3ET6B

The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
180
Chain Sequence
SAPAQEHPEATVLFSDIVGFTEIASRSSPLEVSLLDELYQRFDAAIEEYPQLYKVETIGDAYMVVCNVTVPCDDHADVLLEFALRMHEEASRVAEPVRIRVGMHSGPVVAGVVGRKMPRFLFGDTVNTASRMESHGEAGQIHISEACYCLRSKERFEIRERGNITVKGKGTMRTYLLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Lyase
molecule keywords Soluble guanylyl cyclase beta
total genus 53
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3et6B00
3ET6A 4OYMA 4WP9A 4OYWA 1YK9A 3MR7A 4NI2B 2GVZA 4USTA 1TL7B 1WC3A 5IV4A 2BW7A 1Y11A 2GVDA 1WC0A 3UVJB 1CULA 1CJUA 4OYBA 3MAAA 4P2MA 4WPAA 1AZSB 1AB8A 4CLSA 3G82A 3ET6B 1YBTA 4CLLA 4CLTA 1CJVA 1CS4A 4CM2A 4USUA 2WZ1A 5D0RA 4CLKA 3G82B 4OYAA 4NI2A 1CJTA 1CJVB 1CJUB 3C16A 4CM0A 3R5GA 4USWA 4WP8A 3C14A 2GVZB 4CLFA 4CLPA 4OYXA 1CJKB 4OYIA 3C15A 4WP3A 1CS4B 4OYPA 4USVA 2W01A 4OZ2A 1U0HA 5D0EA 4CLYA 1AZSA 5D0GA 4CLWA 1CJKA 1FX4A 5IV3A 5D0HA 4OZ3A 1Y10A 3C15B 1YBUA 2GVDB 3UVJA 1WC6A 4CLZA 1CULB 1U0HB 1TL7A 4OYZA 4P2FA 3C14B 2QV6A 4CLUA 4OYOA 3C16B 3MAAB 1WC5A 1FX2A 1CJTB 1WC1A 1WC4A 5D15A 4P2XA
chains in the Genus database with same CATH superfamily
2DT9A 3FDSA 3GILA 3CULA 1ZPWX 3NWRA 4YEAA 4OX9J 1NDKA 4KHRA 2AX1A 4Q44A 3D0GE 4DR7J 3OFFA 4DLGA 3H2UB 3GQCA 3D7SB 2CDRB 4AL7A 2HHTA 1RAJA 4LF4F 5KAKA 3CJ2A 5KFZA 2KVQE 4USTA 2D3O1 2VB6A 1U1PA 4U7CA 2HFZA 4V19J 3NNAA 1PJ7A 4CYUB 4ZVOB 1FJGF 1RXOB 2XBPA 1FWLA 2H1YA 1XR6A 2HMIB 3O5TB 3QGHA 7AT1B 3BYPA 1IQZA 1MW7A 3HFVA 2MKKA 2M88A 2POKA 2RQ4A 5F9LA 2E5LJ 4NYOA 2HVHA 1MU2A 3H42A 5GAHI 4LF9J 1VQLS 1JX4A 1T7PA 3LGNA 2WRMA 1IKWA 2J9CA 3AXKA 2QN6B 4ZLLA 3RR7A 3NS7B 1FNOA 4L72B 1P27B 4LR7A 1IWAA 5SZTA 4RZRA 1T9XA 1CC8A 1PAEX 1UFLA 4YR0A 1FRLA 4PQUA 1TK8A 4AT1B 4QIVA 1EJ7L 1DZ5A 3CF5Q 1PYOB 1V3ZA 2APOA 1EAYC 4LRFA 5LJ5Y 3QRQA 1T0TV 1SJQA 1TV6A 3KLIB 2XCPA 2XLIA 1X5PA 2HZCA 2UUTA 5KFBA 5E3QA 3M7VA 5KG4A 3W5ZA 1T05A 1NAQA 3QWUA 2UXDF 2G0JA 1RT1A 1G4CA 1YJ7A 3DFEA 4LSLA 4OYAA 2I38A 1S48A 2MLYA 3EGWB 3US5A 2W9BA 3BR8A 1Z4UA 3IFEA 4F7VA 1QSYA 4WFXA 2BJDA 4Z7YA 2HWHA 4YDDB 2D1CA 1R8CA 1NO8A 4OI2A 2XLKA 2IMOA 1RB0A 1KHVA 3NGSA 2AJ1A 5KG0A 5ADZA 3E51A 5I3QA 5LMUF 2IDEA 1YI2S 2Y8YA 1H72C 1C0UA 2ZDOA 2HS0A 1SKWA 1FKOB 1UJ6A 1WHYA 3PX0A 2OIHA 4BLGA 3IN5A 4N41A 4TY8A 4LSNB 1FDBA 1LW2A 5LJ3Y 3BO2A 5CABA 4ED2A 3M6WA 1H0HB 2EFNA 1BLUA 2UUAJ 5CYMA 4Y0FA 5D8HB 4WP3A 2CAJA 2MGZB 1HPZB 4ELVA 2CQHA 3F73A 1FESA 4RW7B 1UVKA 1U0HA 1VBKA 2M8HA 3BH6B 3FEXB 2YX7A 3P45B 2XY6A 3R1LA 1EIYB 3K0JA 2LEAA 4WFBQ 2D9OA 2MKYA 3OL8A 4PWWA 4CQ1A 5F0WA 1P8GA 2YX4A 2HZAA 1SKUB 2ZWPA 1RBOB 4TNOA 4PUOA 5ETTA 2DISA 1N56A 1DARA 2RHSB 2Y9HA 3SZ2A 4NWBA 3D68A 3DMJB 3Q8YA 4X66J 2VJUA 1WC6A 1OY8A 2G2OA 3OUYB 1VK3A 4DR4J 2XLJA 1WORA 3W8PA 3OVSA 5ITHA 3GB0A 4NA2A 2NYIA 2ACYA 3VV2B 5C24B 4M1KA 3NOCA 3IR7B 3M8RA 4DSEA 4IRCA 4YR3A 3BR9A 4ZP6A 5F8MA 2DD8S 2XMWA 3U02A 3T1YJ 3M8PA 2LFVA 1SB6A 3MM6A 3QT5A 2F40A 1VBZA 3BBBA 3FNNA 3MM9A 3LPEA 1H6KX 1EETB 4NCGA 3P6YC 1FT8A 3CJ3A 1UETA 1HWJA 2HHHJ 5AE1A 1KLMB 1M5HA 3MPVA 3W64A 3GIKA 1U45A 1OIAA 2BJ1A 3UI3A 3THTA 1AT1B 4PG4A 5J2MB 2B8PA 3N79A 1REVA 4B3RF 2YKNA 3QZ8A 1C4AA 3MR6A 2HBZB 2ALZA 1RAGB 1QM9A 3MR7A 2JOQA 1RUSA 2DNZA 3KMQA 2V2ZA 4QZVB 4DUTA 2C22A 1VK8A 1WTFA 2CRLA 4QOTA 2V9WA 1WC0A 4B3RJ 3BSCA 3HPOA 4HHHA 2J9DA 5ETNA 3WBZA 4FBTA 4QWBA 3HHNB 3MF5A 1R0AB 1RI7A 2BKOA 3HX9A 3I32A 1PCAA 3NOGA 2ZKTA 1FWKA 4DV4J 1CLFA 4OJGA 2XMKA 2DNLA 8RUCA 1NJXA 4CTAA 4NLSA 4C9DA 4PUOB 2CXEA 5L9XA 2PMHA 4AXIA 2HGMA 1UTAA 3NLCA 3D4JA 3FKBA 4KV8B 5DETA 1EKSA 4XDCA 3UR0A 2YTCA 4HR2A 4PXDA 2IFXA 1HBUB 5HVGA 3PW4A 4UTGA 1M5VC 1H7WA 2FHKA 2GV1A 3H7HB 4F04B 4NLYA 1H2VZ 4O44A 1TTHB 4QIFA 3V5RA 4UZBA 4ZVGA 2XYPB 2G0CA 3G82B 4KJIA 5A6WA 5C2CA 2MGZA 2C2DA 2QT7A 3DLLQ 2B4VA 2ZJRQ 3DC2A 1RABB 3QZ7A 1LW2B 4N7TA 5E41A 4F36A 1W2BR 3PM9A 3NKYA 3G6YA 2ZBCA 5K20B 4FP9A 3UDLA 1REGX 1S5ZA 2KRBA 2P6SA 5GVQA 4WTYA 1A0OB 3CJ4A 3M9NB 4ERDA 2R3VA 1EQ0A 4ZVRB 3W7BA 1ZTWA 2UP1A 1JLEB 1WKKA 2JLEA 4K5RA 2ZM6F 2GO8A 2GVZB 3FUYA 3L09A 1CJKB 1NKBA 4DZ6A 2A3JA 2NQPA 3DLGB 4Y2CA 4MIBA 2BX6A 5B0EA 3AXMA 5IS2A 2MXYA 3BS9A 4FPRA 5A2QY 2QRRA 4B17A 3M9MB 2V8DA 4DR6J 3FMBA 4WU3A 2R8IA 1N32F 2VG6A 4ID5A 1JMTA 2Z57B 4ED0A 1T05B 2FZKB 3BB5A 4LSZB 4YY3J 4YHHJ 1T9VA 2BOPA 4DR4F 4ECVA 1V9OA 5A0YA 3CCQS 1RZMA 2WW8A 2E5IA 2VFUA 4CLWA 1BHNA 1GFWB 3QPIA 4PWDB 2XI3A 4K4WA 4U7UD 1N6QB 1HNXF 5KT5A 2CZVC 1RU1A 3UO0A 1RDRA 4ZPBA 2PMZD 3QYYA 3VZIA 1TU0B 1LWFA 3UQSA 2CWKA 3CXCR 4J9SA 3KKFA 1VYAA 1U26A 3AB2B 5DDRC 1YJUA 2NPIA 1YBAA 4IFVA 4MK9A 1WD6A 2H3EB 4NPOA 1YITS 1M5OC 4C2MA 4I1TA 1WF1A 3Q22A 3PHTA 1XNQF 4C97A 4B3SJ 2YKNB 4JI8J 1UL3A 1GMWD 4J9QA 4OHZA 4A8WA 4JI2F 2OEMA 3NXZA 4KFBA 1P6TA 1QVGR 2XMAA 1WELA 3GWCA 2XSFA 4FNHA 3R6LB 5EGYA 1SJFA 3HJFA 2UXBJ 5LXYA 2FVPA 3CMES 3HLUA 1X4BA 1WSRA 3BF4A 3LA0A 1Q8BA 3QGIA 5CHCB 5E3AA 2ZH2A 2IAJA 1ZM2A 1FTCA 1NLKL 1IKVB 3HCXA 4EYIB 1XNQJ 4IG0A 3CC4S 1UMJA 2IIHA 4Q0BB 1S1TA 3X3UA 4BHQA 1SL1A 4QCLA 1G7CB 3DU6A 3LPYA 4WP9A 1Q1KA 1Y3JA 2C2EA 2C1EB 4DV3F 4GKKJ 2OLWA 1XK8A 4B3OB 4DL2A 1WOPA 3IBFB 4PRFA 3MR2A 2YKAA 4KV8A 3BGUA 1VQ6S 1EKRA 2O67A 1Q5VA 2YH1A 3DGVA 4AD6A 4Q7AA 3CTRA 4B9VA 1Q16B 1N5SA 4ZDNA 3UCGA 4DL6A 1X4GA 4PXEA 1FHTA 2UU9F 4B9SA 4M5GA 1VQSA 5LL6d 1CJUA 2G0IA 4A8MP 1UVJA 4DV5J 4C3MA 4EBDA 2VKRA 4F4KA 4IG3B 5DZ7A 4IR1A 1V6HA 3MAAA 3PVXA 1J5EF 2DRBA 4WPAA 1UW9A 4C0OC 3I0RB 4Y2KA 1YBTA 3DM2B 4CLLA 1PC5A 4KH0B 4C6AA 5KOXA 4USHA 4CIOA 3OSNA 5GAGU 2BJEA 3R7NB 4HKQA 1IM6A 1X5OA 1TKTA 2YQ1A 2JEFA 1KBRA 2CVIA 5FIIA 1KQFB 2J5AA 3R2CJ 3MEGA 2UZAA 4U6PA 1KTQA 2HQDA 1ROFA 1FVQA 3OXGA 1TZ0A 1TUVA 3KHGA 2HIQA 1RJJA 4ICLB 2FJBB 2DGUA 1RT5A 3HHLB 4FVCA 1ZA2B 1UJ4A 4ES3A 4DSLA 5HQMA 1Z1ZA 4X4RA 3K2YA 3CD7A 2PFFB 2HPUA 2J8SA 4MH8A 4BC7A 2Q6CA 5HBMB 3BEGB 3EICA 3ZXWA 3MM5B 3ZC4A 2NSCA 2G13A 4TLQA 2X1GA 3VGUA 2MQPA 5LXRA 2ZBRA 4ZN1A 3T5JA 4X4NA 1C0TB 3LP1A 2CPXA 4A4JA 2Y0BB 4TXSA 2LXFA 4IH6A 4WZQA 2FJEB 5C42B 4C98A 4LR8A 3SSSA 1C1CB 2Y3YA 1S9FA 1Y9OA 1U0SA 2GA7A 4KFBB 3OXFA 1RP5A 2GMHA 2OEJA 3V81A 1IR2A 3SFGA 2ALYB 4L75A 5C2GA 1H7XA 3CUNA 1SUQB 2R4FA 3QAUA 1FE4A 1KOHA 4ZPTR 2VC0A 1KS2A 1S7IA 4J9VA 2KM8C 2HBRB 2EC0A 3MEEB 3ILJA 3SDEB 2EFPA 1NHKL 3V6JA 2JL9A 1QTMA 3GR0A 2JC1A 4ZOSA 1R8AA 3AOBA 1HR0F 2MYFA 3ZTRA 2BDPA 2OSRA 1WF0A 1JB0C 2P6TA 1RAEB 2RS2A 4IRKA 3K57A 3Q83A 3OTDA 4HHJA 1RAFB 5IV3A 5EWFA 2DIVA 2YWFA 1HQEB 3PHEA 3N0VA 4M5DB 4PWDA 1S99A 2V9KA 2IYIA 1HPZA 4OIXA 2D7SA 3N4WA 5CZVA 3MEDB 2GVDB 4KIAA 1D8YA 3HSGA 3ZZYA 2UVRA 2EI5A 4NXNF 2DHGA 1X9MA 3CCES 1WHVA 4G1PA 5IQ6A 3KMSA 1S0NA 3OTEA 2XMMA 4RJVA 3GJSB 4BS2A 4CT9A 3F41A 1CVJA 1HW8A 1RK8A 4ZVTB 2D74B 4OI6A 4B3OA 5DQGA 4TQRA 4OYOA 4DV3J 3GE9A 1HW9A 1NK5A 3BGOP 3R7BB 3WDOA 1HARA 2CPEA 2E7WA 1HBOB 1MROB 3BH7B 4OLOA 5D78A 5THWA 3Q0AA 4HEA9 2Z4PA 4MFBB 4IG0B 1BY9A 3IP0A 4FKXA 2EK1A 3UN2A 5DDOC 3CCJS 3EZOA 2BE9B 5I42B 4JV5J 1S59A 2QSFA 2RE1A 2HHPA 2WSFC 3CJQA 3LO3A 5KT3A 4N56A 2KZMA 2E5JA 2EFQA 1F3VA 1LK7A 4RNMA 3MAHA 1LWFB 2CUYA 2BJ9A 4LF5F 4DCJB 1H74A 3KUGA 3KK3A 1TL5A 2K7JA 4PXBA 1DHMA 4OHYA 2KKHA 2WBRA 3ILIA 3TA2A 4PG8A 1BD6A 4EBEA 4WF9Q 2DXFA 1BQMB 1Y00A 3B82A 2QIFA 5IT4A 2FVCA 1PSDA 3CIMA 3GMGA 3MEKA 2ZEJA 3QQCD 3O3LA 2HNZA 2W7OA 1S1UB 2YKPA 3M8WA 2VKZG 3K8WA 4UUWA 1M90T 2XS5A 3VGSA 4J7CA 3RW7A 2VBYA 5DGBA 2JJ4D 4A8YA 2OELA 1HBNA 3GJTB 4QIWD 2DJWA 1TVRB 2HFNA 2QTWA 2HYIB 3TUPA 2LP4A 1B0VA 1VCTA 3FBCA 3IC1A 3MMBA 3Q89A 2R2RA 4PPDA 1X5SA 4UY85 3SMZA 1JLBA 4C7QA 2B9EA 1JKHA 4F4WA 2MZTA 3SQGA 1D0EA 3U7JA 2RF2B 1CS4A 3I6PA 3MD3A 4H54A 3Q2TC 4C0BA 2X1BA 2ZD1B 3TX8A 3UD3P 4QIEA 1WSVA 2GIRA 4RW8B 2ZH6A 3M6VA 1GK8A 2PEHA 4Y28C 3KUHA 1DBDA 2W24A 2XGQA 3LWMA 1HI0P 4IO9Q 1NUEA 3D54A 3PR5B 4O3PA 3HT0A 1K1QA 2Q43A 1U7LA 4KO0B 2EW9A 4Y2AA 2XGPA 4DSFA 5IT9U 4X4UA 2ASJA 2V2KA 2F8HA 2MMYA 3ENAA 4Y34A 2N3LA 2KH9A 2R2TA 1SCJB 2EWHA 2GHWA 2H48B 4FS2A 1MWYA 5J2MA 3TWZA 2PSZA 2OD4A 5D4LA 4PAAA 5F3TA 5DQIA 1F3FA 1FRIA 2NCKL 2OPRB 1KLMA 4FYYB 5E33A 5C7PA 3KK1B 1F2GA 3AQPA 4I67A 4L74A 1Q79A 2M5YA 2FGOA 3IWXA 1SXLA 4XPEA 2RSQA 1WUUA 2R8KA 2QMXA 2YKMB 5D4PA 3LALA 3GP9A 3W9HA 5AE3A 2MY7A 3JYTA 5AXNA 2K1RA 5KFQA 2DVIA 2VG7A 2W25A 3DXSX 4NLPA 4ZVEA 3DRXA 5HAOA 2OPPA 3BQ1A 1UFKA 4JV2A 2B7BB 2PFDA 4A48A 3MI7X 4IFYA 2MY8A 1PILA 4EI2A 1RWVB 4ZHRB 3KHHA 3QSYB 4JI6J 3EMTA 3LTOA 3JAMU 3ZZTA 3C46A 5AXKA 4DL4A 2Y1IA 3JS9A 3GFYA 2HFVA 2HVZA 3I4PA 2JFKA 3WIUA 3U1MA 2QYCA 3AJ1A 4O3NA 1MWZA 3GYXB 3NBPA 1K73T 3ZTQA 1Y7PA 2HG4A 3M8SA 4V19X 1TKZA 1WEXA 4DL7A 1HL6A 1KVKA 1QY7A 4KH1B 3W60A 5K8PA 3I55S 1HNWJ 2BKPA 1GXUA 3J81U 2LEBA 1Y5NB 3CJ8A 1OPZA 3BGLA 3PYEA 1T94A 4UT4A 1K9MT 3EGNA 2IVFB 3TYTA 5CA5A 4EO8A 5EDWA 1R6YA 2E66A 5HANA 3G8TA 1G2EA 4DEZA 3PKYA 1VGYA 2V4JA 4KC5A 1TUWA 2M3DA 4WBFA 2QEXS 2Q6BA 1FJ7A 2DGVA 2QL9B 1L3UA 4I6WA 5I42A 2WAQD 3TARA 3RR8A 3GG0A 1LEOA 1M5SA 2MSTA 3H5UA 4AQYJ 5HP1A 2OTLS 4O3RA 4JV1A 4LF9F 4K4XA 1RT6B 3J81j 4FVMA 3Q8QB 2I6WA 2HHSA 4LFCF 2VFSA 2R7WA 5IWAJ 1TAUA 2BV3A 1O6XA 1F9EB 2IM3A 2RDDA 3RG6A 3QLHA 4OYWA 4FZVA 1TMJA 1UEUA 2W9BB 3SCIE 1VIOA 4NA3A 2WVBA 4DUYJ 1DJ0A 