0A 2Z0GA 2K1RA 3U7JA 3HP6A 1SC1B 3FZ2A 4LF7F 4J9NA 2E7VA 3HKWA 3UDCA 4CLSA 2E5IA 3I9ZA 3KNAA 4FXDA 5IT0A 1YBAA 3IG1B 3GYGA 4PWDB 1JLBB 2HQDA 1IBKJ 4F3OA 2DH7A 5H9FK 3MOZA 1DURA 4OIXA 1WC6A 2XCAA 1RWOB 1NHKL 1P27B 4Y00A 1K73T 2P9EA 2DTJA 1FD8A 4XTTA 4NLDA 1BUXA 1EETA 4NCGA 4JI0J 5LL6d 3R6LB 2W8LA 3P6YC 5B0GA 1HPZA 3C46A 1L3UA 1YJ7A 2MQNA 3NEKA 4M5DA 4USUA 4TLRA 3DLEA 3TYTA 2POKA 4Y2MA 2XI3A 2APOA 1RB0A 3KKFA 4M94A 2CPJA 6FD1A 4HTIA 1GXLA 3G86A 2BM0A 3ONQA 3WIVA 2KDOA 4QIWD 4I67A 1XTZA 2E5JA 3SV3A 3KK3A 2V2KA 2X3DA 1RABB 3CCVS 3HX9A 4NLRA 1QSSA 3MR2A 4USHA 3D67A 3OXLA 1RTDB 3M2UB 5E3QA 5KG3A 3LP1A 2DR7A 2IDLA 1DARA 2F9DA 2AX0A 2J7KA 4GC7A 5F0UA 1TKZB 4OZ2A 4Q0BA 2XS2A 4ED8A 2ROEA 1S77D 3H8YA 2E1AA 4BHQA 4ZN1A 3SCIE 1SC4B 2G0CA 4ZPDA 4ES3A 1X4BA 4L74A 4NLQA 5C42A 4KBIA 3TA0A 4UOFA 3QT7A 3ET6A 1NXIA 3OUYB 4P71A 2DVIA 4ZN3A 1X9MA 2ZD1B 5D4NA 2KFNA 4FBUA 1X60A 1CLFA 1PC5A 2ASYA 2ROPA 3GCXP 3IC1A 2M8DB 4HH0A 4OJ3A 2FVCA 1LWFA 2FC8A 2PMWA 3QIPB 2CIMA 1B0PA 1EARA 5HMZA 4OYWA 2BEFA 4MFBB 1SIWB 2NXUA 3UE2A 1WKKA 1SH0A 1Q79A 2RUGA 2HWHA 3KK1A 9ATCB 5IOLA 1X4HA 4WXWA 3PX4A 3MCOA 4OHVA 3GFHA 4TQSA 3AQOA 2CQ0A 4ECYA 4ZLPA 4RW7B 2YY3A 3LANA 2JHEA 1DAXA 3VTIA 2LQ9A 1P6TA 3KLFA 2J5AA 2R7UA 1WI8A 2KL8A 4DV0J 4NLXA 1AUSL 5DDRC 5DGAA 1T8EA 1GXUA 2NLWA 1VI7A 4IRCA 4WPAA 4WFZA 4UTGA 3ILJA 1T9XA 3LO3A 3VGUA 1XC9A 2JLGA 2XG8A 4ID5A 2MJNA 2X7IA 4N56A 4RW8A 1RGVA 1O51A 1LK7A 3QWPA 3Q8YA 1YRTA 1OY6A 2ALZA 2LVWA 3DRPB 1N33J 1H74A 3I0SA 2HRUA 1HHQA 1RT1A 4DUTA 3TI0A 1X4CA 4C2MA 2CPDA 3DNCA 3L4BC 3ENVA 1WF2A 5D0HA 3M8YA 4C9DA 3JTNA 3F73A 3GB0A 3N9UC 5HANA 5LJ3Y 2IHR1 4DFJA 4J91A 4IUFA 4B3RF 1SH2A 2H3EB 2BE2A 3W5XA 1T3OA 2OHDA 4RNMA 3C2PA 1SL2A 2HYIB 1FKPA 4PG8A 1QAIA 4A8SA 3DI6B 5DDQC 1XK8A 4C11B 3K5LA 2QLXA 1AA1B 2MKCA 1RWWB 3E3XA 4G6VB 1Q86T 4RJVA 1S72S 1D3WA 1KP6A 2HK3A 1ZZFA 4U67Q 1YZ6A 4X66F 1FFGB 2CWXA 1X5SA 1WACA 4CO2A 5DM7Q 1REVA 3PFOA 2MY8A 4WYLA 2YNFA 2X3GA 4P73A 1CJTA 2KI2A 4ED0A 5DRKA 3VHQA 1RHUB 3ZTOA 2D1CA 2V8HA 3FBFA 2QYGA 2Z8QA 2EBGA 2NSCA 4BS2A 4MKAA 3L09A 3MMBB 3SDEB 3PW7A 1C4AA 1V5IB 1TKTB 1U09A 4LQ9A 1HR0J 5GMDA 1F0XA 4HDHA 1D9FA 4DV4J 4A8WA 2ZH3A 3NMRA 5CCLA 1XJWB 5ETOA 4NWBA 1HLWA 3N5BA 1OQ6A 3ENAA 4PXEA 5C24B 4PRFA 1C0TA 1PSDA 2QIFA 4F0HA 1S10A 3LP0A 4A8YA 3NWRA 2K2PA 2NQPA 4ZK7M 3POTA 2QLBB 2UV8G 2CPZA 3T9NA 3LGNA 1AT1B 3FFIB 1APSA 3QYYA 4K59A 2ZNZA 3JSRA 2HW3A 1F60B 5KFYA 3QAEA 3ZTRA 2LECA 7FD1A 2WVEA 4MKVA 2WBMA 1HNIA 3R2CJ 2YVSA 1EJ7L 2HIQA 4H4MB 3Q8QB 2FJBB 4FXWA 1FKOB 4DSFA 2CQPA 5GADI 2MGZB 4QWEA 1L3SA 3CCZA 3BQ0A 4PPZA 1RHQB 5A8KB 1Q1KA 3R97A 1S1UB 1SUQB 2YNGB 3TAQA 3NG8A 4DV3J 3BGRA 1H6KX 2BJ1A 4MMOA 1IQTA 4YHHF 3DRRB 5K14A 4XPCA 4UOCA 2C3UA 2JNJA 3T1AA 2LLZA 5DLGA 4DL2A 4IDKB 5ADZA 1RT3B 3AA8A 5D4LA 4OJHA 1N34J 4PG6A 1N88A 3IN5A 2CWKA 1NHUA 4HHHA 5HBMB 1TK8A 3BSCA 1KD1T 4KT0C 5HLFA 3H42A 2EKYA 1ROFA 1H2UX 4OV6A 2RDIA 1XQIA 1U6BA 4UY8T 1I3OB 2NYIA 1Q8IA 2WVDA 4PZVA 3M8ZA 1S1XA 2Z2MA 1FCAA 2ZOMA 1HBMB 4LRDA 4QCLA 4BBYA 3PR5B 2HWTA 4CYUB 4AL5A 4ZA1A 1S1TA 3BGOP 2BBEA 1HKAA 2LDIA 3PXGa 2ZWPA 1SV5B 2VQFJ 4CLTA 3FRZA 2A2CA 4ER8A 3CW2C 2WTFA 2BVZA 4ZP9A 5I42A 2C22A 1Q78A 1RK8A 1TV6B 3MF5A 1ZM9A 2IRXA 1LOUA 3U27A 4ZDNA 4DV1J 1R0AB 3N4WA 3R27A 1K1SA 3EDRB 2E44A 4F04B 2JX2A 4CO3A 2QFIA 4QQBA 2H51B 4ECUA 3MM5A 3E2EA 1C1BA 3UPFA 1VQNS 2XB2D 3NNCA 4ITSA 2HRTA 3VQSA 3FC9A 4BC9A 1WDTA 5DJBA 4P52A 2BE9B 3HCXA 3LALA 4I68A 3MEGB 1BD6A 1K1QA 1EKSA 5JVGQ 1VYAA 1S1WB 3GG1A 3PDNA 3CIZA 2BUNA 3VAFA 3DN9A 4TNOA 2VG6A 3SSRA 2HQCA 4OZ5A 1P9YA 2H54B 2HURA 2EFVA 3D6MB 5KG2A 5KFLA 2YX7A 1MMNA 1H7XA 5CYJA 4RUAA 4C0HA 2NPFA 4X4SA 4PWWA 1XMOJ 5LSRA 3EDQB 3PRBA 1S9GB 4B3OA 4DL7A 5A0YA 1ITPA 3GYXB 3ICLA 1IWGA 2IJFA 2PE8A 3D0HE 2YWHA 4V19X 4DF8A 2BE7D 1RAFB 2AYGA 1FJ7A 4RBTA 1UWBA 4X65F 2GIQA 2VFUA 2R7XA 2V67A 1FDAA 3S6EA 4OV1A 4U7CA 3VAIA 2D3UA 1JLQB 3VGTA 2RQ4A 3MUVP 4W4MA 1AUDA 1TZ0A 4F50A 2UUCF 4F3MA 4ZCLA 4I4BA 4MIAA 2YKPA 2Y1RI 5E5NA 1X8DA 1WF0A 2ZZTA 1N5YB 3MMAB 4L3KA 5AE1A 1WHWA 4NI2A 4GMKA 4RW6B 5T7LA 1PIEA 4ZCMA 3A8KA 3F41A 4DCJB 1U48A 4A8OA 4ZPWR 3TO8A 1XNRF 2Q66A 1Z2ZA 2ZOFA 1IBLF 3W62A 3D3CJ 4CIOA 1RJJA 3OJUA 1LWCB 1WHXA 4Y6IA 2ZH4A 2FZGB 1FJCA 1RAEB 2PSZA 3I0RB 2C2KB 2B8QA 2W2OP 3CIMA 1JK9B 3TANA 1U4BA 4MK9A 1NJIT 2OKQA 3LTOA 4HDGA 5B0EA 3J7YI 4NYPA 3T6BA 1VQ9S 3RRHA 1KFDA 4C8ZA 4ILMA 2QMUB 3IRWP 4KH0B 2J6TA 2HGMA 3CCJS 1U7LA 1JLGA 1T05A 5HMWA 1FRMA 2KM8B 4JI1F 4X4NA 3BDPA 3DXSX 3EJMA 3D6TB 4K4WA 3DOKB 2MZTA 1Q81T 4I64A 1CJKA 1KNZA 4AXIA 5C7PA 5KG4A 4OYAA 2KXNB 4B9VA 4UUXA 4AD6A 4ZLJA 3CD0A 3GR1A 3NNHA 3B78A 3QFHA 4YR2A 4NLVA 2FC9A 5AJ3F 4QU6A 3MR3A 2GMHA 3H2VE 1Q4RA 2VJVA 2JL9A 2EFPA 1VRTB 3C6UA 3Q83A 1TAQA 3DGVA 3HM9A 3IGNA 1G4CA 3W8GA 2V34A 4RUBA 4ZKAA 3GILA 4Z7YA 2OPPB 3OR2A 2YWFA 4UZBA 4BCAA 1IKWB 5M2UA 1KC8T 2I5JA 1S12A 3ZZOA 3DLGB 2CPFA 3PYDA 4WE1A 3HJVA 5GVQA 2HVDA 1FRIA 1W2BR 5KOWA 1U0SA 4IOAQ 3BKTA 5CD4H 2ZVSA 3C15A 5DETA 4U7UK 1ZPWX 5KT2A 2A2DA 4JI2J 3EXCX 2VPZB 4KGVB 3MXHP 4A48A 2J0SD 2KHDA 4GO5X 3MECA 2CQBA 2QV6A 1NJWA 1I6JA 1M5SA 1PJ5A 2RIJA 3M8WA 4LQ3A 4RL1A 3M9MB 1TR0A 3KLVA 2XGPA 3K5MA 4KAIA 1QUPA 1TK0A 1H38A 1IBMJ 5A8WA 4E98A 1Q16B 1S49A 5E3AA 2AJ1A 3T5HA 2J0WA 1HQUB 3KUHA 2CG4A 1NJZA 3QO9A 1U2CA 1F1BB 4QYZK 1U26A 2DGWA 1UP1A 4ZP8A 2HFUA 2RH3A 1U1RA 4OX8A 3N28A 3NGSA 3H0PA 4K2JA 2PI4A 1JLEB 5J2MB 4IFYB 2GAHC 3N6NA 4OI3A 5IT9Y 1YG0A 3BDEA 4WBFA 4DUYF 2F4VJ 5HJXA 7FDRA 2M2BA 1SB6A 3NOGA 4M1KA 2I9SA 1DTTB 4LMZA 2F8HA 2FYXA 5L1JA 4E0DA 4YOEA 3QGGA 2QN6B 1RAHB 5E41A 2PIIA 3QJJA 3EGNA 4KYZA 1JWWA 1VIOA 4IH7A 3DOLA 5FLXY 3DDNA 2B4VA 2WVCA 3OTDA 3KUEA 2ZZNA 2MLZA 1FRHA 4YR3A 4B9LA 4Y65A 2RRAA 5EWFA 4CLLA 2Y0BB 1U1NA 2GVDB 4USTA 3AJDA 3A12A 3BYPA 5HATA 4EBCA 4FYDA 3V6DB 3JQJA 2KXHA 3HFZB 2MHEA 3ZZPA 2B5JA 3CJTA 3MMCA 3ZO7A 5KFUA 3JQMA 4NLPA 1OMSA 3PACA 2P2CB 3CJSA 1ZM4A 3GP9A 2XY5A 5EWGA 3NBPB 1S1VA 2RRBA 3GYNA 3NLCA 4LRCA 5J2QB 4ECWA 2CXEA 2JFKA 1XMQF 3CB4A 4QZVB 3C14B 4FNIA 1VC0A 2ASDA 3H4DA 4ZPAA 2F40A 1LW0B 3RBXA 5KFOA 5D4PA 3PIOQ 2YWGA 3C19A 2FJXA 5IM0A 2BJ7A 1WEZA 1FTRA 3IBCB 2GW8A 2WHOA 2I38A 3BR8A 5CABA 4R5PB 3NGDA 1PKUA 3QFWA 3G96A 1HIYA 2HHHJ 4LT6A 4WFBQ 4YDDB 2R8HA 3KG1A 5M2RA 3QAUA 4K5RA 2HVHA 3KJNB 2D9PA 2GVZA 3JYTA 3NRBA 1RTHB 1FXLA 3QQCD 5IC4B 5AXMA 2YNHA 2ZBQA 2G4BA 3I9V9 2ZDOA 4LF6F 1HW8A 3HDSA 2DNMA 1H2VZ 3JSMA 4LFBF 1YIJS 1N52B 1X5OA 2UUBJ 4F3QA 3HFVA 3TUPA 2Y8YA 1N0VC 4TY8B 4MK8A 2K1RB 2QLJB 2IMOA 2XMMA 4DCOB 4KGXB 3OV7A 3HZEA 3TP2A 3OL8A 1HYSB 3EE3A 3I4PA 2DNZA 1WOOA 3MCMA 1CG2A 5JXSA 5KT6A 3BBFA 5IT4A 2GJFA 2C2EA 1N0UA 2V94A 4AE5A 3SSSA 3L7PA 2IAJA 2XSJB 3R2DJ 1VQSA 2WVFA 2V5HG 3MPWA 2DRBA 2YH0A 9RUBA 4NCGB 4LFCF 2UU9F 1DLOB 3J7A1 2QSWA 5ETMA 2XY7A 2ZH7A 2BQUA 4M5IA 2ZVIA 4M5DB 1M5KC 1D0EA 3TX8A 2BA9A 3DLEB 3BREA 2FVPA 3AH6A 1UVKA 1JXVA 2KYXA 3IG1A 3N01A 3CVKA 5BXIA 1ZM3A 4B3TF 4RZRA 5B09A 1VRQC 2Z57B 3KK3B 4LRBA 3W66A 4F4XA 1RAAB 5DG7A 3HHNB 3UCZP 2QA2A 4IG0B 3D54A 3PJXA 2PD1A 1Y5LB 2WZ1A 5LMNF 3LP1B 3QGPA 2BXJA 1S5ZA 4ENOA 3P49B 3EXYA 2AD9A 2YNIA 2RQMA 4JV0A 4TXSA 1TUVA 2H1YA 1T3NA 3CUNA 4PWUA 2IYGA 3UW1A 2HNDB 2LP4A 2LXIA 2LQBA 4A4JA 4W98A 5F41A 2RNEA 1NB7A 5C42B 4WU2A 2RILA 4DBQA 4DV5F 4NXMJ 1ZOTA 2LKZA 1J5EF 2LQ8A 2O5DA 3G4SS 1OSCA 3G6XA 2BANB 4N5SA 2CYYA 5FIIA 2FJVA 1BWVA 4NPOA 1NK4A 4P72A 2DNRA 3HVAA 5DZ6A 1U1QA 1TKZA 3A3NB 1LFPA 2DH8A 1J2VA 4NZ7A 2FGCA 3ZNUA 5G0RB 4B9NA 2MQ8A 1LWFB 3T6JA 2YBVA 1LW2A 5EN1A 1N32F 3WC0A 2KFYA 1KOOA 3ILLA 4F0MA 1FRKA 2AF6A 3VCDA 3BQ2A 3L3CA 4IO9Q 3I32A 1U24A 5AXLA 1UVMA 2PN6A 4USMA 5FDLA 3Q0AA 1C2PA 1CSJA 2BM1A 3QRRA 1WELA 2DXFA 2UVVA 3KK1B 1P8GA 3RBZA 1RLCL 3S7RA 2FGOA 3OUYA 3KHRA 2K7JA 3HHLD 4HVZA 3CWJA 1ULRA 3FGVA 2FHMA 3PM9A 5GAGI 5LMUF 2OO4A 4ELTA 4YDXA 4UF4A 2RQCA 3ENWA 4O0IA 2G1DA 1V3ZA 3O5TB 4LF5J 5ETSA 2GFFA 1LV5A 2DR5A 1KEKA 2IVYA 5JUMA 2EK6A 3KLGB 3SFGA 4DFPA 1YQHA 4OHXA 4NLTA 1F9FA 3UWTA 4DR4F 5F8LA 4IH6A 4DR7F 1GMWD 2EFOA 3RB0A 4EZ9A 1CULB 2HVIA 2W1BA 3A8EA 3PEHA 4C6AA 3KJQB 4ID8A 1WOSA 1RT1B 2YKQA 5K20B 1DJ0A 1FJEB 1NCLA 3MZIA 4DFMA 3VAJA 5LM7E 4D3GA 3BSNA 3A13A 3UR3C 4IQMA 2VH7A 1KLMB 4I2QA 4C0OC 1F5AA 2BE2B 3HZGA 4A46A 1FKPB 2WB1D 2RU3A 2WVBA 1BWEA 2DNYA 3TJAA 5E3RA 3W5YA 4KHPJ 3K89A 2G0JA 1FI4A 4GVLA 4CT8A 4YP3A 1DTQA 4ECQA 3ILOA 3M6WA 4K4TA 8AT1B 1UWAA 4RNFA 4ZVQB 1IWAA 1RQ0A 3KJVA 4TQRA 3W65A 4AL7A 1YRXA 1REVB 3CJ3A 1OWXA 3R7SB 4LF4J 2VODA 1I94J 3C3LA 3SI8A 2IVFB 2Y0SD 3N79A 4M5MA 1R89A 3KHGA 4C11A 4WCEQ 2ZH1A 3G82A 4DR6F 4RUHA 1VQKS 2ATCB 3LGMA 5HL7Q 1X9WA 4LRAA 2J8SA 2OELA 2YWEA 1X5TA 4NA1A 1B0TA 1UFLA 1KVKA 1C0TB 2M0GB 3H4BA 2WK4A 3UCUP 3TW0A 3QIDA 4LVOP 1FJGF 3RRGA 3CJ2A 4USWA 2IC3A 5KFWA 4LR8A 3MMBA 3SDEA 2J6SA 3AXMA 1VMBA 2HRYA 3W61A 1HNIB 4TYBA 4P75A 4I2PA 1NSAA 4O3NA 1K9MT 1UEKA 4ZITA 3IR7B 3TAPA 4RNOA 5EHHA 4LUBA 4PG7A 5KT5A 2DO4A 5C24A 2PMHA 1NDLA 3GV7B 4DL6A 4B3SJ 1YBTA 3CEDA 1IKYB 3IMQJ 4C8OA 3QGIA 4Y34A 4AUKA 1YSJA 1LWEB 4HHJA 3SIPB 2CJ9A 1JNRB 3AOAA 1RYSA 2PMZD 1EQ0A 4DR2J 2HMIB 4GKKJ 4QIEA 5KFTA 1GFWB 1SKUB 3TJ9A 3IWNC 4LSLA 3CJRA 2VC1A 1FKOA 4OQJA 5A6WA 4JV5J 4CLWA 5HLFB 5FJ4A 3GIKA 2MGZA 3MD3A 3V81A 3ZZUA 5A8KA 1UJ4A 1GX5A 4HI2A 2QT7A 1HQEB 4MJKA 1S1UA 2Y3YA 2UVWA 1E6VB 4OZ1A 4DQIA 2EG2A 2QJ3A 1X4AA 3UDVA 1VK8A 3MEKA 1RHRB 2OD4A 3DRRA 1UA0A 3A3OB 2FJDB 2IM3A 4DQQA 3SYZA 2VU5A 2BYCA 1S1TB 5F9NA 1UZDA 4IDKA 2J76E 5C2CA 2BRKA 4RWXA 3AT1B 1RT3A 3NXZA 2YWKA 1RLDA 3R5AA 2G2OA 1WC1A 2MYFA 2AX1A 3M4XA 4CLZA 4AYBD 5I42B 2ZKTA 1TU0B 4JI4F 2ZH6A 2HHVA 1HD0A 1RSCA 2W25A 1IR0A 4CLYA 2V9WA 3E8OA 1HBMA 1NJYA 2OTLS 1RU2A 5GAEI 2XMTA 2CVEA 1NK6A 5KFAA 1GK8A 1RTZA 1JB0C 1TELA 3J81Y 1Q0NA 4MIBA 4OYPA 4ZCKA 4X4PA 4DS4A 3M8SA 3SSQA 4DR3F 3DDKA 3M1VB 2N7YA 2YH1A 2Z4PA 1ZM2A 1UVNA 3M8QA 5LOQA 2C3MA 3OLAA 3KJFB 3MI7X 5KOXA 2I1RA 2M8HA 