3ET6B

The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
180
Chain Sequence
b'SAPAQEHPEATVLFSDIVGFTEIASRSSPLEVSLLDELYQRFDAAIEEYPQLYKVETIGDAYMVVCNVTVPCDDHADVLLEFALRMHEEASRVAEPVRIRVGMHSGPVVAGVVGRKMPRFLFGDTVNTASRMESHGEAGQIHISEACYCLRSKERFEIRERGNITVKGKGTMRTYLLSPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Soluble guanylyl cyclase beta
publication title The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Lyase
total genus 53
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3et6B00
4CLLA 2GVDB 1WC1A 1YK9A 3C16B 1WC4A 3ET6B 4USVA 1WC6A 3G82A 4USTA 1CS4B 1YBTA 5IV4A 3UVJB 4OYXA 1CJTB 4CM2A 4OYIA 4USUA 2GVZB 4WP3A 4OYOA 3MAAA 1FX2A 4CLPA 4NI2B 4WP8A 4OYMA 2QV6A 4OYAA 5D15A 1Y11A 4P2MA 1U0HA 1CJVB 4USWA 4CM0A 4OYBA 3C14A 4CLSA 5IV3A 4CLUA 4OYZA 3R5GA 1AZSB 1TL7B 3MR7A 4OYPA 1U0HB 1Y10A 5D0HA 4WP9A 2WZ1A 1CULA 3G82B 1CJKA 3C15A 1FX4A 4CLWA 3C16A 4CLFA 4CLYA 1WC3A 4OYWA 4P2FA 2BW7A 3MAAB 1CS4A 4CLKA 3UVJA 4P2XA 3C15B 1WC0A 4OZ2A 4WPAA 4NI2A 3C14B 1CJUA 1WC5A 2GVDA 1CJVA 4CLTA 4CLZA 3ET6A 5D0RA 1YBUA 5D0GA 1CJTA 4OZ3A 2W01A 5D0EA 1CULB 1AB8A 1CJUB 1AZSA 1TL7A 2GVZA 1CJKB
chains in the Genus database with same CATH superfamily
4HEA9 4Q5VA 4A8QA 1WF2A 4I64A 3L95X 1N6QA 2CPJA 1WC6A 5ETTA 3ISNC 3ZZ0A 5IC6B 4NCBA 2GCFA 2JEFA 1U1KA 4CRJA 2VBZA 1G1XA 2LLZA 2MHEA 5DJBA 3H2UB 3CIMA 2O67A 1U1MA 3BEGB 4DQRA 2JLFA 2OJ3A 4KV8A 3CC7S 3ZZPA 3O5TB 1ELOA 1NKBA 3M6UA 3ENAA 2WZ1A 2YWKA 1QD1A 4OZ1A 4AE5A 1JIHA 3FBEA 1D9AA 1VQ8S 4G6VB 1VQ5S 1PJ6A 1RHRB 4ZDNA 3TX8A 4DCJB 2AV5A 5KT2A 5HATA 3AH6A 1X4EA 2VDIA 1C4CA 1WNEA 2BKOA 4A8YA 2BBEA 2A10A 3HHNB 2R8KA 1X5PA 3EGNA 2A6MA 5T41A 4WTOB 2ZJRQ 2FZKB 3TR5A 2B51A 2UU9J 2GHWA 4JYAJ 1LXJA 1WJ9A 5DDRC 1YKWA 1JX4A 3IG1B 4RX6A 1P1LA 2FJWA 2YKMB 4RBVA 2HGNA 2Z2ZA 3MM8B 5E7OB 1ZTWA 1JLGA 2CPFA 4DPUA 3MHYA 4RUCA 4EO6A 1S9GA 3CUNA 2FVSA 3BREA 1FWKA 3OFEA 4ZPAA 2V8DA 4B9LA 3W66A 2Q79A 2XMJA 4R5PB 2KXFA 4CYUA 3MFHA 3G6ES 3KHHA 3MEEA 2BKNA 2QRRA 3TUZC 1HPZA 1U1PA 1VRTA 4CO5A 3QO9B 2DRAA 3UDVA 1OMSA 4M5KA 3IO1A 5AE2A 5F8GA 1WOOA 2P9EA 4NXNF 4KJIA 2J5AA 5J2MA 2B4UA 2PO4A 5FIIA 3UO0A 1KSPA 2NUHA 1U45A 2H5IB 1CULB 1PC4A 1NJYA 3ULHA 3AFGA 3POTA 4M5DA 2AW0A 2CWXA 3M05A 4O3NA 1V5IB 4ETXA 3L3CA 3M30A 1RHUB 1YLXA 2YKQA 4B3SJ 2X1GA 1UFLA 4UUXA 3H98A 3IC1A 3RTVA 3GB0A 1S6PB 2MQPA 4O3OA 5GMEA 5B08A 1OIAA 3PRVA 5IFMA 3RW7A 4IH7A 2WB4A 1NDCA 1JLCA 1Y3JA 2VG7A 1Y10A 1JJ4A 2FLNA 4ZPDA 1JJ2R 1X9WA 5GVQA 2HVDA 2MXYA 1FX4A 1KTQA 3OL7A 5L38A 1CLFA 3QGPA 3E01A 4DQQA 3C6TA 4DLEA 4LSNB 4WZQA 4KT0C 1A9NB 1D09B 4FYXB 3DOLB 4UOFA 4EEYA 3I82A 4OX6A 1ZBTA 2ERRA 1FK9B 4ED4A 3I9V9 1Q78A 1JWWA 2CDQA 1ZM2A 2VG6B 1UEUA 4KFBA 4HR2A 2HNYB 2BANB 2HGLA 5CCLA 2VICA 4I67A 3BKUA 2I6WA 1CJTB 3M6VA 4PRFA 4YB1P 5CABA 1PO6A 3QATA 4NLUA 3HMJG 5KG1A 4HACA 3PXGa 2DH8A 3EE3A 3R7BB 2UUCJ 1D9FA 4WJBA 4CLSA 3MFIA 1FXLA 1ZH5A 1RYRA 5KG4A 4PPDA 4DX8H 2LP4A 1F60B 2BE7D 4Q8FA 2OFGX 2W4DA 4F3OA 2A18A 4WE1B 3DYAB 3EZ5A 3U1MA 2F5GA 2QA4S 4ECTA 4F3QA 1V9OA 3LP0B 2AJ2A 5ETQA 3GFZA 1YZ7A 1XTZA 3KJQB 2ZBRA 5KT5A 3VQTA 5D8HB 5CYQB 3MWBA 4N56A 4G1IA 5KAKA 5J2PB 4QR1A 2CPZA 4Q0BB 4DV3F 3SFGA 2G0CA 2GVDB 5B0FA 3AD8C 4DL2A 1OS5A 1K44A 4GVBB 4B17A 5HLFB 3HHDA 1M5SA 4DR6J 1GXTA 3NAHA 1KLMB 4NI2B 5LT5A 2OIHA 1TR0A 2ROPA 3Q2TC 2V8VA 2X1BA 3FUYA 4QWEA 3CCZA 5HP1A 1TV6B 2XMUA 3DI6A 2HFSA 5F8HA 4ID5B 1S6UA 4QOTA 4ZP6A 4ZLPA 1HR0J 2I0XA 1B70B 2CPXA 2QGFB 2ZBIA 4ZS6A 3M8RA 3T9NA 1R3NA 1P6TA 4AT1B 1XR5A 1MWZA 2AIRB 1HBNB 2N3OA 4C3MA 4B9UA 1RT6B 3RR7A 3N01A 3EGZA 3W64A 1TL7A 4DOZA 3H20A 5AE3A 1P1TA 3THVA 3AXKA 2J9DA 3AODA 1L3SA 1HBOB 1LKZA 1OQ6A 3H5YA 1C0TB 2RJZA 1RT3B 2BE9B 2HNDB 4MAKA 3NAIA 2C3MA 4O4GA 4EBEA 2FHMA 5CQGA 5F0UA 2DJWA 3SI8A 2V4RA 4V19J 4ED0A 1IBMF 1HWIA 2LDYA 4J5OA 5IC4B 2C28A 2NZ4A 1A7GE 4LFCF 1RUSA 2AJQA 2XMVA 1HI0P 3TO8A 2CAJA 4LRFA 1EHWA 2I5JA 2JLEA 2W4PA 4DR3J 4P2FA 3OL9A 3Q22A 3GONA 2C2RA 5BYSA 3MEDA 5JVHQ 4JV2A 4QU7A 1JKHA 3BJYA 3KJVB 1CSJA 4QWAA 2G0JA 1VRUB 2CVEA 2K2PA 4UOHA 4KHPJ 2C2NA 1LWEA 4WTYA 2FYXA 2RT3A 3BGOP 1VQ7S 2OKQA 1DJ0A 2RDIA 3BN4A 3WX4A 3R97A 3CO0P 3TAMA 1TUGB 4DL5A 5HQMA 1K1QA 1HLWA 2HK3A 4DMZA 1RT1B 1M1KT 4C4WA 3O6QA 4UTGA 2AZ3A 2H5JB 4ZN1A 2Z2YB 2YNIB 2B3TB 3AB2B 3E8OA 2J6TA 1N0VC 3GYNA 1NZ8A 4PUOA 3GIKA 3CJRA 4WFNQ 1BC6A 5J2QB 3U27A 2DNYA 4I6AA 2VA2A 4PKDB 3CXCR 1B99A 3V5RA 3IRXB 1OWXA 3CB4A 1H38A 1NCLA 2CJ9A 2HAIA 2M8DB 3M4XA 1FWPA 2IMWP 1NK6A 1IKVB 1DZ5A 4IG0B 4CLFA 2PMZD 1YSJA 2KVQE 4YN3B 2JC0A 1S10A 2XSJB 1H72C 4PXDA 2ZUGA 4OJ1A 3HO1A 3DRSB 3OXGA 2B9XA 2HQCA 5CA5A 2RU3A 3FQLA 2IHR1 3C6UB 4DUZF 2J9EA 1F2HA 4F2SA 4JI5J 3LP1B 3MPUB 3HVWA 2QTWA 2OP5A 2ZVSA 4A46A 2EEYA 3MMCB 3TP2A 4YDXA 5F8JA 2QEXS 4F4YA 2NPFA 1ZYQA 3PYDA 4EI2A 2FQQB 3NBPB 2DTJA 3NEKA 2EKNA 2YKNB 4M63A 4X64F 1TL1A 3KK2A 3MECB 2DHGA 2C3OA 4TYBA 2DNZA 2ADCA 3R2DJ 1I6JA 3DGVA 4L3NA 4F0HA 4DEZA 2GNKA 3D1OA 3QT5A 4NEZA 3UN3A 3JQJA 4DV0F 3U7JA 3IN5A 2DGQA 5MLCV 3LALA 1FO1A 2D41A 1JXEA 2ILYA 3RYLA 3T41A 3OHBA 5L1JA 3E3XA 3VZHA 2DGVA 2OO4A 5LM7E 2OAUA 2ALZA 1UVNA 4X4VA 3D5MA 2L9DA 1L5UA 5K14B 1RWWB 3R5CA 2EK1A 5FDLA 2HSEB 1UPPA 1OYEA 2JHEA 3FK4A 1WG5A 2FHJA 2KHCA 3CJ8A 1U6FA 1RT4B 2H48B 4UUWA 1UJ4A 2JC1A 5EWFA 4I69A 4C9DA 5KFZA 1KVJA 3VF0B 3FEYB 3N6MA 5M2RA 2H1YA 4KO0B 1U0HB 4K4SA 3D67A 3OTOJ 4MFBB 4A8XA 1EKRA 2CQGA 5KFGA 1E6VB 2NXUA 3DC2A 3CCWA 1HQEA 5J1PA 2F8HA 2FHKA 4K59A 3IXQA 3T1AA 1A6LA 3NMRA 4YHHJ 2B56A 2KM8C 3DLKA 5F41A 1B0PA 5A6PA 3IGNA 1WOPA 1H0HB 4DV1F 2AKWB 2BXJA 2EG1A 4I7FA 3MEGA 3N9UC 4K4YA 4QU6A 2PMWA 2EFOA 1DLOB 2FJDB 4DQSA 1Q7LB 2OI2A 5GAHI 4J9RA 4AXJA 3BZQA 2XG8A 1SH3A 1HYSA 2WK4A 4M5IA 1F1BB 2H4WB 1RHQB 3DLGA 2RILA 4USHA 3L7UA 3DNCA 1AW0A 2BVZA 3TVYA 3ZXWA 3B4DA 1OPZA 2HHHF 2R2UA 2V5HG 2J9CA 2K7KA 1N36F 1SC4B 4OHYA 4OZ0A 4M94A 4USJC 2OELA 4EYIB 1JXLA 3MR7A 3SIPB 1AFIA 3RB3A 4BDPA 4IRCA 1E6YA 1VBYA 2QL7B 5KOXA 1RADB 1TMMA 5B09A 3LH2S 3L9ZA 1LW0A 1N34J 2OHDA 4ENOA 2FC8A 2UZAA 3KK3A 3M8PA 1VQYA 1WC5A 1Q4RA 5KFKA 4PWDB 4FYDA 1WF1A 2RMLA 5KT6A 4PG6A 5K8NA 4ES3A 3K8VA 1KQGB 2JEJA 4F4KA 4B02A 5GAGI 3WDOA 4X4NA 4DV5F 2NXCA 3CJ0A 3H5SA 5E3RA 1Q8IA 5IWAF 4B3RJ 2W7AA 4PQUB 3NMAA 1VQ6S 4EBDA 3GJQB 2EWHA 2JEIA 2F9JA 1VYAA 3FFIA 3Q8QB 4ZHRA 3GIJA 3GQCA 2N4DA 4H4OA 1K0VA 4GKKF 1FJEB 1SQFA 1VQSA 3HJVA 1BQXA 1HWKA 1S48A 3RB4A 3BGFA 5A8KB 2KZZA 2YX4A 4PWUA 4Y28C 1L3UA 3CD7A 3I0RB 4RW7B 1U2CA 3QBCA 1MG7A 4RW9B 3G82B 5KFQA 2W25A 1WC3A 5C2GA 2XCAA 1GMWA 1CS4A 2EI5A 1KOOA 2H4YB 4RU9A 4TNOA 3TUIC 4KHRA 4F7VA 1FESA 2DNQA 3CC2S 4O0NA 1RT5A 1I3OB 4XIUA 3D28A 2CQ2A 4HHJA 2HBQB 3LTOA 2D9OA 3KHRA 2MZQA 1VFJA 2WB1D 3PX4A 4WKRA 1N32F 5KFVA 1YBAA 4UOCA 5IXUA 3R6LB 5I42A 2BV3A 2BKPA 3L4BC 3TZZA 4FF2A 3C14A 1IBKF 3BF4A 1F9EB 5DM7Q 4DFMA 5K20B 2E1CA 1S6QA 1FDAA 3TARA 2Y1LB 4KGKA 3UDLA 1GQEA 4ZK7M 2L9NA 4ED2A 4DPXA 4OI4A 1CJKA 1HQ2A 3RW6A 1DAXA 1RWXB 2OGUA 1WEYA 3Q8PB 1DTTA 4B08A 3PR4A 5DQGA 3HVRA 1FCAA 2HHWA 1FKOB 3MM6B 3MURP 3I87A 1D8YA 2DHXA 3QNWB 2JNJA 2R7SA 3TA0A 1VLYA 4RW6B 2GQ2A 2MKYA 1RHKB 5J2NA 1Q82T 2V4JA 2YX7A 5HJYA 2DR7A 4KGXB 1JNZB 4P71A 5U47A 1VQ4S 1CJUB 2VPWB 5EX0A 4LSLB 3K5LA 2BR0A 5F9LA 2CQBA 4WCEQ 4J9PA 1NK0A 2GO9A 5IT9U 2OPPB 2EPIA 4UY8T 2U1AA 1DRZA 2EBEA 3DRYA 4J9KA 2DHSA 1R8CA 4RL1A 3Q8SB 4LF6J 3CCSS 4QWDA 4C3LA 2CWKA 4ZVGA 4NLOA 5LMNF 1WDTA 5GAGU 3JSMA 2ZHOA 5E2QA 2KJVA 3KK1B 3M2VA 5K8MA 1DQ8A 2VKRA 2NREA 4X65F 3ETMA 3DDKA 4EZ9A 3H5UA 3D66A 2AQ4A 1N8RT 3HZGA 4NLVA 1BQNA 3HM9A 1N5SA 1IBLF 2PN6A 3MM5B 3PIPQ 1NLKL 3GV7B 2LVWA 2F63A 4MMOA 2Y1RI 1EKSA 5L9XA 2DD8S 3CMQA 3DDNA 4I56A 3KG0A 1VDHA 1B0VA 5B0EA 1X5SA 2QLFB 1F2GA 3G8SA 2BRLA 2HRUA 3CC4S 2WTFA 5DZ6A 4HVZA 2H51B 4QIVA 1YX2A 1SIWB 4LF2A 3WHIA 3D6HB 2CJKA 4JV5F 4Q44A 4QIFA 1S79A 2CQPA 4AXIA 2F4VJ 1TFWA 4DG1A 2ZVIA 4H4MB 2MMYA 3M9OB 4O44A 3V6DA 2LQBA 1FNOA 3M32B 1S1UA 4Q45A 1OSCA 3T1HF 2RAQA 3TWZA 3TAPA 1PJ7A 1ZPVA 2YPYA 3BGLA 2WBMA 4Y0FA 2D3OR 3IBFB 3RRHA 3NGRA 1TELA 5FLXU 2XLIA 1Y5IB 1T3OA 3SZ2A 2CKWA 3BDEA 3FNNA 2IDEA 2H65B 5A8RA 2A3JA 1YBUA 1R8BA 4YR3A 1W7WA 1T8EA 2F1FA 2LCWA 3IS9A 2XS2A 2RF2A 1UTAA 2J0XA 4J9LA 4GRSA 4NEYA 3I31A 3ZZRA 2E29A 1K73T 4A8OA 4HH1A 1UW4A 3RB0A 3AOAA 3BO3A 3FSXA 1VS3A 5IV3A 1XQIA 2MZRA 2W24A 4C97A 1NUEA 2OTJS 1RAEB 2BE2B 3AD9C 2KDOA 3GIMA 3BQ0A 1HBUA 4ZMMA 3J7ZT 5F3ZA 2O5DA 3QGIA 4CO1A 4DR5F 2NYHA 2HK2A 4K50A 4F3MA 1N33J 2VB6A 3R6GB 4WK3A 3T6BA 3SFUA 4RW8B 2DXEA 3JAMU 3QQCD 1VBXA 3M7VA 2MQNA 3CJQA 1JLBB 5KFSA 1RT7B 2FTRA 1VISA 2B4PA 2LA6A 2OD6A 2XC9A 5THWA 1RB0A 2OH2A 8RUCA 4W90B 1GX6A 2GX8A 4WFZA 5ETVA 2PFDA 3DM2A 4TY9A 3UW1A 2XS7A 2KO1A 4AD6A 1T05A 2RVJA 2CNLB 2HBRB 2FUG9 2RHQB 2RDDA 3NCRA 4X4TA 4FYWB 2IJFA 3OLAA 4K7QA 2F3JA 4OHXA 3LOUA 3QLHB 2XHCA 2J8SA 2GW8A 4BLGA 4MKAA 2KZMA 1IKXB 3JSRA 3AA8A 2IC3A 4ELVA 2G2YA 2NYIA 2OLWA 3GU0A 4WP9A 3ELHA 4CTAB 5A8WA 1H2TZ 1DY3A 3OHAA 2LQ8A 5D4NA 4RU2A 1BQMB 4OX9F 4IFYA 1NAQA 2HIQA 2VFRA 2WVDA 3LO3A 3LUYA 4DN0A 3M8ZA 3R5DA 3VALA 4JV0A 2AX0A 4WIIA 3FMWA 5LJ5Y 2VG5A 4J9VA 3MUTP 3ET6A 5M2PA 5ETMA 4LF7F 5D0GA 2HNZA 4MYUA 4G1QB 4F04B 4G1PA 1T03B 2E5LJ 4Y2IA 3OTBA 4ZP9A 3M8QA 3KOAA 2MDAA 1IQZA 2AJ1A 3MR3A 4UW2A 3EX7B 5D4OA 4ZVHA 3K7RA 5BR8J 4M5GA 1IVZA 3SEOA 4F4WA 1YJUA 1TKXA 4PYAA 4CT8A 4LBIA 2QL9B 2V67A 4R8UB 4ECZA 4PXCA 1WOSA 3D7SB 1RDRA 2MLZA 1EETB 4DDFA 1AUDA 5AXNA 4MYTA 1M5KC 1UP1A 1IM4A 5CYJA 1KKHA 2UUWA 5C42B 2H9ZA 4WXWA 5A6WA 2KXNB 2ASDA 2D69A 3OL6A 4O4RA 1N5YB 3HPOA 4HDHA 2PIIA 2QLWA 4NXNJ 1N6QB 2R8IA 1H7XA 4KPYA 3AJ1A 3IM8A 2L3MA 3G8QA 3TZXA 3J80Y 5HQ8A 2V2KA 1HNWF 1VMBA 4DL7A 1QJHA 1RI7A 4ELTA 7FD1A 2V63A 1WG1A 2MLYA 4K4TA 2MZJA 2CJYB 4KAIA 4K0KF 4NPOA 4ELUA 2NCKL 2OPQB 3JXOA 3LGNA 4IO1A 2C42A 1PBUA 2V34A 4LF5J 1WEZA 4NLQA 3RRKA 2I1RA 1PYOB 1S9FA 2VC0A 3CDAA 2FLOA 1AUSL 4OYXA 3RBDA 2M88A 1U8WA 5F8IA 3MCOA 5E3CA 2VU5A 1FI4A 1U26A 4DR1F 1HA1A 4LJMA 1SJFA 1HKAA 3GV5B 2VA3A 2RS8A 1GMUA 2IVMA 5GADU 1MNEA 4GO7X 3JTOA 4FXDA 2AJFE 4DV6F 1AROP 2KG1A 1OQ3A 3AY0A 3CJ4A 4LMZA 3UR0A 5KG7A 2HZVA 5E41A 3LW5C 2B7CB 3CJKA 1PYTA 2HMIB 2OSQA 1S9GB 2N3LA 1NSKL 4Y2AA 5B7WA 2VC1A 4P6QA 1FA0A 4CT9A 1SVDA 3W65A 4AUKA 1O6XA 4CO4A 1QY7A 5HROB 2RQKA 3CPWR 2RD5C 4I2PA 2KYXA 1HPZB 3W9JA 2D9PA 1ULRA 2P9CA 3EGWB 5LOQA 2B6AA 3FCHA 2K3KA 3RR8A 3H0PA 5IV4A 5KFMA 1WTBA 4WFBQ 2GS8A 1RAJA 5T7LA 3MR2A 4ZPWR 5J2MB 3D3CJ 4ZVQB 4CM0A 4FKXA 