2P9EA 4UOFA 3AD8C 3ENVA 1NH8A 1Y0HA 5IV4A 1S4EA 2GVDA 1BQMA 3R3TA 3HO1A 1U8SA 1IJEB 1GTHA 1SPBP 5HROB 1NK8A 1VRTA 1W2IA 2RB7A 2XSJB 4DPYA 2VPZB 2CQ2A 3L7OA 2KG0A 2FY1A 4WXOA 1RWKB 1YJRA 2FDNA 3VZHA 4P7VA 2IYGA 2ZC4A 3LP0A 2B3TB 3BDPA 2HURA 2Y1LB 1MMDA 3IA0A 4FS1A 1GH8A 4YMEA 2AMCB 3KLGB 2GW8A 2C3YA 1LW0B 5I4MA 3QJLA 1ICEB 4M5NA 2XY5A 3M9OB 2HQIA 3HXMA 1X9SA 1RCOB 5DLFA 4B9NA 4DSKA 1UFWA 2CQBA 3BKUA 1L3VA 2DR7A 4ECUA 4Z2XA 4Y3CA 3KK3B 4DHVA 2XZWA 3QIPA 1RHUB 3AH6A 1QAJA 3MMAA 1C1CA 1IKXB 4KB7A 1YRUA 2XZDB 1FKOA 3RJMB 1JLFB 3POTA 4XAKA 3VQTA 1CJTA 2C3UA 5E7OB 5K14B 5KFKA 1UVIA 1UWBB 5B0DA 2RRBA 3CJ0A 2F4VF 3CIZA 1FRKA 4FNIA 3RU0A 2E5LF 1RWUA 2DBBA 3H98A 4C8KA 4UQTA 1FVSA 5RUBA 2WW4A 3JSMB 2MDAA 2W1BA 5KG3A 1UEVA 3TJ8A 2WCXA 2DR8A 1LWEA 2HVDA 3HHLA 4CLPA 5J2QB 4PWUA 4CCHA 1S10A 2F4VJ 1P9YA 2R7VA 4J37A 1Q5YA 2V5HG 4LF4J 1GNKA 2GHVC 2UVUA 4HTIA 1FI4A 5J2PB 1CG2A 2J9EA 3R6GB 2P9CA 2ZVIA 3AAWB 3GTYX 2GJFA 4RW7A 2LQ9A 3QFHA 2AZ1A 4PG7A 4PZVA 3WC0A 5HN0A 3C6UB 3KK2A 3EPIA 4C8OA 1OS5A 2CJXB 3DHXA 3QGGA 4NE9C 2RQCA 2VJVA 4DFPA 2XG8A 2GJIA 4M5IA 2HGLA 4BWMA 4IYQA 3UDVA 1UKUA 3TVYA 4DPOA 2RKIA 3J80Y 2YXLA 2HHHF 3BQ0A 3DLEA 4A47A 4EFAC 2E9RX 2P8IA 4IH5A 2J0SD 4I7FB 4CO2A 2BE2A 4WFNQ 2KT2A 2Y1JA 1L3TA 1YBUA 5CYMB 4DWIA 3JSYA 2Q79A 3TZXA 3G2XA 4HI1A 2CQ1A 4WJBA 1M1GA 3KJQB 3NRBA 4DFMA 4USKA 2HBQB 1RYSA 2J8AA 4H4OB 3TUJC 4CH1A 2QX0A 3NGRA 3ZZZA 2R7UA 1XMOF 2VASA 5GMDA 5AJ3J 2KZZA 4ATNA 3OV7A 2QLWA 2C2RA 1QUPA 2Z0GA 2GHPA 3CO0P 1B7YB 1VMBA 2W2MP 2AGPA 2JVOA 2DEJA 2ZOMA 4EEYA 4K4SA 3EYZA 2J0XA 2DGOA 3HVTB 3MEDA 1IBCB 4YB7A 4X2BA 1SC3B 1HNZJ 3CJKB 2DNHA 1U4BA 1CJTB 1EB0A 5K14A 2JEGA 2R7SA 1LKZA 1KDNA 3ZZPA 3GFHA 3DYAB 3QFWA 4K5SA 3A8JA 1U25A 5D15A 3DDIA 5U47A 2ZZNA 2H51B 3D3CJ 1HYSB 1NZAA 3NBPB 3NNHA 2LVWA 3I9V9 4OMFG 3QRRA 1QVFR 2HWIA 5LT5A 4IRDA 2UUBF 2ATLA 1UVLA 3IR5B 1S6OA 2DHXA 2GGPA 2PA8D 3MEGB 4ZIWA 3HJVA 2O1PA 1BE4A 4Q2MA 1YWXA 3FJ2A 3FK4A 2KHCA 3HHDA 3OR1B 5DJBA 3VQSA 1UA0A 3IWLA 2ATCB 3OFHA 4AYBD 5SUHA 4IFVB 4CT8A 5GAHU 4XPCA 1K1SA 4OI0A 4K4VA 2DNOA 2DNPA 1CULA 1CQMA 5ETKA 2UUCF 2M0GB 1VHFA 1F6TA 2L9DA 3ENWA 4J9PA 1RTDA 4LQ3A 2N82B 2BACA 3IM8A 5B08A 3VHQA 2FJWA 2UUBJ 4F2RA 1D1UA 3TUIC 4OI4A 2XSJA 1AUSL 5JXSA 4I6YA 1FFGB 3PIOQ 2FVQA 1EZZB 2LKZA 2YNIA 4ITSA 2CPIA 3IRWP 2LECA 4A46A 1F5BA 4JI4J 2B51A 2B56A 1S79A 3L4BC 5HBMA 3CMAS 2VQEJ 3RAXA 4ZJOA 1SC1B 2AW0A 3FQLA 5FDLA 4LFBF 5J1EB 4B3MF 4GVLA 3KJVB 4IH7A 3GYGA 1TKXB 2OHDA 2RVJA 4QPTA 1FEEA 3SIPB 4E98A 1MSWD 3E2EA 1U8WA 2CDQA 1FKPA 5KG7A 1VQMS 2V6AA 2AYEA 1QAYA 2D41A 2M70A 4GVBB 4LT6A 3AA8A 4KGMA 3TAPA 2IVMA 4LFBJ 5HVHA 4IQMA 3FZBA 3PW7A 1B99A 3C16A 2EFVA 3VR1A 2BQUA 1BQNB 1LWCB 4MKVA 3ETOA 3CDAA 3GLJA 4URGA 2CQDA 1PJ6A 1R8BA 2RF2A 4WXWA 1I94J 3M1VB 2C2ZB 4D3HA 2ZH9A 2GZOA 4QR1A 5F41A 3BM7A 1MN9A 2YNHA 2MHEA 5L9NA 5T14A 1YVFA 1NDLA 2RQKA 2W9AA 2BEFA 2IRUA 2HIYA 2W7PA 4DOZA 2DITA 1K44A 1LK5A 3D1QA 5I3UA 3ICLA 4WFZA 1SQGA 2HNDA 2OPQA 2W7AA 3AOAA 4OHVA 4DG1B 2P9GA 3CCTA 5B0AA 2R7RA 5DO2A 1FWPA 3CCVS 1PAUB 5H9EK 1SQFA 3EM1A 1FE0A 1PG5B 1T03B 2UXBF 3M2VA 2O66A 2XM3A 3NCPA 2HW3A 5CYQB 2ZH8A 3KXDA 1P1LA 2FGCA 3CSKA 2MLXA 4ILRA 3Q8VA 3HP6A 1U48A 1D3WA 1HWIA 2HSEB 4W98A 2VG7B 3TVZA 3A4TA 3ENQA 4C8ZA 3EVOA 3G8SA 1YDLA 3OBIA 3C2PA 3FZ2A 4OQJA 2ZWOA 3MECB 5E2QA 3W2VA 8AT1B 1U1OA 3DLGA 3CT9A 5KFOA 2KI2A 4OYZA 2VL1A 3CJRA 1SC6A 2O5DA 2D3UA 3SEOA 4K4UA 1TQLA 5HQ8A 2BKNA 2FHMA 3D28A 5DDQC 5JVHQ 1X4DA 4DR1F 1U49A 4LR9A 3MM7B 3QRPA 1DURA 2DNRA 4H4KC 5HK4A 5ETSA 4DL0C 2YVSA 2R2UA 2YWHA 4YHHF 1SIWB 5CYJA 4I2PB 5IC4B 4IOAQ 3PRVA 1RYRA 4CP5A 4GC7A 2HLUA 1YJNS 3JSBA 4M63A 3TX0A 4IDKB 3FQKA 1PJ5A 5LOQA 2XY7A 3CCSS 2UUWA 2YNIB 2Z2MA 1HHSA 4I0WA 4NLTA 2XWYA 4ED8A 3WX8A 1S4FA 4O44B 1N5YA 1NB7A 3Q8PB 1UZDA 2H5JB 4WIQA 4Q8EA 4P72A 3I5CA 3ZZRA 2ZD1A 4DV1F 3MM8B 3BKFA 3P5BP 2AT1B 4ZVQB 2I5JA 4DQRA 3PTWA 3MUTP 4JI4F 3PEHA 3UVJB 4U67Q 2YNGA 1OJ4A 2OP5A 2JEIA 3DOMA 4KT0C 3U27A 5H9EJ 7FD1A 5D3GA 2I1RA 4RW4A 5EX3A 3NGUA 1CEZA 1JLGA 3GZ7A 4ZCKA 3G71S 3QJJA 4B3MJ 3BSAA 3K17A 1DLOB 3SQOP 3VGVA 1OO0B 1Y4ZB 4QWCA 3DHWC 4DMZA 3AHPA 3EUNA 3ET6B 3UE2A 2H54B 3DU5A 2VC1A 3M6UA 3TJ9A 3G6VA 3SV4A 4CLTA 4RNOA 3OT9A 1Q8KA 4MAKA 2E44A 2C3MA 3GSDA 3PX4A 4M5JA 3CCLS 4O3OA 3TA1A 3TUZC 1B4SA 3MAQA 3MPUB 3TQEA 5DG8A 3BO4A 2E9ZA 2QA4G 2KFZA 2V2QA 1BXNA 4NLOA 4F0MA 4ZKAA 3BO3A 1N34J 2NLWA 3M2VB 3G4SS 1T9UA 2W2QP 2WZ1A 3M8PB 5B7WA 1XC9A 4A8QA 3ELHA 2MKIA 3TNVA 3MCOA 2VF3A 4U9RA 4F0KA 4DV2J 4CLKA 2JEJA 2KTQA 3HKZD 5GAEI 4P75A 5I3UB 4ICLA 1ZM4A 4ZVFA 2RU9A 1RTHA 2GFFA 1X4AA 3THPA 1JKHB 4PQAA 1FNXH 4JI7J 2FLNA 3DRRA 2DCUB 4J9KA 1FD8A 2AF6A 2G9OA 3UN3A 3OL6A 5KFCA 4TVAB 5KFVA 2J7UA 2CPYA 1L3SA 2ZHAA 2XMTA 4EGLA 2WSCC 4WP8A 1I5OB 1IN0A 3PIPQ 1BUXA 1R31A 1XMBA 3DM2A 3GV8B 1FJCA 1JNZB 4N8NA 3OTOF 4CLFA 3RAQA 4EZ9A 1T9WA 4OYXA 2P2CB 3IM9A 3HZGA 4AXJA 1R6VA 2L08A 3M4XA 4NA1A 2UVWA 1HWUA 3QWPA 1B3TA 1M0SA 3ZZOA 4DXLA 1U1NA 1WOOA 1EARA 3EVMA 2RIJA 3M2RB 3M30A 1V5IB 6AT1B 4PYAA 2KT3A 5IFMA 1DTQB 5IZHA 1SJ1A 4MT1A 3KK1A 1U6BA 4CLYA 4P7TA 2NPFA 1QJHA 2VU5A 4GKJF 4JV0A 1TKXA 5J2QA 4KBIA 2HFUA 4NLGA 5KFHA 4QYZK 2IPOB 4EUVA 2DXDA 1Y10A 2ZNZA 4LIWA 5F8LA 5B0GA 1URNA 1TFWA 1SUQA 1YZ6A 2HAFA 3J7AN 4DR6F 4X4OA 1NJIT 3HSJA 4O0IA 1IR1A 3D0HE 1NRKA 3PEJA 1FK9B 3PRDA 2VODA 3CDBA 5HMYA 2IRYA 2QFIA 4KHMA 3BGRB 1U24A 3FBBA 4NRUA 4W92B 4LMZA 3BSOA 2W9CA 3B8HA 1HMVA 1SQEA 2Z2YB 5A8KB 1Q0NA 5G0RA 1O5JA 1HKAA 2OJ3A 2KU7A 4CO0A 2BXJA 1EHWA 4LUBA 5HI7A 2ILZA 3ITHA 4L3NA 1LOUA 3RRHA 1ZS6A 1XIQA 3H2LA 3N28A 4RW9A 3HT3A 3DMJA 1DFDA 2K3KA 4URSA 4C3KA 4PQUB 3PRBA 1T02A 2U1AA 3PKMA 2KYXA 3E01B 3T41A 3PACA 4DG1A 1PGZA 3CNQP 1A6LA 4NMLA 4X4TA 4C8LA 2BABA 2BZ2A 1U6ZA 2EG1A 3TR5A 1R89A 2LMIA 4NXNJ 4J9NA 3NAIA 1N6QA 1U2RA 2F9JA 2QGFB 3SFUA 4HVZA 2R9LA 2ADBA 5F8NA 3UFCX 1TL7B 1Q7LB 4OHXA 2JHEA 4RUHA 3GFXA 5J2NA 3N5BA 1FXDA 2FJDB 3FEYB 4WKRA 3M8QB 4L76A 2YY3A 2D3ZA 3DYAA 1X5TA 2VG6B 2XHWA 4ID5B 5CD4H 2WK4A 4RNNA 3OFEA 4EK2A 2Y8WA 2AJQA 1XTZA 2YKQA 2UU9J 1S6QA 1YJTA 4JBCA 1RHRB 3LAKA 3W9IA 4MFBA 4PEOA 4QYZJ 3FRYA 3H40A 4JV5F 4YS2A 3NWGA 2X51A 4DV2F 2HRYA 3KJNB 3WC2A 3A3NB 5ETVA 3OJUA 3JAMY 2HRUA 3IBCB 2XO7A 3CD6S 2C2OB 4TU8A 4MIWA 3G87A 2W9CB 1SL2A 1WKLA 4WFAQ 1YLXA 1NK9A 3C8YA 2L41A 2DHAA 2I9SA 2KL8A 3DRSA 4IOBA 2ZNYA 4ZLPA 2H4WB 2AD9A 5B0CA 2VA2A 1GTEA 1VLYA 2YWGA 4AUKA 5KG1A 2D69A 4KE5A 4DSJA 2R7OA 4BC9A 4E8UA 5ETMA 4DCOB 2V69A 3KK2B 1NJYA 2BA9A 2QLXA 4DV6J 1IKYA 3K89A 3KLVA 4K59A 3CE8A 2JC0A 3TO8A 5KFYA 4CNYA 2BJ8A 1RHQB 1NSAA 2OO4A 2XMVA 3I0RA 2CQCA 1IKWB 3FEZA 2L9WA 1A9NB 1IUJA 2MQNA 3H20A 2LXUA 1YJVA 1MU2B 3JB9k 3BSNA 1CC7A 3TAMB 2C28A 3E01A 3PYFA 2VQFF 2IDLA 4G1QB 4DBQA 3S8SA 3G96A 4F8RA 2NXNA 2QL7B 4YQWA 4NMXA 4MIAA 2XMJA 2XI2A 2O3DA 3VAGA 4W4MA 2ZUAA 1KD1T 1NDPA 2WHOA 2YX1A 4K7QA 2BQRA 4HL9A 2KHDA 5A8RB 4G1IA 1HMVB 4DF4A 2VQFJ 2K1RB 4DU8A 4USVA 3DLHA 5K5MA 1H73A 1XNRF 3HVAA 4JI1J 4G3IA 3QATA 5L46A 2WVEA 2KM8B 2E29A 2PA3A 1XEZA 1TL3A 2L3MA 2MSSA 3PFOA 2XEXA 1CJKA 1FX4A 2A2CA 3T1AA 3TP2A 3TZWA 1B64A 5L39A 1ELOA 2FPHX 2IBKA 4CH7A 3D9BA 4DZDA 4F2SA 4LFCJ 4JOUA 3EGZA 2O01C 4Y2MA 4I2PA 1NKEA 1GQEA 3LW5C 3Q24A 5KT6A 4K50A 4X62J 1UWAA 1GMWA 4I64A 4NLRA 3JTPA 3SXLA 1F5CA 2A0FB 4K0KJ 1JLCB 4DUYF 2DNYA 3HHLD 2E5HA 3D1HA 3KDNA 3M2UB 2VONA 5HVFA 1FERA 4RL1A 2HQFA 2KO1A 4A8FA 2KT5A 3D2WA 1VC0A 1QE1A 1RT4A 2BQ3A 1NU4A 4F4AA 2CA9A 2ZFHA 4WTOB 3OJSA 1S1VB 1IXKA 4F25A 3JQMA 5BYQA 5LSLA 3DGPA 1KWMA 3NMRA 4K0KF 4X66F 1DQ9A 1U1RA 4ZJLA 4QIGA 2X7IA 3MM8A 5ETQA 1U1KA 3GPAA 1KHWA 3I31A 1TK0A 1YRXA 5E0OA 5KFTA 3GCWP 5CYQA 4J9OA 5HROA 2COLA 2WVCA 4P2XA 2K7KA 2JX2A 2CKWA 3MDFA 2EC2A 1KQSR 4N76A 2HVIA 4EO6A 2FUG9 3H5XA 1KVJA 3A8KA 2ACMA 1HNVA 1HNIA 2VZ9A 4R8UB 2QA1A 1K0VA 1RCXB 3LUYA 5EHHA 4USMA 3I87A 3PW5A 2ZOFA 5D77A 4ECWA 1NK0A 4KGVB 2JWNA 2IBOA 4H4MB 4ZP8A 1SC4B 4E0DA 1S57A 3DGPB 3KLFA 2AV5A 3DRPA 3BYRA 4ZN3A 1S1TB 4QQBA 4BBYA 1JLEA 2J0QD 3PO4A 1VFJA 4DQPA 2B9XA 4FXDA 1RKIA 3TW0A 2RU3A 2W2OP 4ED1A 5HJYA 3OHBA 4Q5VA 4LF2A 4OJ3A 3MFHA 3CD5A 4DUZJ 3DI6B 2VH7A 5FD1A 2DH9A 3EDQB 4L73A 3J7A1 4NOHA 1JLQB 1GAOA 4OFZA 5GADU 3QT8A 4FYWB 2RRAA 3GV7B 4N77A 2CJQA 1S9GA 3HHEA 1PIEA 1YG0A 3WZ0A 5HMWA 2WONA 4Q45A 4RW4B 1SV5B 1WEYA 5E3PA 3IXQA 4DPTA 3PV8A 2QJ3A 2AU0A 2LEPA 4B9TA 3IGNA 4DPUA 3DDKA 1E6VB 3MECA 2M8DB 1DQ8A 1TK5A 3BZQA 4HDGA 2I5JB 2LQJA 4OZ0A 2P5VA 1NH7A 3D5MA 4V1Ak 1RAOA 3HF5A 4WIIA 1BC6A 2JSXA 4ZCIA 2Q1LA 1XMQJ 3IMQJ 4DR3F 3DKDA 3D6FB 4CM0A 1NHVA 3NGTA 2HZVA 4P74A 2MZSA 5F8JA 3GONA 4Z37A 4K4YA 4J91A 1RADB 3D6TB 3R5JB 2UXDJ 4M95A 1Z2ZA 1I1GA 4ID8A 1SJ3P 1OYDA 1TVRA 2EBGA 2E1AA 4ZVUB 3W1YC 1L3KA 2YWKA 3K8VA 2E7VA 2DB1A 3KHRA 1HHQA 3PNIA 2ASLA 1ACMB 1PO6A 1TMMA 1TR0A 3OUYA 1HNVB 2CPHA 2HNZB 5IQQA 2ZVSA 4FPIA 2C3OA 1U6FA 1OPIA 4KHPF 2OPRA 2UUCJ 1C1BA 4C48A 4LJMA 4DR5F 4P73A 4PCQA 4DQIA 3HK2A 3W2VB 4ILLA 1HYSA 3VAJA 1AZSA 3DRSB 1HBMA 4ZP9A 5HJXA 3H25A 1H38A 2OD6A 3OSPA 1BMQB 3SCLE 2R7XA 3MFIA 1N8RT 4TU9A 1M1HA 3P5TL 3MHYA 2EK6A 2F5GA 3W61A 3ZFVA 5A76A 1KONA 5DDPC 2CNNB 2I8EA 2ZJPQ 5KFLA 1HBOA 4YY3F 1JLBB 