4P2FA 3VWSA 1WORA 3O44A 2J7UA 4DEZA 3CCUS 4I6YA 2GO8A 1PAEX 2DNPA 4QJVA 1R6VA 3D1QA 3MR5A 3NCPA 4YS2A 3H20A 3QSIA 4NE9C 1OPZA 4DV7J 1Y11A 1DHMA 5M2PA 3VZHA 4JV1A 4OFZA 4YEAA 3VVUA 3D28A 2DISA 4B3OB 5A0YB 2E1RA 3GSIA 1R31A 2E9TA 3MEGA 4M63A 1MMLA 3PKMA 1RT6A 1UWBB 1FK9A 4O3OA 5A8RA 1PYOB 3VZIA 1SJRA 1NAQA 4G1QB 3QWUA 2B0GA 4DUZJ 4ECVA 4UT4A 2VHGA 2GGPA 2UXBF 1SPBP 1FRJA 1PG5B 4J9PA 1NB2A 2W7OA 4E2FB 3DXBA 4NRTA 2V63A 3UD4P 1QAJA 1HL6A 1IJFB 4RBUA 3OHAA 4HYKA 4OLOA 2XZDB 4JUZA 1RT2A 2F9JA 4QOTA 3S8SA 4NI2B 1NKCA 1UMJA 5T7LB 3NP5A 5EX0A 4X62F 5KFDA 2FD2A 2E5LF 4OZJA 2H5EA 3RW7A 1YKWA 2ZWOA 2W9CB 4LFAJ 1TL4A 1P9QC 4K2XA 3HD1A 2VFRA 1QUVA 5CQGA 3V2UC 2XLKA 4OX9F 1U1PA 3OSPA 5D4OA 1M1HA 3Q22A 1IKXB 3CNQP 3UN5A 4EO6A 1FD2A 4IR9A 4J9QA 3OL6A 4DLGA 3UR0A 4A8KA 5HO4A 4RW6A 2AJFE 3CGIA 2XHCA 3ZNJ1 4GKJJ 2KJVA 2HLTA 4DL5A 1C1CB 1KHVA 1NNDA 5BYSA 5EUHA 4GVBB 3IS9A 2AJ2A 2DBBA 3BBBA 2XCPA 3DM2A 3RBEA 1LWCA 1RXOB 2K3KA 3W5ZA 3QMQA 3PY8A 1CJKB 4QBUA 1PC4A 2Y8WA 2LQ5A 2HVZA 1W25A 4CO5A 4UW2A 2C1EB 2ZHAA 3GJTB 1N54B 1KN6A 2KO1A 2VOPA 2MZSA 2H48B 4LF8F 2V8GA 1M5OC 4JI5F 3BB5A 5F8IA 1URNA 4ZVOB 4RW9A 3W7BA 3RB6A 4UOHA 1RU1A 2N82B 1NLKL 3T5JA 1WI6A 1VDHA 2PEBA 4DU8A 5CD4A 3JAMU 1XR6A 3HVTA 3QNWB 3DOKA 1KQFB 2XO6A 5DLFA 4ZVFA 2HFZA 2BJ8A 3C15B 2QMXA 4HACB 3PRDA 4QU7A 2UZAA 3BKUA 3DMJA 3QPIA 3CMQA 2W2MP 1S97A 3MECB 2OPPA 2RB7A 2J6UA 1NK8A 3KLEB 1MW7A 2VL1A 2KTQA 2ZM6F 4JI8J 3VAMA 4MTPA 1KHWA 4DMZA 1YITS 5A8WB 2VBZA 1FRLA 3MAAB 3GWCA 3L95X 2DNLA 1RZMA 2OPSB 5C2GA 3CCWA 1H0HB 5C5JA 2BV3A 4JI7J 1F5BA 4QR0A 4FF1A 5ETLA 2CNLB 4ES2A 1GQEA 2FLPA 2DHGA 1HNZJ 4WYWA 1J5OA 4MAKA 1NK9A 2ZJRQ 5KFEA 3HSJA 4J90A 1YJNS 2NXJA 3HJFA 1Q82T 1R8CA 2AT1B 4WP3A 3MMJA 1SBRA 3BO3A 4ED6A 1R43A 1WF1A 4EBDA 4F0KA 2ERRA 4PEOA 4EYHB 2XZWA 3O6QA 4BC7A 1L3KA 1J27A 1TUGB 4A8XA 5ITHA 4QWCA 3J7AN 3OVAA 3J80U 1A0OB 1VQ6S 3RYLA 3CDWA 2XSFA 2Y1IA 2AGQA 2NREA 4USJC 5L8RC 3NKYA 1RACB 3U1NA 5CZVA 1FVQA 3TA2A 3EGWB 3LAKA 4NA2A 2OEMA 4P7VA 2EEYA 4H4KC 1NDCA 1QTNB 1UETA 3DOMA 3M2VB 2N3OA 2MY7A 3DOLB 3NAHA 4DWIA 3PW2A 5IFMA 4C8NA 2DEJA 1HNWF 2DJWA 2UXDJ 1M5HA 1FO1A 2FVRA 4JI8F 5ETTA 3PW0A 2Z30B 2XWXA 2VUGA 4NLWA 2FPHX 2KVIA 2RKIB 2ATLA 1TL5A 4GRSA 8ATCB 4K50A 2VFSA 4LF9F 5I4MA 2MLXA 1FA0A 2WW8A 2B5JB 3MMCB 4ZPVR 5HP1B 3EUNA 3W3SA 5RUBA 2CQGA 2KRBA 4WK3A 1XMBA 4I6AA 3ZZRA 3Q2TC 2UUAJ 1OS5A 4KHRA 4DLEA 2VFTA 5LT5A 4OZLA 4MK7A 1CC8A 2MKHA 1N56A 3V4IB 3RR7A 2C3PA 2DHHA 1RTIA 2PT0A 4AQYF 3KLIA 2G13A 2EXUA 4ECSA 3I96A 1R3NA 1UZHA 1C0UB 5L1IA 3PJWA 4U8YA 2PO4A 1IJEB 3V6DA 4KQZA 1R8BA 2W2PP 4FYYB 3CDAA 5BR8J 4D3HA 2GJIA 3ZZYA 1X4DA 4O4RA 4YB7A 5KFQA 5B7WA 5D3GA 3A3PB 4LF7J 1RCXB 5HMYA 2DNOA 4RWWA 4CNZA 1LXJA 3NBPA 5J2QA 1MU2A 3OTOF 3H25A 1HBOB 1UW9A 2YNHB 5GMEA 2AYBA 3CDUA 2EKNA 2V69A 4TLQA 3H5UA 3O3LA 1T9YA 1FTCA 2OPQA 1TKXA 2BJEA 3MTJA 2OAUA 1TL3A 4Q5VA 2OFHX 1KLNA 3UN2A 3EZOA 5D0GA 4R5PA 4MKYA 4G1IA 1E6YB 3G9CA 2OI2A 3QBCA 2GHPA 1HW9A 3EGZA 4YY3F 4B9SA 2AU0A 3L9ZA 5DS7A 2XGQA 3PYFA 3G8QA 4KPYA 4DJBA 1RTHA 1IXKA 4LR9A 3IAS9 4J9KA 2F3JA 1TFYA 2NCKL 1YLXA 2WONB 1GMUA 2DNKA 2M5YA 3V5RA 1VLYA 2CPYA 2DHXA 1S0MA 4DN9A 1IBCB 2HS3A 3OBIA 1N5SA 3C6TB 2ZZMA 3KLHA 4TN2A 1QJHA 2ZHOA 1KS2A 3RB3A 1HYSA 5J2PB 1WHYA 5GAHI 3ZTQA 2F4FA 4HL9A 3I5AA 4N8OA 2XSJA 1VQYA 4K4VA 1U8WA 1HWKA 1TMMA 4OI6A 3K0JA 2D69A 2OMLA 2K3IA 2W2QP 2U1AA 3H59A 1MROA 2KHCA 3KDNA 1R7IA 4LSZB 4CH7A 1R0CB 4DSEA 4EZ6A 4ECTA 3HT3A 1DLOA 3ILIA 4EFAC 4OHZA 4DV6F 4PG4A 3LOUA 4KC5A 2AWZA 3WBZA 2R7WA 2DR8A 2R7QA 4V1Ak 3UVJB 4LF1A 3BEGB 2YNIB 4JOUA 3DLHA 4UQGA 2JLFA 1ZAWA 5B08A 1A7GE 4NMLA 3SEOA 3MAQA 2ZC4A 1M5VC 3TRGA 5AXKA 1VQ8S 4PQUA 3HHKA 1L3VA 1FT8A 3D6HB 3KWMA 3CO9A 2VBXA 4Y2IA 4I69A 3RRKA 2CJKA 2DCLA 4X4TA 2PI5A 3VGVA 4IG0A 4QPTA 5BYRA 2EC2A 3LAMA 4NCAA 1ICEB 2K7KA 1HNXF 1B4SA 2HBQB 5DQGA 3SQGA 4ANEA 1Y10A 4DPTA 3BPDA 1X4FA 1RBLA 1ELOA 1MN9A 5E3CA 2HNDA 3FEZA 1LW2B 1AYEA 2VA2A 4PYAA 1K0VA 2DY9A 2W4CA 4YQWA 3NY0A 1CJUB 2B43A 3MPYA 1TMJA 1X0FA 2ZH8A 4RBVA 5FDLB 4OYXA 4UQTA 1MSWD 4ZIWA 1VBKA 2GMLA 2BANA 4NCBA 3ADAC 3H98A 1QAYA 3W2VB 3NNAA 2YX4A 2MZJA 1SJ1A 3EPIA 4CO0A 1RISA 1UEVA 2MQLA 2GV1A 4P6QA 2E5HA 1FEEA 4KR0B 2VA3A 5F8HA 5G0RA 2QFJA 1RWXB 2WOMB 2HVEA 3J7Z5 1FDDA 1HBNB 1M0SA 3AHPA 4DPWA 1QAXA 2B7CB 1B7FA 2L9DA 4ZOSA 1G7CB 3DC2A 2CJQA 4X4UA 2MQPA 2C2RA 3OFHA 5EX3A 4B3RJ 1WG4A 2PGCA 1U6ZA 3RAXA 5KG5A 4DI6A 2HHWA 2VB6A 4ZHRB 1GTHA 1RWKB 2IA6A 2XBPA 2AHOB 2XNRA 1MG7A 2Z2LA 5KFMA 4B9TA 1SC6A 2LEPA 2V8PA 4X66J 3N6MA 1Y7PA 2AKWB 4O0NA 3AA9A 4FXVA 2DO0A 5B0AA 1H98A 3CTRA 1WEXA 1NK7A 3Q8VA 1KOHA 4DX5A 3KLGA 2ROGA 2B6AA 2V2QA 4I2QB 3VR1A 2OPRA 1K47A 1F6TA 2KVQE 2GAGC 2VIHA 4YFUA 3K2YA 2QX0A 1D9AA 3CD6S 3GQCA 5JVHQ 2DNNA 2ZUAA 1SJ3P 4G1PA 2O66A 4WFYA 1CULA 1DTQB 2C2MB 4TVAB 1IR1A 1YVFA 1OY8A 1QY7A 3ITHB 3KJVB 5ETQA 4OYMA 4U9RA 2BKPA 2IBOA 1NSQA 4C97A 5F9LA 2EBEA 1ZAVA 4A8MP 3IAM9 3DRYA 1KLMA 3W64A 3BGLA 4OL8A 3KG0A 1WDDA 1WNEA 4L72B 5DG8A 4URQU 1M1GA 4J9LA 3X3UA 5HROB 3PX6A 2UUTA 3J81j 3G82B 3TJ8A 2MJUA 1RAOA 4HR2A 3WX4A 4WXOA 1F9HA 2V2VA 2XYPB 3V6KA 1VQ5S 1S59A 1Z4UA 3HHEA 1LXNA 3GSDA 2NXCA 4OHWA 1EHWA 4OYOA 3EVMA 1T9VA 2CDQA 4EMDA 1NJXA 4FN5A 2IC3B 5D15A 4HT7A 4FS1A 1VBXA 3OHBA 2Q1LA 4YHHJ 4WWSA 3CF5Q 5MAOA 2MKYA 1QDUB 3LQVA 1YJUA 2HQIA 4I2PB 3UN3A 2Q79A 1KDNA 3TZYA 2ASLA 4X2BA 4JB8B 3HSGA 1IM6A 4MT1A 2R7RA 1NUEA 4DHVA 4ILRA 3OR1B 4ELVA 3WQPA 1CS4A 2R2TA 1RBOB 4K0KF 1OO0B 2VG7B 2AZ1A 3BO4A 1RE1B 4OZNA 5IXUA 1JLAB 1JLCA 4WIQA 1HI8A 2XQCA 3VF0B 2W01A 2HSEB 2QZ8A 3I5CA 2NPIA 5GADU 2D41A 5B0DA 3KTQA 2Q43A 3IWLA 4BWMA 1YJTA 4GO7X 3AJ1A 4LBHA 1TVRA 2KG0A 4Z7CA 2MDAA 4IOBA 4LSLB 2I6WA 1FFWB 4JI3F 3LP2B 1PJ7A 2B4PA 2HS0A 5BJRA 3EWGA 5KT7A 1X7VA 2XULA 4DQSA 1IKYA 3V81B 2M4MA 4X64F 2R7TA 3HVWA 4XDDA 2KZMA 2KKHA 4O23A 2DXEA 2CNOB 3EX7B 3M2RA 2JZ5A 2ZUGA 2EFQA 1WD6A 2J9EA 1LWEA 3JSYA 4RX6A 3DYAA 2EG1A 4OYBA 4P7TA 5CZXA 2V50A 1RI7A 3FCWA 2R4FA 2HMIA 3M7VA 3BYRA 4DOZA 4ZCIA 3HKZD 1YBUA 3MHYA 4CRJA 1UW4A 2H9ZA 4DSKA 3F0NA 3CCES 2J0QD 1RKJA 2HBRB 1GMWA 1OPIA 1RWUA 2A10A 1TAUA 4DL4A 2C2DA 1O8BA 2MQOA 1N5VA 2VZ9A 2ZBCA 1EKRA 1HQEA 3WC2A 2YPYA 1N36F 1E6VA 3OFEA 3CCRS 4N8NA 5KFKA 4XPEA 1SJ4P 3MM9A 1VRUB 3MOJB 4NLYA 3KHLA 3MWBA 4CLUA 4KGZB 3TZWA 4O3RA 1MLAA 1UVJA 4C8KA 2VJUA 2E5GA 2E1CA 2WSFC 2DIVA 2PEHA 4TYAA 2EWHA 1RYRA 2AMCB 1T9UA 3M8QB 1B0VA 2ZH9A 5KT4A 2DGTA 1AFJA 5C25A 2QGFB 4X65J 2UXCF 2IYIA 3FJ2A 3QSYB 3LWMA 1SQEA 1ZA1B 3VAKA 5HVGA 1WTBA 4X84A 4NLSA 3ISND 4QIFA 4QW8A 1B3TA 2UUCJ 5JMNA 3PV8A 1UVLA 4NYOA 4Z37A 1GEHA 5I3UA 4ETZA 1QTMA 2C2ZB 1VBYA 1CVJA 2E1MC 4KKOA 5CXTA 2GC8A 4IR1A 4ZLLA 1WC5A 3M1VA 5HI7A 1XNRJ 4EK2A 2WSCC 1RT5B 1RT6B 4P74A 4JYAF 4JP8A 4CI0B 1IBLJ 1FK9B 3VQTA 3A1YG 5A8RB 3GE9A 4ZS6A 4USVA 2HGLA 1S9FA 2YQ1A 5DGBA 3P4UB 2A0FB 2MMYA 2KT2A 1L5UA 2GGPB 3DRXA 3GFZA 4K4XA 4XK8C 1VISA 2HQGA 3CE8A 5IV3A 1IKVA 4EUVA 4TU7A 2F63A 2DHAA 4NXNF 2C3YA 2M9KA 1RT2B 1XR7A 4EBEA 2V2ZA 4W90B 2NUHA 3JAMY 4M5LA 3K7RA 2RS2A 5L1LA 4EI2A 1D8YA 1LKZA 2Z58B 3WHIA 3M05A 5KAKA 3U1MA 2NZ4A 3CXCR 4JI1J 2BZ2A 5CYQA 1NO8A 1FWLA 4G1QA 4NOHA 4K4UA 3IFEA 3R5DA 4CDIA 2HFNA 2MEWA 2O01C 1HARA 1EX8A 5MLCV 4F25A 4OMFG 3AB4B 4MYTA 3V6JA 1FX2A 5KFBA 2OSRA 5AJ3J 1HI0P 1F9EB 3QLHA 1SH3A 2I2YA 2CQDA 2V68A 3M30A 1NKBA 1VBZA 2RUSA 3NOCA 2RQKA 4ECRA 2DKOB 3RG6A 4BLGA 5KFSA 1YJWS 2VF3A 2FY1A 2W9CA 3W9IA 2W9AA 3SMZA 3IS9B 4F26A 3P96A 1DBDA 1KTVA 1VR6A 3GIMA 3DM2B 3QT5A 4GC6A 4DV2F 3J7YU 1KBRA 3AD8C 3IO1A 2DD8S 3N0VA 1IKXA 3G2XA 1U47A 3GIJA 4OZ0A 3OFFA 5L9XA 4N76A 2CAJA 3KK2A 1WEYA 2DCUB 2Z56B 3PVXA 3FVYA 1C1CA 4RW9B 3J80Y 4F2SA 1JLFB 2PC6A 2HZVA 1FERA 2JVOA 4GVBA 4AFFA 3J7ZT 1XN9A 2XLIA 1S9EA 3T19A 2YX1A 1N6QB 4KPCA 2BR0A 3HVTB 3EMTA 2PFFB 2JEJA 3H2LA 8RUCA 4PXBA 1PBUA 1UKUA 2VD3A 1VGYA 1YRUA 3BN7A 3PIPQ 1MWQA 2GCFA 4B08A 4I1TA 1XNQF 1U2RA 2CZ4A 3DMJB 4FYXB 1FHTA 3U02A 4DX8H 4M5KA 2X51A 2FHJD 1QD1A 2RJZA 3A8JA 4WIIA 1NM2A 2CQ2A 5E7OB 2KT5A 2XMUA 3R5CA 1TUWA 1H3DA 2RD5C 2IM1A 3AJ2A 4B9MA 5F8JA 4DQPA 3BV8A 5A6PA 4FPIA 2CZ9A 4DUYJ 1ZBTA 3CT9A 5HK4A 2OEJA 3PEJA 4ANCA 2FVSA 5IT9U 2RU9A 3D4JA 3H5YA 5THWA 1NKEA 5KFNA 4HACA 3FSYA 1TKDA 2MPUA 3MR6A 3NWGA 4JI6F 1J5OB 4LBIA 2XNQA 1ZTWA 4ED3A 3D6FB 1SL0A 2N4CA 3HFKA 5IWAF 5EWEA 4USIA 3KLEA 1CJVA 2CPIA 2ZKUA 5FLXU 1XEZA 1BXNA 2IDEA 3CULA 1SKSA 2FJEB 3R5GA 3MAAA 3MCNA 2VC0A 3EPGA 1HBUA 4B02A 3Q2SC 2OPSA 1PILA 4QR1A 3RW6A 3RZAA 4DR1F 3HSDA 3KDOA 4K7QA 1Y3KA 3W8PA 4WTOB 2VPYB 2IM0A 3I6PA 1HA1A 5EGYA 1NEEA 3DOMB 3T3FA 2KRRA 3OVSA 4IFVB 2OH2A 1NH8A 2R2UA 1DZ5A 1RA6A 3PO4A 2CADA 4F4YA 4KTQA 1LWXA 4K4SA 5E33A 4HEA9 4I7FB 1XMQJ 2EK1A 2OD6A 3AODA 2QTWA 4H4KA 1U25A 2VKZG 3PYGA 1T7PA 2GIRA 1VOMA 3ZXWA 2CJAA 3BS9A 2DR9A 1FDBA 4CH0S 3B54A 2VICA 3L7OA 4NZ0A 2H5JB 1U1OA 5LSLA 1W7WA 1S76D 3JXOA 1T11A 1EB0A 3EZUA 4TU9A 3KHHA 4B3MF 1UA1A 3M2VA 4UOGA 3RGIA 4JV2A 2B56A 1RT4A 1AXQA 3BPSP 3R7BB 1U1LA 3TVYA 2BABA 5HN0A 1BMQB 4YUDA 3K5OA 2YKNA 1RTIB 1R8AA 1RP5A 1Y5IB 3KLIB 4R8UB 1X4EA 3BGUA 2GIFA 4LF6J 2G0IA 2RKIA 4LFBJ 3MUMP 2D3O1 2E1PA 3T1HF 2COLA 3DCAA 3QGHA 2DGSA 4DR5F 5HP1A 2VV5A 3O1LA 1QSLA 2VOOA 4DDFA 4NX9A 4DL3A 1ZETA 1RAGB 1YZ7A 4P2SA 2FTRA 2LXUA 5D3GB 4O3SA 4U95A 1FESA 1OYEA 4ZVTB 3KMQA 4ELUA 1MU2B 4LJMA 5D6GA 2L48A 2RMLA 3V4IA 3Q8SB 2R3VA 1IBKF 1YJRA 3LGHA 3THTA 4NLOA 1C0UA 3GG0A 2RSQA 1SVDA 3TAMA 3TQ1A 4IRDA 2OPQB 1TKXB 2B51A 1Q8BA 4ED2A 5HJYA 4LFCJ 4JI0F 1TL3B 1EP4A 2UU9J 2HIYA 1F2HA 4KV8B 5B0FA 4RU2A 3K58A 4KHMA 1WSVA 2NS1B 4CLPA 2ACMA 2V4JB 3OW2R 4OYIA 2IBKA 5F3ZA 1SXLA 5AXNA 1HBOA 2CNKB 4KGKA 4B3TJ 3FBCA 2OJ3A 2DGUA 4CM0A 4CH1A 2C28A 3CCTA 5CYMB 5IS2A 1QE1B 2FLOA 2Y1JA 1B70B 2ABYA 3WX8A 2DPIA 4I0WA 4YMEA 2L08A 3OT9A 3KLHB 2CJBA 4NL5A 5LMNJ 2FZKB 2GNKA 3OXGA 1E6YA 4CTAA 2UVRA 1EZZB 3HF5A 1JKHB 2HK2A 3TUZC 1BC6A 3DLJA 1I1GA 3CCSS 1KFSA 3LPEA 