6AT1B 3KWMA 2AEMA 1WI8A 3W61A 4AYBD 2CJXB 2OEJA 4DX7A 3POTB 4M5DB 3BPSP 2ATCB 4MTPA 2O3DA 1FTRA 3IR7B 4JI3F 3M30B 4UQGA 1R0AB 3D6FB 2HQDA 4DV3J 2LQ9A 2XWYA 2RU9A 3MDFA 2XYHB 3UFCX 8AT1B 1YHQS 2KI2A 4J9NA 3F44A 5KFOA 5ETOA 3V81A 4DFKA 4V1Ak 2BOAA 1XK8A 4E0DA 4N47A 1JLCB 1IBCB 2VG7B 2WHOA 5AJ3J 1IR0A 1UFKA 4C48A 3NP5A 3M8YA 2ZE2A 5LJ3Y 3NNHA 4IRKA 1SIZA 2HFZA 2J0SD 2E5JA 2K8GA 4NLWA 5E3PA 1UA1A 4DN9A 2X1FA 5D6GA 1IKYB 4X84A 2FLPA 2FC9A 1RTJA 3BS9A 1WTFA 2EW9A 5JXSA 5LL6d 4OYZA 2Z30B 1F9FA 3KMQA 4NOHA 1HD1A 5H9FK 4KFBB 1BMQB 3LGHA 1XMOJ 1M5OC 2MKJA 4O3SA 2YNFA 3HX9A 2XBPA 1X4DA 2GV1A 4KIAA 2DCUB 2MY7A 1U2RA 1HNXF 1NPRA 3X3UA 4HACB 1ZAVA 5B0BA 4O3RA 2VBWA 5C7PA 3IWLA 1UWBA 3L09A 3SMZA 4AFFA 1XEZA 4ZJQA 3V6HA 2IPOB 5JMNA 3B54A 3EPIA 1RA7A 1IBMJ 4NLTA 3M8SA 3H2VE 3V6JA 2KTQA 2OD4A 2BQRA 1YJTA 2R42A 2CQHA 4LFCJ 4YMEA 1MU2A 3GFYA 5AXKA 4ZVRB 3ZTQA 2CQIA 2PEBA 3PX0A 4GC7A 3VQSA 3IR5B 4P73A 3KLEA 1TKDA 1U1QA 3OD2A 3OQ2A 1X9MA 2MQLA 2IBKA 3QAEA 1HFEL 1SJ4P 2QMXA 2EK6A 3RAXA 2IM3A 1MW7A 1FDNA 2ZOMA 1S57A 5I3UB 1RCOB 1NB7A 1G2EA 1ZM4A 3UPFA 2WW4A 2R2RA 3B8HA 4Y2MA 1RWKB 3CVKA 1FJGF 3H4DA 2HWIA 1MMLA 3DOKA 2GIFA 3H59A 4C11A 3W2WA 1UEKA 1U47A 2HW3A 5CZXA 5C25B 3G2XA 4J7CA 4WXOA 4ZCLA 3DOMB 4OHWA 4UY85 3PO4A 2ZC4A 3MM9B 5DETA 2B43A 5D3GA 3M1VA 3W5YA 5C24B 1NDLA 1ZAWA 3D6MB 1VC6A 1V3RA 3LANA 2BUNA 2XMKA 2HQGA 1RA6A 1X4FA 2QYGA 2YKOA 4WP8A 5EX3A 2IM0A 1SI9A 1W26A 1N54B 4NLGA 4NLRA 4DU8A 2DGWA 5DLFA 4DFPA 1S1WA 1YJWS 2V94A 1TL7B 3T9ZA 2E1MC 1OY6A 1X0FA 3TJ9A 4ITSA 2R7WA 1GTEA 1YVFA 4L73A 2RQCA 4DUZJ 5CXTA 4CP5A 3T5LA 2B9EA 5KFXA 1KQSR 2NZCA 4MIWA 1NB2A 3P49B 1FF2A 2MZTA 2C3UA 2KT5A 2VL1A 4NYZA 4W98A 2COLA 1UVIA 2VJVA 4ER8A 4PWWA 2CJAA 2RS2A 5F8NA 4I2QA 3OR1A 5KFFA 2I5JB 3TQ1A 4PABA 1NHVA 4DS5A 5IT9Y 3CDBA 4X64J 3DHXA 4YS2A 4FDFA 2L9WA 3HF5A 1RU1A 5H1SV 1FNMA 2WCXA 1HQUA 4P75A 4KTQA 3TA1A 6FDRA 4F2RA 5L46A 3EVWA 1LWEB 2XMMA 3BDPA 4AL5A 2RKIB 1Q5YA 5DQIA 2E1AA 4MT1A 3HHLC 3TAMB 3P5BP 2DR6A 4KPCA 1KC8T 5A76A 2IY5B 5DG8A 3QZ8A 1GEHA 3MF5A 1K1SA 5A2QU 4NL5A 3F73A 4PUOB 2KFNA 4RNHA 4PG4A 1LW2A 1MSWD 2IA0A 2LYVA 1NMEB 1YGYA 2QC3A 1SC3B 3PRDA 1SKSA 4OZLA 3IBCB 8ATCB 1V5VA 3OXFA 3RZAA 3ADAC 2W9CB 4CLLA 3QSYB 2KRRA 4TQSA 1SC6A 2B8PA 1U02A 3PYGA 1S6PA 4KGZB 4KC5A 4LT6A 3EZOA 3AD7C 3EDRB 2IYIA 4MK7A 1CBKA 3ETOA 3WBZA 3IMQJ 3Q89A 2NUUG 1IR1A 1OY8A 4HI1A 1T9TA 3J7Z5 2ZJQQ 2DBBA 1PAUB 1LK7A 4ANCA 2ZM6J 3RJMB 2UV8G 3PR5B 2HBZB 4HTIA 3PW4A 3GV8B 1FK9A 2ABYA 5K9FA 3ENQA 2VG6A 4P74A 4I6WA 2W4CA 2BANA 1RISA 1YJ7A 3IWXA 2UUBJ 1TL1B 3UD5A 1NXIA 3N79A 3DRRB 2CUYA 1CJTA 2NPIA 4IOCQ 4B9SA 2RQMA 4PXEA 2HHHJ 1C2PA 3OBIA 2JFKA 3WX8A 4YB5A 1VK8A 5HMZA 2DY1A 3QRPA 3AQPA 2JJ4D 1S1VA 3TA2A 4CNZA 1Q86T 2IMOA 1R27B 2EFQA 3OTEA 2D3UA 3JTNA 2AP6A 3HHKA 2V2VA 5HBMA 4PZVA 2MQ8A 1Q5VA 4EU0A 1FRJA 5KG3A 5HMXA 1KRPA 3DYAA 2HZAA 2W1BA 2V8PA 2ILZA 2MYFA 5HVHA 2IRXA 3Q8RB 3WC2A 1U0SA 5CYQA 2YPZA 3UVJA 2WVBA 2GJFA 3D54A 4DV5J 5J2PA 2VIHA 5IWAJ 3GIIA 2F65A 4Q0BA 1H74A 1KHWA 2GVDA 1XWLA 4JB8B 3QGGA 4GVBA 2IAJA 2E9ZA 3PYEA 3QT8A 2XY6A 2QT7A 1KLMA 1XMQJ 2AT1B 2BABA 3W1YC 3GR0A 4GKKJ 4OHZA 4QZVB 3PW7A 4DV2F 1SL1A 1TV6A 1O0PA 3DGPB 3OPKA 4OYAA 5KFPA 3NCPA 1N52B 3HK2A 2P6SA 2RQ4A 3O1LA 4I7FB 3MEGB 1YJRA 1HNZJ 3OUYA 4DR4J 1LNQA 5EDWA 4LFAJ 4OYPA 3U1LA 3QIDA 3TZYA 2HHPA 1HYSB 5HJXA 3MPWA 2D7SA 1VQ9S 3DLGB 1ZA1B 4ZLNA 2BOPA 4ICLA 2J9DE 3H5XA 3CD0A 5DO2A 3C15B 2M52A 2BJ8A 1F5BA 5IQQA 1N32J 3G87A 2XWXA 4KH1B 3MXHP 1NKEA 1HBOA 4Y2CA 5T14A 5B0AA 1S4FA 5HVFA 4OZ3A 1C0TA 1ZPWX 2DIVA 4CWBA 2HNDA 2VOPA 1IXKA 1IBKJ 4PPZA 3NGTA 3UD4P 3VGSA 5KFUA 2UXCF 1Z4UA 2UXDF 1U1NA 3BYPA 5HANA 2B7BB 2XO6A 3A8JA 2ZZMA 2G2ZA 1R0BG 2WSEC 4ANDA 4F02A 1NU4A 4ES2A 1HNIA 1RHJB 2JZ5A 4PQAA 2B0GA 2QMUB 2QLBB 3TQEA 1JJHA 1HL6A 4EUVA 1KBRA 2HS4A 4B9NA 1DQ9A 4MKBA 1NNDA 3FCWA 3UNYA 3FFIB 1OYDA 2HWTA 4ZHRB 2OEMA 1RE1B 4C3KA 4DLGA 2MQOA 3VGUA 1WUUA 5AXLA 1WORA 1QTNB 3CE8A 4CLZA 1RT1A 2H5EA 3HSJA 2XYGB 3T1YF 3FBCA 2GA7A 3RAMA 4E98A 4WWSA 2NSCA 1S12A 2W8LA 4TY8A 4ECWA 1CS4B 2CQDA 1HR0F 5J2QA 4DPYA 4LBHA 4EWTA 2I9SA 4X65J 1HARA 3IRXA 4OV1A 1VC0A 4ZKAA 4ATNA 5HL7Q 1IBLJ 2AMCB 1PILA 3GZ7A 2YTCA 2ZDOA 3MMAB 1QSYA 2XLKA 2YH1A 4IFVA 3FZBA 4NXMF 4RBTA 1S9EA 4ZVUB 4EZ6A 2YBVA 2JVOA 1XNRF 5I42B 3TI0A 4RW4B 1K9MT 4C8OA 3BGRA 1S72S 2CFXA 2ZNYA 9ATCB 4X4OA 3V4IA 1QUPA 2KFZA 3C14B 2YNHA 3GIRA 2AYBA 2L48A 4LIWA 3EXCX 2CA9A 4C0BA 1TUWA 4WFAQ 3BSCA 3NWGA 1M5VC 1L3KA 3VAHA 3KDNA 3HHLA 3ZTSA 1CJKB 1YQHA 4J90A 4WBFA 4JI1J 4WYWA 1Q0NA 1T9VA 3NG8A 4ZPCA 2Z57B 3S8SA 3NBPA 3RBEA 3TUJC 3ZC4A 4WP3A 2YKNA 4CLPA 2KT2A 5J2NB 3HT3A 3GJSB 1JK9B 2P8IA 3CMES 4WU2A 1TAQA 2V4JB 1YRUA 3RGIA 4WFXA 4G65A 3R5GA 1KEKA 4OI1A 1JJCB 3BR9A 4ILMA 4YB6A 4QWCA 2NSBA 3IM9A 2OTLS 1KQKA 3MI7X 3MMBA 2X3DA 1MROA 3V2UC 4Q2MA 1FTCA 4LF1A 5I3QA 4KRWA 1R7IA 3CTRA 4LQ3A 2C3PA 2QA2A 1FRHA 3JSMB 4M8LA 1RTDA 4KY3A 4NASA 2FY8A 5HMWA 4JI7F 4HT5A 4Y3CA 1WWHA 3A8IA 3K17A 5CH7B 2UUAF 4YFUA 1HHQA 5KFYA 3FZ2A 1BQNB 2FJBB 3MM7A 1N48A 2U2FA 1RTIA 3PVXA 2IJNA 1QE1A 2G1HA 4KHMA 2MGZB 3E2EA 2YKAA 1RKIA 4NCGB 4I4BA 3J81U 4JUZA 3PV8A 2R7OA 4U8YA 1U0HA 1UAWA 2OEKA 4DR5J 4FXWA 1QDUB 2HHXA 3LAKA 4MFBA 3PHEA 3H4BA 4FN5A 4Q8EA 1MN9A 4UZCA 2R2TA 4TQRA 1GX5A 1TUVA 4JI5F 1IN0A 1FXDA 2W2PP 1HD0A 3JTPA 3FQKA 2BX6A 3MR5A 4DZDA 3H42A 4CO2A 4JBCA 3KHLA 5ADZA 2XHWA 1RWOB 1S1XA 2PFFB 4C8KA 1QAIA 3DLJA 4DG1B 5B0GA 4O44B 3S01A 4CO0A 1SV5B 4O3PA 1XNQJ 1DTQA 2MY8A 2CJQA 4OZNA 2WOMA 3SQGA 1PCAA 4B3OA 4L3KA 3JQKA 2C2MB 2QO3A 1H3DA 4RZRA 4HYKA 1QSSA 2VUGA 2VPZB 4ZPTR 4USTA 2ZH3A 3C19A 4K4XA 2C2OB 1FFWB 4ECYA 4A47A 1U25A 4RJVA 1FKPA 4U9RA 1VQNS 3PO5A 2CXEA 2M8HA 4OX9J 5A8RB 1XR6A 2FGCA 1WACA 1HBMA 3CJ5A 2Y8WA 4NLPA 3MGJA 1WHWA 3CDEA 2XY7A 4IUFA 5LSRA 3AQOA 1CQMA 3CCQS 1HI8A 3FSYA 3PW2A 1QAXA 4HI2A 4L76A 2B4VA 4LF7J 2BW7A 1VHFA 3B78A 4LRDA 4QW9A 3HULA 3PKYA 2KM8B 4ZLJA 1XR7A 4C0HA 3T19A 4ZVFA 3GCWP 4DPTA 2JDJA 1REVB 2KH9A 3GR1A 2C22A 1WKLA 1RAIB 1X31C 2HVEA 1X7VA 2HKEA 3SCLE 2IDLA 3J81j 3PFEA 2ROEA 1QVGR 4PQUA 4DL3A 5L8RC 1HBUB 3QYYA 1WC1A 4L75A 4F0KA 1I51B 2W2NP 4M5LA 2PSZA 3N0VA 1Y3KA 4KBIA 3A4TA 2G4BA 3LPEA 4RW7A 4RW9A 4U67Q 4DX6A 4A4JA 3EVOA 1TVRA 3TEHB 1TKTA 4DSFA 2Z4PA 3GFHA 1RHMB 4K0KJ 1HHTP 2AD9A 1NHKL 4F26A 1UL3A 3ISND 1VCTA 2GHPA 1RSCA 1CG2A 2DGOA 2EVZA 3HVAA 3ISZA 4TLQA 1PGZA 1ROFA 1U49A 2B5JA 4CDIA 3CCVS 4RUBA 2HIYA 2KHDA 3EICA 1R89A 2HHQA 3C2PA 3VAGA 2Q6CA 1IJFB 2BJ9A 3ICLA 5A8WB 5HO4A 4DR1J 3D1QA 3FEXB 4QQBA 4DUYF 5ETPA 4IFYB 1S1TB 2ASYA 2GVZB 1YJVA 4DV6J 3HD2A 2I2YA 2E5IA 4U95A 1N34F 4CH0S 1VJWA 4U7UD 1FRMA 2VG5B 4GKJF 1NO8A 4LF8J 2QLJB 5I4MA 3M6XA 2GMJA 1KN6A 2R9LA 4RNNA 3M8QB 4FF4A 2JH3A 1F5AA 1FKOA 3GJRB 3CF5Q 1JNRB 3PIOQ 1GT8A 3KLFB 1RJJA 4BCAA 5E3QA 1TKXB 1LXNA 3FJ2A 2R8JA 4N5SA 2OMLA 1F5CA 4KSEB 1NK7A 4RWXA 1CJUA 4ID8A 4LF9F 3KJNB 1U2FA 4OZJA 4F67A 1YTYA 3OTCA 3S6EA 4P10A 5KT7A 2OPPA 3R7NB 1VIOA 1UW9A 4DFJA 1AB8A 1T02A 1AZSA 4Y65A 3R5AA 1GXUA 2XSFA 3R2CJ 1SJRA 5AE1A 4IDKB 1GTHA 1FVQA 2H54B 1M5PC 2ZKUA 3D9BA 2AEFA 1N4LA 5CD4H 1KNZA 4FXVA 2BM1A 2WONB 3TUPA 1R8HA 4PG7A 1O5JA 3VZIA 3BO2A 2Y8YA 2J6UA 5D0HA 3TYTA 3GYXB 2DNKA 3EJMA 1YRTA 4ZP8A 4ZITA 2PT0A 1PIEA 4OFZA 2QIFA 4YOEA 4DSKA 3NY0A 2YQ0A 3W2VB 1N5QA 4P9SA 2VPYB 2EFPA 2DKOB 4WK1A 1WC0A 2J76E 2F7VA 1S0OA 4M1KA 3TVKA 3AA9A 1XJWB 2VFVA 5MAOA 5A0YA 3X1LB 3W5XA 4EK2A 1SBRA 2Q43A 1Q8LA 1B64A 5D0RA 1T3NA 4OI3A 4YUDA 5KFJA 5DGAA 2F40A 2NXJA 2V8GA 3PDNA 4Z7CA 3CJKB 2VQFJ 2J7UA 4H4MA 2YVSA 5DG7A 2CZVC 2FHJD 2N7YA 3DRPB 3JYTB 4TU8A 3CULA 5BXIA 4I2PB 1HNXJ 1URNA 4ECRA 3HVTA 3VR1A 1IR2A 3DU6A 4ZVSB 3BKFA 2DNNA 2B6AB 5KFTA 4DBQA 1K47A 4J9QA 3OVSA 2HFNA 3GWCA 4YP3A 3RB6A 2DYAA 4ECQA 2ZHBA 1MMDA 1SKRA 1KTVA 3KMSA 4DF8A 3HCXA 4NCAA 4LF6F 1M5HA 1P8GA 2DNMA 4YDDB 3KNGA 4ED8A 4ZPBA 4ECUA 3HLUA 2KU7A 2DO4A 5EWEA 4U96A 2E7VA 1ZA2B 2J7KA 1UCNA 2VV5A 2ZUAA 2Q3PA 4LR8A 5JUMA 2PMHA 2RDJA 4S0MA 4I6YA 3ZTPA 2DNRA 2QV6A 4GMKA 3V81B 3QAUA 1RLCL 2V6AA 5DDPC 1QVFR 3GYGA 3Q2SC 2HAFA 1Q8BA 3HSDA 1R8AA 2JEGA 1VR6A 2ZE2B 1FJGJ 1SQEA 3FMBA 4ES1A 1FHTA 1VHIA 4I68A 3WIUA 4B3MF 1RAAB 2DGUA 3NS6A 4ZA1A 3U1NA 1F3VA 4RBUA 1RKJA 2DITA 1D9DA 2QLXA 2ZWOA 2PC6A 3AJ2A 1RLDA 3DMJA 4UOGA 1RT7A 4KKOB 4DV7F 2HS3A 3ZZYA 5LXRA 3EPGA 3UN2A 4DL0C 2MB0B 4W92B 3QJJA 3MEKA 5KG0A 4NYOA 2EKYA 4EMDA 4JP8A 5IT4A 2GMLA 1Y9OA 1RACB 2CPEA 2ZH9A 4J9OA 1X4AA 1MLAA 3G9CA 5GAEI 1WKKA 1IKXA 5C5JA 2JSXA 1TK0A 2HFVA 3LPYA 2DH7A 2D3ZA 1PSDA 3NWRA 3HKZD 4NLDA 4CTAA 2LMIA 3CJTA 4QYRA 3GJTB 5CD4A 4RNMA 2BA9A 4R0JA 4YR2A 3A8EA 1OJ4A 4DR2F 1S6OA 4X66F 3KHGA 3H2LA 3AXMA 3NGUA 4ERDA 3MPDA 3NKYA 3KLEB 2XLJA 2VBYA 2FGOA 3R1HA 4F4AA 4G1QA 3PM9A 3I96A 2YX1A 1SC1B 4YEAA 4EGLA 1ACMB 5DQHA 5G0RA 5KT3A 2M4MA 3CDWA 4FZVA 3JB9k 1RGVA 1T0TV 5G4DA 5F0WA 4CH1A 2XQCA 2HVHA 2R3VA 3I0SA 3V4MA 3SDEA 2KG0A 1WC4A 7FDRA 2RIJA 2ZBCA 5C42A 4ED7A 1FT8A 4DSLA 3M2RB 2M0GB 3SBMA 2CPIA 1N5YA 4C11B 3HI9A 2POKA 3N28A 3W2WB 3OL8A 3CIZA 3TJAA 2WVEA 3UCZP 1FVSA 5D3GB 4I0WA 1URRA 5H9EK 3M1VB 4BS2A 2JLGA 4Y34A 4ED1A 2LQ5A 2YWEA 1N88A 4IG3B 5K8PA 1AYEA 1QLNA 4CQ1A 4FF3A 2DXFA 2AYEA 2W9BA 2FVQA 3QJLA 2NXNA 5D78A 1TL4A 2DIUA 3QIPB 2OPQA 1LK5A 1NBEB 1S1WB 4DSEA 2FVPA 4NA1A 1Q81T 1F0XA 2OSRA 1YWXA 4OLPA 1CVJA 4FF1A 2Z2LA 5DZ7A 1FRIA 2R4FA 1X5OA 4USMA 2MJNA 3CGIA 4NZ7A 3K5OA 1DQAA 2N4CA 3I6PA 3MAAA 1IJEB 3NGDA 4CI0B 3W5ZA 4IKAA 4X4PA 4DUTA 1RP5A 3NLCA 2ROGA 1C1CA 2ZD1A 4I2QB 4RKUC 3VAFA 3FVYA 3OR1B 2FY1A 1WHVA 3BM7A 2QSFA 4C98A 2HMIA 4C8ZA 5DS7A 5GAEU 2E5LF 4MJKA 4ZIVA 4NZ0A 1Q53A 2YNGA 5F8MA 4C0OC 5BR8F 2VDHA 3S7RA 1QAYA 5HROA 1HQUB 3C8YA 2RSQA 3NCQA 4PCQA 3BO4A 4F4XA 1YJ9S 1X4CA 1T94A 5IS2A 4XDCA 2D1CA 5LSLA 1J5EF 5LMUJ 2DNPA 5J1NA 1ITPA 5DDQC 4B9TA 1FNXH 4AL6A 4ZVTB 4OI2A 4F50A 3ZZUA 4YR0A 3IWNC 3CCUS 2K1RB 4XK8C 2UV8A 1BHNA 4ZJOA 1REGX 3DXBA 3CJ2A 4XAKA 3LAMA 2XTJP 4BBYA 3ZTRA 2CVIA 2HHVA 1R0CB 2DCLA 2XGPA 3EVMA 3H40A 3PJWA 3THPA 1G7CB 1G3OA 1LW2B 3OVAA 3FEZA 4LVOP 4JI0J 2QL5B 1AXQA 3GMGA 3J81Y 4CIOA 2HWHA 3R27A 1S76D 5F3TA 3S1TA 1YZ6A 1X8DA 1N5TA 2BACA 1YG0A 1R0AA 3NS7B 3VAIA 3BYRA 4NZ6A 2XM3A 1YDLA 1FRXA 2G0IA 1MMNA 1UVKA 4LF5F 2CRLA 1N0UA 2WW8A 5I3PA 3Q8UA 2M2BA 3VAMA 3NOGA 1UVLA 3GP9A 1FE0A 2CIMA 3GFXA 3W7BA 1BE4A 1H98A 3UR3C 4DV2J 2PDAA 4FBTA 3KUHA 1LWCA 2APOA 3AJDA 1SH0A 2G9OA 4NRTA 4X4UA 3DLEB 2F8MA 3FRZA 4TVAB 