3OPKA 5DS7A 1KRPA 1LFWA 2F1FA 3QSIA 3R2DJ 1WTBA 4LF8J 4JYAF 4IKAA 1RT2B 1RGVA 3G86A 2PGCA 1KTVA 3KG4A 2YKOA 1R7IA 2DNKA 4B9UA 3AJDA 4P2FA 2CPZA 4AL6A 3CVKA 5B09A 3KHLA 1WHXA 3E3XA 2MHNA 4KPCA 4ZVHA 3IRXA 4A8KA 1HNIB 4R8UA 4OX9F 1S1UA 2QMUB 2L48A 2KRRA 3OVAA 1JJ2R 4DR7F 2AEMA 1QTNB 1FX2A 2AJ0A 2GO9A 4LRDA 4B9LA 3GU0A 4DJBA 3PJXA 2KG1A 4EZ6A 2DEIA 2OPPB 1I51B 4ES2A 1RTDB 1VS3A 2OFGX 4NXMJ 2EKNA 3BN4A 4DQSA 5E3CA 3A12A 1NSKL 3W8GA 4RBVA 4JI2J 5DZ6A 4IG3A 4LVOP 4OV6A 3KLEA 2OPSA 2RT3A 1URRA 5K8NA 1VQ4S 3G9CA 3KOAA 2CQGA 2NZ4A 1WDDA 1HFEL 2EFGA 1P9QC 2ZHOA 1U47A 1HQ2A 2A6MA 2F3JA 1RT3A 1KQGB 2YWEA 3ADAC 1NPRA 3HDSA 3HVTA 1PC4A 3JXOA 4MYUA 1VC6A 1FKPB 2CYYA 2LXIA 4LSNA 4UUXA 5AJ3F 1N0UA 5JMNA 1JQGA 4ZPCA 3QJPA 3JQJA 2IJRA 1MG7A 3MTKA 4CYUA 1AFIA 1HQUB 1S1XB 5J1EA 4GKKF 1VLOA 3H59A 4HH0A 1N33J 2KJWA 3MD1A 1VJWA 2C2MB 3T5LA 4RW9B 2VV5A 1JK9B 1AROP 2HNYB 4CLSA 4KO0A 4BCAA 3FCVA 4ETZA 3Q2SC 2WB4A 1OSCA 1I94F 1IKVA 3BJYA 1ZZNA 1BWEA 4C8MA 1RWNB 3KNAA 1PBUA 3B4MA 1CBKA 4OI1A 1IWGA 2AP6A 3PR4A 2U2FA 2QSWA 3MURP 1J2VA 3OXLA 1XMQF 2ZKUA 5KFSA 2PC6A 3MCSA 2F7VA 3BQ2A 1XR7A 3UPFA 3CCZA 5J2NB 1J5EJ 1FFWB 3AOCA 3KDOA 4DX8H 1IVZA 1NEEA 3L9ZA 1RT7B 3SDEA 3OR1A 3S7RA 4HTJA 3TEGA 4M5DA 1KP6A 1AFJA 1RBLA 4HI2A 2FVSA 1XBWA 2BE2B 3MGJA 5JJBA 5KT7A 1WDTA 3TA0A 5EX0A 4IUFA 1HNZF 2ZZMA 2OTJS 1VHIA 1ZPVA 3VF0B 4O4RA 3O44A 2V63A 2B4OA 1SKSA 3BDEA 1QLNA 4MKAA 3MEEA 2CJ9A 2MTLA 4KHPJ 4DN0A 2VICA 3BBCA 3SSQA 2QE5A 3ZZ0A 1N88A 5CXTA 3RBDA 1C0TA 2XMUA 3LP1B 3MTJA 1G3OA 4KGXB 3KLHA 2DR5A 3LAMA 1YZ7A 3V4IB 3ITHB 4K2JA 1KNZA 3MXHP 3O2IA 3BN7A 1EP4A 2EPIA 3FCWA 3JTOA 2QMWA 1M5KC 2AWZA 4U96A 1OYEA 2E7XA 3C15A 4DR1J 5CQGA 4A8OA 3N9UC 2RUGA 1SIZA 3QNWB 3EX7B 2JLGA 2IJFA 3NG8A 3SBMA 3FFIA 3T1HF 2BYCA 2CZ9A 4Y2IA 5CCLA 2CNOB 2DH8A 2WB1D 1VBXA 2HNYA 1OWXA 4ED5A 1RT6A 5CD4A 2MQLA 1H98A 2MKHA 2R8JA 3RBZA 4XK8C 1C4CA 5K8OA 5FJ4A 1S6QB 4OZ3A 2BR0A 1FO1A 1GXTA 1TKTB 5LM7E 2WOMA 2UVVA 4C4WA 1KEKA 2N7YA 1WEZA 2M2BA 3GYNA 1HNXJ 1S6UA 4NZ0A 1EP4B 1TKDA 2HAIA 2V8PA 4K4ZA 3QAEA 3VWSA 2PD1A 2QL5B 2XC9A 5E3RA 1FRJA 1K0TA 2BW2A 2N3OA 3CCWA 3OTCA 5KFXA 5D4OA 5KFFA 2YPZA 3D67A 1FRXA 3FBEA 2MKCA 1HQEA 1H2TZ 1XJWB 1RWWB 2FZGB 3A8EA 4ECRA 1LW0A 3KLGA 5KFWA 1JWWA 2PEBA 2B43A 2FHJA 4DSIA 4IQXA 1SJ4P 3R1HA 2WBMA 4IR9A 5BJRA 3KG1A 1VQ5S 4WYWA 4GO7X 3DOMB 5I3PA 2DY1A 2B5JB 1X60A 4LRCA 5KFPA 1RE1B 2W8KA 9RUBA 4X64J 2DNGA 2CFXA 3M8YA 4PG6A 1NBEB 4PG5A 4C11A 5C25A 3K58A 1N33F 4ANCA 4TKTA 4DV5F 5GADI 2IA0A 4UF4A 2EKYA 2GQ2A 4ECSA 1RLDA 2LA4A 3AA9A 3MUVP 4DV4F 4F3QA 4GKJJ 2VHGA 3N6NA 2XTJP 2AJ4A 4KY3A 4AFFA 3ISND 5GMEA 4ALZA 2W8LA 1VC5A 1NKCA 1K8AT 1KFSA 2LDIA 3HM9A 1O8BA 2E5GA 1G1XA 3DRRB 4ELTA 3OVBA 1GEHA 4KQZA 4TQSA 4OYBA 5HLFA 2DXEA 2EXUA 1X4EA 1T9TA 2IY5B 3Q8UA 3I82A 1AB8A 4ED6A 3ISNC 1S0MA 1N5TA 1YJWS 4IOCQ 3DI6A 2W2PP 3UD5A 2BOAA 1F0XA 4OJHA 2CVEA 2BJ3A 4CM2A 1Q53A 1S1WB 3PDNA 4QW8A 3GV5B 1VRTB 2EVZA 3CWJA 3FBFA 1Q86T 6FD1A 1DQAA 2RMLA 2GQCA 2ROPA 2Z58B 4R0EA 3F56A 3KLFB 3RB4A 1T03A 1UVNA 1RBAA 3CD0A 4RW8A 2VA3A 5CCMA 2GAHC 4FF2A 1VQYA 1R0CB 4L6V3 1Q78A 5L1KA 1IBKF 4LVNP 3QBCA 3VGTA 2ZM6J 1D09B 2DRDA 4DS5A 3D1OA 3M32B 3SQGB 4XIUA 2F63A 1CJVB 4CNZA 2OSQA 3TJAA 3AD9C 2BJ7A 2CQ3A 1TELA 3M8ZA 2CG8A 2FD2A 4UZCA 2CNKB 1V5VA 4JB8B 3RBXA 2ABYA 2XULA 5A0YB 5MLCV 4DPXA 2LA6A 3MMBB 5L8RC 4ECTA 2MEWA 4LF1A 4DR2F 4ZHRA 4O0NA 3N6MA 4R5PA 3VAKA 2GX8A 1HBNB 2HS4A 2RDIA 1VISA 4N47A 2G2YA 3TEHB 4A8XA 1ZAVA 4YB6A 3PX6A 2MZRA 3EVWA 4P6QA 2QLFB 1B0TA 4OYIA 4TN2A 4HYKA 3VCDA 2ZHBA 1F5AA 1IR0A 2DNQA 2DYAA 2GC8A 2ZBQA 4EU0A 2ZDPA 5J1PA 4EBCA 3H4BA 1ZYQA 2CPFA 1SV5A 5CAAA 3H0PA 4YB5A 3K5PA 4AE5A 5KFMA 3E8OA 1NPKA 2LQ8A 4MJKA 2CQIA 1NNDA 3I0SB 4NLWA 3T6BA 5L1LA 2NXJA 1Q4RA 4ED4A 3FRZA 2UV8A 3BV8A 1Q8IA 4OJ1A 3MR5A 2K2PA 5K9FA 2IRXA 2R8GA 1Y3KA 4TYAA 5T7LA 3AB4B 5D0HA 2AEFA 2AGQA 4UW2A 1NJZA 2HK3A 1HHTP 1WG5A 2HGNA 2PN6A 3LWLA 1RWPB 4NYZA 5GMKa 5GAGI 2KVIA 4KYZA 1ULRA 2JLFA 4GC6A 1FNMA 1S97A 3L3CA 4IFYB 3UWTA 3W5XA 4J90A 2XO6A 3K5MA 3K7RA 3TANA 4B02A 1RU2A 4ZP7A 4RU9A 3QMQA 4O23A 4URQU 2YPYA 3Q86A 1Z2LA 1J27A 1B0PA 2NXCA 3HFZB 3L7UA 5DG9A 4X64F 2GAGC 2KXFA 2R2SA 3V4IA 3J80U 4N8OA 4DV6F 3N01A 4LF5J 4X4QA 1ZBTA 2H4YB 2JZ5A 3NCQA 3QO9B 4RW6A 1YGYA 3MPDA 2GS8A 3SCJE 5HMXA 2DIUA 3M32A 5FLXY 1SH2A 1S49A 1F60B 2J7WA 2OPQB 3VVUA 3J7YU 1YJ9S 1HD0A 2X1AA 2H65B 2DO0A 1BQNA 1LWCA 3D66A 3R5AA 4WU2A 4D3GA 2AEJA 2V94A 2V8HA 2F8EX 1GT8A 2IHR1 2WOMB 2WSEC 3B78A 3P96A 2CNLB 3QGPA 3DNCA 1MNEA 1RAIB 1HR0J 3AODA 4LRAA 3RB0A 4ZITA 3FCHA 2OH2A 2RH3A 1NCLA 5B0FA 1IKYB 3UR3C 3UD4P 1S72S 1WWHA 3HI9A 2H5IB 2AZ3A 3VAMA 4WE1A 5BR8F 2MQMA 4CI0B 1ZA1B 4NEYA 2UV8G 5AE2A 5KTQA 2FHOB 3H8YA 5G0RB 5IWAF 1VQOS 4P10A 3TRGA 1TL1B 2B6AB 2IVYA 2RNEA 2VD3A 5BYSA 1KFDA 4FF3A 1C0UB 1RAAB 3DLKA 2IC3A 5E5NA 4GVBA 5C24A 2C42A 4NCGB 1YSJA 4WK1A 2RJZA 3IWNC 4JI3J 3GJQB 1U09A 3RRKA 1N4LA 1IBKJ 4XO0A 1GX5A 4UOHA 1UCNA 3KJVA 2RRNA 2HNDB 2ZOGA 1OQ3A 1HQUA 4RNHA 3D0IE 3BPDA 3KJFB 2NUUG 5D4NA 1LNQA 4USUA 3R5DA 5KFGA 4C11B 1RHMB 2JH3A 3GIJA 3AY0A 4JI0F 2RKIB 2CQ4A 3JTNA 4ZMMA 4DFJA 4ENOA 2HHVA 2B5JA 4FYVB 5D0RA 1RWMB 1HA1A 4OX7A 1LV5A 4LFAF 1AA1B 2XZTB 1JXLA 3FC9A 2E1MC 3ONQA 4WCEQ 4HDHA 2CWXA 3H5SA 1R27B 2Z2LA 3OLBA 1FDAA 1QSLA 4NCBA 1J5OB 1FXLA 1FRMA 2ILYA 3UDEA 1IBMF 1RQ0A 1W7WA 4CO3A 3I5BA 3HZEA 5C42A 3V4MA 1W25A 1WI6A 2IJNA 3S01A 1TL4A 3AT1B 3P4UB 2AJ2A 4X84A 5ETOA 2ZE2A 3C14A 3JSMA 1NSPA 2OUGA 1D9AA 3MMCA 3PJWA 4ZPDA 5J2PA 1VQ8S 3Q8RB 3M2UA 2PI4A 1D8ZA 3EWGA 2Z30B 2ZUGA 3DN9A 2VFRA 2AJFE 2HHQA 1ZAXA 2EFOA 2CJAA 3N5FA 1LQ9A 3CO9A 4M5MA 2K8GA 4I6AA 4BWJA 1R0BG 2R7TA 2OAUA 1S1XA 3A13A 1FJGJ 2V0NA 4UOCA 2VUGA 4CWBA 2FHJD 5KT2A 1IKXA 4LF7J 2BANB 2CJYB 2YWWA 5CZXA 4ZCLA 1KSPA 1E6YB 1VIXA 1JXVA 3CJKA 3W2WB 1HNWF 1NPPA 4QWEA 2SXLA 2W4PA 3QT6A 4ZK7M 1PKUA 2MZJA 3DLKB 2ROGA 3F44A 1OQ6A 2FYXA 1MMNA 3DLEB 2F65A 4EWTA 3C15B 5M2UA 4ECZA 2CZ4A 4MKBA 4OHWA 1ZETA 4GMKA 2XHCA 2A10A 1EX8A 1CULB 4H4OA 4JI6F 5KFJA 4ED7A 4K4TA 4OV1A 1C1BB 1G6BA 4NLUA 2G4BA 1AYEA 2NREA 2PE8A 4YB1P 1JLGB 3LH2S 4AL5A 3M05A 1RT3B 2ZE2B 3C14B 4I4BA 4G1QA 2JVRA 1DTTB 2XCAA 4FKYA 1D9DA 3SI8A 3LOUA 1WKJA 2GJ2A 2OPSB 2CQPA 3MZIA 1WNEA 1KR4A 2JFDA 2CADA 9ATCB 3HD2A 1T95A 1Q95G 2VG5A 3OQ2A 2CG4A 4J9MA 1RSCA 2C3PA 4FYDA 1YIJS 1WC1A 4G6VB 3QO9A 5FLXU 5LMNJ 5AXMA 3C6UA 2HKEA 1XMOJ 2B4UA 3JSRA 4NL5A 3T3FA 2J6TA 1RHJB 1OMSA 3TZYA 2FLPA 5KG6A 1Y5LB 2IC3B 2VOOA 3IRXB 1UA1A 3PG9A 4TLRA 1QAIA 1JLFA 3POTB 1RTHB 3DLBA 5DLGA 1Q8LA 5ETRA 3T5HA 2MQQA 2QLJB 4Q8FA 1WC3A 4NLQA 2YQ3A 1WF2A 3WIVA 4J9RA 1U1MA 4YDXA 2UUAF 2BW7A 1NMEB 1FK9A 1SVDA 2V4JB 3H4DA 3EZ5A 1S0OA 3Q8SB 1NHUA 1FDNA 2WONB 3P8BB 4M5LA 4PPZA 1JLAA 1SH3A 3R5CA 4QYRA 1NK7A 2DPIA 2IAJB 4DR3J 3N6LA 4I7FA 4S0MA 2A2DA 2AQ4A 1JLQA 4P2MA 2DGQA 2Q66A 3G8QA 1RT1B 2LLZA 4LFAJ 3MPWA 4HT7A 4DI6A 4GO5X 1DAXA 1APSA 1NXIA 2RUSA 4UOGA 4F0HA 1FFSB 4X62F 1J5OA 2V68A 3M30B 2K3IA 3M2RA 2FQQB 3R7SB 1X8DA 4DFKA 2QG9B 2VPXB 4LREA 3NS6A 4Z7CA 4N5SA 2QC3A 3UNYA 3EXCX 1RA7A 3ZO7A 5EWGA 3GIMA 1RWOB 5L1IA 2C2NA 2VBXA 4M94A 2AKWB 1RACB 1CSJA 1U2FA 5IC6B 4O4GB 1UPPA 2UXCF 2LCWA 1LWXA 4I2QB 2ROEA 3BREA 1UAWA 4CTAB 2B7CB 4IO1A 3OL7A 4L3KA 2B9YA 4X4PA 3IBWA 5KFDA 2DHHA 4YP3A 2ZITA 2E1CA 4GRSA 5CH7B 2V4RA 2B8QA 3R5GA 2FC8A 3CCMS 1KQKA 2JRSA 4FBUA 2RAQA 2ADCA 3H2VE 2DGXA 2IA6A 3C66A 5HP1B 3ZNJ1 4USWA 4NXMF 2HQ3A 3K5NA 3PXGa 2BRKA 2HEKA 2KN4A 3D6MB 4Y65A 3T19A 1VQ9S 1FRHA 3OHAA 1HIYA 2M52A 3BGRA 2MJNA 3RZAA 2X3DA 1T3OA 4ZS6A 4CH0S 3MCNA 2KYZA 4F4XA 1HWKA 1I3OB 2DY9A 2HS3A 1GMVA 4F67A 2E1RA 2MKSA 4OYPA 2FJVA 4NX9A 2ASYA 1JLCA 2W01A 1AW0A 4U8YA 1REVB 4FN5A 1HBUA 3DXBA 2GCFA 3CEDA 4U7UK 4A8SA 1CQNA 4P52A 3BBFA 5B0BA 4DUZF 1U1LA 2DGTA 2VDIA 4F3MA 4FF1A 4KGKA 5HLFB 1SI9A 2GQQA 3IG1B 4R0JA 3TAQA 1NM2A 1UJ5A 2M9KA 3W9JA 5LMUJ 1X4FA 1Y5IB 1KC8T 2J6SA 4NCAA 3MM9B 2NXEA 2KB2A 2B9WA 3PYDA 4RW6B 4ZLJA 3UVJA 2HQCA 4KGZB 4CLZA 4ZVPB 5K8MA 1AXQA 2ERRA 4LRBA 1B7FA 1VR6A 4RWXA 1KKHA 2DR6A 4DF8A 1H3DA 3O1LA 1R8HA 1TP7A 3S1TA 5AXLA 2WVDA 3MPYA 1IQTA 5HSPA 4LQ9A 2J9DE 3JYTB 4YFUA 5A6PA 1PYSB 3QLHB 4M5KA 3SCKE 2YKMA 5ETLA 4DR5J 3K5LA 2GMLA 2HHUA 1RTIA 3IGVA 2J76E 1N5VA 5H1SV 1ZAWA 1OSDA 4I2QA 4PXCA 1S9GB 1R8PA 2NXUA 1ZOTA 1F2HA 2M7SA 3I5AA 4HH1A 3RGIA 2F8MA 5KFNA 1IBLF 3IS9B 5F9NA 3W65A 1E6VA 3I4HX 3CDEA 1AUDA 1JNRB 3JQKA 4CDIA 1VJQA 4ER8A 2ASDA 2CJBA 5KFAA 2AYMA 1EETA 4EMDA 3I0SA 2FB0A 1F9FA 3PCOB 4NZ7A 4OZ1A 4K8RA 1S77D 1HWLA 1JXEA 2DTJA 2QA4S 4NEZA 3T1YF 4USIA 4NYPA 2XYHB 4F26A 2KJVA 3OFGA 3NEKA 3T1HJ 2CIMA 3GJRB 2FY8A 1NK6A 3R5BA 1JLAB 5L38A 1MROA 3DDNA 1U02A 2XYGB 4FXWA 2A1BA 2M4MA 2NZCA 4MTPA 3VVTA 5IM0B 3DCAA 1X7VA 1RAHB 1X31C 2G1HA 3CDWA 4P71A 3HVRA 3DOLA 4HACB 1C2PA 4H4MA 3ILOA 3IR6B 2UXCJ 1X0FA 2L9NA 4OI3A 4TYBA 2MLZA 2E9TA 5A8WB 2YNFA 2J7KA 2ZH7A 3RUBL 1NK4A 1VBYA 3AD7C 4LF8F 4JYAJ 4C8NA 2Q3PA 4LBPA 5KFEA 2OKQA 4CO4A 1X4HA 2N7CA 5KG2A 3PY8A 3ZTPA 3CCRS 5HATA 3I56S 1X0PA 1KOOA 3MOZA 2VBWA 2GNKA 4QJVA 2VIHA 1N5YB 1U2CA 4I69A 3CPWR 4HT5A 2RHQB 3PJ9A 2A6OA 1QE1B 2DRAA 2QLBB 3S6EA 1UW4A 4F3OA 3CMQA 1DRZA 3ETMA 