3CDEA 4G3IA 3GLJA 3DU5A 2B4OA 3D0IE 3KXDA 1U6FA 3PJ9A 3OVBA 2WONA 1U1MA 3W60A 5F3TA 3G6VA 3MGJA 1CC7A 1YWXA 2HZAA 1NZAA 1MROB 3FMWA 1SQFA 4DV5J 2DNHA 2NXNA 1J5EJ 1VC6A 5KFZA 2QMWA 2QC3A 3GONA 2ACYA 4Y2CA 3C6TA 2W8KA 3IA0A 2PA3A 2F5GA 1N4LA 1S0NA 4CZCA 2BKOA 3NMAA 4FVCA 1I5OB 5J2PA 1JX4A 4KFBA 1HNVB 2KG1A 2DPJA 4PQUB 1KR4A 2HGNA 1N32J 4ERDA 4PKDB 4F02A 1FFSB 3HULA 1NSKL 1FWKA 1TFWA 3BBCA 1AB8A 3TQEA 2GJ2A 3SFUA 4CM2A 1IM4A 2M88A 3OL7A 2QRRA 4F4ZA 4G65A 2QLFB 4U7UD 2OP5A 2FZCB 2W4DA 1UTAA 1RAJA 2DXDA 3UVJA 1XERA 3SQGB 1OYDA 3M9OB 2XYHB 3MPDA 2ZE2A 4ICLB 1I51B 4X4RA 4F67A 5LMUJ 1Q7LB 4DV0F 4FVMA 2CKWA 3CJ0A 3OSNA 2IPOB 3E01B 1V3SA 3WIUA 1PO6A 5GMKa 3GV5B 3VAGA 4DR4J 4M5GA 2EPIA 1R27B 3TVKA 4M95A 2KYZA 4DR7J 4Z2XA 5DDOC 2WBRA 4LRFA 2J9DE 2ZOGA 1N33F 3NS7B 5KFCA 2X1GA 1KONA 3ZZZA 3QJLA 4M5HA 4DPYA 4K8RA 2IY5B 4I6WA 1ZZNA 5KFHA 1JXEA 5HMXA 5K8OA 4ZJOA 5IC6B 1DQ9A 2J7WA 1CJUA 1V6HA 4AT1B 1MNEA 4KB7A 3WDOA 2BDPA 5GAGU 1LEOA 4O44B 3FCHA 1XR5A 1KSPA 4FF3A 2YXLA 1IVZA 1CBKA 1S6QA 4H4OB 3W2VA 1RADB 1B7YB 4I56A 2BQRA 3MM7B 1KQKA 3MM8A 1WC0A 1N48A 2ZJQQ 2JH3A 4J9OA 2R9LA 4S0MA 2V8DA 1YI2S 2KZZA 1REGX 2WOMA 1HBNA 4HH1A 1ZS6A 3P45B 3DU6A 3Q8UA 3D66A 1VJWA 1HHSA 2BX6A 4RO0A 3FNNA 2ASJA 2R7VA 3RAQA 2B6AB 2FB0A 1KRPA 4ZVSB 2V8VA 2OPRB 2B7BB 4P2XA 2FIUA 3LA0A 1HR0F 2EC0A 3MEDA 3FQLA 4F7VA 4ZHRA 3GMGA 2KXFA 2DRAA 4DV4F 4F8RA 1RTJA 2LFVA 1BQXA 4DR6J 1UAWA 4FKYA 3W2WB 2VASA 4O4GB 3BZQA 5CA5A 3THVA 5DQIA 1O0PA 5JJBA 1VS3A 2X1FA 2CQCA 3PW4A 1FJGJ 4CWBA 3DRSB 3EYZA 5H9EJ 4QR2A 4DCPB 5J2NA 4DF4A 2NZCA 2WAQD 3NCRA 1KQGB 3OXFA 4F4AA 1Z2LA 1X9SA 2AQ4A 3GJQB 2VBWA 5AE3A 4WZQA 1DY3A 3UI3A 1ZTTA 2O3DA 4F4KA 2R8GA 3W1YC 3JSBA 2D74B 3FEXB 3U1LA 3LUYA 2ZJPQ 3JTPA 2CQIA 3ITHA 2FLNA 1RWVB 5CH7B 2Z2ZA 5HAOA 3SZ2A 2DK2A 3FDSA 5ETKA 1HWUA 4DV3F 3US5A 2JEIA 3IRXA 4OZ3A 3BH7B 2HHUA 3W9JA 2I0XA 1OY9A 2C2NA 2CRLA 4KY3A 4NZ6A 1AZSB 1TL1A 2Y1LB 1SC3B 3PHEA 3GIIA 1IN0A 1N34F 5HROA 2MTLA 2ZFHA 2OTJS 3K5PA 2B4UA 3G8SA 5HQMA 2VKRA 4URSA 2GA7A 3LW5C 2QA1A 4J7CA 3SCJE 3R7NB 4RW4B 2W7AA 4WZMA 4NMXA 3CPWR 2V6AA 3M8PA 2JEFA 3TNVA 2E7WA 2D9OA 4A47A 3BKFA 1CS4B 2KT3A 1MMDA 1KWMA 1EAYC 4ZVEA 3GU0A 3GR0A 1F5CA 1XIQA 2AW0A 1JLCB 4O3PA 3ZC4A 2JRSA 5D77A 2MQQA 2F7VA 1HWJA 2VQFF 2F1FA 5J1PA 1NDKA 4IRKA 1TVRB 1ZPVA 3VALA 3OTEA 2HHXA 2EI5A 3NCQA 1YDLA 2VPXB 3IM9A 3IBFB 1Z1ZA 2DIUA 3HHLB 3I82A 3ETMA 1Q8LA 3OR1A 4JI4J 4ZMMA 4DV1F 4N77A 1WOPA 4CLFA 2VG7A 2XC9A 4X4OA 3FKBA 3M2RB 3PTWA 1JLAA 3X1LB 3OPKA 3DYAB 2DGOA 3HHLC 1XBWA 2JEGA 2YQ3A 5KFPA 3I56S 3PO5A 1U8SA 2LU1A 1EIYB 3QT6A 4DR3J 1JQGA 1S48A 2D3OR 1HHTP 1Q53A 2GQQA 3LP2A 4KSEB 2AEFA 4EGLA 3J81U 3EZ5A 1SKWA 2CQ3A 1RHKB 2HNYB 3JB9k 4L73A 1U1KA 2YQ0A 3PG9A 1TQLA 4CNYA 1ACMB 2LU2A 3MM9B 1AFIA 4Q8FA 5KG0A 1A6LA 1URRA 4EWTA 1Q95G 4NEYA 1FNOA 2R8IA 1PAUB 1XMOF 1JJ4A 3R6GB 4Q2LA 4Q45A 3CMES 2MQMA 2VG5A 1NPRA 3I87A 2A6MA 2BW7A 3D1OA 2AP6A 4PYDA 5K8MA 2EW9A 5GAEU 2AGPA 1CQNA 1RAIB 1R8HA 5C25B 2NYHA 3P5TL 2U2FA 3CCMS 3SCLE 2QYCA 3HMJG 2ALYB 5A2QU 2MZQA 4ZVRB 3ZFVA 5L39A 2UXBJ 1BQNB 1F2GA 2R7SA 2YTCA 1VRUA 3QATA 4UUWA 3C16B 2KB2A 1L3TA 2ZC3A 1JMTA 5I3UB 2KM8C 1UJ6A 3HK2A 1WKJA 4RKUC 4NRUA 1K44A 2EFNA 2HQFA 4PPDA 4IYQA 4W92B 4KKOB 3R5BA 4IG3B 4KO0B 2HHQA 4X62J 2E5LJ 1PJ6A 4FS2A 1K0TA 1QVGR 2XEXA 3AXKA 2AYMA 3FEYB 3B4MA 4LSNA 4OX9J 3TA1A 2VDHA 4JBCA 1WG1A 4UZCA 1KVIA 4FYWB 3TZXA 1TL7B 1IKVB 3QZ8A 3D3BJ 4WTYA 2RDDA 3HD2A 3HHDA 4C8YA 4DX6A 1WG5A 1NMEB 4XO0A 2R8JA 3PX0A 1OIAA 2ZHBA 4HT5A 1T94A 3HVRA 2F8EX 2LDYA 1PBAA 4RUCA 5KFJA 1RT5A 2IIHA 5DQHA 4ES1A 2HNZA 4WFAQ 1HMVB 3VAHA 4ZVHA 5DG9A 5CYQB 2MKIA 1S0VA 2N3LA 1G6BA 5DO2A 2BJ9A 2P8IA 1GXTA 4EYIB 4FYVB 4NLGA 4J5OA 3G6YA 4ALZA 3ZTSA 2ZEJA 2CG8A 1N5QA 2JJ4D 3QLHB 3BGFA 5KG1A 4LF8J 3EM1A 3M30B 3TR5A 3GV8B 4JI5J 3N6LA 1BQMA 4MYUA 4WFNQ 3R3TA 3EVWA 1WC3A 1NHVA 4CP5A 5SUHA 2W4PA 5J1NA 2FHOB 1T03B 3PZPA 2YWWA 4L3NA 1KQSR 3ZZ0A 5J1EB 2HFVA 5KTQA 2VBYA 1IQZA 3DLKB 4FZVA 2ILZA 4JI2F 2AEMA 3Q8PB 4Y0FA 1SJFA 5KFFA 3AY0A 1U0HB 2AJ4A 2GQCA 3KK2B 2HPUA 3NS5A 5FD1A 1S7HA 4LIRA 3BJYA 2QE5A 3D0GE 3MM6A 3SV4A 5KFIA 3V6HA 3RR8A 3G6ES 2GQ2A 3K8WA 2MKKA 4X4VA 1LNQA 3DGPB 3O2IA 1S9EB 2ZM6J 1WJ9A 2XMVA 2W9BB 2VDIA 1IBMF 2WSEC 2HG4A 4MIWA 2K8GA 4C3LA 2AJ0A 2A3JA 4ANDA 2AIRB 4C0BA 4PUOB 3NAIA 2QA4G 5CHCB 5KFGA 2E66A 2FJWA 4LR7A 3MPVA 3M32A 4OHYA 2HWIA 3NGUA 4M5JA 3W63A 3AFGA 4NASA 1S57A 4A8FA 3TWZA 3HLUA 2QEXS 3RB4A 1D1UA 3R1LA 1Y00A 3KNGA 5L38A 2WW4A 1W26A 5SZTA 1JLFA 2MSSA 3HT0A 5HVFA 1N6QA 2XMAA 4OI0A 2CA9A 2F4VF 4PXCA 1FXRA 2IJNA 3A8IA 3CJ5A 4A8QA 1KVJA 2OMOA 5KFRA 4L6V3 3HI9A 3SBMA 4DG1A 1RT7B 3GIRA 4K4ZA 1V3RA 4NEZA 4DSIA 1BHNA 3RU0A 2HAFA 2XI2A 3P8BB 3MEEB 1S99A 4DXLA 5EDWA 1VQ4S 2MHNA 2FJAB 1HNWJ 1TP7A 1DQ8A 2Q6CA 1S6PA 3OL9A 2DGVA 1NU4A 4OI2A 1CJVB 3UO0A 2BOAA 4QWAA 3CJ4A 1NBEB 2CZVC 1Y4ZB 4OYZA 1WC4A 3BSAA 3OQ2A 3DLBA 3MTKA 1HBUB 4LF9J 2DH9A 2ZBPA 3THPA 3AD7C 1WSRA 1RWPB 3PKYA 3TUIC 3M9NB 2LCWA 3CJKB 3KUGA 2JC0A 2RF2B 4K5SA 4NA3A 3KOAA 2DNQA 2UVUA 3PYEA 1IR2A 1JJ2R 3PNIA 4DPOA 4U8VA 5HQLA 1NPPA 2YKMA 1SQGA 5E2QA 4EEYA 2L9WA 4DPUA 3G87A 2CVIA 2N7CA 1UCNA 3EICA 4AQYJ 3T5KA 1Y0HA 2CQHA 3UNYA 2ZH2A 2XLJA 2JVRA 1RHMB 2BJDA 2E29A 4CO4A 1EETB 1T9TA 2CQ1A 4ZLNA 4HLBA 3DKDA 2DB1A 1HWIA 2AYEA 2HKEA 1HPZB 5H9FJ 3M6VA 2HHHF 5D78A 2XWYA 4IFVA 4KE5A 1RT4B 2JFDA 1FRXA 3PCOB 2Q3PA 1KKHA 2J9CA 1VLOA 3TEGA 4PWDA 1FNMA 4YB1P 3OTOJ 3DLLQ 1YGYA 2DRDA 1JLBA 2YKNB 2OSQA 4I7FA 1HWLA 4N47A 3FK4A 3MAHA 1UL3A 1Q5VA 2XMWA 1CQMA 1VK3A 3MR7A 2UUBF 5IV4A 4K4YA 2OUGA 1N5TA 3ISZA 2CNNB 4MH8A 3UD5A 3QRPA 5L46A 2R7OA 4J9SA 2CPHA 2RHSB 4N41A 1Q5YA 3TX0A 1QVFR 2HAIA 1GMVA 3O8WA 5T41A 3SXLA 4Q0BB 1UVIA 1VQLS 4YY3J 2KJWA 2HFOA 1F3FA 3BH6B 2HLUA 4IO1A 3A4TA 4TY9A 4R8UA 5BYQA 1SCJB 2ZITA 1Q8KA 3BM7A 4RR5A 2E9ZA 4J9UE 3TAMB 2P6TA 2IRUA 4C3KA 3ET6B 3AB2B 4DQRA 3I5BA 1PCAA 1EP4B 2V0NA 3T41A 1CPZA 3MD1A 2XY6A 2CPXA 3M2UA 1RTDA 3QRQA 4Q2MA 5K9FA 4Q7AA 3NL0A 3R9LA 3T5LA 1VQOS 1WTFA 2VONA 2R2RA 3M6UA 3Q8RB 3ELHA 2LXFA 2VQEJ 1QM9A 2PDAA 3OTBA 2FHJA 2WCXA 2XYGB 1FXDA 4C4WA 2PA8D 2XMJA 3OD2A 3R1HA 2B8PA 1RKIA 1S79A 1YJVA 4PR6A 3IWXA 4BWJA 3N5FA 1AROP 3RUBL 1S6OA 1W2IA 2CDRB 3D1HA 5K8PA 2FLLA 4KV8A 1GAOA 4DV6J 3FSXA 4DSJA 1RWNB 4KJIA 1CEZA 2ZD1A 3D7SB 3VVTA 2LMIA 4CTAB 2V4JA 1H73A 3LH2S 2PFDA 4OX7A 1SJQA 3KLFB 1O5JA 4PXDA 2SXLA 2XS7A 3QIPA 1FF2A 4YR0A 5B0BA 3CO0P 2L9NA 4MFBA 2XHWA 5CYMA 4NXMF 3GZ7A 4U6PA 1QE1A 5GAHU 1BGXT 4ID5B 1T02A 4RW8B 1H2TZ 4ZPBA 4Q8EA 1HNXJ 4DU7A 3SCKE 1ZAXA 4RW7A 2RDJA 2VQEF 3I0SB 1JKHA 3FCVA 3IP0A 2UP1A 4KFBB 3AOBA 4PAAA 1JJHA 1X4GA 2GZOA 2DNGA 1Y3JA 2M70A 2AJQA 4IQXA 2K06A 2RHQB 3OJSA 1BE4A 2H65B 1DQAA 2MB0B 2ZNYA 1RDRA 4X4QA 5E0OA 1FVSA 4R25A 2L3MA 3BSOA 3VGSA 1RA7A 4HHUA 4WKRA 2Y9HA 2BJ3A 3QZ7A 3DRPA 2XTJP 3AOCA 2JLEA 2ZE2B 1FWPA 3CCLS 5KFXA 2OLWA 1HNVA 1FNXH 3FRYA 3K5NA 4LBPA 2KU7A 4ECXA 3CCQS 1Q7YT 3GFYA 3Q89A 4LF5F 2YNFB 4NYZA 1R0BG 1CJTB 3GFXA 4FBTA 5KFVA 3I4HX 5H1SV 2KH9A 4C7QA 4KGMA 2M7SA 3H90A 1HI1A 5I3PA 3DI6A 2FVQA 3W9HA 2X1AA 3FQKA 1RCOB 2GMJA 3MCSA 1WHVA 7AT1B 2E7XA 1LK5A 1Y5NB 3I31A 5G4DA 2C3OA 4QYRA 4J9RA 2EFGA 1YX2A 4RLEA 3FBBA 4WF9Q 1GT8A 1JXLA 1VC5A 5I3QA 4PCQA 4ICLA 2HBZB 4LIWA 3LP0B 2WRMA 3Q24A 3POTB 4PG5A 2KFZA 3UDLA 3E01A 2QG9B 4Y3CA 2BW2A 1UEUA 4C98A 3D9BA 3CC2S 3H5XA 1DFDA 2BOPA 2M52A 1UJ5A 2MLYA 2DHSA 2CUYA 2R8KA 2IRYA 1TKTA 2EVZA 1NZ8A 1LFWA 4QWBA 3B4DA 1M1KT 5HSPA 1XWLA 3PFEA 4KHPF 1S6QB 2QSFA 3GPAA 3MM8B 1N8RT 4Q43A 1JIHA 4C8MA 1X0PA 3K17A 3I55S 4WFXA 4WKYA 5U47A 2CFXA 1YHQS 1T95A 1D9DA 3CC7S 4LF4F 4IOCQ 5DDPC 1TTHB 4R0EA 1I94F 2AEJA 3FFIA 3BGRB 4ILLA 5ETRA 4QW9A 5HQ8A 1LQ9A 3KFWX 3DFEA 2LEAA 5K14B 1P1LA 3T1YJ 2P6SA 3C66A 3MEDB 3FSIA 4O44A 2Z2YB 3K8VA 1GTEA 2L41A 3FUYA 4H4OA 4H4MA 1RTJB 2DGXA 3MM7A 2UUWA 2W2NP 1P1TA 3V4MA 1VHFA 2C2OB 3F56A 1KTQA 3K59A 5F8GA 4ED1A 4ETXA 4RNNA 4C3MA 2H5IB 1VQ7S 1SUQA 1S1XB 2YNGA 3FMBA 1HD1A 6AT1B 1VHIA 2JWNA 2C42A 2DY1A 2MZ1A 4DSLA 5J2NB 3GTYX 4ZP6A 3CC4S 2QO3A 5ETNA 3Q86A 3PHTA 4DFKA 2QL5B 2A1BA 2NSBA 4EO8A 3P5BP 1SL1A 1WWHA 4DX7A 3W2WA 3JTOA 3K57A 4P10A 4LF2A 5HBMA 4ZJQA 4O4GA 5H9EK 5LSOA 4B3SF 2CJYB 2I8EA 4B17A 1RWMB 2HZCA 2XM3A 1NH7A 5L1KA 1MWZA 4RPFA 2FDNA 2B9YA 3MUTP 3DRSA 2AGOA 4XAKA 3SQOP 4K0KJ 3MPUB 1G3OA 4QIVA 1F3VA 3IRXB 3VV2B 2RT3A 4CYUA 3MM5B 1TL1B 3T1YF 4AL6A 1C1BB 4OJGA 2LEBA 4DR2F 4GKKF 2YPZA 1SV5A 5D0RA 3H7HB 4DZ6A 3EGVA 2A18A 4E8UA 4PQAA 3HPOA 1GH8A 3KG4A 4JV5F 5AT1B 3HXMA 2OEKA 4JI3J 1TV6A 3RTVA 2X1BA 5KG7A 2QA4S 5CAAA 2DYAA 1QSYA 3M8PB 2VG6B 4P9SA 3NGTA 3WZ0A 4DS5A 1R0AA 4X64J 1M5PC 4V19J 3UDEA 2VFVA 1PYSB 2MKJA 2KN4A 1B99A 3MDFA 3TEHB 2V4QA 4DPXA 3P3DA 1S6UA 3HSZA 1AZSA 5E3PA 1FX4A 4ATNA 1B64A 1WUUA 4Y2KA 3IBWA 3OLBA 4CQ1A 2HHTA 2LYVA 3FZBA 1U2FA 2GX8A 5KT3A 5A2QY 4FDFA 2NXEA 5ETVA 5K5MA 2LQJA 4RW4A 3UCGA 3TUJC 1S1WA 1JJCB 4N7TA 1U49A 1JNZB 2UV8A 4RNHA 3ZZTA 3H2UB 1FE4A 4DN0A 4CT9A 3PW5A 1N36J 1A9NB 1C4CA 1VJQA 3CJ8A 1VQPS
chains in the Genus database with same CATH topology
1YBTA 4OYIA 1WC0A 4OZ2A 1WC1A 1YBUA 1CJTB 1CJUB 3MAAB 1WC6A 3MR7A 1CS4A 5D0HA 4CLZA 3UVJB 1Y11A 3G82A 5IV4A 4OYXA 1U0HB 1CS4B 3C16B 3G82B 2GVDA 4CLLA 4WP9A 4CM0A 4CLKA 2GVDB 2W01A 4USTA 1WC5A 2GVZA 5D0EA 1AZSA 4USUA 1FX4A 4CLYA 1FX2A 1YK9A 4P2XA 3ET6A 1TL7A 4USWA 4OYOA 4WP3A 4CLUA 4CLWA 1AB8A 5D15A 4USVA 4OYPA 3C15A 4CM2A 4OZ3A 1CULA 4WPAA 3C15B 1CJVA 2GVZB 1AZSB 1CJVB 5IV3A 4WP8A 1WC3A 3C14A 3R5GA 3ET6B 1CJTA 1CJUA 3MAAA 1TL7B 2QV6A 4NI2A 1CJKA 4CLFA 3UVJA 4OYZA 1WC4A 1Y10A 3C14B 4OYMA 5D0GA 2BW7A 5D0RA 4NI2B 1CJKB 1U0HA 4OYAA 4P2FA 3C16A 4CLSA 4P2MA 4CLTA 4OYWA 4OYBA 4CLPA 1CULB 2WZ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBT A;  4OYI A;  1WC0 A;  4OZ2 A;  1WC1 A;  1YBU A;  1CJT B;  1CJU B;  3MAA B;  1WC6 A;  3MR7 A;  1CS4 A;  5D0H A;  4CLZ A;  3UVJ B;  1Y11 A;  3G82 A;  5IV4 A;  4OYX A;  1U0H B;  1CS4 B;  3C16 B;  3G82 B;  2GVD A;  4CLL A;  4WP9 A;  4CM0 A;  4CLK A;  2GVD B;  2W01 A;  4UST A;  1WC5 A;  2GVZ A;  5D0E A;  1AZS A;  4USU A;  1FX4 A;  4CLY A;  1FX2 A;  1YK9 A;  4P2X A;  3ET6 A;  1TL7 A;  4USW A;  4OYO A;  4WP3 A;  4CLU A;  4CLW A;  1AB8 A;  5D15 A;  4USV A;  4OYP A;  3C15 A;  4CM2 A;  4OZ3 A;  1CUL A;  4WPA A;  3C15 B;  1CJV A;  2GVZ B;  1AZS B;  1CJV B;  5IV3 A;  4WP8 A;  1WC3 A;  3C14 A;  3R5G A;  3ET6 B;  1CJT A;  1CJU A;  3MAA A;  1TL7 B;  2QV6 A;  4NI2 A;  1CJK A;  4CLF A;  3UVJ A;  4OYZ A;  1WC4 A;  1Y10 A;  3C14 B;  4OYM A;  5D0G A;  2BW7 A;  5D0R A;  4NI2 B;  1CJK B;  1U0H A;  4OYA A;  4P2F A;  3C16 A;  4CLS A;  4P2M A;  4CLT A;  4OYW A;  4OYB A;  4CLP A;  1CUL B;  2WZ1 A; 