1IKYA 4AL7A 3GCXP 1LWFA 1FDDA 4P52A 1LFPA 1X60A 2BDPA 1WI6A 3G6VA 4ZVOB 5IM0B 2Y9HA 5DG9A 4IH6A 2DHAA 2P9GA 4P2MA 1RZMA 5CAAA 3B6BA 4O3QA 2UVWA 5EN1A 3QZ7A 3M8WA 5KG6A 1VI7A 2LQJA 1X4GA 2IRYA 2ZZTA 3FSIA 2DISA 1S1VB 4BWJA 3MD1A 3R5JB 4LR9A 4IO9Q 5H9FJ 3OR2A 3OT9A 1RAGB 1D1UA 2WBRA 2GAHC 1QUVA 2HLUA 1KDNA 3MPYA 5HBMB 4FBUA 1RYSA 1NSAA 2EXUA 2UXCJ 2UXDJ 9RUBA 1RAOA 3DFEA 3UDCA 5J1EB 1M1HA 4O23A 1SJ3P 5BJRA 4Q2LA 3EWGA 3VVUA 2GGPA 4FVMA 4HLBA 1TL3A 3UVJB 2FJXA 4DSJA 2XI2A 4EO8A 2ZHAA 1U48A 2GJIA 4ZN3A 2BYCA 1J5OA 1SUQA 4LSZB 2IAJB 3QFWA 3KDOA 3I5AA 2ZFHA 1CC8A 3H7HB 5I3UA 2CPHA 2DEIA 3IP0A 2V9KA 5AJ3F 5CCMA 3MTKA 4JI2F 4UT4A 1EQ0A 3EMTA 4CLYA 2YWHA 2RHSB 1KONA 2CPYA 3Q83A 1DARA 3T1YJ 5GADI 5C25A 1QAJA 5F9NA 3DOMA 3DLHA 4NLYA 3ZZOA 3MM9A 4TLRA 4QJVA 2A1BA 5KFBA 3OUYB 1UFWA 2FD2A 2C2KB 4HHUA 3RBZA 3CJ3A 2MTLA 3SSRA 3QRRA 1SJQA 1H2VZ 5C24A 1EX8A 1ZOTA 2FPHX 2CG4A 4QPTA 2YQ3A 4JI4F 2LXUA 3C3LA 3AT1B 1NPKA 4KE5A 1U7LA 3W8GA 1S7IA 1XMOF 3A12A 4ICLB 3ZZZA 3DLLQ 1EQMA 1FWLA 3LP2A 3IRWP 4NXMJ 3HT0A 4Y6IA 2R7XA 2ZH8A 4J37A 1IKWA 3G71S 1XNRJ 3UCUP 1ICEB 3K59A 2RUSA 4MIAA 4RLEA 4ZVEA 1M1GA 3PKMA 2HPUA 1VQPS 1Q95G 4AQYF 4CLWA 1HNVB 4OI0A 3LQVA 4DPWA 4OIXA 2QJ3A 2V68A 1V6HA 4LFBF 4BC9A 1HNIB 2AJ4A 1VQLS 3EDQB 5L9NA 2CJBA 3TANA 4ZJLA 4B9VA 2PA8D 2MKHA 2Q66A 2F4FA 1HMVA 3RUBL 2VOOA 2IM1A 3VGVA 4NYPA 3OXLA 1TZ0A 1LWXA 2YKPA 1JLQA 3BBCA 1D3WA 1FKAF 2HEKA 4OJ3A 3I4PA 3KLIA 2QFIA 5DM6Q 2EBGA 2RKIA 1W25A 1W2IA 4O0IA 1Y11A 3BN7A 2HFOA 2GO8A 2Q1LA 2LEBA 2OPSA 4IRDA 3R5BA 4ALZA 1C1BA 2JRSA 1R8PA 4OL8A 2BJ1A 4X62F 2O01C 4E8UA 4ECVA 1JLFA 1H7WA 3UNGC 4TU7A 2DXDA 1VJQA 2PEHA 4IQMA 4KV8B 1OSDA 4TY8B 3A1YG 4JI7J 3GLJA 4QCLA 3TAQA 3VWSA 3BQ2A 1KR4A 2RNEA 2UUAJ 3MD3A 3G6YA 3ZNUA 2GJ2A 2Z0GA 2R7VA 1C0UA 4USIA 1HW9A 1U1OA 3SXLA 2W9CA 3DN9A 3J80U 1UKUA 2VQEF 5KFIA 2NS1B 3ITHA 1TK8A 3IFEA 1HIYA 2RE1A 4IFVB 1VOMA 4ECSA 2M70A 3EGVA 2MZ1A 1S9EB 4M5NA 3KLHA 3ENVA 2ACYA 1KVIA 3EUNA 2DY9A 1JLEA 3BGRB 1G4CA 4RNFA 1A0OB 2R8HA 3V4IB 1FEEA 2Y1JA 2XCPA 2W2MP 2YNHB 4RNOA 2Z8QA 4JI6F 4OYBA 3HKWA 1JLGB 4PG8A 4X4RA 1JLAA 5IZHA 3D0IE 3CD5A 1IWAA 3HHLB 1TFYA 1H6KX 1UA0A 1RCXB 2C2EA 4LBPA 1SL0A 2BQUA 2VFTA 4HTJA 4URQU 3P6YC 1NEEA 4GVLA 4CYUB 4LRCA 2XGQA 2XS5A 3VCDA 3PYFA 3DKDA 2VONA 1KFDA 3ILIA 3MEEB 3OJUA 4C8NA 1FRKA 3FDSA 2J8AA 1VRTB 3DRRA 4C8YA 1V3ZA 2IVFB 3MPVA 5E0OA 2XULA 4H54A 3J7AN 3FBBA 3TZWA 3KLGA 4LVNP 3IR6B 5KFEA 3MMBB 1MROB 2GMHA 4YB7A 2W2OP 4KR0B 4NLSA 1YBTA 2IBOA 1AT1B 1TMJA 1VIXA 4IR9A 1TKZA 2X51A 3R8YA 3PCOB 2ASLA 5D15A 1S59A 2PD1A 3NRBA 1RTDB 4FS1A 1VGYA 3T5HA 4P72A 2OMOA 3UI3A 2RB7A 5FJ4A 3I5BA 1DURA 3OJSA 3MUVP 4EBCA 2SXLA 1RABB 1RK8A 3I5CA 3MM7B 4DJBA 1NDPA 1IUJA 3KJFB 4GO5X 1RTIB 3QT7A 1RAHB 2W7PA 1ZM3A 1UETA 3C16A 1QE1B 3PJXA 1T7PA 3OFGA 2HBYB 2FLLA 2GAGC 4MKVA 1LFWA 2V2ZA 7AT1B 4OJGA 3Q23A 4PYDA 2AYMA 3M2UA 1R43A 4N8OA 3E01B 2KT3A 1RTZA 2HFUA 4F4ZA 2E5GA 3C6TB 1O51A 2HGMA 4DCPB 5D0EA 3PHTA 4HHHA 2DR8A 2CDRB 4OLOA 2ZH2A 2VF3A 2KRBA 3M9NB 5ETRA 3DGPA 1VRQC 2YWGA 5C2CA 2ZM6F 4Z37A 1RWNB 2J0WA 4LREA 1S1XB 2MKSA 3W9HA 1VBZA 1U8SA 2VASA 3K0JA 2Y3YA 3BQ1A 1N5VA 1RBAA 1RBOB 5GMKa 3A13A 3HSZA 5GMDA 1DTQB 3D1HA 3CCLS 4LF4F 2WOMB 4C8LA 3SQGB 2FZGB 1YITS 4U7CA 2UUBF 4B3OB 1APSA 2R8GA 2XMAA 2ZEJA 2UVRA 3A8KA 2GQCA 1NPPA 4D3HA 1BY9A 4A8MP 3C15A 3DLBA 1EZZB 4C7QA 4HDGA 2AWZA 3HFVA 2XB2D 2GIQA 2E7XA 1YI2S 2M3DA 3BBBA 1Q79A 2W2QP 1NK4A 4XPCA 3PY8A 4FPIA 1UJ5A 1FKPB 2KVIA 4DUYJ 4OZ2A 5KFHA 3EM1A 1HBMB 2KYZA 2C2ZB 1CJVA 1EP4A 3P4UB 2RRAA 2DNGA 2K7JA 3CCTA 3F56A 4N76A 1WHYA 5KT4A 1CEZA 4NLXA 4RUHA 1V3SA 3OLBA 4GKJJ 4M95A 4TXSA 2MQMA 2OPRA 2XY5A 2LEAA 3IA0A 5CYMA 2RRBA 2AZ1A 1S0NA 2VJUA 2F9DA 2E44A 1NJXA 1RTHA 4IYQA 3HP6A 2ZH7A 2GFFA 2FJEB 1UZDA 4DR7F 3ZTOA 4P7TA 4DV4F 3ENWA 2MKIA 2D74B 1RT2A 4TU9A 3HFKA 2ZOFA 3ZZTA 4LF9J 2DPIA 1NJWA 5HP1B 1IWGA 1KQFB 3BGUA 3DI6B 1XMQF 1LOUA 1L3VA 3BSNA 2N82B 4ZCKA 4ILRA 3K57A 1MWYA 1J27A 2BW2A 1TVRB 4X4QA 1TKTB 2O1PA 3FCVA 4LRBA 1HNZF 1ZZFA 4DR4F 1OO0B 4A48A 3Q24A 4FPRA 4LFAF 2LEPA 3QT6A 3CWJA 4FVCA 2DNOA 1RWVB 3GSIA 5L1LA 3PW0A 4KB7A 4OYIA 1I94F 4UZBA 3N4WA 1FX2A 1TP7A 3EZUA 3OTDA 2VODA 2B5JB 3Q0AA 2Y1IA 5IOLA 3MMAA 2CNOB 4O4GB 3K2YA 2ZBQA 3QGHA 2V0NA 3G86A 5KG5A 3KKFA 4RW4A 1NKCA 5KFCA 1PG5B 2LA4A 3Q86A 2WSFC 3IG1A 4YY3F 3ZFVA 2YKMA 3D68A 4DWIA 3MM8A 5GAHU 2UXBF 3W3SA 2FB0A 1AA1B 3O2IA 2R7UA 1XC9A 3WQPA 3RRGA 2VD3A 3UD3P 2CPDA 3MEDB 1JKHB 4JI8F 3NL0A 4DL4A 1T95A 4B3TF 3P3DA 4IQXA 5KFLA 4R5PA 2HHSA 2HRTA 5JVGQ 1K8AT 2VFSA 2O66A 5EWGA 3T5KA 3BSAA 4JOUA 3QO9A 2VFUA 2V69A 3W9IA 2ZBPA 2ASJA 1XERA 4DV0J 3G6XA 2R7QA 3BBFA 2HYIB 4TKTA 4ETZA 5KTQA 3CD6S 3PEJA 2E9RX 4OZ5A 2ZZNA 4W4MA 3MCSA 1X0PA 1AZSB 3SCKE 4OX7A 1CULA 2HRYA 1YIJS 3I4HX 1NM2A 1Y5LB 3VVTA 3E51A 3KG4A 4NMLA 2HLTA 2P5VA 3CDUA 5HSPA 4CH7A 2D3O1 1I1GA 4K8RA 2C1EB 1FRLA 3D6TB 2MEWA 2EFNA 2W01A 2X1AA 2MGZA 5CZVA 1Y7PA 3DRXA 1F6TA 3MAHA 4NCGA 2JL9A 3R1LA 4QR2A 3DCAA 4LR7A 2Z2MA 4K4VA 1SH2A 4USUA 1UVMA 2B9YA 2A6OA 2PI5A 2UU9F 3EXYA 2WVFA 4JYAF 4B3MJ 1B3TA 3UDEA 5A0YB 4LSNA 4OV6A 2L41A 3V6KA 2E9TA 4DV1J 5B0DA 1NJZA 5RUBA 3TOQA 4MK8A 3UE2A 4XDDA 1S7HA 2X7IA 3DOLA 2E5HA 2KN4A 4RPFA 2XNRA 3NGSA 5FLXY 2FJAB 3FC9A 4LIRA 1Q16B 2HHUA 4DV7J 2AYGA 2W8KA 2P2CB 1U4BA 3UCGA 2HNYA 2DVIA 2ZJPQ 4JI1F 1MWQA 4NWBA 1J2VA 3KK2B 2MHNA 4DF4A 5E5NA 3NS5A 3I56S 4PAAA 2FVRA 1SV5A 2GHVC 3UQSA 1S5ZA 3SYZA 4MK9A 1KP6A 4DXLA 4N8NA 1N36J 1JMTA 2QFJA 3PJ9A 3HVTB 1RWMB 4Z7YA 2BJ7A 4FYVB 1M90T 1R6YA 3OSNA 3B82A 4RUAA 1X4HA 1VBKA 2YY3A 2Y0SD 3J7A1 3GSDA 3NGKA 4IR1A 2QA4G 4D3GA 4TN2A 5JJBA 4PXBA 3P8BB 1TQLA 1BXNA 2DGTA 4WE1A 3BPDA 3HSGA 4OX8A 4FYYB 4HL9A 2QE5A 1PC5A 2MSTA 2J6SA 2ZH5A 1X9SA 4DR2J 2ZC3A 3LP0A 4X66J 2PI4A 1LQ9A 5FDLB 4DQPA 4PEOA 1SJ1A 5HI7A 1EAYC 4BWMA 3K89A 2A2DA 4B3SF 2BJDA 2GZOA 1RWPB 4FNHA 1KD1T 2VH7A 3THTA 2AF6A 1BUXA 1REVA 4K5RA 3JAMY 2G13A 5HLFA 1SXLA 2IYGA 5KG2A 1RBLA 1WKJA 3R7SB 1FFGB 1HQEB 4NI2A 1BGXT 3P96A 2CZ9A 2N7CA 2LXFA 2ZITA 3DLKB 2C2DA 1RU2A 3CCRS 2FHOB 3JSBA 5L39A 2JVRA 1H73A 1SKUB 4ID5A 4DSIA 2MPUA 4L74A 5M2UA 1UPMB 1YJNS 3DMJB 4CO3A 2WSCC 2PA3A 3GG0A 2DNHA 3KLVA 5DLGA 3TVZA 1PBAA 2JOQA 1C4AA 1S49A 1KOHA 2FDNA 5HK4A 1HBNA 3BB5A 1F3FA 1UMJA 1XNQF 3JQMA 1RT6A 3O8WA 1IM6A 1GH8A 2DNLA 2XMTA 1HW8A 1NH7A 2UUCF 1O8BA 2MJUA 4I1TA 1HWUA 1ZETA 2DT9A 1S0MA 1E6YB 1RT3A 4IOBA 1WD6A 1S4EA 1S0VA 4OJHA 1UEVA 3D0GE 1LW0B 1R6VA 1NHUA 2AGQA 3ILOA 2IM2A 3KK3B 1DHMA 4NE9C 3M8PB 1S1TA 2DR9A 2IIHA 2XYPB 5KFAA 2GVZA 1NK9A 4ZPVR 4ANEA 1FXRA 2AU0A 4CM2A 5IQ6A 1B7FA 4UQTA 3CO9A 2E1RA 3VHQA 5HMYA 2FZCB 1T9WA 5EUHA 3KJVA 2ACMA 4EFAC 3LA0A 2Z56B 2AEJA 3CCJS 4DHVA 5G0RB 1TTHB 1VRUA 3KLFA 4Y00A 4DR6F 3I0SB 3SCIE 3SDEB 3IBWA 4MH8A 2NLWA 2CYYA 3Q8YA 3KTQA 3BSOA 1J5EJ 4H4OB 3QWPA 2IRUA 1P9QC 3T3FA 1XN9A 3MOZA 4ZP7A 1I5OB 4QYZJ 1FERA 3JS9A 1XBWA 2H3EB 2KKHA 3OVBA 2WAQD 2XMWA 1KWMA 2GC8A 3SV3A 3AHPA 3MUMP 4F8RA 3CEDA 2ADBA 1PAEX 2ZDPA 3MTJA 4TYAA 5LMNJ 2YNIA 1T9YA 2BQ3A 1RQ0A 2BM0A 4ZOSA 1P9YA 2XZTB 2VBXA 2A2CA 4IDKA 3VTIA 1KLNA 3MR6A 1TU0B 1FEHA 2K06A 3HHLD 2MSSA 3BV8A 1RT5B 3H90A 1GK8A 1BLUA 4N77A 1IKVA 2W9BB 1VC5A 1Y0HA 4IG0A 2WONA 2DRBA 3FBFA 4FKYA 2X3GA 4DI6A 1S97A 2CZ4A 1M0SA 3K8WA 3NXZA 2XSJA 3T6JA 1FJ7A 2MLXA 1DBDA 2NXEA 4ZVPB 3DRSA 2K3IA 3D0HE 3AAWB 3CNQP 2BJ3A 3WIVA 3C6UA 2DB1A 3AOCA 5B0CA 2BEFA 3W2VA 2VKZG 3H25A 4LRAA 3LP1A 1SPBP 3P5TL 4B9MA 1PJ5A 1S6QB 1ZZNA 1H2UX 1NK8A 2FJVA 3MMCA 3MAAB 4X4SA 1FD2A 1XIQA 4JV5J 2UUTA 2ZWPA 5HAOA 1HI1A 2GQQA 2HURA 1SKWA 1C1CB 2BMBA 2AJ0A 3FRYA 5D4PA 4LF8F 4JV1A 1DTTB 2ZD1B 4CLTA 1CC7A 3T1HJ 4DR3F 1GMVA 3LGMA 3MECA 2KFYA 2ZNZA 2HVIA 3DRPA 2YNGB 3SQOP 3JYTA 4NX9A 3F0NA 4A8KA 1VQMS 1UJ6A 4KGVB 4QIGA 3HDSA 3L7OA 1JQGA 2L08A 3A3PB 2KJWA 1EIYB 3PTWA 3M6WA 2G1DA 4KHPF 4OQJA 2XZDB 5CHCB 2W9AA 1HHSA 4C6AA 2V8HA 2IJRA 3FKBA 2FVCA 3CW2C 4K2JA 3FGVA 5K8OA 1U09A 3CMAS 3A3OB 3GE9A 5F8LA 3WC0A 5BYRA 3OV7A 4U8VA 4K4UA 1QM9A 3KUEA 1JB0C 2CQCA 5HQLA 3OFHA 5K14A 3GPAA 3M2VB 4CLKA 3HXMA 1Y4ZB 3QJPA 4PR6A 4A8SA 3ILJA 4CZCA 4K2XA 3W60A 1Y00A 2IA6A 1NSQA 1RT4A 5LXYA 1ZTTA 5E3AA 2E66A 3MOJB 4ZCIA 3VV2B 2XZWA 1GNKA 4XTTA 2QA1A 2BJEA 3U02A 2W7OA 4KO0A 3K5NA 4R0EA 2EC0A 1B4SA 3BR8A 1PYSB 1E6VA 4ZCMA 3GG1A 5K5MA 2QN6B 3W63A 3KXDA 2UVVA 1TK5A 1U24A 2I38A 1Q8KA 4JI2J 3GTYX 5LSOA 3PFOA 2WVCA 4N41A 4CLUA 1LWCB 4IH5A 3VAJA 3A3NB 2HQFA 3RAQA 5DDOC 3DDIA 1BD6A 1LWFB 2QG9B 1DLOA 3GILA 4QW8A 3V6DB 4KKOA 5D4LA 5KFNA 1S1UB 1YRXA 2A0FB 4JI4J 2VQFF 6FD1A 2CQ0A 2CNKB 4H4KC 2ALYB 2XI3A 2OUGA 3N5FA 2IFXA 1NK5A 2KL8A 4U7UK 1P27B 2CQ3A 2ZKTA 4FNIA 4K5SA 1B7YB 2F8EX 4NA2A 3CCES 1X5TA 4WIQA 3OR2B 5E33A 5SUHA 4FS2A 3IS9B 3ILLA 4DPOA 2V50A 2RF2B 2JX2A 2OFHX 3BH6B 4AQYJ 2DK2A 1F9HA 4IOAQ 2CQ4A 2AHOB 1SQGA 4PWDA 1FDBA 4LFBJ 4BHQA 2EC2A 2QZ8A 1NDKA 2GGPB 1XMBA 2HQ3A 3R9LA 2ZH6A 1TL3B 1WDDA 4J9MA 1N56A 3QWUA 4RWWA 4DL6A 3TX0A 1FD8A 4NA3A 1RWUA 1J5OB 2LXIA 4NRUA 3HFZB 1SUQB 3AB4B 3NOCA 2HZCA 1NJIT 1WF0A 3MZIA 3OTOF 5EGYA 1L3TA 1G6BA 5KOWA 3TW0A 3ZO7A 1KVKA 4LUBA 4HKQA 2UP1A 4V19X 4DZ6A 5A8KA 4UF4A 4MIBA 1OY9A 2XNQA 3O44A 3M2RA 4YHHF 4RR5A 3I0RA 3MAQA 3G82A 1HNWJ 2DRDA 4X62J 2CG8A 1WG4A 2LKZA 4A8WA 2HS0A 2RRNA 2MZSA 1X4BA 2FIUA 4E2FB 5BYQA 3DM2B 1T05B 2GIRA 1CPZA 2EG2A 1UZHA 1VQKS 4EYHB 4Z2XA 2DH9A 3KYLA 2RH3A 4IG3A 2VZ9A 3TNVA 3DHWC 4MKYA 4QR0A 2DO0A 4X2BA 2YH0A 3PZPA 2VQEJ 3QIPA 2R2SA 4FP9A 3D2WA 2IC3B 5KFRA 3QFHA 4DQIA 3LP2B 5ITHA 2CNNB 5H9EJ 4K4WA 1NRKA 1LEOA 5DGBA 3TRGA 2LFVA 1Z2LA 1IKWB 1UVJA 4CNYA 4P2SA 2VPXB 3OFFA 2XO7A 3IAM9 2B4OA 3TJ8A 3J7YI 2Q6BA 5L1IA 5ETSA 1AFJA 5ETKA 4JI6J 1U1RA 2ZOGA 4ED5A 2EFGA 3ET6B 5HN0A 2QX0A 4DU7A 4K4ZA 4QYZK 4Y2KA 2HNZB 3R3TA 3SSSA 3M9MB 1EB0A 3WZ0A 2YQ1A 2E1PA 5EHHA 3MM6A 4USKA 3W8PA 4QIEA 4WKYA 3BH7B 4RW6A 4QPXA 3PX6A 4B3RF 3MCNA 2RUGA 2DR5A 3PNIA 1HMVB 2CQ1A 5AT1B 5A2QY 3NNAA 4HT7A 2QMWA 2C3YA 1JLQB 4LSLA 3QMQA 3QPIA 1GAOA 3EYZA 3VAKA 1EJ7L 1WSVA 4HH0A 3KLIB 3F41A 2DGSA 4KH0B 4XO0A 1EARA 1NH8A 4P2XA 3RU0A 3D4JA 2MKKA 3HZEA 3ONQA 2OPSB 3PEHA 1C1BB 4F25A 4WF9Q 2K1RA 4XPEA 2NQPA 3BKTA 1VLOA 3K5MA 1JLFB 3SSQA 1KFSA 2V9WA 3C46A 2IVYA 3HHEA 1YK9A 2QSWA 3ZNJ1 3KK1A 4JI3J 1D0EA 5KFWA 3G8TA 2BZ2A 4USVA 3DXSX 2ZH1A 1HWLA 2MKCA 1Q7YT 2XEXA 4P7VA 2DHHA 4C2MA 3CT9A 4QBUA 3I55S 3N6NA 3LWLA 4DCOB 4KQZA 4Q43A 1C0UB 3MM5A 4OI6A 1Y5NB 1OPIA 4Q7AA 3ITHB 3I32A 1U6ZA 