4P9SA 2PDAA 3R9LA 3T9ZA 2LDYA 1QDUB 2N4CA 3DOKA 3KFWX 2DGSA 3ZZUA 3UCUP 1N34F 2V8VA 1NZ8A 4M8LA 2XS2A 2GIQA 3V6HA 1LWEB 4OX8A 1JJCB 4J9LA 5DG7A 3KTQA 2R8HA 1YTYA 2IMWP 2VPYB 3GSIA 4ZPVR 3L7PA 4WYLA 4DLEA 3LANA 1UEKA 1FA0A 4O3QA 3TVKA 1RT7A 3L95X 4ES1A 3KYLA 3CW2C 5T41A 2HBYB 4CO5A 3A1YG 1U1QA 4ELUA 1FEHA 1O0PA 2OI2A 3O6QA 4ZLNA 2X1FA 2ZBPA 3KG0A 1R43A 3BPSP 1Q82T 1F9HA 4JI8F 5F8GA 4RX6A 4ZA1A 1YHQS 2I2YA 3MMAB 4HLBA 3ZNUA 1ITPA 3CJ5A 2BRLA 1RWXB 4QR0A 4RNFA 1YX2A 5D0EA 5DM7Q 2BUNA 5MAOA 2OEKA 3MCMA 2PMWA 3W5YA 2E1PA 2GMJA 5D0GA 5EUHA 3KLHB 3R8YA 3EE3A 3NL0A 2PO4A 1RA6A 2MKJA 4DV7F 3RTVA 3X1LB 2RQMA 2OGUA 2XS7A 4MKYA 3EPGA 1WOSA 3SV3A 5H9FJ 3VAHA 1RTJA 3LP2A 1FF2A 4ECYA 3P3DA 1N48A 1JJ4A 1FKAF 4QR2A 2CPJA 3V2UC 3CC2S 5KFUA 4P2SA 4R25A 2Y1RI 3U1NA 4U95A 2MZ1A 3NAHA 4ECXA 4NASA 1T3NA 3NMAA 4E2FB 5EN1A 1VRUB 3UDCA 1DTQA 3FGVA 1XQIA 3GR1A 3MMCB 3GFZA 4Y6IA 1LXJA 1GMUA 4RUCA 1IBLJ 4RBUA 2AIRB 1N32J 3W63A 1RKJA 1N5QA 2PI5A 1RTZA 3CB4A 3KLEB 2NR0A 5EWEA 3GIRA 2RDJA 4CLUA 2FZCB 4RO0A 3UW1A 2I0XA 2BE7D 2OFHX 4TY8B 2JNJA 4OZLA 4ZPWR 5KG5A 4JI5J 1Q7YT 2GIFA 3MAAB 2G1DA 4WWSA 3M6XA 2YNFB 1WC5A 4RPFA 4Q43A 2ZJQQ 4DV1J 2NYHA 4EYHB 1XERA 2IM0A 1RTJB 3EDRB 3ULHA 3KUEA 1MN7A 2QA2A 1N52B 2HLTA 3DOLB 2RS8A 2MPUA 4HACA 5DRKA 3DLJA 5IT0A 5A2QU 5IM0A 1MWQA 1E6YA 4OYMA 3W2WA 2H9ZA 2ZH1A 4Y00A 3WQPA 5F8HA 1TFYA 3P49B 3G6XA 4JI5F 3J7ZT 3D6HB 4ZPAA 1TAQA 2F9DA 5T7LB 3CC7S 2B4PA 4KAIA 4NZ6A 1ZTTA 4DN9A 1SBRA 2CPDA 2DNNA 2ZH5A 3HD1A 2FVRA 3ZTOA 1N36J 1RHKB 3HHLC 1KN6A 1Y11A 3HVWA 4X4SA 1S6PB 4Q0BA 3FSYA 1ZM9A 1H2UX 2IM2A 2W2NP 3HSDA 4HHUA 4J5OA 1FCAA 4WK3A 2VQEF 3PFEA 3MM5A 4KR0B 3TQ1A 3QT7A 4RBTA 3TOQA 4CO1A 2LYVA 2NSBA 4TU7A 3B54A 2DPJA 4WZMA 1IM4A 4OZ5A 1OY9A 4DV0F 1WJ9A 4B3SF 3NNCA 3GG1A 1AZSB 4XDDA 1N36F 3PO5A 1RT5B 1UP1A 5H9FK 2BM0A 3Q23A 1WHWA 3LP0B 4UQGA 5G4DA 1MLAA 1VI7A 1UVMA 3TZZA 3PZPA 3NP5A 4DX5A 3PW0A 3IAS9 4I68A 3OLAA 1D9FA 3RB6A 3R97A 2DH7A 5J1NA 3J7YI 4YUDA 1CPZA 2F4FA 3THVA 2HMIA 4ZIVA 2KXNB 1VRUA 3HSZA 3AQOA 4YOEA 2V67A 1BWVA 5HO4A 2X3GA 4OZJA 4OLPA 5HQLA 3T5KA 4OX6A 3MUMP 3LP2B 5A8KA 1WG4A 6FDRA 3A8IA 3K59A 3OW2R 1VOMA 2D9PA 2V2VA 4DX6A 1CJUB 5LSOA 2R7QA 5DM6Q 2ZH4A 1S6PA 1HI1A 1O51A 3H90A 3GIIA 1QSSA 4KPYA 3MMJA 3WX4A 5F3ZA 2BANA 4KTQA 1MMLA 2FLLA 2NS1B 4OL8A 2KXHA 2VDHA 1HBMB 3HFKA 3KNGA 2LU2A 4LIRA 4MMOA 4ED3A 4W90B 3V6KA 4NRTA 3QIPB 5BXIA 2AGOA 3C3LA 1S9EB 4DV7J 2HVEA 2IM1A 1FJEB 3GCXP 3WHIA 2EEYA 3DOKB 4B08A 3K5OA 4ANEA 3OR2A 4O3SA 3DRYA 1FD2A 2MJUA 4I56A 4DCPB 4PABA 4F4ZA 4OZ2A 1IJFB 3J81Y 3EJMA 3C6TA 3ISZA 4QBUA 3OTOJ 4F4YA 3ILLA 1I6JA 3HKWA 3RAMA 4RU2A 2JDJA 4NLDA 3W3SA 4ILMA 2FJXA 2ZBIA 2C2KB 5LSRA 2DCLA 2BMBA 3OTBA 1SL0A 3MR3A 3ZTSA 5M2PA 3NGDA 1JJHA 2Z8QA 2LU1A 4OZNA 1S12A 3KWMA 1M1KT 2DR9A 4H4KA 2YBVA 1KLNA 2YQ0A 4JP8A 3G6ES 4MK7A 1W26A 2OMOA 4QU6A 3C19A 1HD1A 2YNGB 5KFRA 5DGAA 2ZZTA 1V3RA 1VQ7S 2WTFA 4JI1F 4C0HA 1VQNS 2FJAB 3A3PB 5F0UA 3FMWA 3A3OB 3OD2A 4O4GA 5L1JA 4RLEA 3RRGA 2FTRA 4J9UE 1VQPS 1QUVA 2XWXA 1WG1A 4C3LA 4WKYA 4RR5A 3LQVA 3UCZP 4B9MA 3FVYA 3AJ2A 3W62A 1N54B 2YNHB 2NUHA 3UN5A 4ANDA 4TY9A 3SYZA 2KFNA 2Z2ZA 4FXVA 4MYTA 4Q2LA 1V3SA 2VFVA 3PYGA 1N0VC 2XB2D 2DKOB 4FDFA 4IDKA 4QWAA 4K2XA 5JVGQ 1R0AA 1UWBA 1K47A 1QAXA 3IG1A 2HRTA 3LF0A 3EXYA 4PYDA 1GXLA 4JUZA 4ETXA 1HLWA 1UPMB 2J6UA 1RISA 3VALA 2PIIA 1TL1A 2B6AA 2V8GA 3LGMA 2MZQA 3CJSA 2W4DA 1PYTA 3ET6A 1XWLA 1A7GE 4KKOB 4X4VA 4WFYA 4DU7A 3IS9A 4QW9A 4YN3B 1R3NA 3MM7A 1YK9A 1DLOA 1P1TA 2DK2A 3H5YA 2BBEA 3MWBA 4FYXB 4WE1B 3T9NA 4NI2B 2GVZA 3IO1A 4DV0J 1DY3A 2RD5C 3CDUA 2ZH3A 2R42A 4M5HA 4JI3F 4LBHA 3DRPB 4NLVA 1GX6A 2N4DA 1UZHA 2DO4A 1XR5A 3FFIB 4ZVSB 3O8WA 2B0GA 3V6DA 4QU7A 3NS5A 4NLXA 4RKUC 5ETPA 1VDHA 3D3BJ 4QPXA 2K06A 4X65F 2AYBA 2DGWA 5GAEU 1LXNA 4RUAA 1FDDA 2YH0A 4DL3A 1Q81T 3FSIA 3IAM9 1IBMJ 3F0NA 5C25B 5D3GB 4BDPA 3SSRA 3W66A 1TL3B 3G82A 1T9YA 3RBEA 1BQXA 1OY6A 2H5EA 4KSEB 1CJVA 1BGXT 3BKTA 4X65J 4JI7F 5A8RA 1X4CA 4ECQA 2A18A 1YKWA 3RB3A 2HK2A 2HHXA 5A8WA 1NDCA 2HQGA 5KOWA 5KFIA 3CCUS 1HI8A 5AT1B 1S1VA 4DR2J 3V6DB 5BR8J 1X9WA 3EZUA 2V4QA 5BYRA 2W4CA 2MQOA 4DS4A 1ZM3A 3NGKA 2BM1A 2V34A 4U8VA 3OR2B 1YRTA 2MQ8A 2KFYA 3AFGA 2QZ8A 1RLCL 4NI2A 4QWDA 2XQCA 4DL5A 1NJWA 2HFSA 1S9EA 1QD1A 1TUGB 2VPWB 3UNGC 1SKRA 1ZH5A 5FDLB 4AQYF 4KKOA 3CGIA 1LFPA 2LQBA 1KVIA 2HHWA 2Z56B 5F8IA 2EBEA 2RILA 2AHOB 5D6GA 4PKDB 1VRQC 4LF6J 3QIDA 1RT4B 4C8YA 3OL9A 2BVZA 2QYGA 2VOPA 1XNRJ 5M2RA 2ZC3A 2QFJA 3MM6B 2WVFA 2FIUA 3MOJB 4F02A 2XNQA 3LGHA 4RUBA 4JI0J 3HULA 3NCRA 1F1BB 2EG2A 2V50A 1T11A 4F50A 2FC9A 4ZJQA 1TKZB 4DPWA 2D3OR 4LSLB 1CS4B 5HMZA 4LF6F 4ZCMA 2J0WA 2CJKA 3VTIA 2DNMA 4R5PB 3R27A 2AX0A 1B70B 4KRWA 2PT0A 2VBZA 3CJTA 3FSXA 3T6JA 2AYGA 3I96A 3HHKA 3KLIA 5HL7Q 3TI0A 1RTIB 3PW2A 1NB2A 3RYLA 2VFTA 5KT4A 1PBAA 3NY0A 1VQKS 1EQMA 3B4DA 5LMNF 3TAMA 2QO3A 5DQHA 1WACA 1FXRA 1JIHA 2LQ5A 3BGFA 2KDOA 3M1VA 4LBIA 3B6BA 4RWWA 5JUMA 1M5PC 4MK8A 2VG5B 3VAIA 1WI8A 3M8QA 1ZZFA 2CQ0A 4DQQA 1SH0A 2OMLA 4G65A 3RW6A 5IXUA 1TV6B 4UY8T 1U0HB 5IT9Y 3U1LA 3VAFA 1TL7A 3C6TB 5C5JA 4CRJA 2Y0SD 1DTTA 1XN9A 1S1WA 8ATCB 2GGPB 4B3TJ 1L5UA 4DX7A 2QV6A 4FF4A 4PR6A 7FDRA 1SJRA 1S7HA 2XNRA 1S76D 4LF7F 1YQHA 3V81B 3C16B 4XTTA 3HMJG 4CZCA 4YR2A 2G2ZA 5IOLA 4USJC 2MB0B 1FTRA 3I9ZA 2HFOA 2FLOA 1RT2A 1NSQA 2DHSA 3J7Z5 1S0VA 1T8EA 4B3TF 1WC4A 3EGVA 4DDFA 2HWTA
chains in the Genus database with same CATH topology
3ET6A 4OYMA 4WP9A 4OYWA 1YK9A 3MR7A 4NI2B 2GVZA 4USTA 1TL7B 1WC3A 5IV4A 2BW7A 1Y11A 2GVDA 1WC0A 3UVJB 1CULA 1CJUA 4OYBA 3MAAA 4P2MA 4WPAA 1AZSB 1AB8A 4CLSA 3G82A 3ET6B 1YBTA 4CLLA 4CLTA 1CJVA 1CS4A 4CM2A 4USUA 2WZ1A 5D0RA 4CLKA 3G82B 4OYAA 4NI2A 1CJTA 1CJVB 1CJUB 3C16A 4CM0A 3R5GA 4USWA 4WP8A 3C14A 2GVZB 4CLFA 4CLPA 4OYXA 1CJKB 4OYIA 3C15A 4WP3A 1CS4B 4OYPA 4USVA 2W01A 4OZ2A 1U0HA 5D0EA 4CLYA 1AZSA 5D0GA 4CLWA 1CJKA 1FX4A 5IV3A 5D0HA 4OZ3A 1Y10A 3C15B 1YBUA 2GVDB 3UVJA 1WC6A 4CLZA 1CULB 1U0HB 1TL7A 4OYZA 4P2FA 3C14B 2QV6A 4CLUA 4OYOA 3C16B 3MAAB 1WC5A 1FX2A 1CJTB 1WC1A 1WC4A 5D15A 4P2XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ET6 A;  4OYM A;  4WP9 A;  4OYW A;  1YK9 A;  3MR7 A;  4NI2 B;  2GVZ A;  4UST A;  1TL7 B;  1WC3 A;  5IV4 A;  2BW7 A;  1Y11 A;  2GVD A;  1WC0 A;  3UVJ B;  1CUL A;  1CJU A;  4OYB A;  3MAA A;  4P2M A;  4WPA A;  1AZS B;  1AB8 A;  4CLS A;  3G82 A;  3ET6 B;  1YBT A;  4CLL A;  4CLT A;  1CJV A;  1CS4 A;  4CM2 A;  4USU A;  2WZ1 A;  5D0R A;  4CLK A;  3G82 B;  4OYA A;  4NI2 A;  1CJT A;  1CJV B;  1CJU B;  3C16 A;  4CM0 A;  3R5G A;  4USW A;  4WP8 A;  3C14 A;  2GVZ B;  4CLF A;  4CLP A;  4OYX A;  1CJK B;  4OYI A;  3C15 A;  4WP3 A;  1CS4 B;  4OYP A;  4USV A;  2W01 A;  4OZ2 A;  1U0H A;  5D0E A;  4CLY A;  1AZS A;  5D0G A;  4CLW A;  1CJK A;  1FX4 A;  5IV3 A;  5D0H A;  4OZ3 A;  1Y10 A;  3C15 B;  1YBU A;  2GVD B;  3UVJ A;  1WC6 A;  4CLZ A;  1CUL B;  1U0H B;  1TL7 A;  4OYZ A;  4P2F A;  3C14 B;  2QV6 A;  4CLU A;  4OYO A;  3C16 B;  3MAA B;  1WC5 A;  1FX2 A;  1CJT B;  1WC1 A;  1WC4 A;  5D15 A;  4P2X A; 
#chains in the Genus database with same CATH topology
 2DT9 A;  3FDS A;  3GIL A;  3CUL A;  1ZPW X;  3NWR A;  4YEA A;  4OX9 J;  1NDK A;  4KHR A;  2AX1 A;  4Q44 A;  3D0G E;  4DR7 J;  3OFF A;  4DLG A;  3H2U B;  3GQC A;  3D7S B;  2CDR B;  4AL7 A;  2HHT A;  1RAJ A;  4LF4 F;  5KAK A;  3CJ2 A;  5KFZ A;  2KVQ E;  4UST A;  2D3O 1;  2VB6 A;  1U1P A;  4U7C A;  2HFZ A;  4V19 J;  3NNA A;  1PJ7 A;  4CYU B;  4ZVO B;  1FJG F;  1RXO B;  2XBP A;  1FWL A;  2H1Y A;  1XR6 A;  2HMI B;  3O5T B;  3QGH A;  7AT1 B;  3BYP A;  1IQZ A;  1MW7 A;  3HFV A;  2MKK A;  2M88 A;  2POK A;  2RQ4 A;  5F9L A;  2E5L J;  4NYO A;  2HVH A;  1MU2 A;  3H42 A;  5GAH I;  4LF9 J;  1VQL S;  1JX4 A;  1T7P A;  3LGN A;  2WRM A;  1IKW A;  2J9C A;  3AXK A;  2QN6 B;  4ZLL A;  3RR7 A;  3NS7 B;  1FNO A;  4L72 B;  1P27 B;  4LR7 A;  1IWA A;  5SZT A;  4RZR A;  1T9X A;  1CC8 A;  1PAE X;  1UFL A;  4YR0 A;  1FRL A;  4PQU A;  1TK8 A;  4AT1 B;  4QIV A;  1EJ7 L;  1DZ5 A;  3CF5 Q;  1PYO B;  1V3Z A;  2APO A;  1EAY C;  4LRF A;  5LJ5 Y;  3QRQ A;  1T0T V;  1SJQ A;  1TV6 A;  3KLI B;  2XCP A;  2XLI A;  1X5P A;  2HZC A;  2UUT A;  5KFB A;  5E3Q A;  3M7V A;  5KG4 A;  3W5Z A;  1T05 A;  1NAQ A;  3QWU A;  2UXD F;  2G0J A;  1RT1 A;  1G4C A;  1YJ7 A;  3DFE A;  4LSL A;  4OYA A;  2I38 A;  1S48 A;  2MLY A;  3EGW B;  3US5 A;  2W9B A;  3BR8 A;  1Z4U A;  3IFE A;  4F7V A;  1QSY A;  4WFX A;  2BJD A;  4Z7Y A;  2HWH A;  4YDD B;  2D1C A;  1R8C A;  1NO8 A;  4OI2 A;  2XLK A;  2IMO A;  1RB0 A;  1KHV A;  3NGS A;  2AJ1 A;  5KG0 A;  5ADZ A;  3E51 A;  5I3Q A;  5LMU F;  2IDE A;  1YI2 S;  2Y8Y A;  1H72 C;  1C0U A;  2ZDO A;  2HS0 A;  1SKW A;  1FKO B;  1UJ6 A;  1WHY A;  3PX0 A;  2OIH A;  4BLG A;  3IN5 A;  4N41 A;  4TY8 A;  4LSN B;  1FDB A;  1LW2 A;  5LJ3 Y;  3BO2 A;  5CAB A;  4ED2 A;  3M6W A;  1H0H B;  2EFN A;  1BLU A;  2UUA J;  5CYM A;  4Y0F A;  5D8H B;  4WP3 A;  2CAJ A;  2MGZ B;  1HPZ B;  4ELV A;  2CQH A;  3F73 A;  1FES A;  4RW7 B;  1UVK A;  1U0H A;  1VBK A;  2M8H A;  3BH6 B;  3FEX B;  2YX7 A;  