#chains in the Genus database with same CATH topology
 4TU8 A;  4M8L A;  2XS5 A;  4L76 A;  3D68 A;  3CSK A;  4ZPT R;  5IZH A;  3OFG A;  2AZ3 A;  5K8N A;  3AAW B;  1SIZ A;  2ADC A;  1S9G A;  3RJM B;  2JSX A;  2JDJ A;  4ED7 A;  4ZVU B;  3GCW P;  3C8Y A;  4BDP A;  3HHL A;  2ILY A;  3KMS A;  4OLP A;  3CD7 A;  2UXC J;  2QL9 B;  2JOQ A;  2B9E A;  4B9U A;  1JLQ A;  3IGV A;  1Y9O A;  1S7I A;  4Q44 A;  4J9V A;  2B9X A;  2OGU A;  4J37 A;  2QLW A;  2HHP A;  4KIA A;  2G1H A;  3D2W A;  1GX6 A;  2LA6 A;  1D8Z A;  1V5V A;  1R6Y A;  5D8H B;  4DV7 F;  2P5V A;  3H40 A;  1N5Y A;  3MMA A;  2ZBI A;  2E9R X;  1FE0 A;  2CPE A;  1OQ3 A;  4TKT A;  2VG5 B;  2N4D A;  4FF2 A;  2J8A A;  4YB5 A;  4P2M A;  1BLU A;  2WB4 A;  4JYA J;  1JLG B;  1T05 B;  2LA4 A;  2HNY A;  2JC1 A;  2J9D A;  4DUZ F;  2BQ3 A;  2HHS A;  3TAR A;  3MFH A;  3I0R A;  4MKB A;  2BAC A;  2FY8 A;  4CCH A;  2CQ4 A;  3TOQ A;  3NGK A;  3UFC X;  2XMK A;  4NXN J;  2MZR A;  4PAB A;  4WJB A;  4FP9 A;  4ECZ A;  3ETO A;  3FBE A;  1ZH5 A;  3C6U B;  2ZDP A;  5D0E A;  4USK A;  1UPP A;  2NR0 A;  3IM8 A;  3PR4 A;  3MFI A;  2ZBR A;  5HVH A;  6FDR A;  3DHX A;  1UFK A;  4F2R A;  2GHV C;  3OR2 B;  4FF4 A;  4DL0 C;  3JS9 A;  4LFA F;  2O67 A;  4ZVP B;  3E51 A;  4IKA A;  2XZT B;  4Y28 C;  2J0X A;  4LSN B;  4OI1 A;  2I5J B;  2XO7 A;  3NGR A;  4WE1 B;  2RS8 A;  4ZIV A;  3AD9 C;  2MKS A;  1BQN A;  4ZPC A;  3ULH A;  4FNH A;  1SI9 A;  2DIT A;  3C16 A;  3B6B A;  3JQK A;  1S4E A;  4HI1 A;  3PRV A;  4WU3 A;  1BY9 A;  3TVZ A;  1VRT A;  1DRZ A;  2MXY A;  4GKJ F;  4M5N A;  4ZJL A;  2ZH5 A;  4IG3 A;  4KO0 A;  2RE1 A;  4Y2A A;  2HQ3 A;  2H4W B;  2Q6B A;  2HBY B;  2HFS A;  2HNZ B;  1IKW A;  4CLK A;  3H5S A;  3BF4 A;  1UFW A;  4ZVG A;  3DLG A;  2R42 A;  1MWY A;  1V9O A;  4DV2 J;  1X31 C;  4HTJ A;  2FUG 9;  4IH5 A;  3IXQ A;  1TL7 A;  2BRL A;  3DDI A;  4XIU A;  3QO9 B;  2B9W A;  1IUJ A;  1UPM B;  2GS8 A;  2DR6 A;  1NDP A;  2VPW B;  2RRN A;  1FDN A;  3OTC A;  3BN4 A;  2B3T B;  4OJ1 A;  4C48 A;  5KG6 A;  4HKQ A;  2RVJ A;  5AE2 A;  4QIG A;  3RAM A;  2O1P A;  1O6X A;  1BQM B;  4KRW A;  1YTY A;  3L7U A;  3IR6 B;  5A76 A;  5ETP A;  4QYZ J;  5F0W A;  3BQ1 A;  5T14 A;  1HMV A;  4L75 A;  4QPX A;  5DM6 Q;  1NPK A;  1T9W A;  2V9K A;  3CDB A;  1HQU A;  1VQM S;  3NS6 A;  4U96 A;  4URG A;  3MUR P;  1U02 A;  3F44 A;  2ADB A;  2RAQ A;  4OI4 A;  2BKN A;  1XNQ J;  4WP9 A;  3ZTP A;  1AW0 A;  1ZYQ A;  2MST A;  1T0T V;  4LRE A;  3MM6 B;  1YK9 A;  2GHW A;  1JLE A;  2H4Y B;  1HFE L;  5J2M A;  3LPY A;  1VFJ A;  3M8R A;  4IFY A;  4XDC A;  4DZD A;  3LF0 A;  1WKL A;  1H72 C;  5DZ7 A;  1U45 A;  2F65 A;  1T03 A;  1YJ9 S;  1S4F A;  5J1E A;  4OX6 A;  2BMB A;  4LVN P;  4WK1 A;  2GO9 A;  1DTT A;  1D09 B;  3DLK A;  4JI7 F;  3M32 B;  3ENQ A;  1U0H A;  1HNZ F;  1NK0 A;  4JI6 J;  4YB6 A;  3BR9 A;  1EQM A;  1QLN A;  2IA0 A;  2P9G A;  1RHJ B;  1S1V B;  3EVO A;  2DGQ A;  4YN3 B;  5IWA J;  2DEI A;  2M3D A;  1G2E A;  3IR5 B;  3DGP A;  5IQ6 A;  3DHW C;  2QL7 B;  2NUU G;  2W9B A;  2HS4 A;  4FPR A;  2GVD A;  2V4R A;  3B8H A;  1RBA A;  3R8Y A;  2P9C A;  1NSP A;  2G2Z A;  2YKO A;  5F8M A;  5LXR A;  3S1T A;  4PUO A;  4ZP7 A;  5IM0 B;  4DG1 B;  3KYL A;  1VCT A;  4DR1 J;  2IM2 A;  3CJQ A;  1VIX A;  4KH1 B;  1PGZ A;  2IMW P;  3G8T A;  4NLU A;  1OSD A;  5L9N A;  2IFX A;  2OFG X;  3BO2 A;  3Q23 A;  4F4W A;  1X5P A;  4RU9 A;  4AXJ A;  3LWL A;  1HQ2 A;  2D3Z A;  2W24 A;  5IQQ A;  2GVZ B;  2UXD F;  3T9Z A;  2AV5 A;  4C8L A;  1S6P B;  3G71 S;  3ISN C;  3JYT B;  1G1X A;  1K8A T;  3C14 A;  3UD3 P;  2FQQ B;  4FKX A;  2D7S A;  4UY8 5;  5CCM A;  3R5J B;  1MN7 A;  2F8M A;  1LW0 A;  3JSM B;  1TK5 A;  2YKA A;  1RT7 A;  1PYT A;  1S0O A;  2W7P A;  3CMA S;  1FEH A;  4QWD A;  4O3Q A;  5LXY A;  2A6O A;  2IVM A;  3GJR B;  4CO1 A;  4B3M J;  3MEE A;  1GNK A;  1RUS A;  5B0C A;  2YKM B;  3D5M A;  2R2S A;  3B82 A;  2UUA F;  1SKR A;  1ZA2 B;  3UQS A;  4ED5 A;  5LJ5 Y;  4F36 A;  2IAJ B;  1NK5 A;  4J9M A;  3S01 A;  1H7W A;  4H54 A;  2CJX B;  2HEK A;  4R0J A;  3AQP A;  1FKA F;  3UNG C;  2OIH A;  3RBD A;  2IJR A;  3QT8 A;  1OJ4 A;  3QJP A;  4ED4 A;  3T1H J;  1R8P A;  2G9O A;  2DT9 A;  3CD5 A;  5BR8 F;  3GJS B;  1M90 T;  2G2Y A;  3TZZ A;  3HO1 A;  5F8N A;  3CJK A;  1NRK A;  4DR5 J;  2FHK A;  3M6X A;  2RF2 A;  4TY8 A;  4WP8 A;  4EU0 A;  2Z0G A;  2K1R A;  3U7J A;  3HP6 A;  1SC1 B;  3FZ2 A;  4LF7 F;  4J9N A;  2E7V A;  3HKW A;  3UDC A;  4CLS A;  2E5I A;  3I9Z A;  3KNA A;  4FXD A;  5IT0 A;  1YBA A;  3IG1 B;  3GYG A;  4PWD B;  1JLB B;  2HQD A;  1IBK J;  4F3O A;  2DH7 A;  5H9F K;  3MOZ A;  1DUR A;  4OIX A;  1WC6 A;  2XCA A;  1RWO B;  1NHK L;  1P27 B;  4Y00 A;  1K73 T;  2P9E A;  2DTJ A;  1FD8 A;  4XTT A;  4NLD A;  1BUX A;  1EET A;  4NCG A;  4JI0 J;  5LL6 d;  3R6L B;  2W8L A;  3P6Y C;  5B0G A;  1HPZ A;  3C46 A;  1L3U A;  1YJ7 A;  2MQN A;  3NEK A;  4M5D A;  4USU A;  4TLR A;  3DLE A;  3TYT A;  2POK A;  4Y2M A;  2XI3 A;  2APO A;  1RB0 A;  3KKF A;  4M94 A;  2CPJ A;  6FD1 A;  4HTI A;  1GXL A;  3G86 A;  2BM0 A;  3ONQ A;  3WIV A;  2KDO A;  4QIW D;  4I67 A;  1XTZ A;  2E5J A;  3SV3 A;  3KK3 A;  2V2K A;  2X3D A;  1RAB B;  3CCV S;  3HX9 A;  4NLR A;  1QSS A;  3MR2 A;  4USH A;  3D67 A;  3OXL A;  1RTD B;  3M2U B;  5E3Q A;  5KG3 A;  3LP1 A;  2DR7 A;  2IDL A;  1DAR A;  2F9D A;  2AX0 A;  2J7K A;  4GC7 A;  5F0U A;  1TKZ B;  4OZ2 A;  4Q0B A;  2XS2 A;  4ED8 A;  2ROE A;  1S77 D;  3H8Y A;  2E1A A;  4BHQ A;  4ZN1 A;  3SCI E;  1SC4 B;  2G0C A;  4ZPD A;  4ES3 A;  1X4B A;  4L74 A;  4NLQ A;  5C42 A;  4KBI A;  3TA0 A;  4UOF A;  3QT7 A;  3ET6 A;  1NXI A;  3OUY B;  4P71 A;  2DVI A;  4ZN3 A;  1X9M A;  2ZD1 B;  5D4N A;  2KFN A;  4FBU A;  1X60 A;  1CLF A;  1PC5 A;  2ASY A;  2ROP A;  3GCX P;  3IC1 A;  2M8D B;  4HH0 A;  4OJ3 A;  2FVC A;  1LWF A;  2FC8 A;  2PMW A;  3QIP B;  2CIM A;  1B0P A;  1EAR A;  5HMZ A;  4OYW A;  2BEF A;  4MFB B;  1SIW B;  2NXU A;  3UE2 A;  1WKK A;  1SH0 A;  1Q79 A;  2RUG A;  2HWH A;  3KK1 A;  9ATC B;  5IOL A;  1X4H A;  4WXW A;  3PX4 A;  3MCO A;  4OHV A;  3GFH A;  4TQS A;  3AQO A;  2CQ0 A;  4ECY A;  4ZLP A;  4RW7 B;  2YY3 A;  3LAN A;  2JHE A;  1DAX A;  3VTI A;  2LQ9 A;  1P6T A;  3KLF A;  2J5A A;  2R7U A;  1WI8 A;  2KL8 A;  4DV0 J;  4NLX A;  1AUS L;  5DDR C;  5DGA A;  1T8E A;  1GXU A;  2NLW A;  1VI7 A;  4IRC A;  4WPA A;  4WFZ A;  4UTG A;  3ILJ A;  1T9X A;  3LO3 A;  3VGU A;  1XC9 A;  2JLG A;  2XG8 A;  4ID5 A;  2MJN A;  2X7I A;  4N56 A;  4RW8 A;  1RGV A;  1O51 A;  1LK7 A;  3QWP A;  3Q8Y A;  1YRT A;  1OY6 A;  2ALZ A;  2LVW A;  3DRP B;  1N33 J;  1H74 A;  3I0S A;  2HRU A;  1HHQ A;  1RT1 A;  4DUT A;  3TI0 A;  1X4C A;  4C2M A;  2CPD A;  3DNC A;  3L4B C;  3ENV A;  1WF2 A;  5D0H A;  3M8Y A;  4C9D A;  3JTN A;  3F73 A;  3GB0 A;  3N9U C;  5HAN A;  5LJ3 Y;  2IHR 1;  4DFJ A;  4J91 A;  4IUF A;  4B3R F;  1SH2 A;  2H3E B;  2BE2 A;  3W5X A;  1T3O A;  2OHD A;  4RNM A;  3C2P A;  1SL2 A;  2HYI B;  1FKP A;  4PG8 A;  1QAI A;  4A8S A;  3DI6 B;  5DDQ C;  1XK8 A;  4C11 B;  3K5L A;  2QLX A;  1AA1 B;  2MKC A;  1RWW B;  3E3X A;  4G6V B;  1Q86 T;  4RJV A;  1S72 S;  1D3W A;  1KP6 A;  2HK3 A;  1ZZF A;  4U67 Q;  1YZ6 A;  4X66 F;  1FFG B;  2CWX A;  1X5S A;  1WAC A;  4CO2 A;  5DM7 Q;  1REV A;  3PFO A;  2MY8 A;  4WYL A;  2YNF A;  2X3G A;  4P73 A;  1CJT A;  2KI2 A;  4ED0 A;  5DRK A;  3VHQ A;  1RHU B;  3ZTO A;  2D1C A;  2V8H A;  3FBF A;  2QYG A;  2Z8Q A;  2EBG A;  2NSC A;  4BS2 A;  4MKA A;  3L09 A;  3MMB B;  3SDE B;  3PW7 A;  1C4A A;  1V5I B;  1TKT B;  1U09 A;  4LQ9 A;  1HR0 J;  5GMD A;  1F0X A;  4HDH A;  1D9F A;  4DV4 J;  4A8W A;  2ZH3 A;  3NMR A;  5CCL A;  1XJW B;  5ETO A;  4NWB A;  1HLW A;  3N5B A;  1OQ6 A;  3ENA A;  4PXE A;  5C24 B;  4PRF A;  1C0T A;  1PSD A;  2QIF A;  4F0H A;  1S10 A;  3LP0 A;  4A8Y A;  3NWR A;  2K2P A;  2NQP A;  4ZK7 M;  3POT A;  2QLB B;  2UV8 G;  2CPZ A;  3T9N A;  3LGN A;  1AT1 B;  3FFI B;  1APS A;  3QYY A;  4K59 A;  2ZNZ A;  3JSR A;  2HW3 A;  1F60 B;  5KFY A;  3QAE A;  3ZTR A;  2LEC A;  7FD1 A;  2WVE A;  4MKV A;  2WBM A;  1HNI A;  3R2C J;  2YVS A;  1EJ7 L;  2HIQ A;  4H4M B;  3Q8Q B;  2FJB B;  4FXW A;  1FKO B;  4DSF A;  2CQP A;  5GAD I;  2MGZ B;  4QWE A;  1L3S A;  3CCZ A;  3BQ0 A;  4PPZ A;  1RHQ B;  5A8K B;  1Q1K A;  3R97 A;  1S1U B;  1SUQ B;  2YNG B;  3TAQ A;  3NG8 A;  4DV3 J;  3BGR A;  1H6K X;  2BJ1 A;  4MMO A;  1IQT A;  4YHH F;  3DRR B;  5K14 A;  4XPC A;  4UOC A;  2C3U A;  2JNJ A;  3T1A A;  2LLZ A;  5DLG A;  4DL2 A;  4IDK B;  5ADZ A;  1RT3 B;  3AA8 A;  5D4L A;  4OJH A;  1N34 J;  4PG6 A;  1N88 A;  3IN5 A;  2CWK A;  1NHU A;  4HHH A;  5HBM B;  1TK8 A;  3BSC A;  1KD1 T;  4KT0 C;  5HLF A;  3H42 A;  2EKY A;  1ROF A;  1H2U X;  4OV6 A;  2RDI A;  1XQI A;  1U6B A;  4UY8 T;  1I3O B;  2NYI A;  1Q8I A;  2WVD A;  4PZV A;  3M8Z A;  1S1X A;  2Z2M A;  1FCA A;  2ZOM A;  1HBM B;  4LRD A;  4QCL A;  4BBY A;  3PR5 B;  2HWT A;  4CYU B;  4AL5 A;  4ZA1 A;  1S1T A;  3BGO P;  2BBE A;  1HKA A;  