1CQNA 3QRQA 4LQ9A 4J9SA 2NR0A 2ATLA 2M5YA 3KLHB 4C8MA 1R31A 4A8FA 1JLEB 1FJCA 2HQIA 3RG6A 3VGTA 2KB2A 3PG9A 1T9XA 3N5BA 4DS4A 1K0TA 4M5JA 1QTMA 3G4SS 3QSIA 1U6BA 1JLAB 3DLEA 4WYLA 1U1LA 1VQOS 3US5A 1FFSB 1TL5A 3HD1A 1UWAA 3M32A 4LF4J 3I9ZA 5DRKA 2WRMA 5IM0A 3OW2R 5KFDA 2BRKA 1BWVA 1VK3A 2B8QA 2VHGA 4GC6A 1NZAA 1SL2A 1ZS6A 1MN7A 4BC7A 3J7YU 5LMUF 1WHXA 5T7LB 3KLGB 2V4QA 1SCJB 2E7WA 3N6LA 4ZIWA 3L7PA 2AX1A 2MQQA 4YQWA 4L6V3 3KNAA 4F0MA 2G2OA 4DX5A 4KGMA 5AXMA 4OYWA 5L1KA 5FD1A 1TKZB 1WELA 3LF0A 2M9KA 1IQTA 4ED3A 5J1EA 2J7WA 2R7TA 4JI0F 1T11A 5ETLA 1WEXA 1KHVA 3W62A 2KXHA 1RXOB 4M5HA 4RO0A 3O3LA 2DEJA 3K5PA 1WSRA 4ZLLA 3KUGA 3C16B 3KFWX 2BE2A 3SCJE 1DFDA 4DR7J 1JXVA 3PACA 2LU2A 2EFVA 3K58A 2YXLA 3CSKA 2AGPA 4DV4J 3G96A 1Q1KA 2HVZA 4URGA 4R25A 4CCHA 1BWEA 1TAUA 3CJSA 4WU3A 1QSLA 4OYMA 3M2UB 2LECA 4H4KA 5IT0A 4ECXA 4USWA 4WZMA 5ETNA 2AGOA 1ZM9A 4RW8A 4WFYA 2R7RA 4J91A 4J9UE 3C66A 1JLBA 4F36A 2HG4A 1RTJB 4N7TA 2V2QA 3MCMA 1W2BR 1D8ZA 2F4VF 2HHTA 2LDIA 3RBXA 4L72B 1NSPA 1Z2ZA 1S99A 3P45B 3AOBA 2PE8A 2YNFB 4OMFG 4U6PA 2LU1A 3QLHA 1I94J 3DU5A 2CADA 2DPJA 1RAFB 1UWBB 1ZAXA 2DGXA 2YWWA 2B9WA 1GXLA 4URSA 3UWTA 3H8YA 3LWMA 3IGVA 3PW5A 3T5JA 1HWJA 3B4MA 2J0QD 3IAS9 5SZTA 1BQMA 4KYZA 4ED6A 1KS2A 4OYOA 1SB6A 5HVGA 2P6TA 4M5MA 4PG5A 4QIWD 2UVUA 1MU2B 1CJVB 1EP4B 5D77A 4OHVA 4YY3J 4G3IA 3SV4A 2JFDA 2ZH4A 1GMWD 2PGCA 3HJFA 2UXBJ 1HNVA 3MMJA 3NNCA 2M7SA 4ILLA 2JWNA 4QWBA 2Z58B 3OSPA 1FE4A 2OPRB 1T03A 3CCMS 5CYMB 1T9UA 1GFWB 4JI8J 2I8EA 3D3BJ 3Q8VA 1RTHB 1LV5A 4B3TJ 3KG1A 2Y0BB 3UN5A 2YWFA 4WPAA 1Z1ZA 4R8UA 3JSYA 2QYCA 3PRBA 3TEGA 1EETA 1S77D 1B0TA 1RT2B 4NMXA 1PKUA 3DOKB 1N33F
chains in the Genus database with same CATH topology
4CLLA 2GVDB 1WC1A 1YK9A 3C16B 1WC4A 3ET6B 4USVA 1WC6A 3G82A 4USTA 1CS4B 1YBTA 5IV4A 3UVJB 4OYXA 1CJTB 4CM2A 4OYIA 4USUA 2GVZB 4WP3A 4OYOA 3MAAA 1FX2A 4CLPA 4NI2B 4WP8A 4OYMA 2QV6A 4OYAA 5D15A 1Y11A 4P2MA 1U0HA 1CJVB 4USWA 4CM0A 4OYBA 3C14A 4CLSA 5IV3A 4CLUA 4OYZA 3R5GA 1AZSB 1TL7B 3MR7A 4OYPA 1U0HB 1Y10A 5D0HA 4WP9A 2WZ1A 1CULA 3G82B 1CJKA 3C15A 1FX4A 4CLWA 3C16A 4CLFA 4CLYA 1WC3A 4OYWA 4P2FA 2BW7A 3MAAB 1CS4A 4CLKA 3UVJA 4P2XA 3C15B 1WC0A 4OZ2A 4WPAA 4NI2A 3C14B 1CJUA 1WC5A 2GVDA 1CJVA 4CLTA 4CLZA 3ET6A 5D0RA 1YBUA 5D0GA 1CJTA 4OZ3A 2W01A 5D0EA 1CULB 1AB8A 1CJUB 1AZSA 1TL7A 2GVZA 1CJKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CLL A;  2GVD B;  1WC1 A;  1YK9 A;  3C16 B;  1WC4 A;  3ET6 B;  4USV A;  1WC6 A;  3G82 A;  4UST A;  1CS4 B;  1YBT A;  5IV4 A;  3UVJ B;  4OYX A;  1CJT B;  4CM2 A;  4OYI A;  4USU A;  2GVZ B;  4WP3 A;  4OYO A;  3MAA A;  1FX2 A;  4CLP A;  4NI2 B;  4WP8 A;  4OYM A;  2QV6 A;  4OYA A;  5D15 A;  1Y11 A;  4P2M A;  1U0H A;  1CJV B;  4USW A;  4CM0 A;  4OYB A;  3C14 A;  4CLS A;  5IV3 A;  4CLU A;  4OYZ A;  3R5G A;  1AZS B;  1TL7 B;  3MR7 A;  4OYP A;  1U0H B;  1Y10 A;  5D0H A;  4WP9 A;  2WZ1 A;  1CUL A;  3G82 B;  1CJK A;  3C15 A;  1FX4 A;  4CLW A;  3C16 A;  4CLF A;  4CLY A;  1WC3 A;  4OYW A;  4P2F A;  2BW7 A;  3MAA B;  1CS4 A;  4CLK A;  3UVJ A;  4P2X A;  3C15 B;  1WC0 A;  4OZ2 A;  4WPA A;  4NI2 A;  3C14 B;  1CJU A;  1WC5 A;  2GVD A;  1CJV A;  4CLT A;  4CLZ A;  3ET6 A;  5D0R A;  1YBU A;  5D0G A;  1CJT A;  4OZ3 A;  2W01 A;  5D0E A;  1CUL B;  1AB8 A;  1CJU B;  1AZS A;  1TL7 A;  2GVZ A;  1CJK B; 
#chains in the Genus database with same CATH topology
 4HEA 9;  4Q5V A;  4A8Q A;  1WF2 A;  4I64 A;  3L95 X;  1N6Q A;  2CPJ A;  1WC6 A;  5ETT A;  3ISN C;  3ZZ0 A;  5IC6 B;  4NCB A;  2GCF A;  2JEF A;  1U1K A;  4CRJ A;  2VBZ A;  1G1X A;  2LLZ A;  2MHE A;  5DJB A;  3H2U B;  3CIM A;  2O67 A;  1U1M A;  3BEG B;  4DQR A;  2JLF A;  2OJ3 A;  4KV8 A;  3CC7 S;  3ZZP A;  3O5T B;  1ELO A;  1NKB A;  3M6U A;  3ENA A;  2WZ1 A;  2YWK A;  1QD1 A;  4OZ1 A;  4AE5 A;  1JIH A;  3FBE A;  1D9A A;  1VQ8 S;  4G6V B;  1VQ5 S;  1PJ6 A;  1RHR B;  4ZDN A;  3TX8 A;  4DCJ B;  2AV5 A;  5KT2 A;  5HAT A;  3AH6 A;  1X4E A;  2VDI A;  1C4C A;  1WNE A;  2BKO A;  4A8Y A;  2BBE A;  2A10 A;  3HHN B;  2R8K A;  1X5P A;  3EGN A;  2A6M A;  5T41 A;  4WTO B;  2ZJR Q;  2FZK B;  3TR5 A;  2B51 A;  2UU9 J;  2GHW A;  4JYA J;  1LXJ A;  1WJ9 A;  5DDR C;  1YKW A;  1JX4 A;  3IG1 B;  4RX6 A;  1P1L A;  2FJW A;  2YKM B;  4RBV A;  2HGN A;  2Z2Z A;  3MM8 B;  5E7O B;  1ZTW A;  1JLG A;  2CPF A;  4DPU A;  3MHY A;  4RUC A;  4EO6 A;  1S9G A;  3CUN A;  2FVS A;  3BRE A;  1FWK A;  3OFE A;  4ZPA A;  2V8D A;  4B9L A;  3W66 A;  2Q79 A;  2XMJ A;  4R5P B;  2KXF A;  4CYU A;  3MFH A;  3G6E S;  3KHH A;  3MEE A;  2BKN A;  2QRR A;  3TUZ C;  1HPZ A;  1U1P A;  1VRT A;  4CO5 A;  3QO9 B;  2DRA A;  3UDV A;  1OMS A;  4M5K A;  3IO1 A;  5AE2 A;  5F8G A;  1WOO A;  2P9E A;  4NXN F;  4KJI A;  2J5A A;  5J2M A;  2B4U A;  2PO4 A;  5FII A;  3UO0 A;  1KSP A;  2NUH A;  1U45 A;  2H5I B;  1CUL B;  1PC4 A;  1NJY A;  3ULH A;  3AFG A;  3POT A;  4M5D A;  2AW0 A;  2CWX A;  3M05 A;  4O3N A;  1V5I B;  4ETX A;  3L3C A;  3M30 A;  1RHU B;  1YLX A;  2YKQ A;  4B3S J;  2X1G A;  1UFL A;  4UUX A;  3H98 A;  3IC1 A;  3RTV A;  3GB0 A;  1S6P B;  2MQP A;  4O3O A;  5GME A;  5B08 A;  1OIA A;  3PRV A;  5IFM A;  3RW7 A;  4IH7 A;  2WB4 A;  1NDC A;  1JLC A;  1Y3J A;  2VG7 A;  1Y10 A;  1JJ4 A;  2FLN A;  4ZPD A;  1JJ2 R;  1X9W A;  5GVQ A;  2HVD A;  2MXY A;  1FX4 A;  1KTQ A;  3OL7 A;  5L38 A;  1CLF A;  3QGP A;  3E01 A;  4DQQ A;  3C6T A;  4DLE A;  4LSN B;  4WZQ A;  4KT0 C;  1A9N B;  1D09 B;  4FYX B;  3DOL B;  4UOF A;  4EEY A;  3I82 A;  4OX6 A;  1ZBT A;  2ERR A;  1FK9 B;  4ED4 A;  3I9V 9;  1Q78 A;  1JWW A;  2CDQ A;  1ZM2 A;  2VG6 B;  1UEU A;  4KFB A;  4HR2 A;  2HNY B;  2BAN B;  2HGL A;  5CCL A;  2VIC A;  4I67 A;  3BKU A;  2I6W A;  1CJT B;  3M6V A;  4PRF A;  4YB1 P;  5CAB A;  1PO6 A;  3QAT A;  4NLU A;  3HMJ G;  5KG1 A;  4HAC A;  3PXG a;  2DH8 A;  3EE3 A;  3R7B B;  2UUC J;  1D9F A;  4WJB A;  4CLS A;  3MFI A;  1FXL A;  1ZH5 A;  1RYR A;  5KG4 A;  4PPD A;  4DX8 H;  2LP4 A;  1F60 B;  2BE7 D;  4Q8F A;  2OFG X;  2W4D A;  4F3O A;  2A18 A;  4WE1 B;  3DYA B;  3EZ5 A;  3U1M A;  2F5G A;  2QA4 S;  4ECT A;  4F3Q A;  1V9O A;  3LP0 B;  2AJ2 A;  5ETQ A;  3GFZ A;  1YZ7 A;  1XTZ A;  3KJQ B;  2ZBR A;  5KT5 A;  3VQT A;  5D8H B;  5CYQ B;  3MWB A;  4N56 A;  4G1I A;  5KAK A;  5J2P B;  4QR1 A;  2CPZ A;  4Q0B B;  4DV3 F;  3SFG A;  2G0C A;  2GVD B;  5B0F A;  3AD8 C;  4DL2 A;  1OS5 A;  1K44 A;  4GVB B;  4B17 A;  5HLF B;  3HHD A;  1M5S A;  4DR6 J;  1GXT A;  3NAH A;  1KLM B;  4NI2 B;  5LT5 A;  2OIH A;  1TR0 A;  2ROP A;  3Q2T C;  2V8V A;  2X1B A;  3FUY A;  4QWE A;  3CCZ A;  5HP1 A;  1TV6 B;  2XMU A;  3DI6 A;  2HFS A;  5F8H A;  4ID5 B;  1S6U A;  4QOT A;  4ZP6 A;  4ZLP A;  1HR0 J;  2I0X A;  1B70 B;  2CPX A;  2QGF B;  2ZBI A;  4ZS6 A;  3M8R A;  3T9N A;  1R3N A;  1P6T A;  4AT1 B;  1XR5 A;  1MWZ A;  2AIR B;  1HBN B;  2N3O A;  4C3M A;  4B9U A;  1RT6 B;  3RR7 A;  3N01 A;  3EGZ A;  3W64 A;  1TL7 A;  4DOZ A;  3H20 A;  5AE3 A;  1P1T A;  3THV A;  3AXK A;  2J9D A;  3AOD A;  1L3S A;  1HBO B;  1LKZ A;  1OQ6 A;  3H5Y A;  1C0T B;  2RJZ A;  1RT3 B;  2BE9 B;  2HND B;  4MAK A;  3NAI A;  2C3M A;  4O4G A;  4EBE A;  2FHM A;  5CQG A;  5F0U A;  2DJW A;  3SI8 A;  2V4R A;  4V19 J;  4ED0 A;  1IBM F;  1HWI A;  2LDY A;  4J5O A;  5IC4 B;  2C28 A;  2NZ4 A;  1A7G E;  4LFC F;  1RUS A;  2AJQ A;  2XMV A;  1HI0 P;  3TO8 A;  2CAJ A;  4LRF A;  1EHW A;  2I5J A;  2JLE A;  2W4P A;  4DR3 J;  4P2F A;  3OL9 A;  3Q22 A;  3GON A;  2C2R A;  5BYS A;  3MED A;  5JVH Q;  4JV2 A;  4QU7 A;  1JKH A;  3BJY A;  3KJV B;  1CSJ A;  4QWA A;  2G0J A;  1VRU B;  2CVE A;  2K2P A;  4UOH A;  4KHP J;  2C2N A;  1LWE A;  4WTY A;  2FYX A;  2RT3 A;  3BGO P;  1VQ7 S;  2OKQ A;  1DJ0 A;  2RDI A;  3BN4 A;  3WX4 A;  3R97 A;  3CO0 P;  3TAM A;  1TUG B;  4DL5 A;  5HQM A;  1K1Q A;  1HLW A;  2HK3 A;  4DMZ A;  1RT1 B;  1M1K T;  4C4W A;  3O6Q A;  4UTG A;  2AZ3 A;  2H5J B;  4ZN1 A;  2Z2Y B;  2YNI B;  2B3T B;  3AB2 B;  3E8O A;  2J6T A;  1N0V C;  3GYN A;  1NZ8 A;  4PUO A;  3GIK A;  3CJR A;  4WFN Q;  1BC6 A;  5J2Q B;  3U27 A;  2DNY A;  4I6A A;  2VA2 A;  4PKD B;  3CXC R;  1B99 A;  3V5R A;  3IRX B;  1OWX A;  3CB4 A;  1H38 A;  1NCL A;  2CJ9 A;  2HAI A;  2M8D B;  3M4X A;  1FWP A;  2IMW P;  1NK6 A;  1IKV B;  1DZ5 A;  4IG0 B;  4CLF A;  2PMZ D;  1YSJ A;  2KVQ E;  4YN3 B;  2JC0 A;  1S10 A;  2XSJ B;  1H72 C;  4PXD A;  2ZUG A;  4OJ1 A;  3HO1 A;  3DRS B;  3OXG A;  2B9X A;  2HQC A;  5CA5 A;  2RU3 A;  3FQL A;  2IHR 1;  3C6U B;  4DUZ F;  2J9E A;  1F2H A;  4F2S A;  4JI5 J;  3LP1 B;  3MPU B;  3HVW A;  2QTW A;  2OP5 A;  2ZVS A;  4A46 A;  2EEY A;  3MMC B;  3TP2 A;  4YDX A;  5F8J A;  2QEX S;  4F4Y A;  2NPF A;  1ZYQ A;  3PYD A;  4EI2 A;  2FQQ B;  3NBP B;  2DTJ A;  3NEK A;  2EKN A;  2YKN B;  4M63 A;  4X64 F;  1TL1 A;  3KK2 A;  3MEC B;  2DHG A;  2C3O A;  4TYB A;  2DNZ A;  2ADC A;  3R2D J;  1I6J A;  3DGV A;  4L3N A;  4F0H A;  4DEZ A;  2GNK A;  3D1O A;  3QT5 A;  4NEZ A;  3UN3 A;  3JQJ A;  4DV0 F;  3U7J A;  3IN5 A;  2DGQ A;  5MLC V;  3LAL A;  1FO1 A;  2D41 A;  1JXE A;  2ILY A;  3RYL A;  3T41 A;  3OHB A;  5L1J A;  3E3X A;  3VZH A;  2DGV A;  2OO4 A;  5LM7 E;  2OAU A;  2ALZ A;  1UVN A;  4X4V A;  3D5M A;  2L9D A;  1L5U A;  5K14 B;  1RWW B;  3R5C A;  2EK1 A;  5FDL A;  2HSE B;  1UPP A;  1OYE A;  2JHE A;  3FK4 A;  1WG5 A;  2FHJ A;  2KHC A;  3CJ8 A;  1U6F A;  1RT4 B;  2H48 B;  4UUW A;  1UJ4 A;  2JC1 A;  5EWF A;  4I69 A;  4C9D A;  5KFZ A;  1KVJ A;  3VF0 B;  3FEY B;  3N6M A;  5M2R A;  2H1Y A;  4KO0 B;  1U0H B;  4K4S A;  3D67 A;  3OTO J;  4MFB B;  4A8X A;  1EKR A;  2CQG A;  5KFG A;  1E6V B;  2NXU A;  3DC2 A;  3CCW A;  1HQE A;  5J1P A;  2F8H A;  2FHK A;  4K59 A;  3IXQ A;  3T1A A;  1A6L A;  3NMR A;  4YHH J;  2B56 A;  2KM8 C;  3DLK A;  5F41 A;  1B0P A;  5A6P A;  3IGN A;  1WOP A;  1H0H B;  4DV1 F;  2AKW B;  2BXJ A;  2EG1 A;  4I7F A;  3MEG A;  3N9U C;  4K4Y A;  4QU6 A;  2PMW A;  2EFO A;  1DLO B;  2FJD B;  4DQS A;  1Q7L B;  2OI2 A;  5GAH I;  4J9R A;  4AXJ A;  3BZQ A;  2XG8 A;  1SH3 A;  1HYS A;  2WK4 A;  4M5I A;  1F1B B;  2H4W B;  1RHQ B;  3DLG A;  2RIL A;  4USH A;  3L7U A;  3DNC A;  1AW0 A;  2BVZ A;  3TVY A;  3ZXW A;  3B4D A;  1OPZ A;  2HHH F;  2R2U A;  2V5H G;  2J9C A;  2K7K A;  1N36 F;  1SC4 B;  4OHY A;  4OZ0 A;  4M94 A;  4USJ C;  2OEL A;  