3P45 B;  2XY6 A;  3R1L A;  1EIY B;  3K0J A;  2LEA A;  4WFB Q;  2D9O A;  2MKY A;  3OL8 A;  4PWW A;  4CQ1 A;  5F0W A;  1P8G A;  2YX4 A;  2HZA A;  1SKU B;  2ZWP A;  1RBO B;  4TNO A;  4PUO A;  5ETT A;  2DIS A;  1N56 A;  1DAR A;  2RHS B;  2Y9H A;  3SZ2 A;  4NWB A;  3D68 A;  3DMJ B;  3Q8Y A;  4X66 J;  2VJU A;  1WC6 A;  1OY8 A;  2G2O A;  3OUY B;  1VK3 A;  4DR4 J;  2XLJ A;  1WOR A;  3W8P A;  3OVS A;  5ITH A;  3GB0 A;  4NA2 A;  2NYI A;  2ACY A;  3VV2 B;  5C24 B;  4M1K A;  3NOC A;  3IR7 B;  3M8R A;  4DSE A;  4IRC A;  4YR3 A;  3BR9 A;  4ZP6 A;  5F8M A;  2DD8 S;  2XMW A;  3U02 A;  3T1Y J;  3M8P A;  2LFV A;  1SB6 A;  3MM6 A;  3QT5 A;  2F40 A;  1VBZ A;  3BBB A;  3FNN A;  3MM9 A;  3LPE A;  1H6K X;  1EET B;  4NCG A;  3P6Y C;  1FT8 A;  3CJ3 A;  1UET A;  1HWJ A;  2HHH J;  5AE1 A;  1KLM B;  1M5H A;  3MPV A;  3W64 A;  3GIK A;  1U45 A;  1OIA A;  2BJ1 A;  3UI3 A;  3THT A;  1AT1 B;  4PG4 A;  5J2M B;  2B8P A;  3N79 A;  1REV A;  4B3R F;  2YKN A;  3QZ8 A;  1C4A A;  3MR6 A;  2HBZ B;  2ALZ A;  1RAG B;  1QM9 A;  3MR7 A;  2JOQ A;  1RUS A;  2DNZ A;  3KMQ A;  2V2Z A;  4QZV B;  4DUT A;  2C22 A;  1VK8 A;  1WTF A;  2CRL A;  4QOT A;  2V9W A;  1WC0 A;  4B3R J;  3BSC A;  3HPO A;  4HHH A;  2J9D A;  5ETN A;  3WBZ A;  4FBT A;  4QWB A;  3HHN B;  3MF5 A;  1R0A B;  1RI7 A;  2BKO A;  3HX9 A;  3I32 A;  1PCA A;  3NOG A;  2ZKT A;  1FWK A;  4DV4 J;  1CLF A;  4OJG A;  2XMK A;  2DNL A;  8RUC A;  1NJX A;  4CTA A;  4NLS A;  4C9D A;  4PUO B;  2CXE A;  5L9X A;  2PMH A;  4AXI A;  2HGM A;  1UTA A;  3NLC A;  3D4J A;  3FKB A;  4KV8 B;  5DET A;  1EKS A;  4XDC A;  3UR0 A;  2YTC A;  4HR2 A;  4PXD A;  2IFX A;  1HBU B;  5HVG A;  3PW4 A;  4UTG A;  1M5V C;  1H7W A;  2FHK A;  2GV1 A;  3H7H B;  4F04 B;  4NLY A;  1H2V Z;  4O44 A;  1TTH B;  4QIF A;  3V5R A;  4UZB A;  4ZVG A;  2XYP B;  2G0C A;  3G82 B;  4KJI A;  5A6W A;  5C2C A;  2MGZ A;  2C2D A;  2QT7 A;  3DLL Q;  2B4V A;  2ZJR Q;  3DC2 A;  1RAB B;  3QZ7 A;  1LW2 B;  4N7T A;  5E41 A;  4F36 A;  1W2B R;  3PM9 A;  3NKY A;  3G6Y A;  2ZBC A;  5K20 B;  4FP9 A;  3UDL A;  1REG X;  1S5Z A;  2KRB A;  2P6S A;  5GVQ A;  4WTY A;  1A0O B;  3CJ4 A;  3M9N B;  4ERD A;  2R3V A;  1EQ0 A;  4ZVR B;  3W7B A;  1ZTW A;  2UP1 A;  1JLE B;  1WKK A;  2JLE A;  4K5R A;  2ZM6 F;  2GO8 A;  2GVZ B;  3FUY A;  3L09 A;  1CJK B;  1NKB A;  4DZ6 A;  2A3J A;  2NQP A;  3DLG B;  4Y2C A;  4MIB A;  2BX6 A;  5B0E A;  3AXM A;  5IS2 A;  2MXY A;  3BS9 A;  4FPR A;  5A2Q Y;  2QRR A;  4B17 A;  3M9M B;  2V8D A;  4DR6 J;  3FMB A;  4WU3 A;  2R8I A;  1N32 F;  2VG6 A;  4ID5 A;  1JMT A;  2Z57 B;  4ED0 A;  1T05 B;  2FZK B;  3BB5 A;  4LSZ B;  4YY3 J;  4YHH J;  1T9V A;  2BOP A;  4DR4 F;  4ECV A;  1V9O A;  5A0Y A;  3CCQ S;  1RZM A;  2WW8 A;  2E5I A;  2VFU A;  4CLW A;  1BHN A;  1GFW B;  3QPI A;  4PWD B;  2XI3 A;  4K4W A;  4U7U D;  1N6Q B;  1HNX F;  5KT5 A;  2CZV C;  1RU1 A;  3UO0 A;  1RDR A;  4ZPB A;  2PMZ D;  3QYY A;  3VZI A;  1TU0 B;  1LWF A;  3UQS A;  2CWK A;  3CXC R;  4J9S A;  3KKF A;  1VYA A;  1U26 A;  3AB2 B;  5DDR C;  1YJU A;  2NPI A;  1YBA A;  4IFV A;  4MK9 A;  1WD6 A;  2H3E B;  4NPO A;  1YIT S;  1M5O C;  4C2M A;  4I1T A;  1WF1 A;  3Q22 A;  3PHT A;  1XNQ F;  4C97 A;  4B3S J;  2YKN B;  4JI8 J;  1UL3 A;  1GMW D;  4J9Q A;  4OHZ A;  4A8W A;  4JI2 F;  2OEM A;  3NXZ A;  4KFB A;  1P6T A;  1QVG R;  2XMA A;  1WEL A;  3GWC A;  2XSF A;  4FNH A;  3R6L B;  5EGY A;  1SJF A;  3HJF A;  2UXB J;  5LXY A;  2FVP A;  3CME S;  3HLU A;  1X4B A;  1WSR A;  3BF4 A;  3LA0 A;  1Q8B A;  3QGI A;  5CHC B;  5E3A A;  2ZH2 A;  2IAJ A;  1ZM2 A;  1FTC A;  1NLK L;  1IKV B;  3HCX A;  4EYI B;  1XNQ J;  4IG0 A;  3CC4 S;  1UMJ A;  2IIH A;  4Q0B B;  1S1T A;  3X3U A;  4BHQ A;  1SL1 A;  4QCL A;  1G7C B;  3DU6 A;  3LPY A;  4WP9 A;  1Q1K A;  1Y3J A;  2C2E A;  2C1E B;  4DV3 F;  4GKK J;  2OLW A;  1XK8 A;  4B3O B;  4DL2 A;  1WOP A;  3IBF B;  4PRF A;  3MR2 A;  2YKA A;  4KV8 A;  3BGU A;  1VQ6 S;  1EKR A;  2O67 A;  1Q5V A;  2YH1 A;  3DGV A;  4AD6 A;  4Q7A A;  3CTR A;  4B9V A;  1Q16 B;  1N5S A;  4ZDN A;  3UCG A;  4DL6 A;  1X4G A;  4PXE A;  1FHT A;  2UU9 F;  4B9S A;  4M5G A;  1VQS A;  5LL6 d;  1CJU A;  2G0I A;  4A8M P;  1UVJ A;  4DV5 J;  4C3M A;  4EBD A;  2VKR A;  4F4K A;  4IG3 B;  5DZ7 A;  4IR1 A;  1V6H A;  3MAA A;  3PVX A;  1J5E F;  2DRB A;  4WPA A;  1UW9 A;  4C0O C;  3I0R B;  4Y2K A;  1YBT A;  3DM2 B;  4CLL A;  1PC5 A;  4KH0 B;  4C6A A;  5KOX A;  4USH A;  4CIO A;  3OSN A;  5GAG U;  2BJE A;  3R7N B;  4HKQ A;  1IM6 A;  1X5O A;  1TKT A;  2YQ1 A;  2JEF A;  1KBR A;  2CVI A;  5FII A;  1KQF B;  2J5A A;  3R2C J;  3MEG A;  2UZA A;  4U6P A;  1KTQ A;  2HQD A;  1ROF A;  1FVQ A;  3OXG A;  1TZ0 A;  1TUV A;  3KHG A;  2HIQ A;  1RJJ A;  4ICL B;  2FJB B;  2DGU A;  1RT5 A;  3HHL B;  4FVC A;  1ZA2 B;  1UJ4 A;  4ES3 A;  4DSL A;  5HQM A;  1Z1Z A;  4X4R A;  3K2Y A;  3CD7 A;  2PFF B;  2HPU A;  2J8S A;  4MH8 A;  4BC7 A;  2Q6C A;  5HBM B;  3BEG B;  3EIC A;  3ZXW A;  3MM5 B;  3ZC4 A;  2NSC A;  2G13 A;  4TLQ A;  2X1G A;  3VGU A;  2MQP A;  5LXR A;  2ZBR A;  4ZN1 A;  3T5J A;  4X4N A;  1C0T B;  3LP1 A;  2CPX A;  4A4J A;  2Y0B B;  4TXS A;  2LXF A;  4IH6 A;  4WZQ A;  2FJE B;  5C42 B;  4C98 A;  4LR8 A;  3SSS A;  1C1C B;  2Y3Y A;  1S9F A;  1Y9O A;  1U0S A;  2GA7 A;  4KFB B;  3OXF A;  1RP5 A;  2GMH A;  2OEJ A;  3V81 A;  1IR2 A;  3SFG A;  2ALY B;  4L75 A;  5C2G A;  1H7X A;  3CUN A;  1SUQ B;  2R4F A;  3QAU A;  1FE4 A;  1KOH A;  4ZPT R;  2VC0 A;  1KS2 A;  1S7I A;  4J9V A;  2KM8 C;  2HBR B;  2EC0 A;  3MEE B;  3ILJ A;  3SDE B;  2EFP A;  1NHK L;  3V6J A;  2JL9 A;  1QTM A;  3GR0 A;  2JC1 A;  4ZOS A;  1R8A A;  3AOB A;  1HR0 F;  2MYF A;  3ZTR A;  2BDP A;  2OSR A;  1WF0 A;  1JB0 C;  2P6T A;  1RAE B;  2RS2 A;  4IRK A;  3K57 A;  3Q83 A;  3OTD A;  4HHJ A;  1RAF B;  5IV3 A;  5EWF A;  2DIV A;  2YWF A;  1HQE B;  3PHE A;  3N0V A;  4M5D B;  4PWD A;  1S99 A;  2V9K A;  2IYI A;  1HPZ A;  4OIX A;  2D7S A;  3N4W A;  5CZV A;  3MED B;  2GVD B;  4KIA A;  1D8Y A;  3HSG A;  3ZZY A;  2UVR A;  2EI5 A;  4NXN F;  2DHG A;  1X9M A;  3CCE S;  1WHV A;  4G1P A;  5IQ6 A;  3KMS A;  1S0N A;  3OTE A;  2XMM A;  4RJV A;  3GJS B;  4BS2 A;  4CT9 A;  3F41 A;  1CVJ A;  1HW8 A;  1RK8 A;  4ZVT B;  2D74 B;  4OI6 A;  4B3O A;  5DQG A;  4TQR A;  4OYO A;  4DV3 J;  3GE9 A;  1HW9 A;  1NK5 A;  3BGO P;  3R7B B;  3WDO A;  1HAR A;  2CPE A;  2E7W A;  1HBO B;  1MRO B;  3BH7 B;  4OLO A;  5D78 A;  5THW A;  3Q0A A;  4HEA 9;  2Z4P A;  4MFB B;  4IG0 B;  1BY9 A;  3IP0 A;  4FKX A;  2EK1 A;  3UN2 A;  5DDO C;  3CCJ S;  3EZO A;  2BE9 B;  5I42 B;  4JV5 J;  1S59 A;  2QSF A;  2RE1 A;  2HHP A;  2WSF C;  3CJQ A;  3LO3 A;  5KT3 A;  4N56 A;  2KZM A;  2E5J A;  2EFQ A;  1F3V A;  1LK7 A;  4RNM A;  3MAH A;  1LWF B;  2CUY A;  2BJ9 A;  4LF5 F;  4DCJ B;  1H74 A;  3KUG A;  3KK3 A;  1TL5 A;  2K7J A;  4PXB A;  1DHM A;  4OHY A;  2KKH A;  2WBR A;  3ILI A;  3TA2 A;  4PG8 A;  1BD6 A;  4EBE A;  4WF9 Q;  2DXF A;  1BQM B;  1Y00 A;  3B82 A;  2QIF A;  5IT4 A;  2FVC A;  1PSD A;  3CIM A;  3GMG A;  3MEK A;  2ZEJ A;  3QQC D;  3O3L A;  2HNZ A;  2W7O A;  1S1U B;  2YKP A;  3M8W A;  2VKZ G;  3K8W A;  4UUW A;  1M90 T;  2XS5 A;  3VGS A;  4J7C A;  3RW7 A;  2VBY A;  5DGB A;  2JJ4 D;  4A8Y A;  2OEL A;  1HBN A;  3GJT B;  4QIW D;  2DJW A;  1TVR B;  2HFN A;  2QTW A;  2HYI B;  3TUP A;  2LP4 A;  1B0V A;  1VCT A;  3FBC A;  3IC1 A;  3MMB A;  3Q89 A;  2R2R A;  4PPD A;  1X5S A;  4UY8 5;  3SMZ A;  1JLB A;  4C7Q A;  2B9E A;  1JKH A;  4F4W A;  2MZT A;  3SQG A;  1D0E A;  3U7J A;  2RF2 B;  1CS4 A;  3I6P A;  3MD3 A;  4H54 A;  3Q2T C;  4C0B A;  2X1B A;  2ZD1 B;  3TX8 A;  3UD3 P;  4QIE A;  1WSV A;  2GIR A;  4RW8 B;  2ZH6 A;  3M6V A;  1GK8 A;  2PEH A;  4Y28 C;  3KUH A;  1DBD A;  2W24 A;  2XGQ A;  3LWM A;  1HI0 P;  4IO9 Q;  1NUE A;  3D54 A;  3PR5 B;  4O3P A;  3HT0 A;  1K1Q A;  2Q43 A;  1U7L A;  4KO0 B;  2EW9 A;  4Y2A A;  2XGP A;  4DSF A;  5IT9 U;  4X4U A;  2ASJ A;  2V2K A;  2F8H A;  2MMY A;  3ENA A;  4Y34 A;  2N3L A;  2KH9 A;  2R2T A;  1SCJ B;  2EWH A;  2GHW A;  2H48 B;  4FS2 A;  1MWY A;  5J2M A;  3TWZ A;  2PSZ A;  2OD4 A;  5D4L A;  4PAA A;  5F3T A;  5DQI A;  1F3F A;  1FRI A;  2NCK L;  2OPR B;  1KLM A;  4FYY B;  5E33 A;  5C7P A;  3KK1 B;  1F2G A;  3AQP A;  4I67 A;  4L74 A;  1Q79 A;  2M5Y A;  2FGO A;  3IWX A;  1SXL A;  4XPE A;  2RSQ A;  1WUU A;  2R8K A;  2QMX A;  2YKM B;  5D4P A;  3LAL A;  3GP9 A;  3W9H A;  5AE3 A;  2MY7 A;  3JYT A;  5AXN A;  2K1R A;  5KFQ A;  2DVI A;  2VG7 A;  2W25 A;  3DXS X;  4NLP A;  4ZVE A;  3DRX A;  5HAO A;  2OPP A;  3BQ1 A;  1UFK A;  4JV2 A;  2B7B B;  2PFD A;  4A48 A;  3MI7 X;  4IFY A;  2MY8 A;  1PIL A;  4EI2 A;  1RWV B;  4ZHR B;  3KHH A;  3QSY B;  4JI6 J;  3EMT A;  3LTO A;  3JAM U;  3ZZT A;  3C46 A;  5AXK A;  4DL4 A;  2Y1I A;  3JS9 A;  3GFY A;  2HFV A;  2HVZ A;  3I4P A;  2JFK A;  3WIU A;  3U1M A;  2QYC A;  3AJ1 A;  4O3N A;  1MWZ A;  3GYX B;  3NBP A;  1K73 T;  3ZTQ A;  1Y7P A;  2HG4 A;  3M8S A;  4V19 X;  1TKZ A;  1WEX A;  4DL7 A;  1HL6 A;  1KVK A;  1QY7 A;  4KH1 B;  3W60 A;  