2LDI A;  3PXG a;  2ZWP A;  1SV5 B;  2VQF J;  4CLT A;  3FRZ A;  2A2C A;  4ER8 A;  3CW2 C;  2WTF A;  2BVZ A;  4ZP9 A;  5I42 A;  2C22 A;  1Q78 A;  1RK8 A;  1TV6 B;  3MF5 A;  1ZM9 A;  2IRX A;  1LOU A;  3U27 A;  4ZDN A;  4DV1 J;  1R0A B;  3N4W A;  3R27 A;  1K1S A;  3EDR B;  2E44 A;  4F04 B;  2JX2 A;  4CO3 A;  2QFI A;  4QQB A;  2H51 B;  4ECU A;  3MM5 A;  3E2E A;  1C1B A;  3UPF A;  1VQN S;  2XB2 D;  3NNC A;  4ITS A;  2HRT A;  3VQS A;  3FC9 A;  4BC9 A;  1WDT A;  5DJB A;  4P52 A;  2BE9 B;  3HCX A;  3LAL A;  4I68 A;  3MEG B;  1BD6 A;  1K1Q A;  1EKS A;  5JVG Q;  1VYA A;  1S1W B;  3GG1 A;  3PDN A;  3CIZ A;  2BUN A;  3VAF A;  3DN9 A;  4TNO A;  2VG6 A;  3SSR A;  2HQC A;  4OZ5 A;  1P9Y A;  2H54 B;  2HUR A;  2EFV A;  3D6M B;  5KG2 A;  5KFL A;  2YX7 A;  1MMN A;  1H7X A;  5CYJ A;  4RUA A;  4C0H A;  2NPF A;  4X4S A;  4PWW A;  1XMO J;  5LSR A;  3EDQ B;  3PRB A;  1S9G B;  4B3O A;  4DL7 A;  5A0Y A;  1ITP A;  3GYX B;  3ICL A;  1IWG A;  2IJF A;  2PE8 A;  3D0H E;  2YWH A;  4V19 X;  4DF8 A;  2BE7 D;  1RAF B;  2AYG A;  1FJ7 A;  4RBT A;  1UWB A;  4X65 F;  2GIQ A;  2VFU A;  2R7X A;  2V67 A;  1FDA A;  3S6E A;  4OV1 A;  4U7C A;  3VAI A;  2D3U A;  1JLQ B;  3VGT A;  2RQ4 A;  3MUV P;  4W4M A;  1AUD A;  1TZ0 A;  4F50 A;  2UUC F;  4F3M A;  4ZCL A;  4I4B A;  4MIA A;  2YKP A;  2Y1R I;  5E5N A;  1X8D A;  1WF0 A;  2ZZT A;  1N5Y B;  3MMA B;  4L3K A;  5AE1 A;  1WHW A;  4NI2 A;  4GMK A;  4RW6 B;  5T7L A;  1PIE A;  4ZCM A;  3A8K A;  3F41 A;  4DCJ B;  1U48 A;  4A8O A;  4ZPW R;  3TO8 A;  1XNR F;  2Q66 A;  1Z2Z A;  2ZOF A;  1IBL F;  3W62 A;  3D3C J;  4CIO A;  1RJJ A;  3OJU A;  1LWC B;  1WHX A;  4Y6I A;  2ZH4 A;  2FZG B;  1FJC A;  1RAE B;  2PSZ A;  3I0R B;  2C2K B;  2B8Q A;  2W2O P;  3CIM A;  1JK9 B;  3TAN A;  1U4B A;  4MK9 A;  1NJI T;  2OKQ A;  3LTO A;  4HDG A;  5B0E A;  3J7Y I;  4NYP A;  3T6B A;  1VQ9 S;  3RRH A;  1KFD A;  4C8Z A;  4ILM A;  2QMU B;  3IRW P;  4KH0 B;  2J6T A;  2HGM A;  3CCJ S;  1U7L A;  1JLG A;  1T05 A;  5HMW A;  1FRM A;  2KM8 B;  4JI1 F;  4X4N A;  3BDP A;  3DXS X;  3EJM A;  3D6T B;  4K4W A;  3DOK B;  2MZT A;  1Q81 T;  4I64 A;  1CJK A;  1KNZ A;  4AXI A;  5C7P A;  5KG4 A;  4OYA A;  2KXN B;  4B9V A;  4UUX A;  4AD6 A;  4ZLJ A;  3CD0 A;  3GR1 A;  3NNH A;  3B78 A;  3QFH A;  4YR2 A;  4NLV A;  2FC9 A;  5AJ3 F;  4QU6 A;  3MR3 A;  2GMH A;  3H2V E;  1Q4R A;  2VJV A;  2JL9 A;  2EFP A;  1VRT B;  3C6U A;  3Q83 A;  1TAQ A;  3DGV A;  3HM9 A;  3IGN A;  1G4C A;  3W8G A;  2V34 A;  4RUB A;  4ZKA A;  3GIL A;  4Z7Y A;  2OPP B;  3OR2 A;  2YWF A;  4UZB A;  4BCA A;  1IKW B;  5M2U A;  1KC8 T;  2I5J A;  1S12 A;  3ZZO A;  3DLG B;  2CPF A;  3PYD A;  4WE1 A;  3HJV A;  5GVQ A;  2HVD A;  1FRI A;  1W2B R;  5KOW A;  1U0S A;  4IOA Q;  3BKT A;  5CD4 H;  2ZVS A;  3C15 A;  5DET A;  4U7U K;  1ZPW X;  5KT2 A;  2A2D A;  4JI2 J;  3EXC X;  2VPZ B;  4KGV B;  3MXH P;  4A48 A;  2J0S D;  2KHD A;  4GO5 X;  3MEC A;  2CQB A;  2QV6 A;  1NJW A;  1I6J A;  1M5S A;  1PJ5 A;  2RIJ A;  3M8W A;  4LQ3 A;  4RL1 A;  3M9M B;  1TR0 A;  3KLV A;  2XGP A;  3K5M A;  4KAI A;  1QUP A;  1TK0 A;  1H38 A;  1IBM J;  5A8W A;  4E98 A;  1Q16 B;  1S49 A;  5E3A A;  2AJ1 A;  3T5H A;  2J0W A;  1HQU B;  3KUH A;  2CG4 A;  1NJZ A;  3QO9 A;  1U2C A;  1F1B B;  4QYZ K;  1U26 A;  2DGW A;  1UP1 A;  4ZP8 A;  2HFU A;  2RH3 A;  1U1R A;  4OX8 A;  3N28 A;  3NGS A;  3H0P A;  4K2J A;  2PI4 A;  1JLE B;  5J2M B;  4IFY B;  2GAH C;  3N6N A;  4OI3 A;  5IT9 Y;  1YG0 A;  3BDE A;  4WBF A;  4DUY F;  2F4V J;  5HJX A;  7FDR A;  2M2B A;  1SB6 A;  3NOG A;  4M1K A;  2I9S A;  1DTT B;  4LMZ A;  2F8H A;  2FYX A;  5L1J A;  4E0D A;  4YOE A;  3QGG A;  2QN6 B;  1RAH B;  5E41 A;  2PII A;  3QJJ A;  3EGN A;  4KYZ A;  1JWW A;  1VIO A;  4IH7 A;  3DOL A;  5FLX Y;  3DDN A;  2B4V A;  2WVC A;  3OTD A;  3KUE A;  2ZZN A;  2MLZ A;  1FRH A;  4YR3 A;  4B9L A;  4Y65 A;  2RRA A;  5EWF A;  4CLL A;  2Y0B B;  1U1N A;  2GVD B;  4UST A;  3AJD A;  3A12 A;  3BYP A;  5HAT A;  4EBC A;  4FYD A;  3V6D B;  3JQJ A;  2KXH A;  3HFZ B;  2MHE A;  3ZZP A;  2B5J A;  3CJT A;  3MMC A;  3ZO7 A;  5KFU A;  3JQM A;  4NLP A;  1OMS A;  3PAC A;  2P2C B;  3CJS A;  1ZM4 A;  3GP9 A;  2XY5 A;  5EWG A;  3NBP B;  1S1V A;  2RRB A;  3GYN A;  3NLC A;  4LRC A;  5J2Q B;  4ECW A;  2CXE A;  2JFK A;  1XMQ F;  3CB4 A;  4QZV B;  3C14 B;  4FNI A;  1VC0 A;  2ASD A;  3H4D A;  4ZPA A;  2F40 A;  1LW0 B;  3RBX A;  5KFO A;  5D4P A;  3PIO Q;  2YWG A;  3C19 A;  2FJX A;  5IM0 A;  2BJ7 A;  1WEZ A;  1FTR A;  3IBC B;  2GW8 A;  2WHO A;  2I38 A;  3BR8 A;  5CAB A;  4R5P B;  3NGD A;  1PKU A;  3QFW A;  3G96 A;  1HIY A;  2HHH J;  4LT6 A;  4WFB Q;  4YDD B;  2R8H A;  3KG1 A;  5M2R A;  3QAU A;  4K5R A;  2HVH A;  3KJN B;  2D9P A;  2GVZ A;  3JYT A;  3NRB A;  1RTH B;  1FXL A;  3QQC D;  5IC4 B;  5AXM A;  2YNH A;  2ZBQ A;  2G4B A;  3I9V 9;  2ZDO A;  4LF6 F;  1HW8 A;  3HDS A;  2DNM A;  1H2V Z;  3JSM A;  4LFB F;  1YIJ S;  1N52 B;  1X5O A;  2UUB J;  4F3Q A;  3HFV A;  3TUP A;  2Y8Y A;  1N0V C;  4TY8 B;  4MK8 A;  2K1R B;  2QLJ B;  2IMO A;  2XMM A;  4DCO B;  4KGX B;  3OV7 A;  3HZE A;  3TP2 A;  3OL8 A;  1HYS B;  3EE3 A;  3I4P A;  2DNZ A;  1WOO A;  3MCM A;  1CG2 A;  5JXS A;  5KT6 A;  3BBF A;  5IT4 A;  2GJF A;  2C2E A;  1N0U A;  2V94 A;  4AE5 A;  3SSS A;  3L7P A;  2IAJ A;  2XSJ B;  3R2D J;  1VQS A;  2WVF A;  2V5H G;  3MPW A;  2DRB A;  2YH0 A;  9RUB A;  4NCG B;  4LFC F;  2UU9 F;  1DLO B;  3J7A 1;  2QSW A;  5ETM A;  2XY7 A;  2ZH7 A;  2BQU A;  4M5I A;  2ZVI A;  4M5D B;  1M5K C;  1D0E A;  3TX8 A;  2BA9 A;  3DLE B;  3BRE A;  2FVP A;  3AH6 A;  1UVK A;  1JXV A;  2KYX A;  3IG1 A;  3N01 A;  3CVK A;  5BXI A;  1ZM3 A;  4B3T F;  4RZR A;  5B09 A;  1VRQ C;  2Z57 B;  3KK3 B;  4LRB A;  3W66 A;  4F4X A;  1RAA B;  5DG7 A;  3HHN B;  3UCZ P;  2QA2 A;  4IG0 B;  3D54 A;  3PJX A;  2PD1 A;  1Y5L B;  2WZ1 A;  5LMN F;  3LP1 B;  3QGP A;  2BXJ A;  1S5Z A;  4ENO A;  3P49 B;  3EXY A;  2AD9 A;  2YNI A;  2RQM A;  4JV0 A;  4TXS A;  1TUV A;  2H1Y A;  1T3N A;  3CUN A;  4PWU A;  2IYG A;  3UW1 A;  2HND B;  2LP4 A;  2LXI A;  2LQB A;  4A4J A;  4W98 A;  5F41 A;  2RNE A;  1NB7 A;  5C42 B;  4WU2 A;  2RIL A;  4DBQ A;  4DV5 F;  4NXM J;  1ZOT A;  2LKZ A;  1J5E F;  2LQ8 A;  2O5D A;  3G4S S;  1OSC A;  3G6X A;  2BAN B;  4N5S A;  2CYY A;  5FII A;  2FJV A;  1BWV A;  4NPO A;  1NK4 A;  4P72 A;  2DNR A;  3HVA A;  5DZ6 A;  1U1Q A;  1TKZ A;  3A3N B;  1LFP A;  2DH8 A;  1J2V A;  4NZ7 A;  2FGC A;  3ZNU A;  5G0R B;  4B9N A;  2MQ8 A;  1LWF B;  3T6J A;  2YBV A;  1LW2 A;  5EN1 A;  1N32 F;  3WC0 A;  2KFY A;  1KOO A;  3ILL A;  4F0M A;  1FRK A;  2AF6 A;  3VCD A;  3BQ2 A;  3L3C A;  4IO9 Q;  3I32 A;  1U24 A;  5AXL A;  1UVM A;  2PN6 A;  4USM A;  5FDL A;  3Q0A A;  1C2P A;  1CSJ A;  2BM1 A;  3QRR A;  1WEL A;  2DXF A;  2UVV A;  3KK1 B;  1P8G A;  3RBZ A;  1RLC L;  3S7R A;  2FGO A;  3OUY A;  3KHR A;  2K7J A;  3HHL D;  4HVZ A;  3CWJ A;  1ULR A;  3FGV A;  2FHM A;  3PM9 A;  5GAG I;  5LMU F;  2OO4 A;  4ELT A;  4YDX A;  4UF4 A;  2RQC A;  3ENW A;  4O0I A;  2G1D A;  1V3Z A;  3O5T B;  4LF5 J;  5ETS A;  2GFF A;  1LV5 A;  2DR5 A;  1KEK A;  2IVY A;  5JUM A;  2EK6 A;  3KLG B;  3SFG A;  4DFP A;  1YQH A;  4OHX A;  4NLT A;  1F9F A;  3UWT A;  4DR4 F;  5F8L A;  4IH6 A;  4DR7 F;  1GMW D;  2EFO A;  3RB0 A;  4EZ9 A;  1CUL B;  2HVI A;  2W1B A;  3A8E A;  3PEH A;  4C6A A;  3KJQ B;  4ID8 A;  1WOS A;  1RT1 B;  2YKQ A;  5K20 B;  1DJ0 A;  1FJE B;  1NCL A;  3MZI A;  4DFM A;  3VAJ A;  5LM7 E;  4D3G A;  3BSN A;  3A13 A;  3UR3 C;  4IQM A;  2VH7 A;  1KLM B;  4I2Q A;  4C0O C;  1F5A A;  2BE2 B;  3HZG A;  4A46 A;  1FKP B;  2WB1 D;  2RU3 A;  2WVB A;  1BWE A;  2DNY A;  3TJA A;  5E3R A;  3W5Y A;  4KHP J;  3K89 A;  2G0J A;  1FI4 A;  4GVL A;  4CT8 A;  4YP3 A;  1DTQ A;  4ECQ A;  3ILO A;  3M6W A;  4K4T A;  8AT1 B;  1UWA A;  4RNF A;  4ZVQ B;  1IWA A;  1RQ0 A;  3KJV A;  4TQR A;  3W65 A;  4AL7 A;  1YRX A;  1REV B;  3CJ3 A;  1OWX A;  3R7S B;  4LF4 J;  2VOD A;  1I94 J;  3C3L A;  3SI8 A;  2IVF B;  2Y0S D;  3N79 A;  4M5M A;  1R89 A;  3KHG A;  4C11 A;  4WCE Q;  2ZH1 A;  3G82 A;  4DR6 F;  4RUH A;  1VQK S;  2ATC B;  3LGM A;  5HL7 Q;  1X9W A;  4LRA A;  2J8S A;  2OEL A;  2YWE A;  1X5T A;  4NA1 A;  1B0T A;  1UFL A;  1KVK A;  1C0T B;  2M0G B;  3H4B A;  2WK4 A;  3UCU P;  3TW0 A;  3QID A;  4LVO P;  1FJG F;  3RRG A;  3CJ2 A;  4USW A;  2IC3 A;  5KFW A;  4LR8 A;  3MMB A;  3SDE A;  2J6S A;  3AXM A;  1VMB A;  2HRY A;  3W61 A;  1HNI B;  4TYB A;  4P75 A;  4I2P A;  1NSA A;  4O3N A;  1K9M T;  1UEK A;  4ZIT A;  3IR7 B;  3TAP A;  4RNO A;  5EHH A;  4LUB A;  4PG7 A;  5KT5 A;  2DO4 A;  5C24 A;  2PMH A;  1NDL A;  3GV7 B;  4DL6 A;  4B3S J;  1YBT A;  3CED A;  1IKY B;  3IMQ J;  4C8O A;  3QGI A;  4Y34 A;  4AUK A;  1YSJ A;  1LWE B;  4HHJ A;  3SIP B;  2CJ9 A;  1JNR B;  3AOA A;  1RYS A;  2PMZ D;  1EQ0 A;  4DR2 J;  2HMI B;  4GKK J;  4QIE A;  5KFT A;  1GFW B;  1SKU B;  3TJ9 A;  3IWN C;  4LSL A;  3CJR A;  2VC1 A;  1FKO A;  4OQJ A;  5A6W A;  4JV5 J;  4CLW A;  5HLF B;  5FJ4 A;  3GIK A;  2MGZ A;  3MD3 A;  3V81 A;  3ZZU A;  5A8K A;  1UJ4 A;  1GX5 A;  4HI2 A;  2QT7 A;  1HQE B;  4MJK A;  1S1U A;  2Y3Y A;  2UVW A;  1E6V B;  4OZ1 A;  4DQI A;  2EG2 A;  2QJ3 A;  1X4A A;  3UDV A;  1VK8 A;  3MEK A;  1RHR B;  2OD4 A;  3DRR A;  1UA0 A;  3A3O B;  2FJD B;  2IM3 A;  4DQQ A;  3SYZ A;  2VU5 A;  2BYC A;  1S1T B;  5F9N A;  1UZD A;  4IDK A;  2J76 E;  5C2C A;  2BRK A;  4RWX A;  3AT1 B;  1RT3 A;  3NXZ A;  2YWK A;  1RLD A;  3R5A A;  2G2O A;  1WC1 A;  2MYF A;  2AX1 A;  3M4X A;  4CLZ A;  4AYB D;  5I42 B;  2ZKT A;  1TU0 B;  4JI4 F;  2ZH6 A;  2HHV A;  1HD0 A;  1RSC A;  2W25 A;  1IR0 A;  4CLY A;  2V9W A;  3E8O A;  1HBM A;  1NJY A;  2OTL S;  1RU2 A;  5GAE I;  2XMT A;  2CVE A;  1NK6 A;  5KFA A;  1GK8 A;  1RTZ A;  