4EYI B;  1JXL A;  3MR7 A;  3SIP B;  1AFI A;  3RB3 A;  4BDP A;  4IRC A;  1E6Y A;  1VBY A;  2QL7 B;  5KOX A;  1RAD B;  1TMM A;  5B09 A;  3LH2 S;  3L9Z A;  1LW0 A;  1N34 J;  2OHD A;  4ENO A;  2FC8 A;  2UZA A;  3KK3 A;  3M8P A;  1VQY A;  1WC5 A;  1Q4R A;  5KFK A;  4PWD B;  4FYD A;  1WF1 A;  2RML A;  5KT6 A;  4PG6 A;  5K8N A;  4ES3 A;  3K8V A;  1KQG B;  2JEJ A;  4F4K A;  4B02 A;  5GAG I;  3WDO A;  4X4N A;  4DV5 F;  2NXC A;  3CJ0 A;  3H5S A;  5E3R A;  1Q8I A;  5IWA F;  4B3R J;  2W7A A;  4PQU B;  3NMA A;  1VQ6 S;  4EBD A;  3GJQ B;  2EWH A;  2JEI A;  2F9J A;  1VYA A;  3FFI A;  3Q8Q B;  4ZHR A;  3GIJ A;  3GQC A;  2N4D A;  4H4O A;  1K0V A;  4GKK F;  1FJE B;  1SQF A;  1VQS A;  3HJV A;  1BQX A;  1HWK A;  1S48 A;  3RB4 A;  3BGF A;  5A8K B;  2KZZ A;  2YX4 A;  4PWU A;  4Y28 C;  1L3U A;  3CD7 A;  3I0R B;  4RW7 B;  1U2C A;  3QBC A;  1MG7 A;  4RW9 B;  3G82 B;  5KFQ A;  2W25 A;  1WC3 A;  5C2G A;  2XCA A;  1GMW A;  1CS4 A;  2EI5 A;  1KOO A;  2H4Y B;  4RU9 A;  4TNO A;  3TUI C;  4KHR A;  4F7V A;  1FES A;  2DNQ A;  3CC2 S;  4O0N A;  1RT5 A;  1I3O B;  4XIU A;  3D28 A;  2CQ2 A;  4HHJ A;  2HBQ B;  3LTO A;  2D9O A;  3KHR A;  2MZQ A;  1VFJ A;  2WB1 D;  3PX4 A;  4WKR A;  1N32 F;  5KFV A;  1YBA A;  4UOC A;  5IXU A;  3R6L B;  5I42 A;  2BV3 A;  2BKP A;  3L4B C;  3TZZ A;  4FF2 A;  3C14 A;  1IBK F;  3BF4 A;  1F9E B;  5DM7 Q;  4DFM A;  5K20 B;  2E1C A;  1S6Q A;  1FDA A;  3TAR A;  2Y1L B;  4KGK A;  3UDL A;  1GQE A;  4ZK7 M;  2L9N A;  4ED2 A;  4DPX A;  4OI4 A;  1CJK A;  1HQ2 A;  3RW6 A;  1DAX A;  1RWX B;  2OGU A;  1WEY A;  3Q8P B;  1DTT A;  4B08 A;  3PR4 A;  5DQG A;  3HVR A;  1FCA A;  2HHW A;  1FKO B;  3MM6 B;  3MUR P;  3I87 A;  1D8Y A;  2DHX A;  3QNW B;  2JNJ A;  2R7S A;  3TA0 A;  1VLY A;  4RW6 B;  2GQ2 A;  2MKY A;  1RHK B;  5J2N A;  1Q82 T;  2V4J A;  2YX7 A;  5HJY A;  2DR7 A;  4KGX B;  1JNZ B;  4P71 A;  5U47 A;  1VQ4 S;  1CJU B;  2VPW B;  5EX0 A;  4LSL B;  3K5L A;  2BR0 A;  5F9L A;  2CQB A;  4WCE Q;  4J9P A;  1NK0 A;  2GO9 A;  5IT9 U;  2OPP B;  2EPI A;  4UY8 T;  2U1A A;  1DRZ A;  2EBE A;  3DRY A;  4J9K A;  2DHS A;  1R8C A;  4RL1 A;  3Q8S B;  4LF6 J;  3CCS S;  4QWD A;  4C3L A;  2CWK A;  4ZVG A;  4NLO A;  5LMN F;  1WDT A;  5GAG U;  3JSM A;  2ZHO A;  5E2Q A;  2KJV A;  3KK1 B;  3M2V A;  5K8M A;  1DQ8 A;  2VKR A;  2NRE A;  4X65 F;  3ETM A;  3DDK A;  4EZ9 A;  3H5U A;  3D66 A;  2AQ4 A;  1N8R T;  3HZG A;  4NLV A;  1BQN A;  3HM9 A;  1N5S A;  1IBL F;  2PN6 A;  3MM5 B;  3PIP Q;  1NLK L;  3GV7 B;  2LVW A;  2F63 A;  4MMO A;  2Y1R I;  1EKS A;  5L9X A;  2DD8 S;  3CMQ A;  3DDN A;  4I56 A;  3KG0 A;  1VDH A;  1B0V A;  5B0E A;  1X5S A;  2QLF B;  1F2G A;  3G8S A;  2BRL A;  2HRU A;  3CC4 S;  2WTF A;  5DZ6 A;  4HVZ A;  2H51 B;  4QIV A;  1YX2 A;  1SIW B;  4LF2 A;  3WHI A;  3D6H B;  2CJK A;  4JV5 F;  4Q44 A;  4QIF A;  1S79 A;  2CQP A;  4AXI A;  2F4V J;  1TFW A;  4DG1 A;  2ZVI A;  4H4M B;  2MMY A;  3M9O B;  4O44 A;  3V6D A;  2LQB A;  1FNO A;  3M32 B;  1S1U A;  4Q45 A;  1OSC A;  3T1H F;  2RAQ A;  3TWZ A;  3TAP A;  1PJ7 A;  1ZPV A;  2YPY A;  3BGL A;  2WBM A;  4Y0F A;  2D3O R;  3IBF B;  3RRH A;  3NGR A;  1TEL A;  5FLX U;  2XLI A;  1Y5I B;  1T3O A;  3SZ2 A;  2CKW A;  3BDE A;  3FNN A;  2IDE A;  2H65 B;  5A8R A;  2A3J A;  1YBU A;  1R8B A;  4YR3 A;  1W7W A;  1T8E A;  2F1F A;  2LCW A;  3IS9 A;  2XS2 A;  2RF2 A;  1UTA A;  2J0X A;  4J9L A;  4GRS A;  4NEY A;  3I31 A;  3ZZR A;  2E29 A;  1K73 T;  4A8O A;  4HH1 A;  1UW4 A;  3RB0 A;  3AOA A;  3BO3 A;  3FSX A;  1VS3 A;  5IV3 A;  1XQI A;  2MZR A;  2W24 A;  4C97 A;  1NUE A;  2OTJ S;  1RAE B;  2BE2 B;  3AD9 C;  2KDO A;  3GIM A;  3BQ0 A;  1HBU A;  4ZMM A;  3J7Z T;  5F3Z A;  2O5D A;  3QGI A;  4CO1 A;  4DR5 F;  2NYH A;  2HK2 A;  4K50 A;  4F3M A;  1N33 J;  2VB6 A;  3R6G B;  4WK3 A;  3T6B A;  3SFU A;  4RW8 B;  2DXE A;  3JAM U;  3QQC D;  1VBX A;  3M7V A;  2MQN A;  3CJQ A;  1JLB B;  5KFS A;  1RT7 B;  2FTR A;  1VIS A;  2B4P A;  2LA6 A;  2OD6 A;  2XC9 A;  5THW A;  1RB0 A;  2OH2 A;  8RUC A;  4W90 B;  1GX6 A;  2GX8 A;  4WFZ A;  5ETV A;  2PFD A;  3DM2 A;  4TY9 A;  3UW1 A;  2XS7 A;  2KO1 A;  4AD6 A;  1T05 A;  2RVJ A;  2CNL B;  2HBR B;  2FUG 9;  2RHQ B;  2RDD A;  3NCR A;  4X4T A;  4FYW B;  2IJF A;  3OLA A;  4K7Q A;  2F3J A;  4OHX A;  3LOU A;  3QLH B;  2XHC A;  2J8S A;  2GW8 A;  4BLG A;  4MKA A;  2KZM A;  1IKX B;  3JSR A;  3AA8 A;  2IC3 A;  4ELV A;  2G2Y A;  2NYI A;  2OLW A;  3GU0 A;  4WP9 A;  3ELH A;  4CTA B;  5A8W A;  1H2T Z;  1DY3 A;  3OHA A;  2LQ8 A;  5D4N A;  4RU2 A;  1BQM B;  4OX9 F;  4IFY A;  1NAQ A;  2HIQ A;  2VFR A;  2WVD A;  3LO3 A;  3LUY A;  4DN0 A;  3M8Z A;  3R5D A;  3VAL A;  4JV0 A;  2AX0 A;  4WII A;  3FMW A;  5LJ5 Y;  2VG5 A;  4J9V A;  3MUT P;  3ET6 A;  5M2P A;  5ETM A;  4LF7 F;  5D0G A;  2HNZ A;  4MYU A;  4G1Q B;  4F04 B;  4G1P A;  1T03 B;  2E5L J;  4Y2I A;  3OTB A;  4ZP9 A;  3M8Q A;  3KOA A;  2MDA A;  1IQZ A;  2AJ1 A;  3MR3 A;  4UW2 A;  3EX7 B;  5D4O A;  4ZVH A;  3K7R A;  5BR8 J;  4M5G A;  1IVZ A;  3SEO A;  4F4W A;  1YJU A;  1TKX A;  4PYA A;  4CT8 A;  4LBI A;  2QL9 B;  2V67 A;  4R8U B;  4ECZ A;  4PXC A;  1WOS A;  3D7S B;  1RDR A;  2MLZ A;  1EET B;  4DDF A;  1AUD A;  5AXN A;  4MYT A;  1M5K C;  1UP1 A;  1IM4 A;  5CYJ A;  1KKH A;  2UUW A;  5C42 B;  2H9Z A;  4WXW A;  5A6W A;  2KXN B;  2ASD A;  2D69 A;  3OL6 A;  4O4R A;  1N5Y B;  3HPO A;  4HDH A;  2PII A;  2QLW A;  4NXN J;  1N6Q B;  2R8I A;  1H7X A;  4KPY A;  3AJ1 A;  3IM8 A;  2L3M A;  3G8Q A;  3TZX A;  3J80 Y;  5HQ8 A;  2V2K A;  1HNW F;  1VMB A;  4DL7 A;  1QJH A;  1RI7 A;  4ELT A;  7FD1 A;  2V63 A;  1WG1 A;  2MLY A;  4K4T A;  2MZJ A;  2CJY B;  4KAI A;  4K0K F;  4NPO A;  4ELU A;  2NCK L;  2OPQ B;  3JXO A;  3LGN A;  4IO1 A;  2C42 A;  1PBU A;  2V34 A;  4LF5 J;  1WEZ A;  4NLQ A;  3RRK A;  2I1R A;  1PYO B;  1S9F A;  2VC0 A;  3CDA A;  2FLO A;  1AUS L;  4OYX A;  3RBD A;  2M88 A;  1U8W A;  5F8I A;  3MCO A;  5E3C A;  2VU5 A;  1FI4 A;  1U26 A;  4DR1 F;  1HA1 A;  4LJM A;  1SJF A;  1HKA A;  3GV5 B;  2VA3 A;  2RS8 A;  1GMU A;  2IVM A;  5GAD U;  1MNE A;  4GO7 X;  3JTO A;  4FXD A;  2AJF E;  4DV6 F;  1ARO P;  2KG1 A;  1OQ3 A;  3AY0 A;  3CJ4 A;  4LMZ A;  3UR0 A;  5KG7 A;  2HZV A;  5E41 A;  3LW5 C;  2B7C B;  3CJK A;  1PYT A;  2HMI B;  2OSQ A;  1S9G B;  2N3L A;  1NSK L;  4Y2A A;  5B7W A;  2VC1 A;  4P6Q A;  1FA0 A;  4CT9 A;  1SVD A;  3W65 A;  4AUK A;  1O6X A;  4CO4 A;  1QY7 A;  5HRO B;  2RQK A;  3CPW R;  2RD5 C;  4I2P A;  2KYX A;  1HPZ B;  3W9J A;  2D9P A;  1ULR A;  2P9C A;  3EGW B;  5LOQ A;  2B6A A;  3FCH A;  2K3K A;  3RR8 A;  3H0P A;  5IV4 A;  5KFM A;  1WTB A;  4WFB Q;  2GS8 A;  1RAJ A;  5T7L A;  3MR2 A;  4ZPW R;  5J2M B;  3D3C J;  4ZVQ B;  4CM0 A;  4FKX A;  6AT1 B;  3KWM A;  2AEM A;  1WI8 A;  3W61 A;  4AYB D;  2CJX B;  2OEJ A;  4DX7 A;  3POT B;  4M5D B;  3BPS P;  2ATC B;  4MTP A;  2O3D A;  1FTR A;  3IR7 B;  4JI3 F;  3M30 B;  4UQG A;  1R0A B;  3D6F B;  2HQD A;  4DV3 J;  2LQ9 A;  2XWY A;  2RU9 A;  3MDF A;  2XYH B;  3UFC X;  8AT1 B;  1YHQ S;  2KI2 A;  4J9N A;  3F44 A;  5KFO A;  5ETO A;  3V81 A;  4DFK A;  4V1A k;  2BOA A;  1XK8 A;  4E0D A;  4N47 A;  1JLC B;  1IBC B;  2VG7 B;  2WHO A;  5AJ3 J;  1IR0 A;  1UFK A;  4C48 A;  3NP5 A;  3M8Y A;  2ZE2 A;  5LJ3 Y;  3NNH A;  4IRK A;  1SIZ A;  2HFZ A;  2J0S D;  2E5J A;  2K8G A;  4NLW A;  5E3P A;  1UA1 A;  4DN9 A;  2X1F A;  5D6G A;  1IKY B;  4X84 A;  2FLP A;  2FC9 A;  1RTJ A;  3BS9 A;  1WTF A;  2EW9 A;  5JXS A;  5LL6 d;  4OYZ A;  2Z30 B;  1F9F A;  3KMQ A;  4NOH A;  1HD1 A;  5H9F K;  4KFB B;  1BMQ B;  3LGH A;  1XMO J;  1M5O C;  2MKJ A;  4O3S A;  2YNF A;  3HX9 A;  2XBP A;  1X4D A;  2GV1 A;  4KIA A;  2DCU B;  2MY7 A;  1U2R A;  1HNX F;  1NPR A;  3X3U A;  4HAC B;  1ZAV A;  5B0B A;  4O3R A;  2VBW A;  5C7P A;  3IWL A;  1UWB A;  3L09 A;  3SMZ A;  4AFF A;  1XEZ A;  4ZJQ A;  3V6H A;  2IPO B;  5JMN A;  3B54 A;  3EPI A;  1RA7 A;  1IBM J;  4NLT A;  3M8S A;  3H2V E;  3V6J A;  2KTQ A;  2OD4 A;  2BQR A;  1YJT A;  2R42 A;  2CQH A;  4LFC J;  4YME A;  1MU2 A;  3GFY A;  5AXK A;  4ZVR B;  3ZTQ A;  2CQI A;  2PEB A;  3PX0 A;  4GC7 A;  3VQS A;  3IR5 B;  4P73 A;  3KLE A;  1TKD A;  1U1Q A;  3OD2 A;  3OQ2 A;  1X9M A;  2MQL A;  2IBK A;  3QAE A;  1HFE L;  1SJ4 P;  2QMX A;  2EK6 A;  3RAX A;  2IM3 A;  1MW7 A;  1FDN A;  2ZOM A;  1S57 A;  5I3U B;  1RCO B;  1NB7 A;  1G2E A;  1ZM4 A;  3UPF A;  2WW4 A;  2R2R A;  3B8H A;  4Y2M A;  1RWK B;  3CVK A;  1FJG F;  3H4D A;  2HWI A;  1MML A;  3DOK A;  2GIF A;  3H59 A;  4C11 A;  3W2W A;  1UEK A;  1U47 A;  2HW3 A;  5CZX A;  5C25 B;  3G2X A;  4J7C A;  4WXO A;  4ZCL A;  3DOM B;  4OHW A;  4UY8 5;  3PO4 A;  2ZC4 A;  3MM9 B;  5DET A;  2B43 A;  5D3G A;  3M1V A;  3W5Y A;  5C24 B;  1NDL A;  1ZAW A;  3D6M B;  1VC6 A;  1V3R A;  3LAN A;  2BUN A;  2XMK A;  2HQG A;  1RA6 A;  1X4F A;  2QYG A;  2YKO A;  4WP8 A;  5EX3 A;  2IM0 A;  1SI9 A;  1W26 A;  1N54 B;  4NLG A;  4NLR A;  4DU8 A;  2DGW A;  5DLF A;  4DFP A;  1S1W A;  1YJW S;  2V94 A;  1TL7 B;  3T9Z A;  2E1M C;  1OY6 A;  1X0F A;  3TJ9 A;  4ITS A;  2R7W A;  1GTE A;  1YVF A;  4L73 A;  2RQC A;  4DUZ J;  5CXT A;  4CP5 A;  3T5L A;  2B9E A;  5KFX A;  1KQS R;  2NZC A;  4MIW A;  1NB2 A;  3P49 B;  1FF2 A;  2MZT A;  2C3U A;  2KT5 A;  2VL1 A;  4NYZ A;  4W98 A;  2COL A;  1UVI A;  2VJV A;  4ER8 A;  4PWW A;  2CJA A;  2RS2 A;  5F8N A;  4I2Q A;  3OR1 A;  5KFF A;  2I5J B;  3TQ1 A;  4PAB A;  1NHV A;  4DS5 A;  5IT9 Y;  3CDB A;  4X64 J;  3DHX A;  4YS2 A;  4FDF A;  2L9W A;  3HF5 A;  1RU1 A;  5H1S V;  1FNM A;  2WCX A;  1HQU A;  4P75 A;  4KTQ A;  3TA1 A;  6FDR A;  4F2R A;  5L46 A;  3EVW A;  1LWE B;  2XMM A;  3BDP A;  4AL5 A;  2RKI B;  1Q5Y A;  5DQI A;  2E1A A;  4MT1 A;  3HHL C;  3TAM B;  3P5B P;  2DR6 A;  4KPC A;  1KC8 T;  5A76 A;  2IY5 B;  5DG8 A;  3QZ8 A;  1GEH A;  3MF5 A;  1K1S A;  5A2Q U;  4NL5 A;  3F73 A;  4PUO B;  2KFN A;  4RNH A;  4PG4 A;  1LW2 A;  1MSW D;  2IA0 A;  2LYV A;  1NME B;  1YGY A;  2QC3 A;  1SC3 B;  3PRD A;  1SKS A;  4OZL A;  3IBC B;  8ATC B;  1V5V A;  3OXF A;  3RZA A;  3ADA C;  2W9C B;  4CLL A;  3QSY B;  2KRR A;  4TQS A;  1SC6 A;  2B8P A;  1U02 A;  3PYG A;  1S6P A;  4KGZ B;  4KC5 A;  4LT6 A;  3EZO A;  3AD7 C;  3EDR B;  2IYI A;  4MK7 A;  1CBK A;  3ETO A;  3WBZ A;  3IMQ J;  3Q89 A;  2NUU G;  1IR1 A;  