5K8P A;  3I55 S;  1HNW J;  2BKP A;  1GXU A;  3J81 U;  2LEB A;  1Y5N B;  3CJ8 A;  1OPZ A;  3BGL A;  3PYE A;  1T94 A;  4UT4 A;  1K9M T;  3EGN A;  2IVF B;  3TYT A;  5CA5 A;  4EO8 A;  5EDW A;  1R6Y A;  2E66 A;  5HAN A;  3G8T A;  1G2E A;  4DEZ A;  3PKY A;  1VGY A;  2V4J A;  4KC5 A;  1TUW A;  2M3D A;  4WBF A;  2QEX S;  2Q6B A;  1FJ7 A;  2DGV A;  2QL9 B;  1L3U A;  4I6W A;  5I42 A;  2WAQ D;  3TAR A;  3RR8 A;  3GG0 A;  1LEO A;  1M5S A;  2MST A;  3H5U A;  4AQY J;  5HP1 A;  2OTL S;  4O3R A;  4JV1 A;  4LF9 F;  4K4X A;  1RT6 B;  3J81 j;  4FVM A;  3Q8Q B;  2I6W A;  2HHS A;  4LFC F;  2VFS A;  2R7W A;  5IWA J;  1TAU A;  2BV3 A;  1O6X A;  1F9E B;  2IM3 A;  2RDD A;  3RG6 A;  3QLH A;  4OYW A;  4FZV A;  1TMJ A;  1UEU A;  2W9B B;  3SCI E;  1VIO A;  4NA3 A;  2WVB A;  4DUY J;  1DJ0 A;  2P9E A;  4UOF A;  3AD8 C;  3ENV A;  1NH8 A;  1Y0H A;  5IV4 A;  1S4E A;  2GVD A;  1BQM A;  3R3T A;  3HO1 A;  1U8S A;  1IJE B;  1GTH A;  1SPB P;  5HRO B;  1NK8 A;  1VRT A;  1W2I A;  2RB7 A;  2XSJ B;  4DPY A;  2VPZ B;  2CQ2 A;  3L7O A;  2KG0 A;  2FY1 A;  4WXO A;  1RWK B;  1YJR A;  2FDN A;  3VZH A;  4P7V A;  2IYG A;  2ZC4 A;  3LP0 A;  2B3T B;  3BDP A;  2HUR A;  2Y1L B;  1MMD A;  3IA0 A;  4FS1 A;  1GH8 A;  4YME A;  2AMC B;  3KLG B;  2GW8 A;  2C3Y A;  1LW0 B;  5I4M A;  3QJL A;  1ICE B;  4M5N A;  2XY5 A;  3M9O B;  2HQI A;  3HXM A;  1X9S A;  1RCO B;  5DLF A;  4B9N A;  4DSK A;  1UFW A;  2CQB A;  3BKU A;  1L3V A;  2DR7 A;  4ECU A;  4Z2X A;  4Y3C A;  3KK3 B;  4DHV A;  2XZW A;  3QIP A;  1RHU B;  3AH6 A;  1QAJ A;  3MMA A;  1C1C A;  1IKX B;  4KB7 A;  1YRU A;  2XZD B;  1FKO A;  3RJM B;  1JLF B;  3POT A;  4XAK A;  3VQT A;  1CJT A;  2C3U A;  5E7O B;  5K14 B;  5KFK A;  1UVI A;  1UWB B;  5B0D A;  2RRB A;  3CJ0 A;  2F4V F;  3CIZ A;  1FRK A;  4FNI A;  3RU0 A;  2E5L F;  1RWU A;  2DBB A;  3H98 A;  4C8K A;  4UQT A;  1FVS A;  5RUB A;  2WW4 A;  3JSM B;  2MDA A;  2W1B A;  5KG3 A;  1UEV A;  3TJ8 A;  2WCX A;  2DR8 A;  1LWE A;  2HVD A;  3HHL A;  4CLP A;  5J2Q B;  4PWU A;  4CCH A;  1S10 A;  2F4V J;  1P9Y A;  2R7V A;  4J37 A;  1Q5Y A;  2V5H G;  4LF4 J;  1GNK A;  2GHV C;  2UVU A;  4HTI A;  1FI4 A;  5J2P B;  1CG2 A;  2J9E A;  3R6G B;  2P9C A;  2ZVI A;  3AAW B;  3GTY X;  2GJF A;  4RW7 A;  2LQ9 A;  3QFH A;  2AZ1 A;  4PG7 A;  4PZV A;  3WC0 A;  5HN0 A;  3C6U B;  3KK2 A;  3EPI A;  4C8O A;  1OS5 A;  2CJX B;  3DHX A;  3QGG A;  4NE9 C;  2RQC A;  2VJV A;  4DFP A;  2XG8 A;  2GJI A;  4M5I A;  2HGL A;  4BWM A;  4IYQ A;  3UDV A;  1UKU A;  3TVY A;  4DPO A;  2RKI A;  3J80 Y;  2YXL A;  2HHH F;  3BQ0 A;  3DLE A;  4A47 A;  4EFA C;  2E9R X;  2P8I A;  4IH5 A;  2J0S D;  4I7F B;  4CO2 A;  2BE2 A;  4WFN Q;  2KT2 A;  2Y1J A;  1L3T A;  1YBU A;  5CYM B;  4DWI A;  3JSY A;  2Q79 A;  3TZX A;  3G2X A;  4HI1 A;  2CQ1 A;  4WJB A;  1M1G A;  3KJQ B;  3NRB A;  4DFM A;  4USK A;  2HBQ B;  1RYS A;  2J8A A;  4H4O B;  3TUJ C;  4CH1 A;  2QX0 A;  3NGR A;  3ZZZ A;  2R7U A;  1XMO F;  2VAS A;  5GMD A;  5AJ3 J;  2KZZ A;  4ATN A;  3OV7 A;  2QLW A;  2C2R A;  1QUP A;  2Z0G A;  2GHP A;  3CO0 P;  1B7Y B;  1VMB A;  2W2M P;  2AGP A;  2JVO A;  2DEJ A;  2ZOM A;  4EEY A;  4K4S A;  3EYZ A;  2J0X A;  2DGO A;  3HVT B;  3MED A;  1IBC B;  4YB7 A;  4X2B A;  1SC3 B;  1HNZ J;  3CJK B;  2DNH A;  1U4B A;  1CJT B;  1EB0 A;  5K14 A;  2JEG A;  2R7S A;  1LKZ A;  1KDN A;  3ZZP A;  3GFH A;  3DYA B;  3QFW A;  4K5S A;  3A8J A;  1U25 A;  5D15 A;  3DDI A;  5U47 A;  2ZZN A;  2H51 B;  3D3C J;  1HYS B;  1NZA A;  3NBP B;  3NNH A;  2LVW A;  3I9V 9;  4OMF G;  3QRR A;  1QVF R;  2HWI A;  5LT5 A;  4IRD A;  2UUB F;  2ATL A;  1UVL A;  3IR5 B;  1S6O A;  2DHX A;  2GGP A;  2PA8 D;  3MEG B;  4ZIW A;  3HJV A;  2O1P A;  1BE4 A;  4Q2M A;  1YWX A;  3FJ2 A;  3FK4 A;  2KHC A;  3HHD A;  3OR1 B;  5DJB A;  3VQS A;  1UA0 A;  3IWL A;  2ATC B;  3OFH A;  4AYB D;  5SUH A;  4IFV B;  4CT8 A;  5GAH U;  4XPC A;  1K1S A;  4OI0 A;  4K4V A;  2DNO A;  2DNP A;  1CUL A;  1CQM A;  5ETK A;  2UUC F;  2M0G B;  1VHF A;  1F6T A;  2L9D A;  3ENW A;  4J9P A;  1RTD A;  4LQ3 A;  2N82 B;  2BAC A;  3IM8 A;  5B08 A;  3VHQ A;  2FJW A;  2UUB J;  4F2R A;  1D1U A;  3TUI C;  4OI4 A;  2XSJ A;  1AUS L;  5JXS A;  4I6Y A;  1FFG B;  3PIO Q;  2FVQ A;  1EZZ B;  2LKZ A;  2YNI A;  4ITS A;  2CPI A;  3IRW P;  2LEC A;  4A46 A;  1F5B A;  4JI4 J;  2B51 A;  2B56 A;  1S79 A;  3L4B C;  5HBM A;  3CMA S;  2VQE J;  3RAX A;  4ZJO A;  1SC1 B;  2AW0 A;  3FQL A;  5FDL A;  4LFB F;  5J1E B;  4B3M F;  4GVL A;  3KJV B;  4IH7 A;  3GYG A;  1TKX B;  2OHD A;  2RVJ A;  4QPT A;  1FEE A;  3SIP B;  4E98 A;  1MSW D;  3E2E A;  1U8W A;  2CDQ A;  1FKP A;  5KG7 A;  1VQM S;  2V6A A;  2AYE A;  1QAY A;  2D41 A;  2M70 A;  4GVB B;  4LT6 A;  3AA8 A;  4KGM A;  3TAP A;  2IVM A;  4LFB J;  5HVH A;  4IQM A;  3FZB A;  3PW7 A;  1B99 A;  3C16 A;  2EFV A;  3VR1 A;  2BQU A;  1BQN B;  1LWC B;  4MKV A;  3ETO A;  3CDA A;  3GLJ A;  4URG A;  2CQD A;  1PJ6 A;  1R8B A;  2RF2 A;  4WXW A;  1I94 J;  3M1V B;  2C2Z B;  4D3H A;  2ZH9 A;  2GZO A;  4QR1 A;  5F41 A;  3BM7 A;  1MN9 A;  2YNH A;  2MHE A;  5L9N A;  5T14 A;  1YVF A;  1NDL A;  2RQK A;  2W9A A;  2BEF A;  2IRU A;  2HIY A;  2W7P A;  4DOZ A;  2DIT A;  1K44 A;  1LK5 A;  3D1Q A;  5I3U A;  3ICL A;  4WFZ A;  1SQG A;  2HND A;  2OPQ A;  2W7A A;  3AOA A;  4OHV A;  4DG1 B;  2P9G A;  3CCT A;  5B0A A;  2R7R A;  5DO2 A;  1FWP A;  3CCV S;  1PAU B;  5H9E K;  1SQF A;  3EM1 A;  1FE0 A;  1PG5 B;  1T03 B;  2UXB F;  3M2V A;  2O66 A;  2XM3 A;  3NCP A;  2HW3 A;  5CYQ B;  2ZH8 A;  3KXD A;  1P1L A;  2FGC A;  3CSK A;  2MLX A;  4ILR A;  3Q8V A;  3HP6 A;  1U48 A;  1D3W A;  1HWI A;  2HSE B;  4W98 A;  2VG7 B;  3TVZ A;  3A4T A;  3ENQ A;  4C8Z A;  3EVO A;  3G8S A;  1YDL A;  3OBI A;  3C2P A;  3FZ2 A;  4OQJ A;  2ZWO A;  3MEC B;  5E2Q A;  3W2V A;  8AT1 B;  1U1O A;  3DLG A;  3CT9 A;  5KFO A;  2KI2 A;  4OYZ A;  2VL1 A;  3CJR A;  1SC6 A;  2O5D A;  2D3U A;  3SEO A;  4K4U A;  1TQL A;  5HQ8 A;  2BKN A;  2FHM A;  3D28 A;  5DDQ C;  5JVH Q;  1X4D A;  4DR1 F;  1U49 A;  4LR9 A;  3MM7 B;  3QRP A;  1DUR A;  2DNR A;  4H4K C;  5HK4 A;  5ETS A;  4DL0 C;  2YVS A;  2R2U A;  2YWH A;  4YHH F;  1SIW B;  5CYJ A;  4I2P B;  5IC4 B;  4IOA Q;  3PRV A;  1RYR A;  4CP5 A;  4GC7 A;  2HLU A;  1YJN S;  3JSB A;  4M63 A;  3TX0 A;  4IDK B;  3FQK A;  1PJ5 A;  5LOQ A;  2XY7 A;  3CCS S;  2UUW A;  2YNI B;  2Z2M A;  1HHS A;  4I0W A;  4NLT A;  2XWY A;  4ED8 A;  3WX8 A;  1S4F A;  4O44 B;  1N5Y A;  1NB7 A;  3Q8P B;  1UZD A;  2H5J B;  4WIQ A;  4Q8E A;  4P72 A;  3I5C A;  3ZZR A;  2ZD1 A;  4DV1 F;  3MM8 B;  3BKF A;  3P5B P;  2AT1 B;  4ZVQ B;  2I5J A;  4DQR A;  3PTW A;  3MUT P;  4JI4 F;  3PEH A;  3UVJ B;  4U67 Q;  2YNG A;  1OJ4 A;  2OP5 A;  2JEI A;  3DOM A;  4KT0 C;  3U27 A;  5H9E J;  7FD1 A;  5D3G A;  2I1R A;  4RW4 A;  5EX3 A;  3NGU A;  1CEZ A;  1JLG A;  3GZ7 A;  4ZCK A;  3G71 S;  3QJJ A;  4B3M J;  3BSA A;  3K17 A;  1DLO B;  3SQO P;  3VGV A;  1OO0 B;  1Y4Z B;  4QWC A;  3DHW C;  4DMZ A;  3AHP A;  3EUN A;  3ET6 B;  3UE2 A;  2H54 B;  3DU5 A;  2VC1 A;  3M6U A;  3TJ9 A;  3G6V A;  3SV4 A;  4CLT A;  4RNO A;  3OT9 A;  1Q8K A;  4MAK A;  2E44 A;  2C3M A;  3GSD A;  3PX4 A;  4M5J A;  3CCL S;  4O3O A;  3TA1 A;  3TUZ C;  1B4S A;  3MAQ A;  3MPU B;  3TQE A;  5DG8 A;  3BO4 A;  2E9Z A;  2QA4 G;  2KFZ A;  2V2Q A;  1BXN A;  4NLO A;  4F0M A;  4ZKA A;  3BO3 A;  1N34 J;  2NLW A;  3M2V B;  3G4S S;  1T9U A;  2W2Q P;  2WZ1 A;  3M8P B;  5B7W A;  1XC9 A;  4A8Q A;  3ELH A;  2MKI A;  3TNV A;  3MCO A;  2VF3 A;  4U9R A;  4F0K A;  4DV2 J;  4CLK A;  2JEJ A;  2KTQ A;  3HKZ D;  5GAE I;  4P75 A;  5I3U B;  4ICL A;  1ZM4 A;  4ZVF A;  2RU9 A;  1RTH A;  2GFF A;  1X4A A;  3THP A;  1JKH B;  4PQA A;  1FNX H;  4JI7 J;  2FLN A;  3DRR A;  2DCU B;  4J9K A;  1FD8 A;  2AF6 A;  2G9O A;  3UN3 A;  3OL6 A;  5KFC A;  4TVA B;  5KFV A;  2J7U A;  2CPY A;  1L3S A;  2ZHA A;  2XMT A;  4EGL A;  2WSC C;  4WP8 A;  1I5O B;  1IN0 A;  3PIP Q;  1BUX A;  1R31 A;  1XMB A;  3DM2 A;  3GV8 B;  1FJC A;  1JNZ B;  4N8N A;  3OTO F;  4CLF A;  3RAQ A;  4EZ9 A;  1T9W A;  4OYX A;  2P2C B;  3IM9 A;  3HZG A;  4AXJ A;  1R6V A;  2L08 A;  3M4X A;  4NA1 A;  2UVW A;  1HWU A;  3QWP A;  1B3T A;  1M0S A;  3ZZO A;  4DXL A;  1U1N A;  1WOO A;  1EAR A;  3EVM A;  2RIJ A;  3M2R B;  3M30 A;  1V5I B;  6AT1 B;  4PYA A;  2KT3 A;  5IFM A;  1DTQ B;  5IZH A;  1SJ1 A;  4MT1 A;  3KK1 A;  1U6B A;  4CLY A;  4P7T A;  2NPF A;  1QJH A;  2VU5 A;  4GKJ F;  4JV0 A;  1TKX A;  5J2Q A;  4KBI A;  2HFU A;  4NLG A;  5KFH A;  4QYZ K;  2IPO B;  4EUV A;  2DXD A;  1Y10 A;  2ZNZ A;  4LIW A;  5F8L A;  5B0G A;  1URN A;  1TFW A;  1SUQ A;  1YZ6 A;  2HAF A;  3J7A N;  4DR6 F;  4X4O A;  1NJI T;  3HSJ A;  4O0I A;  1IR1 A;  3D0H E;  1NRK A;  3PEJ A;  1FK9 B;  3PRD A;  2VOD A;  3CDB A;  5HMY A;  2IRY A;  2QFI A;  4KHM A;  3BGR B;  1U24 A;  3FBB A;  4NRU A;  4W92 B;  4LMZ A;  3BSO A;  2W9C A;  3B8H A;  1HMV A;  1SQE A;  2Z2Y B;  5A8K B;  1Q0N A;  5G0R A;  1O5J A;  1HKA A;  2OJ3 A;  2KU7 A;  4CO0 A;  2BXJ A;  1EHW A;  4LUB A;  5HI7 A;  2ILZ A;  