1JB0 C;  1TEL A;  3J81 Y;  1Q0N A;  4MIB A;  4OYP A;  4ZCK A;  4X4P A;  4DS4 A;  3M8S A;  3SSQ A;  4DR3 F;  3DDK A;  3M1V B;  2N7Y A;  2YH1 A;  2Z4P A;  1ZM2 A;  1UVN A;  3M8Q A;  5LOQ A;  2C3M A;  3OLA A;  3KJF B;  3MI7 X;  5KOX A;  2I1R A;  2M8H A;  4P2F A;  3VWS A;  1WOR A;  3O44 A;  2J7U A;  4DEZ A;  3CCU S;  4I6Y A;  2GO8 A;  1PAE X;  2DNP A;  4QJV A;  1R6V A;  3D1Q A;  3MR5 A;  3NCP A;  4YS2 A;  3H20 A;  3QSI A;  4NE9 C;  1OPZ A;  4DV7 J;  1Y11 A;  1DHM A;  5M2P A;  3VZH A;  4JV1 A;  4OFZ A;  4YEA A;  3VVU A;  3D28 A;  2DIS A;  4B3O B;  5A0Y B;  2E1R A;  3GSI A;  1R31 A;  2E9T A;  3MEG A;  4M63 A;  1MML A;  3PKM A;  1RT6 A;  1UWB B;  1FK9 A;  4O3O A;  5A8R A;  1PYO B;  3VZI A;  1SJR A;  1NAQ A;  4G1Q B;  3QWU A;  2B0G A;  4DUZ J;  4ECV A;  4UT4 A;  2VHG A;  2GGP A;  2UXB F;  1SPB P;  1FRJ A;  1PG5 B;  4J9P A;  1NB2 A;  2W7O A;  4E2F B;  3DXB A;  4NRT A;  2V63 A;  3UD4 P;  1QAJ A;  1HL6 A;  1IJF B;  4RBU A;  3OHA A;  4HYK A;  4OLO A;  2XZD B;  4JUZ A;  1RT2 A;  2F9J A;  4QOT A;  3S8S A;  4NI2 B;  1NKC A;  1UMJ A;  5T7L B;  3NP5 A;  5EX0 A;  4X62 F;  5KFD A;  2FD2 A;  2E5L F;  4OZJ A;  2H5E A;  3RW7 A;  1YKW A;  2ZWO A;  2W9C B;  4LFA J;  1TL4 A;  1P9Q C;  4K2X A;  3HD1 A;  2VFR A;  1QUV A;  5CQG A;  3V2U C;  2XLK A;  4OX9 F;  1U1P A;  3OSP A;  5D4O A;  1M1H A;  3Q22 A;  1IKX B;  3CNQ P;  3UN5 A;  4EO6 A;  1FD2 A;  4IR9 A;  4J9Q A;  3OL6 A;  4DLG A;  3UR0 A;  4A8K A;  5HO4 A;  4RW6 A;  2AJF E;  3CGI A;  2XHC A;  3ZNJ 1;  4GKJ J;  2KJV A;  2HLT A;  4DL5 A;  1C1C B;  1KHV A;  1NND A;  5BYS A;  5EUH A;  4GVB B;  3IS9 A;  2AJ2 A;  2DBB A;  3BBB A;  2XCP A;  3DM2 A;  3RBE A;  1LWC A;  1RXO B;  2K3K A;  3W5Z A;  3QMQ A;  3PY8 A;  1CJK B;  4QBU A;  1PC4 A;  2Y8W A;  2LQ5 A;  2HVZ A;  1W25 A;  4CO5 A;  4UW2 A;  2C1E B;  2ZHA A;  3GJT B;  1N54 B;  1KN6 A;  2KO1 A;  2VOP A;  2MZS A;  2H48 B;  4LF8 F;  2V8G A;  1M5O C;  4JI5 F;  3BB5 A;  5F8I A;  1URN A;  4ZVO B;  4RW9 A;  3W7B A;  3RB6 A;  4UOH A;  1RU1 A;  2N82 B;  1NLK L;  3T5J A;  1WI6 A;  1VDH A;  2PEB A;  4DU8 A;  5CD4 A;  3JAM U;  1XR6 A;  3HVT A;  3QNW B;  3DOK A;  1KQF B;  2XO6 A;  5DLF A;  4ZVF A;  2HFZ A;  2BJ8 A;  3C15 B;  2QMX A;  4HAC B;  3PRD A;  4QU7 A;  2UZA A;  3BKU A;  3DMJ A;  3QPI A;  3CMQ A;  2W2M P;  1S97 A;  3MEC B;  2OPP A;  2RB7 A;  2J6U A;  1NK8 A;  3KLE B;  1MW7 A;  2VL1 A;  2KTQ A;  2ZM6 F;  4JI8 J;  3VAM A;  4MTP A;  1KHW A;  4DMZ A;  1YIT S;  5A8W B;  2VBZ A;  1FRL A;  3MAA B;  3GWC A;  3L95 X;  2DNL A;  1RZM A;  2OPS B;  5C2G A;  3CCW A;  1H0H B;  5C5J A;  2BV3 A;  4JI7 J;  1F5B A;  4QR0 A;  4FF1 A;  5ETL A;  2CNL B;  4ES2 A;  1GQE A;  2FLP A;  2DHG A;  1HNZ J;  4WYW A;  1J5O A;  4MAK A;  1NK9 A;  2ZJR Q;  5KFE A;  3HSJ A;  4J90 A;  1YJN S;  2NXJ A;  3HJF A;  1Q82 T;  1R8C A;  2AT1 B;  4WP3 A;  3MMJ A;  1SBR A;  3BO3 A;  4ED6 A;  1R43 A;  1WF1 A;  4EBD A;  4F0K A;  2ERR A;  4PEO A;  4EYH B;  2XZW A;  3O6Q A;  4BC7 A;  1L3K A;  1J27 A;  1TUG B;  4A8X A;  5ITH A;  4QWC A;  3J7A N;  3OVA A;  3J80 U;  1A0O B;  1VQ6 S;  3RYL A;  3CDW A;  2XSF A;  2Y1I A;  2AGQ A;  2NRE A;  4USJ C;  5L8R C;  3NKY A;  1RAC B;  3U1N A;  5CZV A;  1FVQ A;  3TA2 A;  3EGW B;  3LAK A;  4NA2 A;  2OEM A;  4P7V A;  2EEY A;  4H4K C;  1NDC A;  1QTN B;  1UET A;  3DOM A;  3M2V B;  2N3O A;  2MY7 A;  3DOL B;  3NAH A;  4DWI A;  3PW2 A;  5IFM A;  4C8N A;  2DEJ A;  1HNW F;  2DJW A;  2UXD J;  1M5H A;  1FO1 A;  2FVR A;  4JI8 F;  5ETT A;  3PW0 A;  2Z30 B;  2XWX A;  2VUG A;  4NLW A;  2FPH X;  2KVI A;  2RKI B;  2ATL A;  1TL5 A;  4GRS A;  8ATC B;  4K50 A;  2VFS A;  4LF9 F;  5I4M A;  2MLX A;  1FA0 A;  2WW8 A;  2B5J B;  3MMC B;  4ZPV R;  5HP1 B;  3EUN A;  3W3S A;  5RUB A;  2CQG A;  2KRB A;  4WK3 A;  1XMB A;  4I6A A;  3ZZR A;  3Q2T C;  2UUA J;  1OS5 A;  4KHR A;  4DLE A;  2VFT A;  5LT5 A;  4OZL A;  4MK7 A;  1CC8 A;  2MKH A;  1N56 A;  3V4I B;  3RR7 A;  2C3P A;  2DHH A;  1RTI A;  2PT0 A;  4AQY F;  3KLI A;  2G13 A;  2EXU A;  4ECS A;  3I96 A;  1R3N A;  1UZH A;  1C0U B;  5L1I A;  3PJW A;  4U8Y A;  2PO4 A;  1IJE B;  3V6D A;  4KQZ A;  1R8B A;  2W2P P;  4FYY B;  3CDA A;  5BR8 J;  4D3H A;  2GJI A;  3ZZY A;  1X4D A;  4O4R A;  4YB7 A;  5KFQ A;  5B7W A;  5D3G A;  3A3P B;  4LF7 J;  1RCX B;  5HMY A;  2DNO A;  4RWW A;  4CNZ A;  1LXJ A;  3NBP A;  5J2Q A;  1MU2 A;  3OTO F;  3H25 A;  1HBO B;  1UW9 A;  2YNH B;  5GME A;  2AYB A;  3CDU A;  2EKN A;  2V69 A;  4TLQ A;  3H5U A;  3O3L A;  1T9Y A;  1FTC A;  2OPQ A;  1TKX A;  2BJE A;  3MTJ A;  2OAU A;  1TL3 A;  4Q5V A;  2OFH X;  1KLN A;  3UN2 A;  3EZO A;  5D0G A;  4R5P A;  4MKY A;  4G1I A;  1E6Y B;  3G9C A;  2OI2 A;  3QBC A;  2GHP A;  1HW9 A;  3EGZ A;  4YY3 F;  4B9S A;  2AU0 A;  3L9Z A;  5DS7 A;  2XGQ A;  3PYF A;  3G8Q A;  4KPY A;  4DJB A;  1RTH A;  1IXK A;  4LR9 A;  3IAS 9;  4J9K A;  2F3J A;  1TFY A;  2NCK L;  1YLX A;  2WON B;  1GMU A;  2DNK A;  2M5Y A;  3V5R A;  1VLY A;  2CPY A;  2DHX A;  1S0M A;  4DN9 A;  1IBC B;  2HS3 A;  3OBI A;  1N5S A;  3C6T B;  2ZZM A;  3KLH A;  4TN2 A;  1QJH A;  2ZHO A;  1KS2 A;  3RB3 A;  1HYS A;  5J2P B;  1WHY A;  5GAH I;  3ZTQ A;  2F4F A;  4HL9 A;  3I5A A;  4N8O A;  2XSJ A;  1VQY A;  4K4V A;  1U8W A;  1HWK A;  1TMM A;  4OI6 A;  3K0J A;  2D69 A;  2OML A;  2K3I A;  2W2Q P;  2U1A A;  3H59 A;  1MRO A;  2KHC A;  3KDN A;  1R7I A;  4LSZ B;  4CH7 A;  1R0C B;  4DSE A;  4EZ6 A;  4ECT A;  3HT3 A;  1DLO A;  3ILI A;  4EFA C;  4OHZ A;  4DV6 F;  4PG4 A;  3LOU A;  4KC5 A;  2AWZ A;  3WBZ A;  2R7W A;  2DR8 A;  2R7Q A;  4V1A k;  3UVJ B;  4LF1 A;  3BEG B;  2YNI B;  4JOU A;  3DLH A;  4UQG A;  2JLF A;  1ZAW A;  5B08 A;  1A7G E;  4NML A;  3SEO A;  3MAQ A;  2ZC4 A;  1M5V C;  3TRG A;  5AXK A;  1VQ8 S;  4PQU A;  3HHK A;  1L3V A;  1FT8 A;  3D6H B;  3KWM A;  3CO9 A;  2VBX A;  4Y2I A;  4I69 A;  3RRK A;  2CJK A;  2DCL A;  4X4T A;  2PI5 A;  3VGV A;  4IG0 A;  4QPT A;  5BYR A;  2EC2 A;  3LAM A;  4NCA A;  1ICE B;  2K7K A;  1HNX F;  1B4S A;  2HBQ B;  5DQG A;  3SQG A;  4ANE A;  1Y10 A;  4DPT A;  3BPD A;  1X4F A;  1RBL A;  1ELO A;  1MN9 A;  5E3C A;  2HND A;  3FEZ A;  1LW2 B;  1AYE A;  2VA2 A;  4PYA A;  1K0V A;  2DY9 A;  2W4C A;  4YQW A;  3NY0 A;  1CJU B;  2B43 A;  3MPY A;  1TMJ A;  1X0F A;  2ZH8 A;  4RBV A;  5FDL B;  4OYX A;  4UQT A;  1MSW D;  4ZIW A;  1VBK A;  2GML A;  2BAN A;  4NCB A;  3ADA C;  3H98 A;  1QAY A;  3W2V B;  3NNA A;  2YX4 A;  2MZJ A;  1SJ1 A;  3EPI A;  4CO0 A;  1RIS A;  1UEV A;  2MQL A;  2GV1 A;  4P6Q A;  2E5H A;  1FEE A;  4KR0 B;  2VA3 A;  5F8H A;  5G0R A;  2QFJ A;  1RWX B;  2WOM B;  2HVE A;  3J7Z 5;  1FDD A;  1HBN B;  1M0S A;  3AHP A;  4DPW A;  1QAX A;  2B7C B;  1B7F A;  2L9D A;  4ZOS A;  1G7C B;  3DC2 A;  2CJQ A;  4X4U A;  2MQP A;  2C2R A;  3OFH A;  5EX3 A;  4B3R J;  1WG4 A;  2PGC A;  1U6Z A;  3RAX A;  5KG5 A;  4DI6 A;  2HHW A;  2VB6 A;  4ZHR B;  1GTH A;  1RWK B;  2IA6 A;  2XBP A;  2AHO B;  2XNR A;  1MG7 A;  2Z2L A;  5KFM A;  4B9T A;  1SC6 A;  2LEP A;  2V8P A;  4X66 J;  3N6M A;  1Y7P A;  2AKW B;  4O0N A;  3AA9 A;  4FXV A;  2DO0 A;  5B0A A;  1H98 A;  3CTR A;  1WEX A;  1NK7 A;  3Q8V A;  1KOH A;  4DX5 A;  3KLG A;  2ROG A;  2B6A A;  2V2Q A;  4I2Q B;  3VR1 A;  2OPR A;  1K47 A;  1F6T A;  2KVQ E;  2GAG C;  2VIH A;  4YFU A;  3K2Y A;  2QX0 A;  1D9A A;  3CD6 S;  3GQC A;  5JVH Q;  2DNN A;  2ZUA A;  1SJ3 P;  4G1P A;  2O66 A;  4WFY A;  1CUL A;  1DTQ B;  2C2M B;  4TVA B;  1IR1 A;  1YVF A;  1OY8 A;  1QY7 A;  3ITH B;  3KJV B;  5ETQ A;  4OYM A;  4U9R A;  2BKP A;  2IBO A;  1NSQ A;  4C97 A;  5F9L A;  2EBE A;  1ZAV A;  4A8M P;  3IAM 9;  3DRY A;  1KLM A;  3W64 A;  3BGL A;  4OL8 A;  3KG0 A;  1WDD A;  1WNE A;  4L72 B;  5DG8 A;  4URQ U;  1M1G A;  4J9L A;  3X3U A;  5HRO B;  3PX6 A;  2UUT A;  3J81 j;  3G82 B;  3TJ8 A;  2MJU A;  1RAO A;  4HR2 A;  3WX4 A;  4WXO A;  1F9H A;  2V2V A;  2XYP B;  3V6K A;  1VQ5 S;  1S59 A;  1Z4U A;  3HHE A;  1LXN A;  3GSD A;  2NXC A;  4OHW A;  1EHW A;  4OYO A;  3EVM A;  1T9V A;  2CDQ A;  4EMD A;  1NJX A;  4FN5 A;  2IC3 B;  5D15 A;  4HT7 A;  4FS1 A;  1VBX A;  3OHB A;  2Q1L A;  4YHH J;  4WWS A;  3CF5 Q;  5MAO A;  2MKY A;  1QDU B;  3LQV A;  1YJU A;  2HQI A;  4I2P B;  3UN3 A;  2Q79 A;  1KDN A;  3TZY A;  2ASL A;  4X2B A;  4JB8 B;  3HSG A;  1IM6 A;  4MT1 A;  2R7R A;  1NUE A;  4DHV A;  4ILR A;  3OR1 B;  4ELV A;  3WQP A;  1CS4 A;  2R2T A;  1RBO B;  4K0K F;  1OO0 B;  2VG7 B;  2AZ1 A;  3BO4 A;  1RE1 B;  4OZN A;  5IXU A;  1JLA B;  1JLC A;  4WIQ A;  1HI8 A;  2XQC A;  3VF0 B;  2W01 A;  2HSE B;  2QZ8 A;  3I5C A;  2NPI A;  5GAD U;  2D41 A;  5B0D A;  3KTQ A;  2Q43 A;  3IWL A;  4BWM A;  1YJT A;  4GO7 X;  3AJ1 A;  4LBH A;  1TVR A;  2KG0 A;  4Z7C A;  2MDA A;  4IOB A;  4LSL B;  2I6W A;  1FFW B;  4JI3 F;  3LP2 B;  1PJ7 A;  2B4P A;  2HS0 A;  5BJR A;  3EWG A;  5KT7 A;  1X7V A;  2XUL A;  4DQS A;  1IKY A;  3V81 B;  2M4M A;  4X64 F;  2R7T A;  3HVW A;  4XDD A;  2KZM A;  2KKH A;  4O23 A;  2DXE A;  2CNO B;  3EX7 B;  3M2R A;  2JZ5 A;  2ZUG A;  2EFQ A;  1WD6 A;  2J9E A;  1LWE A;  3JSY A;  4RX6 A;  3DYA A;  2EG1 A;  4OYB A;  4P7T A;  5CZX A;  2V50 A;  1RI7 A;  3FCW A;  2R4F A;  2HMI A;  3M7V A;  3BYR A;  4DOZ A;  4ZCI A;  3HKZ D;  1YBU A;  3MHY A;  4CRJ A;  1UW4 A;  2H9Z A;  4DSK A;  3F0N A;  3CCE S;  2J0Q D;  1RKJ A;  2HBR B;  1GMW A;  1OPI A;  1RWU A;  2A10 A;  1TAU A;  4DL4 A;  2C2D A;  1O8B A;  2MQO A;  1N5V A;  2VZ9 A;  2ZBC A;  1EKR A;  1HQE A;  3WC2 A;  2YPY A;  1N36 F;  1E6V A;  3OFE A;  3CCR S;  4N8N A;  5KFK A;  4XPE A;  1SJ4 P;  3MM9 A;  1VRU B;  3MOJ B;  4NLY A;  3KHL A;  3MWB A;  4CLU A;  4KGZ B;  3TZW A;  4O3R A;  1MLA A;  1UVJ A;  4C8K A;  2VJU A;  2E5G A;  2E1C A;  2WSF C;  2DIV A;  2PEH A;  4TYA A;  2EWH A;  1RYR A;  2AMC B;  1T9U A;  3M8Q B;  1B0V A;  2ZH9 