1OY8 A;  4HI1 A;  1T9T A;  3J7Z 5;  2ZJQ Q;  2DBB A;  1PAU B;  1LK7 A;  4ANC A;  2ZM6 J;  3RJM B;  2UV8 G;  3PR5 B;  2HBZ B;  4HTI A;  3PW4 A;  3GV8 B;  1FK9 A;  2ABY A;  5K9F A;  3ENQ A;  2VG6 A;  4P74 A;  4I6W A;  2W4C A;  2BAN A;  1RIS A;  1YJ7 A;  3IWX A;  2UUB J;  1TL1 B;  3UD5 A;  1NXI A;  3N79 A;  3DRR B;  2CUY A;  1CJT A;  2NPI A;  4IOC Q;  4B9S A;  2RQM A;  4PXE A;  2HHH J;  1C2P A;  3OBI A;  2JFK A;  3WX8 A;  4YB5 A;  1VK8 A;  5HMZ A;  2DY1 A;  3QRP A;  3AQP A;  2JJ4 D;  1S1V A;  3TA2 A;  4CNZ A;  1Q86 T;  2IMO A;  1R27 B;  2EFQ A;  3OTE A;  2D3U A;  3JTN A;  2AP6 A;  3HHK A;  2V2V A;  5HBM A;  4PZV A;  2MQ8 A;  1Q5V A;  4EU0 A;  1FRJ A;  5KG3 A;  5HMX A;  1KRP A;  3DYA A;  2HZA A;  2W1B A;  2V8P A;  2ILZ A;  2MYF A;  5HVH A;  2IRX A;  3Q8R B;  3WC2 A;  1U0S A;  5CYQ A;  2YPZ A;  3UVJ A;  2WVB A;  2GJF A;  3D54 A;  4DV5 J;  5J2P A;  2VIH A;  5IWA J;  3GII A;  2F65 A;  4Q0B A;  1H74 A;  1KHW A;  2GVD A;  1XWL A;  4JB8 B;  3QGG A;  4GVB A;  2IAJ A;  2E9Z A;  3PYE A;  3QT8 A;  2XY6 A;  2QT7 A;  1KLM A;  1XMQ J;  2AT1 B;  2BAB A;  3W1Y C;  3GR0 A;  4GKK J;  4OHZ A;  4QZV B;  3PW7 A;  4DV2 F;  1SL1 A;  1TV6 A;  1O0P A;  3DGP B;  3OPK A;  4OYA A;  5KFP A;  3NCP A;  1N52 B;  3HK2 A;  2P6S A;  2RQ4 A;  3O1L A;  4I7F B;  3MEG B;  1YJR A;  1HNZ J;  3OUY A;  4DR4 J;  1LNQ A;  5EDW A;  4LFA J;  4OYP A;  3U1L A;  3QID A;  3TZY A;  2HHP A;  1HYS B;  5HJX A;  3MPW A;  2D7S A;  1VQ9 S;  3DLG B;  1ZA1 B;  4ZLN A;  2BOP A;  4ICL A;  2J9D E;  3H5X A;  3CD0 A;  5DO2 A;  3C15 B;  2M52 A;  2BJ8 A;  1F5B A;  5IQQ A;  1N32 J;  3G87 A;  2XWX A;  4KH1 B;  3MXH P;  1NKE A;  1HBO A;  4Y2C A;  5T14 A;  5B0A A;  1S4F A;  5HVF A;  4OZ3 A;  1C0T A;  1ZPW X;  2DIV A;  4CWB A;  2HND A;  2VOP A;  1IXK A;  1IBK J;  4PPZ A;  3NGT A;  3UD4 P;  3VGS A;  5KFU A;  2UXC F;  1Z4U A;  2UXD F;  1U1N A;  3BYP A;  5HAN A;  2B7B B;  2XO6 A;  3A8J A;  2ZZM A;  2G2Z A;  1R0B G;  2WSE C;  4AND A;  4F02 A;  1NU4 A;  4ES2 A;  1HNI A;  1RHJ B;  2JZ5 A;  4PQA A;  2B0G A;  2QMU B;  2QLB B;  3TQE A;  1JJH A;  1HL6 A;  4EUV A;  1KBR A;  2HS4 A;  4B9N A;  1DQ9 A;  4MKB A;  1NND A;  3FCW A;  3UNY A;  3FFI B;  1OYD A;  2HWT A;  4ZHR B;  2OEM A;  1RE1 B;  4C3K A;  4DLG A;  2MQO A;  3VGU A;  1WUU A;  5AXL A;  1WOR A;  1QTN B;  3CE8 A;  4CLZ A;  1RT1 A;  2H5E A;  3HSJ A;  2XYG B;  3T1Y F;  3FBC A;  2GA7 A;  3RAM A;  4E98 A;  4WWS A;  2NSC A;  1S12 A;  2W8L A;  4TY8 A;  4ECW A;  1CS4 B;  2CQD A;  1HR0 F;  5J2Q A;  4DPY A;  4LBH A;  4EWT A;  2I9S A;  4X65 J;  1HAR A;  3IRX A;  4OV1 A;  1VC0 A;  4ZKA A;  4ATN A;  5HL7 Q;  1IBL J;  2AMC B;  1PIL A;  3GZ7 A;  2YTC A;  2ZDO A;  3MMA B;  1QSY A;  2XLK A;  2YH1 A;  4IFV A;  3FZB A;  4NXM F;  4RBT A;  1S9E A;  4ZVU B;  4EZ6 A;  2YBV A;  2JVO A;  1XNR F;  5I42 B;  3TI0 A;  4RW4 B;  1K9M T;  4C8O A;  3BGR A;  1S72 S;  2CFX A;  2ZNY A;  9ATC B;  4X4O A;  3V4I A;  1QUP A;  2KFZ A;  3C14 B;  2YNH A;  3GIR A;  2AYB A;  2L48 A;  4LIW A;  3EXC X;  2CA9 A;  4C0B A;  1TUW A;  4WFA Q;  3BSC A;  3NWG A;  1M5V C;  1L3K A;  3VAH A;  3KDN A;  3HHL A;  3ZTS A;  1CJK B;  1YQH A;  4J90 A;  4WBF A;  4JI1 J;  4WYW A;  1Q0N A;  1T9V A;  3NG8 A;  4ZPC A;  2Z57 B;  3S8S A;  3NBP A;  3RBE A;  3TUJ C;  3ZC4 A;  4WP3 A;  2YKN A;  4CLP A;  2KT2 A;  5J2N B;  3HT3 A;  3GJS B;  1JK9 B;  2P8I A;  3CME S;  4WU2 A;  1TAQ A;  2V4J B;  1YRU A;  3RGI A;  4WFX A;  4G65 A;  3R5G A;  1KEK A;  4OI1 A;  1JJC B;  3BR9 A;  4ILM A;  4YB6 A;  4QWC A;  2NSB A;  3IM9 A;  2OTL S;  1KQK A;  3MI7 X;  3MMB A;  2X3D A;  1MRO A;  3V2U C;  4Q2M A;  1FTC A;  4LF1 A;  5I3Q A;  4KRW A;  1R7I A;  3CTR A;  4LQ3 A;  2C3P A;  2QA2 A;  1FRH A;  3JSM B;  4M8L A;  1RTD A;  4KY3 A;  4NAS A;  2FY8 A;  5HMW A;  4JI7 F;  4HT5 A;  4Y3C A;  1WWH A;  3A8I A;  3K17 A;  5CH7 B;  2UUA F;  4YFU A;  1HHQ A;  5KFY A;  3FZ2 A;  1BQN B;  2FJB B;  3MM7 A;  1N48 A;  2U2F A;  1RTI A;  3PVX A;  2IJN A;  1QE1 A;  2G1H A;  4KHM A;  2MGZ B;  3E2E A;  2YKA A;  1RKI A;  4NCG B;  4I4B A;  3J81 U;  4JUZ A;  3PV8 A;  2R7O A;  4U8Y A;  1U0H A;  1UAW A;  2OEK A;  4DR5 J;  4FXW A;  1QDU B;  2HHX A;  3LAK A;  4MFB A;  3PHE A;  3H4B A;  4FN5 A;  4Q8E A;  1MN9 A;  4UZC A;  2R2T A;  4TQR A;  1GX5 A;  1TUV A;  4JI5 F;  1IN0 A;  1FXD A;  2W2P P;  1HD0 A;  3JTP A;  3FQK A;  2BX6 A;  3MR5 A;  4DZD A;  3H42 A;  4CO2 A;  4JBC A;  3KHL A;  5ADZ A;  2XHW A;  1RWO B;  1S1X A;  2PFF B;  4C8K A;  1QAI A;  3DLJ A;  4DG1 B;  5B0G A;  4O44 B;  3S01 A;  4CO0 A;  1SV5 B;  4O3P A;  1XNQ J;  1DTQ A;  2MY8 A;  2CJQ A;  4OZN A;  2WOM A;  3SQG A;  1PCA A;  4B3O A;  4L3K A;  3JQK A;  2C2M B;  2QO3 A;  1H3D A;  4RZR A;  4HYK A;  1QSS A;  2VUG A;  2VPZ B;  4ZPT R;  4UST A;  2ZH3 A;  3C19 A;  4K4X A;  2C2O B;  1FFW B;  4ECY A;  4A47 A;  1U25 A;  4RJV A;  1FKP A;  4U9R A;  1VQN S;  3PO5 A;  2CXE A;  2M8H A;  4OX9 J;  5A8R B;  1XR6 A;  2FGC A;  1WAC A;  1HBM A;  3CJ5 A;  2Y8W A;  4NLP A;  3MGJ A;  1WHW A;  3CDE A;  2XY7 A;  4IUF A;  5LSR A;  3AQO A;  1CQM A;  3CCQ S;  1HI8 A;  3FSY A;  3PW2 A;  1QAX A;  4HI2 A;  4L76 A;  2B4V A;  4LF7 J;  2BW7 A;  1VHF A;  3B78 A;  4LRD A;  4QW9 A;  3HUL A;  3PKY A;  2KM8 B;  4ZLJ A;  1XR7 A;  4C0H A;  3T19 A;  4ZVF A;  3GCW P;  4DPT A;  2JDJ A;  1REV B;  2KH9 A;  3GR1 A;  2C22 A;  1WKL A;  1RAI B;  1X31 C;  2HVE A;  1X7V A;  2HKE A;  3SCL E;  2IDL A;  3J81 j;  3PFE A;  2ROE A;  1QVG R;  4PQU A;  4DL3 A;  5L8R C;  1HBU B;  3QYY A;  1WC1 A;  4L75 A;  4F0K A;  1I51 B;  2W2N P;  4M5L A;  2PSZ A;  3N0V A;  1Y3K A;  4KBI A;  3A4T A;  2G4B A;  3LPE A;  4RW7 A;  4RW9 A;  4U67 Q;  4DX6 A;  4A4J A;  3EVO A;  1TVR A;  3TEH B;  1TKT A;  4DSF A;  2Z4P A;  3GFH A;  1RHM B;  4K0K J;  1HHT P;  2AD9 A;  1NHK L;  4F26 A;  1UL3 A;  3ISN D;  1VCT A;  2GHP A;  1RSC A;  1CG2 A;  2DGO A;  2EVZ A;  3HVA A;  3ISZ A;  4TLQ A;  1PGZ A;  1ROF A;  1U49 A;  2B5J A;  4CDI A;  3CCV S;  4RUB A;  2HIY A;  2KHD A;  3EIC A;  1R89 A;  2HHQ A;  3C2P A;  3VAG A;  2Q6C A;  1IJF B;  2BJ9 A;  3ICL A;  5A8W B;  5HO4 A;  4DR1 J;  3D1Q A;  3FEX B;  4QQB A;  4DUY F;  5ETP A;  4IFY B;  1S1T B;  2ASY A;  2GVZ B;  1YJV A;  4DV6 J;  3HD2 A;  2I2Y A;  2E5I A;  4U95 A;  1N34 F;  4CH0 S;  1VJW A;  4U7U D;  1FRM A;  2VG5 B;  4GKJ F;  1NO8 A;  4LF8 J;  2QLJ B;  5I4M A;  3M6X A;  2GMJ A;  1KN6 A;  2R9L A;  4RNN A;  3M8Q B;  4FF4 A;  2JH3 A;  1F5A A;  1FKO A;  3GJR B;  3CF5 Q;  1JNR B;  3PIO Q;  1GT8 A;  3KLF B;  1RJJ A;  4BCA A;  5E3Q A;  1TKX B;  1LXN A;  3FJ2 A;  2R8J A;  4N5S A;  2OML A;  1F5C A;  4KSE B;  1NK7 A;  4RWX A;  1CJU A;  4ID8 A;  4LF9 F;  3KJN B;  1U2F A;  4OZJ A;  4F67 A;  1YTY A;  3OTC A;  3S6E A;  4P10 A;  5KT7 A;  2OPP A;  3R7N B;  1VIO A;  1UW9 A;  4DFJ A;  1AB8 A;  1T02 A;  1AZS A;  4Y65 A;  3R5A A;  1GXU A;  2XSF A;  3R2C J;  1SJR A;  5AE1 A;  4IDK B;  1GTH A;  1FVQ A;  2H54 B;  1M5P C;  2ZKU A;  3D9B A;  2AEF A;  1N4L A;  5CD4 H;  1KNZ A;  4FXV A;  2BM1 A;  2WON B;  3TUP A;  1R8H A;  4PG7 A;  1O5J A;  3VZI A;  3BO2 A;  2Y8Y A;  2J6U A;  5D0H A;  3TYT A;  3GYX B;  2DNK A;  3EJM A;  1YRT A;  4ZP8 A;  4ZIT A;  2PT0 A;  1PIE A;  4OFZ A;  2QIF A;  4YOE A;  4DSK A;  3NY0 A;  2YQ0 A;  3W2V B;  1N5Q A;  4P9S A;  2VPY B;  2EFP A;  2DKO B;  4WK1 A;  1WC0 A;  2J76 E;  2F7V A;  1S0O A;  4M1K A;  3TVK A;  3AA9 A;  1XJW B;  2VFV A;  5MAO A;  5A0Y A;  3X1L B;  3W5X A;  4EK2 A;  1SBR A;  2Q43 A;  1Q8L A;  1B64 A;  5D0R A;  1T3N A;  4OI3 A;  4YUD A;  5KFJ A;  5DGA A;  2F40 A;  2NXJ A;  2V8G A;  3PDN A;  4Z7C A;  3CJK B;  2VQF J;  2J7U A;  4H4M A;  2YVS A;  5DG7 A;  2CZV C;  2FHJ D;  2N7Y A;  3DRP B;  3JYT B;  4TU8 A;  3CUL A;  5BXI A;  4I2P B;  1HNX J;  1URN A;  4ECR A;  3HVT A;  3VR1 A;  1IR2 A;  3DU6 A;  4ZVS B;  3BKF A;  2DNN A;  2B6A B;  5KFT A;  4DBQ A;  1K47 A;  4J9Q A;  3OVS A;  2HFN A;  3GWC A;  4YP3 A;  3RB6 A;  2DYA A;  4ECQ A;  2ZHB A;  1MMD A;  1SKR A;  1KTV A;  3KMS A;  4DF8 A;  3HCX A;  4NCA A;  4LF6 F;  1M5H A;  1P8G A;  2DNM A;  4YDD B;  3KNG A;  4ED8 A;  4ZPB A;  4ECU A;  3HLU A;  2KU7 A;  2DO4 A;  5EWE A;  4U96 A;  2E7V A;  1ZA2 B;  2J7K A;  1UCN A;  2VV5 A;  2ZUA A;  2Q3P A;  4LR8 A;  5JUM A;  2PMH A;  2RDJ A;  4S0M A;  4I6Y A;  3ZTP A;  2DNR A;  2QV6 A;  4GMK A;  3V81 B;  3QAU A;  1RLC L;  2V6A A;  5DDP C;  1QVF R;  3GYG A;  3Q2S C;  2HAF A;  1Q8B A;  3HSD A;  1R8A A;  2JEG A;  1VR6 A;  2ZE2 B;  1FJG J;  1SQE A;  3FMB A;  4ES1 A;  1FHT A;  1VHI A;  4I68 A;  3WIU A;  4B3M F;  1RAA B;  2DGU A;  3NS6 A;  4ZA1 A;  3U1N A;  1F3V A;  4RBU A;  1RKJ A;  2DIT A;  1D9D A;  2QLX A;  2ZWO A;  2PC6 A;  3AJ2 A;  1RLD A;  3DMJ A;  4UOG A;  1RT7 A;  4KKO B;  4DV7 F;  2HS3 A;  3ZZY A;  5LXR A;  3EPG A;  3UN2 A;  4DL0 C;  2MB0 B;  4W92 B;  3QJJ A;  3MEK A;  5KG0 A;  4NYO A;  2EKY A;  4EMD A;  4JP8 A;  5IT4 A;  2GML A;  1Y9O A;  1RAC B;  2CPE A;  2ZH9 A;  4J9O A;  1X4A A;  1MLA A;  3G9C A;  5GAE I;  1WKK A;  1IKX A;  5C5J A;  2JSX A;  1TK0 A;  2HFV A;  3LPY A;  2DH7 A;  2D3Z A;  1PSD A;  3NWR A;  3HKZ D;  4NLD A;  4CTA A;  2LMI A;  3CJT A;  4QYR A;  3GJT B;  5CD4 A;  4RNM A;  2BA9 A;  4R0J A;  4YR2 A;  3A8E A;  1OJ4 A;  4DR2 F;  1S6O A;  4X66 F;  3KHG A;  3H2L A;  3AXM A;  3NGU A;  4ERD A;  3MPD A;  3NKY A;  3KLE B;  2XLJ A;  2VBY A;  2FGO A;  3R1H A;  4F4A A;  4G1Q A;  3PM9 A;  3I96 A;  2YX1 A;  1SC1 B;  4YEA A;  4EGL A;  1ACM B;  5DQH A;  5G0R A;  5KT3 A;  2M4M A;  3CDW A;  4FZV A;  3JB9 k;  1RGV A;  1T0T V;  5G4D A;  5F0W A;  4CH1 A;  2XQC A;  2HVH A;  2R3V A;  3I0S A;  3V4M A;  3SDE A;  2KG0 A;  1WC4 A;  7FDR A;  2RIJ A;  2ZBC A;  5C42 A;  4ED7 A;  1FT8 A;  4DSL A;  3M2R B;  2M0G B;  3SBM A;  2CPI A;  1N5Y A;  4C11 B;  3HI9 A;  2POK A;  3N28 A;  3W2W B;  3OL8 A;  3CIZ A;  3TJA A;  2WVE A;  3UCZ P;  1FVS A;  5D3G B;  4I0W A;  1URR A;  5H9E K;  3M1V B;  4BS2 A;  2JLG A;  4Y34 A;  4ED1 A;  2LQ5 A;  2YWE A;  1N88 A;  4IG3 B;  5K8P A;  1AYE A;  1QLN A;  4CQ1 A;  4FF3 A;  2DXF A;  2AYE A;  2W9B A;  2FVQ A;  3QJL A;  2NXN A;  5D78 A;  1TL4 A;  2DIU A;  3QIP B;  2OPQ A;  1LK5 A;  1NBE B;  1S1W B;  4DSE A;  2FVP A;  4NA1 A;  1Q81 T;  1F0X A;  2OSR A;  1YWX A;  4OLP A;  1CVJ A;  4FF1 A;  2Z2L A;  5DZ7 A;  1FRI A;  2R4F A;  