3ITH A;  4L3N A;  1LOU A;  3RRH A;  1ZS6 A;  1XIQ A;  3H2L A;  3N28 A;  4RW9 A;  3HT3 A;  3DMJ A;  1DFD A;  2K3K A;  4URS A;  4C3K A;  4PQU B;  3PRB A;  1T02 A;  2U1A A;  3PKM A;  2KYX A;  3E01 B;  3T41 A;  3PAC A;  4DG1 A;  1PGZ A;  3CNQ P;  1A6L A;  4NML A;  4X4T A;  4C8L A;  2BAB A;  2BZ2 A;  1U6Z A;  2EG1 A;  3TR5 A;  1R89 A;  2LMI A;  4NXN J;  4J9N A;  3NAI A;  1N6Q A;  1U2R A;  2F9J A;  2QGF B;  3SFU A;  4HVZ A;  2R9L A;  2ADB A;  5F8N A;  3UFC X;  1TL7 B;  1Q7L B;  4OHX A;  2JHE A;  4RUH A;  3GFX A;  5J2N A;  3N5B A;  1FXD A;  2FJD B;  3FEY B;  4WKR A;  3M8Q B;  4L76 A;  2YY3 A;  2D3Z A;  3DYA A;  1X5T A;  2VG6 B;  2XHW A;  4ID5 B;  5CD4 H;  2WK4 A;  4RNN A;  3OFE A;  4EK2 A;  2Y8W A;  2AJQ A;  1XTZ A;  2YKQ A;  2UU9 J;  1S6Q A;  1YJT A;  4JBC A;  1RHR B;  3LAK A;  3W9I A;  4MFB A;  4PEO A;  4QYZ J;  3FRY A;  3H40 A;  4JV5 F;  4YS2 A;  3NWG A;  2X51 A;  4DV2 F;  2HRY A;  3KJN B;  3WC2 A;  3A3N B;  5ETV A;  3OJU A;  3JAM Y;  2HRU A;  3IBC B;  2XO7 A;  3CD6 S;  2C2O B;  4TU8 A;  4MIW A;  3G87 A;  2W9C B;  1SL2 A;  1WKL A;  4WFA Q;  1YLX A;  1NK9 A;  3C8Y A;  2L41 A;  2DHA A;  2I9S A;  2KL8 A;  3DRS A;  4IOB A;  2ZNY A;  4ZLP A;  2H4W B;  2AD9 A;  5B0C A;  2VA2 A;  1GTE A;  1VLY A;  2YWG A;  4AUK A;  5KG1 A;  2D69 A;  4KE5 A;  4DSJ A;  2R7O A;  4BC9 A;  4E8U A;  5ETM A;  4DCO B;  2V69 A;  3KK2 B;  1NJY A;  2BA9 A;  2QLX A;  4DV6 J;  1IKY A;  3K89 A;  3KLV A;  4K59 A;  3CE8 A;  2JC0 A;  3TO8 A;  5KFY A;  4CNY A;  2BJ8 A;  1RHQ B;  1NSA A;  2OO4 A;  2XMV A;  3I0R A;  2CQC A;  1IKW B;  3FEZ A;  2L9W A;  1A9N B;  1IUJ A;  2MQN A;  3H20 A;  2LXU A;  1YJV A;  1MU2 B;  3JB9 k;  3BSN A;  1CC7 A;  3TAM B;  2C28 A;  3E01 A;  3PYF A;  2VQF F;  2IDL A;  4G1Q B;  4DBQ A;  3S8S A;  3G96 A;  4F8R A;  2NXN A;  2QL7 B;  4YQW A;  4NMX A;  4MIA A;  2XMJ A;  2XI2 A;  2O3D A;  3VAG A;  4W4M A;  2ZUA A;  1KD1 T;  1NDP A;  2WHO A;  2YX1 A;  4K7Q A;  2BQR A;  4HL9 A;  2KHD A;  5A8R B;  4G1I A;  1HMV B;  4DF4 A;  2VQF J;  2K1R B;  4DU8 A;  4USV A;  3DLH A;  5K5M A;  1H73 A;  1XNR F;  3HVA A;  4JI1 J;  4G3I A;  3QAT A;  5L46 A;  2WVE A;  2KM8 B;  2E29 A;  2PA3 A;  1XEZ A;  1TL3 A;  2L3M A;  2MSS A;  3PFO A;  2XEX A;  1CJK A;  1FX4 A;  2A2C A;  3T1A A;  3TP2 A;  3TZW A;  1B64 A;  5L39 A;  1ELO A;  2FPH X;  2IBK A;  4CH7 A;  3D9B A;  4DZD A;  4F2S A;  4LFC J;  4JOU A;  3EGZ A;  2O01 C;  4Y2M A;  4I2P A;  1NKE A;  1GQE A;  3LW5 C;  3Q24 A;  5KT6 A;  4K50 A;  4X62 J;  1UWA A;  1GMW A;  4I64 A;  4NLR A;  3JTP A;  3SXL A;  1F5C A;  2A0F B;  4K0K J;  1JLC B;  4DUY F;  2DNY A;  3HHL D;  2E5H A;  3D1H A;  3KDN A;  3M2U B;  2VON A;  5HVF A;  1FER A;  4RL1 A;  2HQF A;  2KO1 A;  4A8F A;  2KT5 A;  3D2W A;  1VC0 A;  1QE1 A;  1RT4 A;  2BQ3 A;  1NU4 A;  4F4A A;  2CA9 A;  2ZFH A;  4WTO B;  3OJS A;  1S1V B;  1IXK A;  4F25 A;  3JQM A;  5BYQ A;  5LSL A;  3DGP A;  1KWM A;  3NMR A;  4K0K F;  4X66 F;  1DQ9 A;  1U1R A;  4ZJL A;  4QIG A;  2X7I A;  3MM8 A;  5ETQ A;  1U1K A;  3GPA A;  1KHW A;  3I31 A;  1TK0 A;  1YRX A;  5E0O A;  5KFT A;  3GCW P;  5CYQ A;  4J9O A;  5HRO A;  2COL A;  2WVC A;  4P2X A;  2K7K A;  2JX2 A;  2CKW A;  3MDF A;  2EC2 A;  1KQS R;  4N76 A;  2HVI A;  4EO6 A;  2FUG 9;  3H5X A;  1KVJ A;  3A8K A;  2ACM A;  1HNV A;  1HNI A;  2VZ9 A;  4R8U B;  2QA1 A;  1K0V A;  1RCX B;  3LUY A;  5EHH A;  4USM A;  3I87 A;  3PW5 A;  2ZOF A;  5D77 A;  4ECW A;  1NK0 A;  4KGV B;  2JWN A;  2IBO A;  4H4M B;  4ZP8 A;  1SC4 B;  4E0D A;  1S57 A;  3DGP B;  3KLF A;  2AV5 A;  3DRP A;  3BYR A;  4ZN3 A;  1S1T B;  4QQB A;  4BBY A;  1JLE A;  2J0Q D;  3PO4 A;  1VFJ A;  4DQP A;  2B9X A;  4FXD A;  1RKI A;  3TW0 A;  2RU3 A;  2W2O P;  4ED1 A;  5HJY A;  3OHB A;  4Q5V A;  4LF2 A;  4OJ3 A;  3MFH A;  3CD5 A;  4DUZ J;  3DI6 B;  2VH7 A;  5FD1 A;  2DH9 A;  3EDQ B;  4L73 A;  3J7A 1;  4NOH A;  1JLQ B;  1GAO A;  4OFZ A;  5GAD U;  3QT8 A;  4FYW B;  2RRA A;  3GV7 B;  4N77 A;  2CJQ A;  1S9G A;  3HHE A;  1PIE A;  1YG0 A;  3WZ0 A;  5HMW A;  2WON A;  4Q45 A;  4RW4 B;  1SV5 B;  1WEY A;  5E3P A;  3IXQ A;  4DPT A;  3PV8 A;  2QJ3 A;  2AU0 A;  2LEP A;  4B9T A;  3IGN A;  4DPU A;  3DDK A;  1E6V B;  3MEC A;  2M8D B;  1DQ8 A;  1TK5 A;  3BZQ A;  4HDG A;  2I5J B;  2LQJ A;  4OZ0 A;  2P5V A;  1NH7 A;  3D5M A;  4V1A k;  1RAO A;  3HF5 A;  4WII A;  1BC6 A;  2JSX A;  4ZCI A;  2Q1L A;  1XMQ J;  3IMQ J;  4DR3 F;  3DKD A;  3D6F B;  4CM0 A;  1NHV A;  3NGT A;  2HZV A;  4P74 A;  2MZS A;  5F8J A;  3GON A;  4Z37 A;  4K4Y A;  4J91 A;  1RAD B;  3D6T B;  3R5J B;  2UXD J;  4M95 A;  1Z2Z A;  1I1G A;  4ID8 A;  1SJ3 P;  1OYD A;  1TVR A;  2EBG A;  2E1A A;  4ZVU B;  3W1Y C;  1L3K A;  2YWK A;  3K8V A;  2E7V A;  2DB1 A;  3KHR A;  1HHQ A;  3PNI A;  2ASL A;  1ACM B;  1PO6 A;  1TMM A;  1TR0 A;  3OUY A;  1HNV B;  2CPH A;  2HNZ B;  5IQQ A;  2ZVS A;  4FPI A;  2C3O A;  1U6F A;  1OPI A;  4KHP F;  2OPR A;  2UUC J;  1C1B A;  4C48 A;  4LJM A;  4DR5 F;  4P73 A;  4PCQ A;  4DQI A;  3HK2 A;  3W2V B;  4ILL A;  1HYS A;  3VAJ A;  1AZS A;  3DRS B;  1HBM A;  4ZP9 A;  5HJX A;  3H25 A;  1H38 A;  2OD6 A;  3OSP A;  1BMQ B;  3SCL E;  2R7X A;  3MFI A;  1N8R T;  4TU9 A;  1M1H A;  3P5T L;  3MHY A;  2EK6 A;  2F5G A;  3W61 A;  3ZFV A;  5A76 A;  1KON A;  5DDP C;  2CNN B;  2I8E A;  2ZJP Q;  5KFL A;  1HBO A;  4YY3 F;  1JLB B;  3OPK A;  5DS7 A;  1KRP A;  1LFW A;  2F1F A;  3QSI A;  3R2D J;  1WTB A;  4LF8 J;  4JYA F;  4IKA A;  1RT2 B;  1RGV A;  3G86 A;  2PGC A;  1KTV A;  3KG4 A;  2YKO A;  1R7I A;  2DNK A;  4B9U A;  3AJD A;  4P2F A;  2CPZ A;  4AL6 A;  3CVK A;  5B09 A;  3KHL A;  1WHX A;  3E3X A;  2MHN A;  4KPC A;  4ZVH A;  3IRX A;  4A8K A;  1HNI B;  4R8U A;  4OX9 F;  1S1U A;  2QMU B;  2L48 A;  2KRR A;  3OVA A;  1JJ2 R;  4DR7 F;  2AEM A;  1QTN B;  1FX2 A;  2AJ0 A;  2GO9 A;  4LRD A;  4B9L A;  3GU0 A;  4DJB A;  3PJX A;  2KG1 A;  4EZ6 A;  2DEI A;  2OPP B;  1I51 B;  4ES2 A;  1RTD B;  1VS3 A;  2OFG X;  4NXM J;  2EKN A;  3BN4 A;  4DQS A;  5E3C A;  3A12 A;  1NSK L;  3W8G A;  4RBV A;  4JI2 J;  5DZ6 A;  4IG3 A;  4LVO P;  4OV6 A;  3KLE A;  2OPS A;  2RT3 A;  1URR A;  5K8N A;  1VQ4 S;  3G9C A;  3KOA A;  2CQG A;  2NZ4 A;  1WDD A;  1HFE L;  2EFG A;  1P9Q C;  2ZHO A;  1U47 A;  1HQ2 A;  2A6M A;  2F3J A;  1RT3 A;  1KQG B;  2YWE A;  3ADA C;  1NPR A;  3HDS A;  3HVT A;  1PC4 A;  3JXO A;  4MYU A;  1VC6 A;  1FKP B;  2CYY A;  2LXI A;  4LSN A;  4UUX A;  5AJ3 F;  1N0U A;  5JMN A;  1JQG A;  4ZPC A;  3QJP A;  3JQJ A;  2IJR A;  1MG7 A;  3MTK A;  4CYU A;  1AFI A;  1HQU B;  1S1X B;  5J1E A;  4GKK F;  1VLO A;  3H59 A;  4HH0 A;  1N33 J;  2KJW A;  3MD1 A;  1VJW A;  2C2M B;  3T5L A;  4RW9 B;  2VV5 A;  1JK9 B;  1ARO P;  2HNY B;  4CLS A;  4KO0 A;  4BCA A;  3FCV A;  4ETZ A;  3Q2S C;  2WB4 A;  1OSC A;  1I94 F;  1IKV A;  3BJY A;  1ZZN A;  1BWE A;  4C8M A;  1RWN B;  3KNA A;  1PBU A;  3B4M A;  1CBK A;  4OI1 A;  1IWG A;  2AP6 A;  3PR4 A;  2U2F A;  2QSW A;  3MUR P;  1J2V A;  3OXL A;  1XMQ F;  2ZKU A;  5KFS A;  2PC6 A;  3MCS A;  2F7V A;  3BQ2 A;  1XR7 A;  3UPF A;  3CCZ A;  5J2N B;  1J5E J;  1FFW B;  3AOC A;  3KDO A;  4DX8 H;  1IVZ A;  1NEE A;  3L9Z A;  1RT7 B;  3SDE A;  3OR1 A;  3S7R A;  4HTJ A;  3TEG A;  4M5D A;  1KP6 A;  1AFJ A;  1RBL A;  4HI2 A;  2FVS A;  1XBW A;  2BE2 B;  3MGJ A;  5JJB A;  5KT7 A;  1WDT A;  3TA0 A;  5EX0 A;  4IUF A;  1HNZ F;  2ZZM A;  2OTJ S;  1VHI A;  1ZPV A;  3VF0 B;  4O4R A;  3O44 A;  2V63 A;  2B4O A;  1SKS A;  3BDE A;  1QLN A;  4MKA A;  3MEE A;  2CJ9 A;  2MTL A;  4KHP J;  4DN0 A;  2VIC A;  3BBC A;  3SSQ A;  2QE5 A;  3ZZ0 A;  1N88 A;  5CXT A;  3RBD A;  1C0T A;  2XMU A;  3LP1 B;  3MTJ A;  1G3O A;  4KGX B;  3KLH A;  2DR5 A;  3LAM A;  1YZ7 A;  3V4I B;  3ITH B;  4K2J A;  1KNZ A;  3MXH P;  3O2I A;  3BN7 A;  1EP4 A;  2EPI A;  3FCW A;  3JTO A;  2QMW A;  1M5K C;  2AWZ A;  4U96 A;  1OYE A;  2E7X A;  3C15 A;  4DR1 J;  5CQG A;  4A8O A;  3N9U C;  2RUG A;  1SIZ A;  3QNW B;  3EX7 B;  2JLG A;  2IJF A;  3NG8 A;  3SBM A;  3FFI A;  3T1H F;  2BYC A;  2CZ9 A;  4Y2I A;  5CCL A;  2CNO B;  2DH8 A;  2WB1 D;  1VBX A;  2HNY A;  1OWX A;  4ED5 A;  1RT6 A;  5CD4 A;  2MQL A;  1H98 A;  2MKH A;  2R8J A;  3RBZ A;  4XK8 C;  1C4C A;  5K8O A;  5FJ4 A;  1S6Q B;  4OZ3 A;  2BR0 A;  1FO1 A;  1GXT A;  1TKT B;  5LM7 E;  2WOM A;  2UVV A;  4C4W A;  1KEK A;  2N7Y A;  1WEZ A;  2M2B A;  3GYN A;  1HNX J;  1S6U A;  4NZ0 A;  1EP4 B;  1TKD A;  2HAI A;  2V8P A;  4K4Z A;  3QAE A;  3VWS A;  2PD1 A;  2QL5 B;  2XC9 A;  5E3R A;  1FRJ A;  1K0T A;  2BW2 A;  2N3O A;  3CCW A;  3OTC A;  5KFX A;  5D4O A;  5KFF A;  2YPZ A;  3D67 A;  1FRX A;  3FBE A;  2MKC A;  1HQE A;  1H2T Z;  1XJW B;  1RWW B;  2FZG B;  3A8E A;  4ECR A;  1LW0 A;  3KLG A;  5KFW A;  1JWW A;  2PEB A;  2B43 A;  2FHJ A;  4DSI A;  4IQX A;  1SJ4 P;  3R1H A;  2WBM A;  4IR9 A;  5BJR A;  3KG1 A;  1VQ5 S;  4WYW A;  4GO7 X;  3DOM B;  5I3P A;  2DY1 A;  2B5J B;  1X60 A;  4LRC A;  5KFP A;  1RE1 B;  2W8K A;  9RUB A;  4X64 J;  2DNG A;  2CFX A;  3M8Y A;  4PG6 A;  1NBE B;  4PG5 A;  4C11 A;  5C25 A;  3K58 A;  1N33 