A;  5KT4 A;  2DGT A;  1AFJ A;  5C25 A;  2QGF B;  4X65 J;  2UXC F;  2IYI A;  3FJ2 A;  3QSY B;  3LWM A;  1SQE A;  1ZA1 B;  3VAK A;  5HVG A;  1WTB A;  4X84 A;  4NLS A;  3ISN D;  4QIF A;  4QW8 A;  1B3T A;  2UUC J;  5JMN A;  3PV8 A;  1UVL A;  4NYO A;  4Z37 A;  1GEH A;  5I3U A;  4ETZ A;  1QTM A;  2C2Z B;  1VBY A;  1CVJ A;  2E1M C;  4KKO A;  5CXT A;  2GC8 A;  4IR1 A;  4ZLL A;  1WC5 A;  3M1V A;  5HI7 A;  1XNR J;  4EK2 A;  2WSC C;  1RT5 B;  1RT6 B;  4P74 A;  4JYA F;  4JP8 A;  4CI0 B;  1IBL J;  1FK9 B;  3VQT A;  3A1Y G;  5A8R B;  3GE9 A;  4ZS6 A;  4USV A;  2HGL A;  1S9F A;  2YQ1 A;  5DGB A;  3P4U B;  2A0F B;  2MMY A;  2KT2 A;  1L5U A;  2GGP B;  3DRX A;  3GFZ A;  4K4X A;  4XK8 C;  1VIS A;  2HQG A;  3CE8 A;  5IV3 A;  1IKV A;  4EUV A;  4TU7 A;  2F63 A;  2DHA A;  4NXN F;  2C3Y A;  2M9K A;  1RT2 B;  1XR7 A;  4EBE A;  2V2Z A;  4W90 B;  2NUH A;  3JAM Y;  4M5L A;  3K7R A;  2RS2 A;  5L1L A;  4EI2 A;  1D8Y A;  1LKZ A;  2Z58 B;  3WHI A;  3M05 A;  5KAK A;  3U1M A;  2NZ4 A;  3CXC R;  4JI1 J;  2BZ2 A;  5CYQ A;  1NO8 A;  1FWL A;  4G1Q A;  4NOH A;  4K4U A;  3IFE A;  3R5D A;  4CDI A;  2HFN A;  2MEW A;  2O01 C;  1HAR A;  1EX8 A;  5MLC V;  4F25 A;  4OMF G;  3AB4 B;  4MYT A;  3V6J A;  1FX2 A;  5KFB A;  2OSR A;  5AJ3 J;  1HI0 P;  1F9E B;  3QLH A;  1SH3 A;  2I2Y A;  2CQD A;  2V68 A;  3M30 A;  1NKB A;  1VBZ A;  2RUS A;  3NOC A;  2RQK A;  4ECR A;  2DKO B;  3RG6 A;  4BLG A;  5KFS A;  1YJW S;  2VF3 A;  2FY1 A;  2W9C A;  3W9I A;  2W9A A;  3SMZ A;  3IS9 B;  4F26 A;  3P96 A;  1DBD A;  1KTV A;  1VR6 A;  3GIM A;  3DM2 B;  3QT5 A;  4GC6 A;  4DV2 F;  3J7Y U;  1KBR A;  3AD8 C;  3IO1 A;  2DD8 S;  3N0V A;  1IKX A;  3G2X A;  1U47 A;  3GIJ A;  4OZ0 A;  3OFF A;  5L9X A;  4N76 A;  2CAJ A;  3KK2 A;  1WEY A;  2DCU B;  2Z56 B;  3PVX A;  3FVY A;  1C1C A;  4RW9 B;  3J80 Y;  4F2S A;  1JLF B;  2PC6 A;  2HZV A;  1FER A;  2JVO A;  4GVB A;  4AFF A;  3J7Z T;  1XN9 A;  2XLI A;  1S9E A;  3T19 A;  2YX1 A;  1N6Q B;  4KPC A;  2BR0 A;  3HVT B;  3EMT A;  2PFF B;  2JEJ A;  3H2L A;  8RUC A;  4PXB A;  1PBU A;  1UKU A;  2VD3 A;  1VGY A;  1YRU A;  3BN7 A;  3PIP Q;  1MWQ A;  2GCF A;  4B08 A;  4I1T A;  1XNQ F;  1U2R A;  2CZ4 A;  3DMJ B;  4FYX B;  1FHT A;  3U02 A;  4DX8 H;  4M5K A;  2X51 A;  2FHJ D;  1QD1 A;  2RJZ A;  3A8J A;  4WII A;  1NM2 A;  2CQ2 A;  5E7O B;  2KT5 A;  2XMU A;  3R5C A;  1TUW A;  1H3D A;  2RD5 C;  2IM1 A;  3AJ2 A;  4B9M A;  5F8J A;  4DQP A;  3BV8 A;  5A6P A;  4FPI A;  2CZ9 A;  4DUY J;  1ZBT A;  3CT9 A;  5HK4 A;  2OEJ A;  3PEJ A;  4ANC A;  2FVS A;  5IT9 U;  2RU9 A;  3D4J A;  3H5Y A;  5THW A;  1NKE A;  5KFN A;  4HAC A;  3FSY A;  1TKD A;  2MPU A;  3MR6 A;  3NWG A;  4JI6 F;  1J5O B;  4LBI A;  2XNQ A;  1ZTW A;  4ED3 A;  3D6F B;  1SL0 A;  2N4C A;  3HFK A;  5IWA F;  5EWE A;  4USI A;  3KLE A;  1CJV A;  2CPI A;  2ZKU A;  5FLX U;  1XEZ A;  1BXN A;  2IDE A;  3CUL A;  1SKS A;  2FJE B;  3R5G A;  3MAA A;  3MCN A;  2VC0 A;  3EPG A;  1HBU A;  4B02 A;  3Q2S C;  2OPS A;  1PIL A;  4QR1 A;  3RW6 A;  3RZA A;  4DR1 F;  3HSD A;  3KDO A;  4K7Q A;  1Y3K A;  3W8P A;  4WTO B;  2VPY B;  2IM0 A;  3I6P A;  1HA1 A;  5EGY A;  1NEE A;  3DOM B;  3T3F A;  2KRR A;  3OVS A;  4IFV B;  2OH2 A;  1NH8 A;  2R2U A;  1DZ5 A;  1RA6 A;  3PO4 A;  2CAD A;  4F4Y A;  4KTQ A;  1LWX A;  4K4S A;  5E33 A;  4HEA 9;  4I7F B;  1XMQ J;  2EK1 A;  2OD6 A;  3AOD A;  2QTW A;  4H4K A;  1U25 A;  2VKZ G;  3PYG A;  1T7P A;  2GIR A;  1VOM A;  3ZXW A;  2CJA A;  3BS9 A;  2DR9 A;  1FDB A;  4CH0 S;  3B54 A;  2VIC A;  3L7O A;  4NZ0 A;  2H5J B;  1U1O A;  5LSL A;  1W7W A;  1S76 D;  3JXO A;  1T11 A;  1EB0 A;  3EZU A;  4TU9 A;  3KHH A;  4B3M F;  1UA1 A;  3M2V A;  4UOG A;  3RGI A;  4JV2 A;  2B56 A;  1RT4 A;  1AXQ A;  3BPS P;  3R7B B;  1U1L A;  3TVY A;  2BAB A;  5HN0 A;  1BMQ B;  4YUD A;  3K5O A;  2YKN A;  1RTI B;  1R8A A;  1RP5 A;  1Y5I B;  3KLI B;  4R8U B;  1X4E A;  3BGU A;  2GIF A;  4LF6 J;  2G0I A;  2RKI A;  4LFB J;  3MUM P;  2D3O 1;  2E1P A;  3T1H F;  2COL A;  3DCA A;  3QGH A;  2DGS A;  4DR5 F;  5HP1 A;  2VV5 A;  3O1L A;  1QSL A;  2VOO A;  4DDF A;  4NX9 A;  4DL3 A;  1ZET A;  1RAG B;  1YZ7 A;  4P2S A;  2FTR A;  2LXU A;  5D3G B;  4O3S A;  4U95 A;  1FES A;  1OYE A;  4ZVT B;  3KMQ A;  4ELU A;  1MU2 B;  4LJM A;  5D6G A;  2L48 A;  2RML A;  3V4I A;  3Q8S B;  2R3V A;  1IBK F;  1YJR A;  3LGH A;  3THT A;  4NLO A;  1C0U A;  3GG0 A;  2RSQ A;  1SVD A;  3TAM A;  3TQ1 A;  4IRD A;  2OPQ B;  1TKX B;  2B51 A;  1Q8B A;  4ED2 A;  5HJY A;  4LFC J;  4JI0 F;  1TL3 B;  1EP4 A;  2UU9 J;  2HIY A;  1F2H A;  4KV8 B;  5B0F A;  4RU2 A;  3K58 A;  4KHM A;  1WSV A;  2NS1 B;  4CLP A;  2ACM A;  2V4J B;  3OW2 R;  4OYI A;  2IBK A;  5F3Z A;  1SXL A;  5AXN A;  1HBO A;  2CNK B;  4KGK A;  4B3T J;  3FBC A;  2OJ3 A;  2DGU A;  4CM0 A;  4CH1 A;  2C28 A;  3CCT A;  5CYM B;  5IS2 A;  1QE1 B;  2FLO A;  2Y1J A;  1B70 B;  2ABY A;  3WX8 A;  2DPI A;  4I0W A;  4YME A;  2L08 A;  3OT9 A;  3KLH B;  2CJB A;  4NL5 A;  5LMN J;  2FZK B;  2GNK A;  3OXG A;  1E6Y A;  4CTA A;  2UVR A;  1EZZ B;  3HF5 A;  1JKH B;  2HK2 A;  3TUZ C;  1BC6 A;  3DLJ A;  1I1G A;  3CCS S;  1KFS A;  3LPE A;  3CDE A;  4G3I A;  3GLJ A;  3DU5 A;  2B4O A;  3D0I E;  3KXD A;  1U6F A;  3PJ9 A;  3OVB A;  2WON A;  1U1M A;  3W60 A;  5F3T A;  3G6V A;  3MGJ A;  1CC7 A;  1YWX A;  2HZA A;  1NZA A;  1MRO B;  3FMW A;  1SQF A;  4DV5 J;  2DNH A;  2NXN A;  1J5E J;  1VC6 A;  5KFZ A;  2QMW A;  2QC3 A;  3GON A;  2ACY A;  4Y2C A;  3C6T A;  2W8K A;  3IA0 A;  2PA3 A;  2F5G A;  1N4L A;  1S0N A;  4CZC A;  2BKO A;  3NMA A;  4FVC A;  1I5O B;  5J2P A;  1JX4 A;  4KFB A;  1HNV B;  2KG1 A;  2DPJ A;  4PQU B;  1KR4 A;  2HGN A;  1N32 J;  4ERD A;  4PKD B;  4F02 A;  1FFS B;  3HUL A;  1NSK L;  1FWK A;  1TFW A;  3BBC A;  1AB8 A;  3TQE A;  2GJ2 A;  3SFU A;  4CM2 A;  1IM4 A;  2M88 A;  3OL7 A;  2QRR A;  4F4Z A;  4G65 A;  2QLF B;  4U7U D;  2OP5 A;  2FZC B;  2W4D A;  1UTA A;  1RAJ A;  2DXD A;  3UVJ A;  1XER A;  3SQG B;  1OYD A;  3M9O B;  2XYH B;  3MPD A;  2ZE2 A;  4ICL B;  1I51 B;  4X4R A;  4F67 A;  5LMU J;  1Q7L B;  4DV0 F;  4FVM A;  2CKW A;  3CJ0 A;  3OSN A;  2IPO B;  3E01 B;  1V3S A;  3WIU A;  1PO6 A;  5GMK a;  3GV5 B;  3VAG A;  4DR4 J;  4M5G A;  2EPI A;  1R27 B;  3TVK A;  4M95 A;  2KYZ A;  4DR7 J;  4Z2X A;  5DDO C;  2WBR A;  4LRF A;  2J9D E;  2ZOG A;  1N33 F;  3NS7 B;  5KFC A;  2X1G A;  1KON A;  3ZZZ A;  3QJL A;  4M5H A;  4DPY A;  4K8R A;  2IY5 B;  4I6W A;  1ZZN A;  5KFH A;  1JXE A;  5HMX A;  5K8O A;  4ZJO A;  5IC6 B;  1DQ9 A;  2J7W A;  1CJU A;  1V6H A;  4AT1 B;  1MNE A;  4KB7 A;  3WDO A;  2BDP A;  5GAG U;  1LEO A;  4O44 B;  3FCH A;  1XR5 A;  1KSP A;  4FF3 A;  2YXL A;  1IVZ A;  1CBK A;  1S6Q A;  4H4O B;  3W2V A;  1RAD B;  1B7Y B;  4I56 A;  2BQR A;  3MM7 B;  1KQK A;  3MM8 A;  1WC0 A;  1N48 A;  2ZJQ Q;  2JH3 A;  4J9O A;  2R9L A;  4S0M A;  2V8D A;  1YI2 S;  2KZZ A;  1REG X;  2WOM A;  1HBN A;  4HH1 A;  1ZS6 A;  3P45 B;  3DU6 A;  3Q8U A;  3D66 A;  1VJW A;  1HHS A;  2BX6 A;  4RO0 A;  3FNN A;  2ASJ A;  2R7V A;  3RAQ A;  2B6A B;  2FB0 A;  1KRP A;  4ZVS B;  2V8V A;  2OPR B;  2B7B B;  4P2X A;  2FIU A;  3LA0 A;  1HR0 F;  2EC0 A;  3MED A;  3FQL A;  4F7V A;  4ZHR A;  3GMG A;  2KXF A;  2DRA A;  4DV4 F;  4F8R A;  1RTJ A;  2LFV A;  1BQX A;  4DR6 J;  1UAW A;  4FKY A;  3W2W B;  2VAS A;  4O4G B;  3BZQ A;  5CA5 A;  3THV A;  5DQI A;  1O0P A;  5JJB A;  1VS3 A;  2X1F A;  2CQC A;  3PW4 A;  1FJG J;  4CWB A;  3DRS B;  3EYZ A;  5H9E J;  4QR2 A;  4DCP B;  5J2N A;  4DF4 A;  2NZC A;  2WAQ D;  3NCR A;  1KQG B;  3OXF A;  4F4A A;  1Z2L A;  1X9S A;  2AQ4 A;  3GJQ B;  2VBW A;  5AE3 A;  4WZQ A;  1DY3 A;  3UI3 A;  1ZTT A;  2O3D A;  4F4K A;  2R8G A;  3W1Y C;  3JSB A;  2D74 B;  3FEX B;  3U1L A;  3LUY A;  2ZJP Q;  3JTP A;  2CQI A;  3ITH A;  2FLN A;  1RWV B;  5CH7 B;  2Z2Z A;  5HAO A;  3SZ2 A;  2DK2 A;  3FDS A;  5ETK A;  1HWU A;  4DV3 F;  3US5 A;  2JEI A;  3IRX A;  4OZ3 A;  3BH7 B;  2HHU A;  3W9J A;  2I0X A;  1OY9 A;  2C2N A;  2CRL A;  4KY3 A;  4NZ6 A;  1AZS B;  1TL1 A;  2Y1L B;  1SC3 B;  3PHE A;  3GII A;  1IN0 A;  1N34 F;  5HRO A;  2MTL A;  2ZFH A;  2OTJ S;  3K5P A;  2B4U A;  3G8S A;  5HQM A;  2VKR A;  4URS A;  2GA7 A;  3LW5 C;  2QA1 A;  4J7C A;  3SCJ E;  3R7N B;  4RW4 B;  2W7A A;  4WZM A;  4NMX A;  3CPW R;  2V6A A;  3M8P A;  2JEF A;  3TNV A;  2E7W A;  2D9O A;  4A47 A;  3BKF A;  1CS4 B;  2KT3 A;  1MMD A;  1KWM A;  1EAY C;  4ZVE A;  3GU0 A;  3GR0 A;  1F5C A;  1XIQ A;  2AW0 A;  1JLC B;  4O3P A;  3ZC4 A;  2JRS A;  5D77 A;  2MQQ A;  2F7V A;  1HWJ A;  2VQF F;  2F1F A;  5J1P A;  1NDK A;  4IRK A;  1TVR B;  1ZPV A;  3VAL A;  3OTE A;  2HHX A;  2EI5 A;  3NCQ A;  1YDL A;  2VPX B;  3IM9 A;  3IBF B;  1Z1Z A;  2DIU A;  3HHL B;  3I82 A;  3ETM A;  1Q8L A;  3OR1 A;  4JI4 J;  4ZMM A;  4DV1 F;  4N77 A;  1WOP A;  4CLF A;  2VG7 A;  2XC9 A;  4X4O A;  3FKB A;  3M2R B;  3PTW A;  1JLA A;  3X1L B;  3OPK A;  3DYA B;  2DGO A;  3HHL C;  1XBW A;  2JEG A;  2YQ3 A;  5KFP A;  3I56 S;  3PO5 A;  1U8S A;  2LU1 A;  1EIY B;  3QT6 A;  4DR3 J;  1JQG A;  1S48 A;  2D3O R;  1HHT P;  1Q53 A;  2GQQ A;  3LP2 A;  4KSE B;  2AEF A;  4EGL A;  3J81 U;  3EZ5 A;  1SKW A;  2CQ3 A;  1RHK B;  2HNY B;  3JB9 k;  4L73 A;  1U1K A;  2YQ0 A;  3PG9 A;  1TQL A;  4CNY A;  1ACM B;  2LU2 A;  3MM9 B;  1AFI A;  4Q8F A;  5KG0 A;  1A6L A;  1URR A;  4EWT A;  1Q95 G;  4NEY A;  1FNO A;  2R8I A;  1PAU B;  1XMO F;  1JJ4 A;  3R6G B;  4Q2L A;  4Q45 A;  3CME S;  2MQM A;  2VG5 A;  1NPR A;  3I87 A;  2A6M A;  2BW7 A;  3D1O A;  2AP6 A;  4PYD A;  5K8M A;  2EW9 A;  5GAE U;  2AGP A;  1CQN A;  1RAI B;  1R8H A;  5C25 B;  2NYH A;  3P5T L;  2U2F A;  3CCM S;  3SCL E;  2QYC A;  3HMJ G;  2ALY B;  5A2Q U;  2MZQ A;  4ZVR B;  3ZFV A;  5L39 A;  2UXB J;  1BQN B;  1F2G A;  2R7S A;  2YTC