1X5O A;  4USM A;  2MJN A;  3CGI A;  4NZ7 A;  3K5O A;  1DQA A;  2N4C A;  3I6P A;  3MAA A;  1IJE B;  3NGD A;  4CI0 B;  3W5Z A;  4IKA A;  4X4P A;  4DUT A;  1RP5 A;  3NLC A;  2ROG A;  1C1C A;  2ZD1 A;  4I2Q B;  4RKU C;  3VAF A;  3FVY A;  3OR1 B;  2FY1 A;  1WHV A;  3BM7 A;  2QSF A;  4C98 A;  2HMI A;  4C8Z A;  5DS7 A;  5GAE U;  2E5L F;  4MJK A;  4ZIV A;  4NZ0 A;  1Q53 A;  2YNG A;  5F8M A;  4C0O C;  5BR8 F;  2VDH A;  3S7R A;  1QAY A;  5HRO A;  1HQU B;  3C8Y A;  2RSQ A;  3NCQ A;  4PCQ A;  3BO4 A;  4F4X A;  1YJ9 S;  1X4C A;  1T94 A;  5IS2 A;  4XDC A;  2D1C A;  5LSL A;  1J5E F;  5LMU J;  2DNP A;  5J1N A;  1ITP A;  5DDQ C;  4B9T A;  1FNX H;  4AL6 A;  4ZVT B;  4OI2 A;  4F50 A;  3ZZU A;  4YR0 A;  3IWN C;  3CCU S;  2K1R B;  4XK8 C;  2UV8 A;  1BHN A;  4ZJO A;  1REG X;  3DXB A;  3CJ2 A;  4XAK A;  3LAM A;  2XTJ P;  4BBY A;  3ZTR A;  2CVI A;  2HHV A;  1R0C B;  2DCL A;  2XGP A;  3EVM A;  3H40 A;  3PJW A;  3THP A;  1G7C B;  1G3O A;  1LW2 B;  3OVA A;  3FEZ A;  4LVO P;  4JI0 J;  2QL5 B;  1AXQ A;  3GMG A;  3J81 Y;  4CIO A;  2HWH A;  3R27 A;  1S76 D;  5F3T A;  3S1T A;  1YZ6 A;  1X8D A;  1N5T A;  2BAC A;  1YG0 A;  1R0A A;  3NS7 B;  3VAI A;  3BYR A;  4NZ6 A;  2XM3 A;  1YDL A;  1FRX A;  2G0I A;  1MMN A;  1UVK A;  4LF5 F;  2CRL A;  1N0U A;  2WW8 A;  5I3P A;  3Q8U A;  2M2B A;  3VAM A;  3NOG A;  1UVL A;  3GP9 A;  1FE0 A;  2CIM A;  3GFX A;  3W7B A;  1BE4 A;  1H98 A;  3UR3 C;  4DV2 J;  2PDA A;  4FBT A;  3KUH A;  1LWC A;  2APO A;  3AJD A;  1SH0 A;  2G9O A;  4NRT A;  4X4U A;  3DLE B;  2F8M A;  3FRZ A;  4TVA B;  1IKY A;  4AL7 A;  3GCX P;  1LWF A;  1FDD A;  4P52 A;  1LFP A;  1X60 A;  2BDP A;  1WI6 A;  3G6V A;  4ZVO B;  5IM0 B;  2Y9H A;  5DG9 A;  4IH6 A;  2DHA A;  2P9G A;  4P2M A;  1RZM A;  5CAA A;  3B6B A;  4O3Q A;  2UVW A;  5EN1 A;  3QZ7 A;  3M8W A;  5KG6 A;  1VI7 A;  2LQJ A;  1X4G A;  2IRY A;  2ZZT A;  3FSI A;  2DIS A;  1S1V B;  4BWJ A;  3MD1 A;  3R5J B;  4LR9 A;  4IO9 Q;  5H9F J;  3OR2 A;  3OT9 A;  1RAG B;  1D1U A;  2WBR A;  2GAH C;  1QUV A;  2HLU A;  1KDN A;  3MPY A;  5HBM B;  4FBU A;  1RYS A;  1NSA A;  2EXU A;  2UXC J;  2UXD J;  9RUB A;  1RAO A;  3DFE A;  3UDC A;  5J1E B;  1M1H A;  4O23 A;  1SJ3 P;  5BJR A;  4Q2L A;  3EWG A;  3VVU A;  2GGP A;  4FVM A;  4HLB A;  1TL3 A;  3UVJ B;  2FJX A;  4DSJ A;  2XI2 A;  4EO8 A;  2ZHA A;  1U48 A;  2GJI A;  4ZN3 A;  2BYC A;  1J5O A;  1SUQ A;  4LSZ B;  2IAJ B;  3QFW A;  3KDO A;  3I5A A;  2ZFH A;  1CC8 A;  3H7H B;  5I3U A;  2CPH A;  2DEI A;  3IP0 A;  2V9K A;  5AJ3 F;  5CCM A;  3MTK A;  4JI2 F;  4UT4 A;  1EQ0 A;  3EMT A;  4CLY A;  2YWH A;  2RHS B;  1KON A;  2CPY A;  3Q83 A;  1DAR A;  3T1Y J;  5GAD I;  5C25 A;  1QAJ A;  5F9N A;  3DOM A;  3DLH A;  4NLY A;  3ZZO A;  3MM9 A;  4TLR A;  4QJV A;  2A1B A;  5KFB A;  3OUY B;  1UFW A;  2FD2 A;  2C2K B;  4HHU A;  3RBZ A;  3CJ3 A;  2MTL A;  3SSR A;  3QRR A;  1SJQ A;  1H2V Z;  5C24 A;  1EX8 A;  1ZOT A;  2FPH X;  2CG4 A;  4QPT A;  2YQ3 A;  4JI4 F;  2LXU A;  3C3L A;  3AT1 B;  1NPK A;  4KE5 A;  1U7L A;  3W8G A;  1S7I A;  1XMO F;  3A12 A;  4ICL B;  3ZZZ A;  3DLL Q;  1EQM A;  1FWL A;  3LP2 A;  3IRW P;  4NXM J;  3HT0 A;  4Y6I A;  2R7X A;  2ZH8 A;  4J37 A;  1IKW A;  3G71 S;  1XNR J;  3UCU P;  1ICE B;  3K59 A;  2RUS A;  4MIA A;  4RLE A;  4ZVE A;  1M1G A;  3PKM A;  2HPU A;  1VQP S;  1Q95 G;  4AQY F;  4CLW A;  1HNV B;  4OI0 A;  3LQV A;  4DPW A;  4OIX A;  2QJ3 A;  2V68 A;  1V6H A;  4LFB F;  4BC9 A;  1HNI B;  2AJ4 A;  1VQL S;  3EDQ B;  5L9N A;  2CJB A;  3TAN A;  4ZJL A;  4B9V A;  2PA8 D;  2MKH A;  2Q66 A;  2F4F A;  1HMV A;  3RUB L;  2VOO A;  2IM1 A;  3VGV A;  4NYP A;  3OXL A;  1TZ0 A;  1LWX A;  2YKP A;  1JLQ A;  3BBC A;  1D3W A;  1FKA F;  2HEK A;  4OJ3 A;  3I4P A;  3KLI A;  2QFI A;  5DM6 Q;  2EBG A;  2RKI A;  1W25 A;  1W2I A;  4O0I A;  1Y11 A;  3BN7 A;  2HFO A;  2GO8 A;  2Q1L A;  2LEB A;  2OPS A;  4IRD A;  3R5B A;  4ALZ A;  1C1B A;  2JRS A;  1R8P A;  4OL8 A;  2BJ1 A;  4X62 F;  2O01 C;  4E8U A;  4ECV A;  1JLF A;  1H7W A;  3UNG C;  4TU7 A;  2DXD A;  1VJQ A;  2PEH A;  4IQM A;  4KV8 B;  1OSD A;  4TY8 B;  3A1Y G;  4JI7 J;  3GLJ A;  4QCL A;  3TAQ A;  3VWS A;  3BQ2 A;  1KR4 A;  2RNE A;  2UUA J;  3MD3 A;  3G6Y A;  3ZNU A;  2GJ2 A;  2Z0G A;  2R7V A;  1C0U A;  4USI A;  1HW9 A;  1U1O A;  3SXL A;  2W9C A;  3DN9 A;  3J80 U;  1UKU A;  2VQE F;  5KFI A;  2NS1 B;  3ITH A;  1TK8 A;  3IFE A;  1HIY A;  2RE1 A;  4IFV B;  1VOM A;  4ECS A;  2M70 A;  3EGV A;  2MZ1 A;  1S9E B;  4M5N A;  3KLH A;  3ENV A;  2ACY A;  1KVI A;  3EUN A;  2DY9 A;  1JLE A;  3BGR B;  1G4C A;  4RNF A;  1A0O B;  2R8H A;  3V4I B;  1FEE A;  2Y1J A;  2XCP A;  2W2M P;  2YNH B;  4RNO A;  2Z8Q A;  4JI6 F;  4OYB A;  3HKW A;  1JLG B;  4PG8 A;  4X4R A;  1JLA A;  5IZH A;  3D0I E;  3CD5 A;  1IWA A;  3HHL B;  1TFY A;  1H6K X;  1UA0 A;  1RCX B;  2C2E A;  4LBP A;  1SL0 A;  2BQU A;  2VFT A;  4HTJ A;  4URQ U;  3P6Y C;  1NEE A;  4GVL A;  4CYU B;  4LRC A;  2XGQ A;  2XS5 A;  3VCD A;  3PYF A;  3DKD A;  2VON A;  1KFD A;  3ILI A;  3MEE B;  3OJU A;  4C8N A;  1FRK A;  3FDS A;  2J8A A;  1VRT B;  3DRR A;  4C8Y A;  1V3Z A;  2IVF B;  3MPV A;  5E0O A;  2XUL A;  4H54 A;  3J7A N;  3FBB A;  3TZW A;  3KLG A;  4LVN P;  3IR6 B;  5KFE A;  3MMB B;  1MRO B;  2GMH A;  4YB7 A;  2W2O P;  4KR0 B;  4NLS A;  1YBT A;  2IBO A;  1AT1 B;  1TMJ A;  1VIX A;  4IR9 A;  1TKZ A;  2X51 A;  3R8Y A;  3PCO B;  2ASL A;  5D15 A;  1S59 A;  2PD1 A;  3NRB A;  1RTD B;  4FS1 A;  1VGY A;  3T5H A;  4P72 A;  2OMO A;  3UI3 A;  2RB7 A;  5FJ4 A;  3I5B A;  1DUR A;  3OJS A;  3MUV P;  4EBC A;  2SXL A;  1RAB B;  1RK8 A;  3I5C A;  3MM7 B;  4DJB A;  1NDP A;  1IUJ A;  3KJF B;  4GO5 X;  1RTI B;  3QT7 A;  1RAH B;  2W7P A;  1ZM3 A;  1UET A;  3C16 A;  1QE1 B;  3PJX A;  1T7P A;  3OFG A;  2HBY B;  2FLL A;  2GAG C;  4MKV A;  1LFW A;  2V2Z A;  7AT1 B;  4OJG A;  3Q23 A;  4PYD A;  2AYM A;  3M2U A;  1R43 A;  4N8O A;  3E01 B;  2KT3 A;  1RTZ A;  2HFU A;  4F4Z A;  2E5G A;  3C6T B;  1O51 A;  2HGM A;  4DCP B;  5D0E A;  3PHT A;  4HHH A;  2DR8 A;  2CDR B;  4OLO A;  2ZH2 A;  2VF3 A;  2KRB A;  3M9N B;  5ETR A;  3DGP A;  1VRQ C;  2YWG A;  5C2C A;  2ZM6 F;  4Z37 A;  1RWN B;  2J0W A;  4LRE A;  1S1X B;  2MKS A;  3W9H A;  1VBZ A;  1U8S A;  2VAS A;  3K0J A;  2Y3Y A;  3BQ1 A;  1N5V A;  1RBA A;  1RBO B;  5GMK a;  3A13 A;  3HSZ A;  5GMD A;  1DTQ B;  3D1H A;  3CCL S;  4LF4 F;  2WOM B;  4C8L A;  3SQG B;  2FZG B;  1YIT S;  4U7C A;  2UUB F;  4B3O B;  1APS A;  2R8G A;  2XMA A;  2ZEJ A;  2UVR A;  3A8K A;  2GQC A;  1NPP A;  4D3H A;  1BY9 A;  4A8M P;  3C15 A;  3DLB A;  1EZZ B;  4C7Q A;  4HDG A;  2AWZ A;  3HFV A;  2XB2 D;  2GIQ A;  2E7X A;  1YI2 S;  2M3D A;  3BBB A;  1Q79 A;  2W2Q P;  1NK4 A;  4XPC A;  3PY8 A;  4FPI A;  1UJ5 A;  1FKP B;  2KVI A;  4DUY J;  4OZ2 A;  5KFH A;  3EM1 A;  1HBM B;  2KYZ A;  2C2Z B;  1CJV A;  1EP4 A;  3P4U B;  2RRA A;  2DNG A;  2K7J A;  3CCT A;  3F56 A;  4N76 A;  1WHY A;  5KT4 A;  1CEZ A;  4NLX A;  4RUH A;  1V3S A;  3OLB A;  4GKJ J;  4M95 A;  4TXS A;  2MQM A;  2OPR A;  2XY5 A;  2LEA A;  3IA0 A;  5CYM A;  2RRB A;  2AZ1 A;  1S0N A;  2VJU A;  2F9D A;  2E44 A;  1NJX A;  1RTH A;  4IYQ A;  3HP6 A;  2ZH7 A;  2GFF A;  2FJE B;  1UZD A;  4DR7 F;  3ZTO A;  4P7T A;  4DV4 F;  3ENW A;  2MKI A;  2D74 B;  1RT2 A;  4TU9 A;  3HFK A;  2ZOF A;  3ZZT A;  4LF9 J;  2DPI A;  1NJW A;  5HP1 B;  1IWG A;  1KQF B;  3BGU A;  3DI6 B;  1XMQ F;  1LOU A;  1L3V A;  3BSN A;  2N82 B;  4ZCK A;  4ILR A;  3K57 A;  1MWY A;  1J27 A;  2BW2 A;  1TVR B;  4X4Q A;  1TKT B;  2O1P A;  3FCV A;  4LRB A;  1HNZ F;  1ZZF A;  4DR4 F;  1OO0 B;  4A48 A;  3Q24 A;  4FPR A;  4LFA F;  2LEP A;  3QT6 A;  3CWJ A;  4FVC A;  2DNO A;  1RWV B;  3GSI A;  5L1L A;  3PW0 A;  4KB7 A;  4OYI A;  1I94 F;  4UZB A;  3N4W A;  1FX2 A;  1TP7 A;  3EZU A;  3OTD A;  2VOD A;  2B5J B;  3Q0A A;  2Y1I A;  5IOL A;  3MMA A;  2CNO B;  4O4G B;  3K2Y A;  2ZBQ A;  3QGH A;  2V0N A;  3G86 A;  5KG5 A;  3KKF A;  4RW4 A;  1NKC A;  5KFC A;  1PG5 B;  2LA4 A;  3Q86 A;  2WSF C;  3IG1 A;  4YY3 F;  3ZFV A;  2YKM A;  3D68 A;  4DWI A;  3MM8 A;  5GAH U;  2UXB F;  3W3S A;  2FB0 A;  1AA1 B;  3O2I A;  2R7U A;  1XC9 A;  3WQP A;  3RRG A;  2VD3 A;  3UD3 P;  2CPD A;  3MED B;  1JKH B;  4JI8 F;  3NL0 A;  4DL4 A;  1T95 A;  4B3T F;  3P3D A;  4IQX A;  5KFL A;  4R5P A;  2HHS A;  2HRT A;  5JVG Q;  1K8A T;  2VFS A;  2O66 A;  5EWG A;  3T5K A;  3BSA A;  4JOU A;  3QO9 A;  2VFU A;  2V69 A;  3W9I A;  2ZBP A;  2ASJ A;  1XER A;  4DV0 J;  3G6X A;  2R7Q A;  3BBF A;  2HYI B;  4TKT A;  4ETZ A;  5KTQ A;  3CD6 S;  3PEJ A;  2E9R X;  4OZ5 A;  2ZZN A;  4W4M A;  3MCS A;  1X0P A;  1AZS B;  3SCK E;  4OX7 A;  1CUL A;  2HRY A;  1YIJ S;  3I4H X;  1NM2 A;  1Y5L B;  3VVT A;  3E51 A;  3KG4 A;  4NML A;  2HLT A;  2P5V A;  3CDU A;  5HSP A;  4CH7 A;  2D3O 1;  1I1G A;  4K8R A;  2C1E B;  1FRL A;  3D6T B;  2MEW A;  2EFN A;  2W01 A;  2X1A A;  2MGZ A;  5CZV A;  1Y7P A;  3DRX A;  1F6T A;  3MAH A;  4NCG A;  2JL9 A;  3R1L A;  4QR2 A;  3DCA A;  4LR7 A;  2Z2M A;  4K4V A;  1SH2 A;  4USU A;  1UVM A;  2B9Y A;  2A6O A;  2PI5 A;  2UU9 F;  3EXY A;  2WVF A;  4JYA F;  4B3M J;  1B3T A;  3UDE A;  5A0Y B;  4LSN A;  4OV6 A;  2L41 A;  3V6K A;  2E9T A;  4DV1 J;  5B0D A;  1NJZ A;  5RUB A;  3TOQ A;  4MK8 A;  3UE2 A;  4XDD A;  1S7H A;  2X7I A;  3DOL A;  2E5H A;  2KN4 A;  4RPF A;  2XNR A;  3NGS A;  5FLX Y;  2FJA B;  3FC9 A;  4LIR A;  1Q16 B;  2HHU A;  4DV7 J;  2AYG A;  2W8K A;  2P2C B;  1U4B A;  3UCG A;  2HNY A;  2DVI A;  2ZJP Q;  4JI1 F;  1MWQ A;  4NWB A;  1J2V A;  3KK2 B;  2MHN A;  4DF4 A;  5E5N A;  3NS5 A;  3I56 S;  4PAA A;  2FVR A;  1SV5 A;  2GHV C;  3UQS A;  1S5Z A;  3SYZ A;  4MK9 A;  1KP6 A;  4DXL A;  4N8N A;  1N36 J;  1JMT A;  2QFJ A;  3PJ9 A;  3HVT B;  1RWM B;  4Z7Y A;  2BJ7 A;  4FYV B;  1M90 T;  1R6Y A;  3OSN A;  3B82 A;  4RUA A;  1X4H A;  1VBK A;  2YY3 A;  2Y0S D;  3J7A 1;  3GSD A;  3NGK A;  4IR1 A;  2QA4 G;  4D3G A;  4TN2 A;  5JJB A;  4PXB A;  3P8B B;  1TQL A;  1BXN A;  2DGT A;  4WE1 A;  3BPD A;  3HSG A;  4OX8 A;  4FYY B;  4HL9 A;  2QE5 A;  1PC5 A;  2MST A;  2J6S A;  2ZH5 A;  1X9S A;  4DR2 J;  2ZC3 A;  3LP0 A;  4X66 J;  2PI4 A;  1LQ9 A;  5FDL B;  4DQP A;  4PEO A;  1SJ1 A;  5HI7 A;  1EAY C;  4BWM A;  3K89 A;  2A2D A;  4B3S F;  2BJD A;  2GZO A;  1RWP B;  