A;  1VRU A;  3QAT A;  4UUW A;  3C16 B;  2KB2 A;  1L3T A;  2ZC3 A;  1JMT A;  5I3U B;  2KM8 C;  1UJ6 A;  3HK2 A;  1WKJ A;  4RKU C;  4NRU A;  1K44 A;  2EFN A;  2HQF A;  4PPD A;  4IYQ A;  4W92 B;  4KKO B;  3R5B A;  4IG3 B;  4KO0 B;  2HHQ A;  4X62 J;  2E5L J;  1PJ6 A;  4FS2 A;  1K0T A;  1QVG R;  2XEX A;  3AXK A;  2AYM A;  3FEY B;  3B4M A;  4LSN A;  4OX9 J;  3TA1 A;  2VDH A;  4JBC A;  1WG1 A;  4UZC A;  1KVI A;  4FYW B;  3TZX A;  1TL7 B;  1IKV B;  3QZ8 A;  3D3B J;  4WTY A;  2RDD A;  3HD2 A;  3HHD A;  4C8Y A;  4DX6 A;  1WG5 A;  1NME B;  4XO0 A;  2R8J A;  3PX0 A;  1OIA A;  2ZHB A;  4HT5 A;  1T94 A;  3HVR A;  2F8E X;  2LDY A;  1PBA A;  4RUC A;  5KFJ A;  1RT5 A;  2IIH A;  5DQH A;  4ES1 A;  2HNZ A;  4WFA Q;  1HMV B;  3VAH A;  4ZVH A;  5DG9 A;  5CYQ B;  2MKI A;  1S0V A;  2N3L A;  1G6B A;  5DO2 A;  2BJ9 A;  2P8I A;  1GXT A;  4EYI B;  4FYV B;  4NLG A;  4J5O A;  3G6Y A;  4ALZ A;  3ZTS A;  2ZEJ A;  2CG8 A;  1N5Q A;  2JJ4 D;  3QLH B;  3BGF A;  5KG1 A;  4LF8 J;  3EM1 A;  3M30 B;  3TR5 A;  3GV8 B;  4JI5 J;  3N6L A;  1BQM A;  4MYU A;  4WFN Q;  3R3T A;  3EVW A;  1WC3 A;  1NHV A;  4CP5 A;  5SUH A;  2W4P A;  5J1N A;  2FHO B;  1T03 B;  3PZP A;  2YWW A;  4L3N A;  1KQS R;  3ZZ0 A;  5J1E B;  2HFV A;  5KTQ A;  2VBY A;  1IQZ A;  3DLK B;  4FZV A;  2ILZ A;  4JI2 F;  2AEM A;  3Q8P B;  4Y0F A;  1SJF A;  5KFF A;  3AY0 A;  1U0H B;  2AJ4 A;  2GQC A;  3KK2 B;  2HPU A;  3NS5 A;  5FD1 A;  1S7H A;  4LIR A;  3BJY A;  2QE5 A;  3D0G E;  3MM6 A;  3SV4 A;  5KFI A;  3V6H A;  3RR8 A;  3G6E S;  2GQ2 A;  3K8W A;  2MKK A;  4X4V A;  1LNQ A;  3DGP B;  3O2I A;  1S9E B;  2ZM6 J;  1WJ9 A;  2XMV A;  2W9B B;  2VDI A;  1IBM F;  2WSE C;  2HG4 A;  4MIW A;  2K8G A;  4C3L A;  2AJ0 A;  2A3J A;  4AND A;  2AIR B;  4C0B A;  4PUO B;  3NAI A;  2QA4 G;  5CHC B;  5KFG A;  2E66 A;  2FJW A;  4LR7 A;  3MPV A;  3M32 A;  4OHY A;  2HWI A;  3NGU A;  4M5J A;  3W63 A;  3AFG A;  4NAS A;  1S57 A;  4A8F A;  3TWZ A;  3HLU A;  2QEX S;  3RB4 A;  1D1U A;  3R1L A;  1Y00 A;  3KNG A;  5L38 A;  2WW4 A;  1W26 A;  5SZT A;  1JLF A;  2MSS A;  3HT0 A;  5HVF A;  1N6Q A;  2XMA A;  4OI0 A;  2CA9 A;  2F4V F;  4PXC A;  1FXR A;  2IJN A;  3A8I A;  3CJ5 A;  4A8Q A;  1KVJ A;  2OMO A;  5KFR A;  4L6V 3;  3HI9 A;  3SBM A;  4DG1 A;  1RT7 B;  3GIR A;  4K4Z A;  1V3R A;  4NEZ A;  4DSI A;  1BHN A;  3RU0 A;  2HAF A;  2XI2 A;  3P8B B;  3MEE B;  1S99 A;  4DXL A;  5EDW A;  1VQ4 S;  2MHN A;  2FJA B;  1HNW J;  1TP7 A;  1DQ8 A;  2Q6C A;  1S6P A;  3OL9 A;  2DGV A;  1NU4 A;  4OI2 A;  1CJV B;  3UO0 A;  2BOA A;  4QWA A;  3CJ4 A;  1NBE B;  2CZV C;  1Y4Z B;  4OYZ A;  1WC4 A;  3BSA A;  3OQ2 A;  3DLB A;  3MTK A;  1HBU B;  4LF9 J;  2DH9 A;  2ZBP A;  3THP A;  3AD7 C;  1WSR A;  1RWP B;  3PKY A;  3TUI C;  3M9N B;  2LCW A;  3CJK B;  3KUG A;  2JC0 A;  2RF2 B;  4K5S A;  4NA3 A;  3KOA A;  2DNQ A;  2UVU A;  3PYE A;  1IR2 A;  1JJ2 R;  3PNI A;  4DPO A;  4U8V A;  5HQL A;  1NPP A;  2YKM A;  1SQG A;  5E2Q A;  4EEY A;  2L9W A;  4DPU A;  3G87 A;  2CVI A;  2N7C A;  1UCN A;  3EIC A;  4AQY J;  3T5K A;  1Y0H A;  2CQH A;  3UNY A;  2ZH2 A;  2XLJ A;  2JVR A;  1RHM B;  2BJD A;  2E29 A;  4CO4 A;  1EET B;  1T9T A;  2CQ1 A;  4ZLN A;  4HLB A;  3DKD A;  2DB1 A;  1HWI A;  2AYE A;  2HKE A;  1HPZ B;  5H9F J;  3M6V A;  2HHH F;  5D78 A;  2XWY A;  4IFV A;  4KE5 A;  1RT4 B;  2JFD A;  1FRX A;  3PCO B;  2Q3P A;  1KKH A;  2J9C A;  1VLO A;  3TEG A;  4PWD A;  1FNM A;  4YB1 P;  3OTO J;  3DLL Q;  1YGY A;  2DRD A;  1JLB A;  2YKN B;  2OSQ A;  4I7F A;  1HWL A;  4N47 A;  3FK4 A;  3MAH A;  1UL3 A;  1Q5V A;  2XMW A;  1CQM A;  1VK3 A;  3MR7 A;  2UUB F;  5IV4 A;  4K4Y A;  2OUG A;  1N5T A;  3ISZ A;  2CNN B;  4MH8 A;  3UD5 A;  3QRP A;  5L46 A;  2R7O A;  4J9S A;  2CPH A;  2RHS B;  4N41 A;  1Q5Y A;  3TX0 A;  1QVF R;  2HAI A;  1GMV A;  3O8W A;  5T41 A;  3SXL A;  4Q0B B;  1UVI A;  1VQL S;  4YY3 J;  2KJW A;  2HFO A;  1F3F A;  3BH6 B;  2HLU A;  4IO1 A;  3A4T A;  4TY9 A;  4R8U A;  5BYQ A;  1SCJ B;  2ZIT A;  1Q8K A;  3BM7 A;  4RR5 A;  2E9Z A;  4J9U E;  3TAM B;  2P6T A;  2IRU A;  4C3K A;  3ET6 B;  3AB2 B;  4DQR A;  3I5B A;  1PCA A;  1EP4 B;  2V0N A;  3T41 A;  1CPZ A;  3MD1 A;  2XY6 A;  2CPX A;  3M2U A;  1RTD A;  3QRQ A;  4Q2M A;  5K9F A;  4Q7A A;  3NL0 A;  3R9L A;  3T5L A;  1VQO S;  1WTF A;  2VON A;  2R2R A;  3M6U A;  3Q8R B;  3ELH A;  2LXF A;  2VQE J;  1QM9 A;  2PDA A;  3OTB A;  2FHJ A;  2WCX A;  2XYG B;  1FXD A;  4C4W A;  2PA8 D;  2XMJ A;  3OD2 A;  3R1H A;  2B8P A;  1RKI A;  1S79 A;  1YJV A;  4PR6 A;  3IWX A;  4BWJ A;  3N5F A;  1ARO P;  3RUB L;  1S6O A;  1W2I A;  2CDR B;  3D1H A;  5K8P A;  2FLL A;  4KV8 A;  1GAO A;  4DV6 J;  3FSX A;  4DSJ A;  1RWN B;  4KJI A;  1CEZ A;  2ZD1 A;  3D7S B;  3VVT A;  2LMI A;  4CTA B;  2V4J A;  1H73 A;  3LH2 S;  2PFD A;  4OX7 A;  1SJQ A;  3KLF B;  1O5J A;  4PXD A;  2SXL A;  2XS7 A;  3QIP A;  1FF2 A;  4YR0 A;  5B0B A;  3CO0 P;  2L9N A;  4MFB A;  2XHW A;  5CYM A;  4NXM F;  3GZ7 A;  4U6P A;  1QE1 A;  5GAH U;  1BGX T;  4ID5 B;  1T02 A;  4RW8 B;  1H2T Z;  4ZPB A;  4Q8E A;  1HNX J;  4DU7 A;  3SCK E;  1ZAX A;  4RW7 A;  2RDJ A;  2VQE F;  3I0S B;  1JKH A;  3FCV A;  3IP0 A;  2UP1 A;  4KFB B;  3AOB A;  4PAA A;  1JJH A;  1X4G A;  2GZO A;  2DNG A;  1Y3J A;  2M70 A;  2AJQ A;  4IQX A;  2K06 A;  2RHQ B;  3OJS A;  1BE4 A;  2H65 B;  1DQA A;  2MB0 B;  2ZNY A;  1RDR A;  4X4Q A;  5E0O A;  1FVS A;  4R25 A;  2L3M A;  3BSO A;  3VGS A;  1RA7 A;  4HHU A;  4WKR A;  2Y9H A;  2BJ3 A;  3QZ7 A;  3DRP A;  2XTJ P;  3AOC A;  2JLE A;  2ZE2 B;  1FWP A;  3CCL S;  5KFX A;  2OLW A;  1HNV A;  1FNX H;  3FRY A;  3K5N A;  4LBP A;  2KU7 A;  4ECX A;  3CCQ S;  1Q7Y T;  3GFY A;  3Q89 A;  4LF5 F;  2YNF B;  4NYZ A;  1R0B G;  1CJT B;  3GFX A;  4FBT A;  5KFV A;  3I4H X;  5H1S V;  2KH9 A;  4C7Q A;  4KGM A;  2M7S A;  3H90 A;  1HI1 A;  5I3P A;  3DI6 A;  2FVQ A;  3W9H A;  2X1A A;  3FQK A;  1RCO B;  2GMJ A;  3MCS A;  1WHV A;  7AT1 B;  2E7X A;  1LK5 A;  1Y5N B;  3I31 A;  5G4D A;  2C3O A;  4QYR A;  4J9R A;  2EFG A;  1YX2 A;  4RLE A;  3FBB A;  4WF9 Q;  1GT8 A;  1JXL A;  1VC5 A;  5I3Q A;  4PCQ A;  4ICL A;  2HBZ B;  4LIW A;  3LP0 B;  2WRM A;  3Q24 A;  3POT B;  4PG5 A;  2KFZ A;  3UDL A;  3E01 A;  2QG9 B;  4Y3C A;  2BW2 A;  1UEU A;  4C98 A;  3D9B A;  3CC2 S;  3H5X A;  1DFD A;  2BOP A;  2M52 A;  1UJ5 A;  2MLY A;  2DHS A;  2CUY A;  2R8K A;  2IRY A;  1TKT A;  2EVZ A;  1NZ8 A;  1LFW A;  4QWB A;  3B4D A;  1M1K T;  5HSP A;  1XWL A;  3PFE A;  4KHP F;  1S6Q B;  2QSF A;  3GPA A;  3MM8 B;  1N8R T;  4Q43 A;  1JIH A;  4C8M A;  1X0P A;  3K17 A;  3I55 S;  4WFX A;  4WKY A;  5U47 A;  2CFX A;  1YHQ S;  1T95 A;  1D9D A;  3CC7 S;  4LF4 F;  4IOC Q;  5DDP C;  1TTH B;  4R0E A;  1I94 F;  2AEJ A;  3FFI A;  3BGR B;  4ILL A;  5ETR A;  4QW9 A;  5HQ8 A;  1LQ9 A;  3KFW X;  3DFE A;  2LEA A;  5K14 B;  1P1L A;  3T1Y J;  2P6S A;  3C66 A;  3MED B;  3FSI A;  4O44 A;  2Z2Y B;  3K8V A;  1GTE A;  2L41 A;  3FUY A;  4H4O A;  4H4M A;  1RTJ B;  2DGX A;  3MM7 A;  2UUW A;  2W2N P;  1P1T A;  3V4M A;  1VHF A;  2C2O B;  3F56 A;  1KTQ A;  3K59 A;  5F8G A;  4ED1 A;  4ETX A;  4RNN A;  4C3M A;  2H5I B;  1VQ7 S;  1SUQ A;  1S1X B;  2YNG A;  3FMB A;  1HD1 A;  6AT1 B;  1VHI A;  2JWN A;  2C42 A;  2DY1 A;  2MZ1 A;  4DSL A;  5J2N B;  3GTY X;  4ZP6 A;  3CC4 S;  2QO3 A;  5ETN A;  3Q86 A;  3PHT A;  4DFK A;  2QL5 B;  2A1B A;  2NSB A;  4EO8 A;  3P5B P;  1SL1 A;  1WWH A;  4DX7 A;  3W2W A;  3JTO A;  3K57 A;  4P10 A;  4LF2 A;  5HBM A;  4ZJQ A;  4O4G A;  5H9E K;  5LSO A;  4B3S F;  2CJY B;  2I8E A;  4B17 A;  1RWM B;  2HZC A;  2XM3 A;  1NH7 A;  5L1K A;  1MWZ A;  4RPF A;  2FDN A;  2B9Y A;  3MUT P;  3DRS A;  2AGO A;  4XAK A;  3SQO P;  4K0K J;  3MPU B;  1G3O A;  4QIV A;  1F3V A;  3IRX B;  3VV2 B;  2RT3 A;  4CYU A;  3MM5 B;  1TL1 B;  3T1Y F;  4AL6 A;  1C1B B;  4OJG A;  2LEB A;  4DR2 F;  4GKK F;  2YPZ A;  1SV5 A;  5D0R A;  3H7H B;  4DZ6 A;  3EGV A;  2A18 A;  4E8U A;  4PQA A;  3HPO A;  1GH8 A;  3KG4 A;  4JV5 F;  5AT1 B;  3HXM A;  2OEK A;  4JI3 J;  1TV6 A;  3RTV A;  2X1B A;  5KG7 A;  2QA4 S;  5CAA A;  2DYA A;  1QSY A;  3M8P B;  2VG6 B;  4P9S A;  3NGT A;  3WZ0 A;  4DS5 A;  1R0A A;  4X64 J;  1M5P C;  4V19 J;  3UDE A;  2VFV A;  1PYS B;  2MKJ A;  2KN4 A;  1B99 A;  3MDF A;  3TEH B;  2V4Q A;  4DPX A;  3P3D A;  1S6U A;  3HSZ A;  1AZS A;  5E3P A;  1FX4 A;  4ATN A;  1B64 A;  1WUU A;  4Y2K A;  3IBW A;  3OLB A;  4CQ1 A;  2HHT A;  2LYV A;  3FZB A;  1U2F A;  2GX8 A;  5KT3 A;  5A2Q Y;  4FDF A;  2NXE A;  5ETV A;  5K5M A;  2LQJ A;  4RW4 A;  3UCG A;  3TUJ C;  1S1W A;  1JJC B;  4N7T A;  1U49 A;  1JNZ B;  2UV8 A;  4RNH A;  3ZZT A;  3H2U B;  1FE4 A;  4DN0 A;  4CT9 A;  3PW5 A;  1N36 J;  1A9N B;  1C4C A;  1VJQ A;  3CJ8 A;  1VQP S; 
#chains in the Genus database with same CATH homology
 1YBT A;  4OYI A;  1WC0 A;  4OZ2 A;  1WC1 A;  1YBU A;  1CJT B;  1CJU B;  3MAA B;  1WC6 A;  3MR7 A;  1CS4 A;  5D0H A;  4CLZ A;  3UVJ B;  1Y11 A;  3G82 A;  5IV4 A;  4OYX A;  1U0H B;  1CS4 B;  3C16 B;  3G82 B;  2GVD A;  4CLL A;  4WP9 A;  4CM0 A;  4CLK A;  2GVD B;  2W01 A;  4UST A;  1WC5 A;  2GVZ A;  5D0E A;  1AZS A;  4USU A;  1FX4 A;  4CLY A;  1FX2 A;  1YK9 A;  4P2X A;  3ET6 A;  1TL7 A;  4USW A;  4OYO A;  4WP3 A;  4CLU A;  4CLW A;  1AB8 A;  5D15 A;  4USV A;  4OYP A;  3C15 A;  4CM2 A;  4OZ3 A;  1CUL A;  4WPA A;  3C15 B;  1CJV A;  2GVZ B;  1AZS B;  1CJV B;  5IV3 A;  4WP8 A;  1WC3 A;  3C14 A;  3R5G A;  3ET6 B;  1CJT A;  1CJU A;  3MAA A;  1TL7 B;  2QV6 A;  4NI2 A;  1CJK A;  4CLF A;  3UVJ A;  4OYZ A;  1WC4 A;  1Y10 A;  3C14 B;  4OYM A;  5D0G A;  2BW7 A;  5D0R A;  4NI2 B;  1CJK B;  1U0H A;  4OYA A;  4P2F A;  3C16 A;  4CLS A;  4P2M A;  4CLT A;  4OYW A;  4OYB A;  4CLP A;  1CUL B;  2WZ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...