4FNH A;  1KD1 T;  2VH7 A;  3THT A;  2AF6 A;  1BUX A;  1REV A;  4K5R A;  3JAM Y;  2G13 A;  5HLF A;  1SXL A;  2IYG A;  5KG2 A;  1RBL A;  1WKJ A;  3R7S B;  1FFG B;  1HQE B;  4NI2 A;  1BGX T;  3P96 A;  2CZ9 A;  2N7C A;  2LXF A;  2ZIT A;  3DLK B;  2C2D A;  1RU2 A;  3CCR S;  2FHO B;  3JSB A;  5L39 A;  2JVR A;  1H73 A;  1SKU B;  4ID5 A;  4DSI A;  2MPU A;  4L74 A;  5M2U A;  1UPM B;  1YJN S;  3DMJ B;  4CO3 A;  2WSC C;  2PA3 A;  3GG0 A;  2DNH A;  3KLV A;  5DLG A;  3TVZ A;  1PBA A;  2JOQ A;  1C4A A;  1S49 A;  1KOH A;  2FDN A;  5HK4 A;  1HBN A;  3BB5 A;  1F3F A;  1UMJ A;  1XNQ F;  3JQM A;  1RT6 A;  3O8W A;  1IM6 A;  1GH8 A;  2DNL A;  2XMT A;  1HW8 A;  1NH7 A;  2UUC F;  1O8B A;  2MJU A;  4I1T A;  1HWU A;  1ZET A;  2DT9 A;  1S0M A;  1E6Y B;  1RT3 A;  4IOB A;  1WD6 A;  1S4E A;  1S0V A;  4OJH A;  1UEV A;  3D0G E;  1LW0 B;  1R6V A;  1NHU A;  2AGQ A;  3ILO A;  2IM2 A;  3KK3 B;  1DHM A;  4NE9 C;  3M8P B;  1S1T A;  2DR9 A;  2IIH A;  2XYP B;  5KFA A;  2GVZ A;  1NK9 A;  4ZPV R;  4ANE A;  1FXR A;  2AU0 A;  4CM2 A;  5IQ6 A;  1B7F A;  4UQT A;  3CO9 A;  2E1R A;  3VHQ A;  5HMY A;  2FZC B;  1T9W A;  5EUH A;  3KJV A;  2ACM A;  4EFA C;  3LA0 A;  2Z56 B;  2AEJ A;  3CCJ S;  4DHV A;  5G0R B;  1TTH B;  1VRU A;  3KLF A;  4Y00 A;  4DR6 F;  3I0S B;  3SCI E;  3SDE B;  3IBW A;  4MH8 A;  2NLW A;  2CYY A;  3Q8Y A;  3KTQ A;  3BSO A;  1J5E J;  4H4O B;  3QWP A;  2IRU A;  1P9Q C;  3T3F A;  1XN9 A;  3MOZ A;  4ZP7 A;  1I5O B;  4QYZ J;  1FER A;  3JS9 A;  1XBW A;  2H3E B;  2KKH A;  3OVB A;  2WAQ D;  2XMW A;  1KWM A;  2GC8 A;  3SV3 A;  3AHP A;  3MUM P;  4F8R A;  3CED A;  2ADB A;  1PAE X;  2ZDP A;  3MTJ A;  4TYA A;  5LMN J;  2YNI A;  1T9Y A;  2BQ3 A;  1RQ0 A;  2BM0 A;  4ZOS A;  1P9Y A;  2XZT B;  2VBX A;  2A2C A;  4IDK A;  3VTI A;  1KLN A;  3MR6 A;  1TU0 B;  1FEH A;  2K06 A;  3HHL D;  2MSS A;  3BV8 A;  1RT5 B;  3H90 A;  1GK8 A;  1BLU A;  4N77 A;  1IKV A;  2W9B B;  1VC5 A;  1Y0H A;  4IG0 A;  2WON A;  2DRB A;  3FBF A;  4FKY A;  2X3G A;  4DI6 A;  1S97 A;  2CZ4 A;  1M0S A;  3K8W A;  3NXZ A;  2XSJ A;  3T6J A;  1FJ7 A;  2MLX A;  1DBD A;  2NXE A;  4ZVP B;  3DRS A;  2K3I A;  3D0H E;  3AAW B;  3CNQ P;  2BJ3 A;  3WIV A;  3C6U A;  2DB1 A;  3AOC A;  5B0C A;  2BEF A;  3W2V A;  2VKZ G;  3H25 A;  4LRA A;  3LP1 A;  1SPB P;  3P5T L;  4B9M A;  1PJ5 A;  1S6Q B;  1ZZN A;  1H2U X;  1NK8 A;  2FJV A;  3MMC A;  3MAA B;  4X4S A;  1FD2 A;  1XIQ A;  4JV5 J;  2UUT A;  2ZWP A;  5HAO A;  1HI1 A;  2GQQ A;  2HUR A;  1SKW A;  1C1C B;  2BMB A;  2AJ0 A;  3FRY A;  5D4P A;  4LF8 F;  4JV1 A;  1DTT B;  2ZD1 B;  4CLT A;  1CC7 A;  3T1H J;  4DR3 F;  1GMV A;  3LGM A;  3MEC A;  2KFY A;  2ZNZ A;  2HVI A;  3DRP A;  2YNG B;  3SQO P;  3JYT A;  4NX9 A;  3F0N A;  4A8K A;  1VQM S;  1UJ6 A;  4KGV B;  4QIG A;  3HDS A;  3L7O A;  1JQG A;  2L08 A;  3A3P B;  2KJW A;  1EIY B;  3PTW A;  3M6W A;  2G1D A;  4KHP F;  4OQJ A;  2XZD B;  5CHC B;  2W9A A;  1HHS A;  4C6A A;  2V8H A;  2IJR A;  3FKB A;  2FVC A;  3CW2 C;  4K2J A;  3FGV A;  5K8O A;  1U09 A;  3CMA S;  3A3O B;  3GE9 A;  5F8L A;  3WC0 A;  5BYR A;  3OV7 A;  4U8V A;  4K4U A;  1QM9 A;  3KUE A;  1JB0 C;  2CQC A;  5HQL A;  3OFH A;  5K14 A;  3GPA A;  3M2V B;  4CLK A;  3HXM A;  1Y4Z B;  3QJP A;  4PR6 A;  4A8S A;  3ILJ A;  4CZC A;  4K2X A;  3W60 A;  1Y00 A;  2IA6 A;  1NSQ A;  1RT4 A;  5LXY A;  1ZTT A;  5E3A A;  2E66 A;  3MOJ B;  4ZCI A;  3VV2 B;  2XZW A;  1GNK A;  4XTT A;  2QA1 A;  2BJE A;  3U02 A;  2W7O A;  4KO0 A;  3K5N A;  4R0E A;  2EC0 A;  1B4S A;  3BR8 A;  1PYS B;  1E6V A;  4ZCM A;  3GG1 A;  5K5M A;  2QN6 B;  3W63 A;  3KXD A;  2UVV A;  1TK5 A;  1U24 A;  2I38 A;  1Q8K A;  4JI2 J;  3GTY X;  5LSO A;  3PFO A;  2WVC A;  4N41 A;  4CLU A;  1LWC B;  4IH5 A;  3VAJ A;  3A3N B;  2HQF A;  3RAQ A;  5DDO C;  3DDI A;  1BD6 A;  1LWF B;  2QG9 B;  1DLO A;  3GIL A;  4QW8 A;  3V6D B;  4KKO A;  5D4L A;  5KFN A;  1S1U B;  1YRX A;  2A0F B;  4JI4 J;  2VQF F;  6FD1 A;  2CQ0 A;  2CNK B;  4H4K C;  2ALY B;  2XI3 A;  2OUG A;  3N5F A;  2IFX A;  1NK5 A;  2KL8 A;  4U7U K;  1P27 B;  2CQ3 A;  2ZKT A;  4FNI A;  4K5S A;  1B7Y B;  2F8E X;  4NA2 A;  3CCE S;  1X5T A;  4WIQ A;  3OR2 B;  5E33 A;  5SUH A;  4FS2 A;  3IS9 B;  3ILL A;  4DPO A;  2V50 A;  2RF2 B;  2JX2 A;  2OFH X;  3BH6 B;  4AQY J;  2DK2 A;  1F9H A;  4IOA Q;  2CQ4 A;  2AHO B;  1SQG A;  4PWD A;  1FDB A;  4LFB J;  4BHQ A;  2EC2 A;  2QZ8 A;  1NDK A;  2GGP B;  1XMB A;  2HQ3 A;  3R9L A;  2ZH6 A;  1TL3 B;  1WDD A;  4J9M A;  1N56 A;  3QWU A;  4RWW A;  4DL6 A;  3TX0 A;  1FD8 A;  4NA3 A;  1RWU A;  1J5O B;  2LXI A;  4NRU A;  3HFZ B;  1SUQ B;  3AB4 B;  3NOC A;  2HZC A;  1NJI T;  1WF0 A;  3MZI A;  3OTO F;  5EGY A;  1L3T A;  1G6B A;  5KOW A;  3TW0 A;  3ZO7 A;  1KVK A;  4LUB A;  4HKQ A;  2UP1 A;  4V19 X;  4DZ6 A;  5A8K A;  4UF4 A;  4MIB A;  1OY9 A;  2XNQ A;  3O44 A;  3M2R A;  4YHH F;  4RR5 A;  3I0R A;  3MAQ A;  3G82 A;  1HNW J;  2DRD A;  4X62 J;  2CG8 A;  1WG4 A;  2LKZ A;  4A8W A;  2HS0 A;  2RRN A;  2MZS A;  1X4B A;  2FIU A;  4E2F B;  5BYQ A;  3DM2 B;  1T05 B;  2GIR A;  1CPZ A;  2EG2 A;  1UZH A;  1VQK S;  4EYH B;  4Z2X A;  2DH9 A;  3KYL A;  2RH3 A;  4IG3 A;  2VZ9 A;  3TNV A;  3DHW C;  4MKY A;  4QR0 A;  2DO0 A;  4X2B A;  2YH0 A;  3PZP A;  2VQE J;  3QIP A;  2R2S A;  4FP9 A;  3D2W A;  2IC3 B;  5KFR A;  3QFH A;  4DQI A;  3LP2 B;  5ITH A;  2CNN B;  5H9E J;  4K4W A;  1NRK A;  1LEO A;  5DGB A;  3TRG A;  2LFV A;  1Z2L A;  1IKW B;  1UVJ A;  4CNY A;  4P2S A;  2VPX B;  3OFF A;  2XO7 A;  3IAM 9;  2B4O A;  3TJ8 A;  3J7Y I;  2Q6B A;  5L1I A;  5ETS A;  1AFJ A;  5ETK A;  4JI6 J;  1U1R A;  2ZOG A;  4ED5 A;  2EFG A;  3ET6 B;  5HN0 A;  2QX0 A;  4DU7 A;  4K4Z A;  4QYZ K;  4Y2K A;  2HNZ B;  3R3T A;  3SSS A;  3M9M B;  1EB0 A;  3WZ0 A;  2YQ1 A;  2E1P A;  5EHH A;  3MM6 A;  4USK A;  3W8P A;  4QIE A;  4WKY A;  3BH7 B;  4RW6 A;  4QPX A;  3PX6 A;  4B3R F;  3MCN A;  2RUG A;  2DR5 A;  3PNI A;  1HMV B;  2CQ1 A;  5AT1 B;  5A2Q Y;  3NNA A;  4HT7 A;  2QMW A;  2C3Y A;  1JLQ B;  4LSL A;  3QMQ A;  3QPI A;  1GAO A;  3EYZ A;  3VAK A;  1EJ7 L;  1WSV A;  4HH0 A;  3KLI B;  3F41 A;  2DGS A;  4KH0 B;  4XO0 A;  1EAR A;  1NH8 A;  4P2X A;  3RU0 A;  3D4J A;  2MKK A;  3HZE A;  3ONQ A;  2OPS B;  3PEH A;  1C1B B;  4F25 A;  4WF9 Q;  2K1R A;  4XPE A;  2NQP A;  3BKT A;  1VLO A;  3K5M A;  1JLF B;  3SSQ A;  1KFS A;  2V9W A;  3C46 A;  2IVY A;  3HHE A;  1YK9 A;  2QSW A;  3ZNJ 1;  3KK1 A;  4JI3 J;  1D0E A;  5KFW A;  3G8T A;  2BZ2 A;  4USV A;  3DXS X;  2ZH1 A;  1HWL A;  2MKC A;  1Q7Y T;  2XEX A;  4P7V A;  2DHH A;  4C2M A;  3CT9 A;  4QBU A;  3I55 S;  3N6N A;  3LWL A;  4DCO B;  4KQZ A;  4Q43 A;  1C0U B;  3MM5 A;  4OI6 A;  1Y5N B;  1OPI A;  4Q7A A;  3ITH B;  3I32 A;  1U6Z A;  1CQN A;  3QRQ A;  4LQ9 A;  4J9S A;  2NR0 A;  2ATL A;  2M5Y A;  3KLH B;  4C8M A;  1R31 A;  4A8F A;  1JLE B;  1FJC A;  2HQI A;  3RG6 A;  3VGT A;  2KB2 A;  3PG9 A;  1T9X A;  3N5B A;  4DS4 A;  1K0T A;  4M5J A;  1QTM A;  3G4S S;  3QSI A;  1U6B A;  1JLA B;  3DLE A;  4WYL A;  1U1L A;  1VQO S;  3US5 A;  1FFS B;  1TL5 A;  3HD1 A;  1UWA A;  3M32 A;  4LF4 J;  3I9Z A;  5DRK A;  2WRM A;  5IM0 A;  3OW2 R;  5KFD A;  2BRK A;  1BWV A;  1VK3 A;  2B8Q A;  2VHG A;  4GC6 A;  1NZA A;  1SL2 A;  1ZS6 A;  1MN7 A;  4BC7 A;  3J7Y U;  5LMU F;  1WHX A;  5T7L B;  3KLG B;  2V4Q A;  1SCJ B;  2E7W A;  3N6L A;  4ZIW A;  3L7P A;  2AX1 A;  2MQQ A;  4YQW A;  4L6V 3;  3KNA A;  4F0M A;  2G2O A;  4DX5 A;  4KGM A;  5AXM A;  4OYW A;  5L1K A;  5FD1 A;  1TKZ B;  1WEL A;  3LF0 A;  2M9K A;  1IQT A;  4ED3 A;  5J1E A;  2J7W A;  2R7T A;  4JI0 F;  1T11 A;  5ETL A;  1WEX A;  1KHV A;  3W62 A;  2KXH A;  1RXO B;  4M5H A;  4RO0 A;  3O3L A;  2DEJ A;  3K5P A;  1WSR A;  4ZLL A;  3KUG A;  3C16 B;  3KFW X;  2BE2 A;  3SCJ E;  1DFD A;  4DR7 J;  1JXV A;  3PAC A;  2LU2 A;  2EFV A;  3K58 A;  2YXL A;  3CSK A;  2AGP A;  4DV4 J;  3G96 A;  1Q1K A;  2HVZ A;  4URG A;  4R25 A;  4CCH A;  1BWE A;  1TAU A;  3CJS A;  4WU3 A;  1QSL A;  4OYM A;  3M2U B;  2LEC A;  4H4K A;  5IT0 A;  4ECX A;  4USW A;  4WZM A;  5ETN A;  2AGO A;  1ZM9 A;  4RW8 A;  4WFY A;  2R7R A;  4J91 A;  4J9U E;  3C66 A;  1JLB A;  4F36 A;  2HG4 A;  1RTJ B;  4N7T A;  2V2Q A;  3MCM A;  1W2B R;  1D8Z A;  2F4V F;  2HHT A;  2LDI A;  3RBX A;  4L72 B;  1NSP A;  1Z2Z A;  1S99 A;  3P45 B;  3AOB A;  2PE8 A;  2YNF B;  4OMF G;  4U6P A;  2LU1 A;  3QLH A;  1I94 J;  3DU5 A;  2CAD A;  2DPJ A;  1RAF B;  1UWB B;  1ZAX A;  2DGX A;  2YWW A;  2B9W A;  1GXL A;  4URS A;  3UWT A;  3H8Y A;  3LWM A;  3IGV A;  3PW5 A;  3T5J A;  1HWJ A;  3B4M A;  2J0Q D;  3IAS 9;  5SZT A;  1BQM A;  4KYZ A;  4ED6 A;  1KS2 A;  4OYO A;  1SB6 A;  5HVG A;  2P6T A;  4M5M A;  4PG5 A;  4QIW D;  2UVU A;  1MU2 B;  1CJV B;  1EP4 B;  5D77 A;  4OHV A;  4YY3 J;  4G3I A;  3SV4 A;  2JFD A;  2ZH4 A;  1GMW D;  2PGC A;  3HJF A;  2UXB J;  1HNV A;  3MMJ A;  3NNC A;  2M7S A;  4ILL A;  2JWN A;  4QWB A;  2Z58 B;  3OSP A;  1FE4 A;  2OPR B;  1T03 A;  3CCM S;  5CYM B;  1T9U A;  1GFW B;  4JI8 J;  2I8E A;  3D3B J;  3Q8V A;  1RTH B;  1LV5 A;  4B3T J;  3KG1 A;  2Y0B B;  3UN5 A;  2YWF A;  4WPA A;  1Z1Z A;  4R8U A;  3JSY A;  2QYC A;  3PRB A;  3TEG A;  1EET A;  1S77 D;  1B0T A;  1RT2 B;  4NMX A;  1PKU A;  3DOK B;  1N33 F; 
#chains in the Genus database with same CATH homology
 4CLL A;  2GVD B;  1WC1 A;  1YK9 A;  3C16 B;  1WC4 A;  3ET6 B;  4USV A;  1WC6 A;  3G82 A;  4UST A;  1CS4 B;  1YBT A;  5IV4 A;  3UVJ B;  4OYX A;  1CJT B;  4CM2 A;  4OYI A;  4USU A;  2GVZ B;  4WP3 A;  4OYO A;  3MAA A;  1FX2 A;  4CLP A;  4NI2 B;  4WP8 A;  4OYM A;  2QV6 A;  4OYA A;  5D15 A;  1Y11 A;  4P2M A;  1U0H A;  1CJV B;  4USW A;  4CM0 A;  4OYB A;  3C14 A;  4CLS A;  5IV3 A;  4CLU A;  4OYZ A;  3R5G A;  1AZS B;  1TL7 B;  3MR7 A;  4OYP A;  1U0H B;  1Y10 A;  5D0H A;  4WP9 A;  2WZ1 A;  1CUL A;  3G82 B;  1CJK A;  3C15 A;  1FX4 A;  4CLW A;  3C16 A;  4CLF A;  4CLY A;  1WC3 A;  4OYW A;  4P2F A;  2BW7 A;  3MAA B;  1CS4 A;  4CLK A;  3UVJ A;  4P2X A;  3C15 B;  1WC0 A;  4OZ2 A;  4WPA A;  4NI2 A;  3C14 B;  1CJU A;  1WC5 A;  2GVD A;  1CJV A;  4CLT A;  4CLZ A;  3ET6 A;  5D0R A;  1YBU A;  5D0G A;  1CJT A;  4OZ3 A;  2W01 A;  5D0E A;  1CUL B;  1AB8 A;  1CJU B;  1AZS A;  1TL7 A;  2GVZ A;  1CJK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...