F;  4ANC A;  4TKT A;  4DV5 F;  5GAD I;  2IA0 A;  4UF4 A;  2EKY A;  2GQ2 A;  4ECS A;  1RLD A;  2LA4 A;  3AA9 A;  3MUV P;  4DV4 F;  4F3Q A;  4GKJ J;  2VHG A;  3N6N A;  2XTJ P;  2AJ4 A;  4KY3 A;  4AFF A;  3ISN D;  5GME A;  4ALZ A;  2W8L A;  1VC5 A;  1NKC A;  1K8A T;  1KFS A;  2LDI A;  3HM9 A;  1O8B A;  2E5G A;  1G1X A;  3DRR B;  4ELT A;  3OVB A;  1GEH A;  4KQZ A;  4TQS A;  4OYB A;  5HLF A;  2DXE A;  2EXU A;  1X4E A;  1T9T A;  2IY5 B;  3Q8U A;  3I82 A;  1AB8 A;  4ED6 A;  3ISN C;  1S0M A;  1N5T A;  1YJW S;  4IOC Q;  3DI6 A;  2W2P P;  3UD5 A;  2BOA A;  1F0X A;  4OJH A;  2CVE A;  2BJ3 A;  4CM2 A;  1Q53 A;  1S1W B;  3PDN A;  4QW8 A;  3GV5 B;  1VRT B;  2EVZ A;  3CWJ A;  3FBF A;  1Q86 T;  6FD1 A;  1DQA A;  2RML A;  2GQC A;  2ROP A;  2Z58 B;  4R0E A;  3F56 A;  3KLF B;  3RB4 A;  1T03 A;  1UVN A;  1RBA A;  3CD0 A;  4RW8 A;  2VA3 A;  5CCM A;  2GAH C;  4FF2 A;  1VQY A;  1R0C B;  4L6V 3;  1Q78 A;  5L1K A;  1IBK F;  4LVN P;  3QBC A;  3VGT A;  2ZM6 J;  1D09 B;  2DRD A;  4DS5 A;  3D1O A;  3M32 B;  3SQG B;  4XIU A;  2F63 A;  1CJV B;  4CNZ A;  2OSQ A;  3TJA A;  3AD9 C;  2BJ7 A;  2CQ3 A;  1TEL A;  3M8Z A;  2CG8 A;  2FD2 A;  4UZC A;  2CNK B;  1V5V A;  4JB8 B;  3RBX A;  2ABY A;  2XUL A;  5A0Y B;  5MLC V;  4DPX A;  2LA6 A;  3MMB B;  5L8R C;  4ECT A;  2MEW A;  4LF1 A;  4DR2 F;  4ZHR A;  4O0N A;  3N6M A;  4R5P A;  3VAK A;  2GX8 A;  1HBN B;  2HS4 A;  2RDI A;  1VIS A;  4N47 A;  2G2Y A;  3TEH B;  4A8X A;  1ZAV A;  4YB6 A;  3PX6 A;  2MZR A;  3EVW A;  4P6Q A;  2QLF B;  1B0T A;  4OYI A;  4TN2 A;  4HYK A;  3VCD A;  2ZHB A;  1F5A A;  1IR0 A;  2DNQ A;  2DYA A;  2GC8 A;  2ZBQ A;  4EU0 A;  2ZDP A;  5J1P A;  4EBC A;  3H4B A;  1ZYQ A;  2CPF A;  1SV5 A;  5CAA A;  3H0P A;  4YB5 A;  3K5P A;  4AE5 A;  5KFM A;  3E8O A;  1NPK A;  2LQ8 A;  4MJK A;  2CQI A;  1NND A;  3I0S B;  4NLW A;  3T6B A;  5L1L A;  2NXJ A;  1Q4R A;  4ED4 A;  3FRZ A;  2UV8 A;  3BV8 A;  1Q8I A;  4OJ1 A;  3MR5 A;  2K2P A;  5K9F A;  2IRX A;  2R8G A;  1Y3K A;  4TYA A;  5T7L A;  3AB4 B;  5D0H A;  2AEF A;  2AGQ A;  4UW2 A;  1NJZ A;  2HK3 A;  1HHT P;  1WG5 A;  2HGN A;  2PN6 A;  3LWL A;  1RWP B;  4NYZ A;  5GMK a;  5GAG I;  2KVI A;  4KYZ A;  1ULR A;  2JLF A;  4GC6 A;  1FNM A;  1S97 A;  3L3C A;  4IFY B;  3UWT A;  3W5X A;  4J90 A;  2XO6 A;  3K5M A;  3K7R A;  3TAN A;  4B02 A;  1RU2 A;  4ZP7 A;  4RU9 A;  3QMQ A;  4O23 A;  4URQ U;  2YPY A;  3Q86 A;  1Z2L A;  1J27 A;  1B0P A;  2NXC A;  3HFZ B;  3L7U A;  5DG9 A;  4X64 F;  2GAG C;  2KXF A;  2R2S A;  3V4I A;  3J80 U;  4N8O A;  4DV6 F;  3N01 A;  4LF5 J;  4X4Q A;  1ZBT A;  2H4Y B;  2JZ5 A;  3NCQ A;  3QO9 B;  4RW6 A;  1YGY A;  3MPD A;  2GS8 A;  3SCJ E;  5HMX A;  2DIU A;  3M32 A;  5FLX Y;  1SH2 A;  1S49 A;  1F60 B;  2J7W A;  2OPQ B;  3VVU A;  3J7Y U;  1YJ9 S;  1HD0 A;  2X1A A;  2H65 B;  2DO0 A;  1BQN A;  1LWC A;  3D66 A;  3R5A A;  4WU2 A;  4D3G A;  2AEJ A;  2V94 A;  2V8H A;  2F8E X;  1GT8 A;  2IHR 1;  2WOM B;  2WSE C;  3B78 A;  3P96 A;  2CNL B;  3QGP A;  3DNC A;  1MNE A;  1RAI B;  1HR0 J;  3AOD A;  4LRA A;  3RB0 A;  4ZIT A;  3FCH A;  2OH2 A;  2RH3 A;  1NCL A;  5B0F A;  1IKY B;  3UR3 C;  3UD4 P;  1S72 S;  1WWH A;  3HI9 A;  2H5I B;  2AZ3 A;  3VAM A;  4WE1 A;  5BR8 F;  2MQM A;  4CI0 B;  1ZA1 B;  4NEY A;  2UV8 G;  5AE2 A;  5KTQ A;  2FHO B;  3H8Y A;  5G0R B;  5IWA F;  1VQO S;  4P10 A;  3TRG A;  1TL1 B;  2B6A B;  2IVY A;  2RNE A;  2VD3 A;  5BYS A;  1KFD A;  4FF3 A;  1C0U B;  1RAA B;  3DLK A;  2IC3 A;  5E5N A;  4GVB A;  5C24 A;  2C42 A;  4NCG B;  1YSJ A;  4WK1 A;  2RJZ A;  3IWN C;  4JI3 J;  3GJQ B;  1U09 A;  3RRK A;  1N4L A;  1IBK J;  4XO0 A;  1GX5 A;  4UOH A;  1UCN A;  3KJV A;  2RRN A;  2HND B;  2ZOG A;  1OQ3 A;  1HQU A;  4RNH A;  3D0I E;  3BPD A;  3KJF B;  2NUU G;  5D4N A;  1LNQ A;  4USU A;  3R5D A;  5KFG A;  4C11 B;  1RHM B;  2JH3 A;  3GIJ A;  3AY0 A;  4JI0 F;  2RKI B;  2CQ4 A;  3JTN A;  4ZMM A;  4DFJ A;  4ENO A;  2HHV A;  2B5J A;  4FYV B;  5D0R A;  1RWM B;  1HA1 A;  4OX7 A;  1LV5 A;  4LFA F;  1AA1 B;  2XZT B;  1JXL A;  3FC9 A;  2E1M C;  3ONQ A;  4WCE Q;  4HDH A;  2CWX A;  3H5S A;  1R27 B;  2Z2L A;  3OLB A;  1FDA A;  1QSL A;  4NCB A;  1J5O B;  1FXL A;  1FRM A;  2ILY A;  3UDE A;  1IBM F;  1RQ0 A;  1W7W A;  4CO3 A;  3I5B A;  3HZE A;  5C42 A;  3V4M A;  1W25 A;  1WI6 A;  2IJN A;  3S01 A;  1TL4 A;  3AT1 B;  3P4U B;  2AJ2 A;  4X84 A;  5ETO A;  2ZE2 A;  3C14 A;  3JSM A;  1NSP A;  2OUG A;  1D9A A;  3MMC A;  3PJW A;  4ZPD A;  5J2P A;  1VQ8 S;  3Q8R B;  3M2U A;  2PI4 A;  1D8Z A;  3EWG A;  2Z30 B;  2ZUG A;  3DN9 A;  2VFR A;  2AJF E;  2HHQ A;  1ZAX A;  2EFO A;  2CJA A;  3N5F A;  1LQ9 A;  3CO9 A;  4M5M A;  2K8G A;  4I6A A;  4BWJ A;  1R0B G;  2R7T A;  2OAU A;  1S1X A;  3A13 A;  1FJG J;  2V0N A;  4UOC A;  2VUG A;  4CWB A;  2FHJ D;  5KT2 A;  1IKX A;  4LF7 J;  2BAN B;  2CJY B;  2YWW A;  5CZX A;  4ZCL A;  1KSP A;  1E6Y B;  1VIX A;  1JXV A;  3CJK A;  3W2W B;  1HNW F;  1NPP A;  4QWE A;  2SXL A;  2W4P A;  3QT6 A;  4ZK7 M;  1PKU A;  2MZJ A;  3DLK B;  2ROG A;  3F44 A;  1OQ6 A;  2FYX A;  1MMN A;  3DLE B;  2F65 A;  4EWT A;  3C15 B;  5M2U A;  4ECZ A;  2CZ4 A;  4MKB A;  4OHW A;  1ZET A;  4GMK A;  2XHC A;  2A10 A;  1EX8 A;  1CUL B;  4H4O A;  4JI6 F;  5KFJ A;  4ED7 A;  4K4T A;  4OV1 A;  1C1B B;  1G6B A;  4NLU A;  2G4B A;  1AYE A;  2NRE A;  2PE8 A;  4YB1 P;  1JLG B;  3LH2 S;  4AL5 A;  3M05 A;  1RT3 B;  2ZE2 B;  3C14 B;  4I4B A;  4G1Q A;  2JVR A;  1DTT B;  2XCA A;  4FKY A;  1D9D A;  3SI8 A;  3LOU A;  1WKJ A;  2GJ2 A;  2OPS B;  2CQP A;  3MZI A;  1WNE A;  1KR4 A;  2JFD A;  2CAD A;  9ATC B;  3HD2 A;  1T95 A;  1Q95 G;  2VG5 A;  3OQ2 A;  2CG4 A;  4J9M A;  1RSC A;  2C3P A;  4FYD A;  1YIJ S;  1WC1 A;  4G6V B;  3QO9 A;  5FLX U;  5LMN J;  5AXM A;  3C6U A;  2HKE A;  1XMO J;  2B4U A;  3JSR A;  4NL5 A;  3T3F A;  2J6T A;  1RHJ B;  1OMS A;  3TZY A;  2FLP A;  5KG6 A;  1Y5L B;  2IC3 B;  2VOO A;  3IRX B;  1UA1 A;  3PG9 A;  4TLR A;  1QAI A;  1JLF A;  3POT B;  1RTH B;  3DLB A;  5DLG A;  1Q8L A;  5ETR A;  3T5H A;  2MQQ A;  2QLJ B;  4Q8F A;  1WC3 A;  4NLQ A;  2YQ3 A;  1WF2 A;  3WIV A;  4J9R A;  1U1M A;  4YDX A;  2UUA F;  2BW7 A;  1NME B;  1FK9 A;  1SVD A;  2V4J B;  3H4D A;  3EZ5 A;  1S0O A;  3Q8S B;  1NHU A;  1FDN A;  2WON B;  3P8B B;  4M5L A;  4PPZ A;  1JLA A;  1SH3 A;  3R5C A;  4QYR A;  1NK7 A;  2DPI A;  2IAJ B;  4DR3 J;  3N6L A;  4I7F A;  4S0M A;  2A2D A;  2AQ4 A;  1JLQ A;  4P2M A;  2DGQ A;  2Q66 A;  3G8Q A;  1RT1 B;  2LLZ A;  4LFA J;  3MPW A;  4HT7 A;  4DI6 A;  4GO5 X;  1DAX A;  1APS A;  1NXI A;  2RUS A;  4UOG A;  4F0H A;  1FFS B;  4X62 F;  1J5O A;  2V68 A;  3M30 B;  2K3I A;  3M2R A;  2FQQ B;  3R7S B;  1X8D A;  4DFK A;  2QG9 B;  2VPX B;  4LRE A;  3NS6 A;  4Z7C A;  4N5S A;  2QC3 A;  3UNY A;  3EXC X;  1RA7 A;  3ZO7 A;  5EWG A;  3GIM A;  1RWO B;  5L1I A;  2C2N A;  2VBX A;  4M94 A;  2AKW B;  1RAC B;  1CSJ A;  1U2F A;  5IC6 B;  4O4G B;  1UPP A;  2UXC F;  2LCW A;  1LWX A;  4I2Q B;  2ROE A;  3BRE A;  1UAW A;  4CTA B;  2B7C B;  4IO1 A;  3OL7 A;  4L3K A;  2B9Y A;  4X4P A;  3IBW A;  5KFD A;  2DHH A;  4YP3 A;  2ZIT A;  2E1C A;  4GRS A;  5CH7 B;  2V4R A;  2B8Q A;  3R5G A;  2FC8 A;  3CCM S;  1KQK A;  2JRS A;  4FBU A;  2RAQ A;  2ADC A;  3H2V E;  2DGX A;  2IA6 A;  3C66 A;  5HP1 B;  3ZNJ 1;  4USW A;  4NXM F;  2HQ3 A;  3K5N A;  3PXG a;  2BRK A;  2HEK A;  2KN4 A;  3D6M B;  4Y65 A;  3T19 A;  1VQ9 S;  1FRH A;  3OHA A;  1HIY A;  2M52 A;  3BGR A;  2MJN A;  3RZA A;  2X3D A;  1T3O A;  4ZS6 A;  4CH0 S;  3MCN A;  2KYZ A;  4F4X A;  1HWK A;  1I3O B;  2DY9 A;  2HS3 A;  1GMV A;  4F67 A;  2E1R A;  2MKS A;  4OYP A;  2FJV A;  4NX9 A;  2ASY A;  1JLC A;  2W01 A;  1AW0 A;  4U8Y A;  1REV B;  4FN5 A;  1HBU A;  3DXB A;  2GCF A;  3CED A;  4U7U K;  4A8S A;  1CQN A;  4P52 A;  3BBF A;  5B0B A;  4DUZ F;  1U1L A;  2DGT A;  2VDI A;  4F3M A;  4FF1 A;  4KGK A;  5HLF B;  1SI9 A;  2GQQ A;  3IG1 B;  4R0J A;  3TAQ A;  1NM2 A;  1UJ5 A;  2M9K A;  3W9J A;  5LMU J;  1X4F A;  1Y5I B;  1KC8 T;  2J6S A;  4NCA A;  3MM9 B;  2NXE A;  2KB2 A;  2B9W A;  3PYD A;  4RW6 B;  4ZLJ A;  3UVJ A;  2HQC A;  4KGZ B;  4CLZ A;  4ZVP B;  5K8M A;  1AXQ A;  2ERR A;  4LRB A;  1B7F A;  1VR6 A;  4RWX A;  1KKH A;  2DR6 A;  4DF8 A;  1H3D A;  3O1L A;  1R8H A;  1TP7 A;  3S1T A;  5AXL A;  2WVD A;  3MPY A;  1IQT A;  5HSP A;  4LQ9 A;  2J9D E;  3JYT B;  4YFU A;  5A6P A;  1PYS B;  3QLH B;  4M5K A;  3SCK E;  2YKM A;  5ETL A;  4DR5 J;  3K5L A;  2GML A;  2HHU A;  1RTI A;  3IGV A;  2J76 E;  1N5V A;  5H1S V;  1ZAW A;  1OSD A;  4I2Q A;  4PXC A;  1S9G B;  1R8P A;  2NXU A;  1ZOT A;  1F2H A;  2M7S A;  3I5A A;  4HH1 A;  3RGI A;  2F8M A;  5KFN A;  1IBL F;  3IS9 B;  5F9N A;  3W65 A;  1E6V A;  3I4H X;  3CDE A;  1AUD A;  1JNR B;  3JQK A;  4CDI A;  1VJQ A;  4ER8 A;  2ASD A;  2CJB A;  5KFA A;  2AYM A;  1EET A;  4EMD A;  3I0S A;  2FB0 A;  1F9F A;  3PCO B;  4NZ7 A;  4OZ1 A;  4K8R A;  1S77 D;  1HWL A;  1JXE A;  2DTJ A;  2QA4 S;  4NEZ A;  3T1Y F;  4USI A;  4NYP A;  2XYH B;  4F26 A;  2KJV A;  3OFG A;  3NEK A;  3T1H J;  2CIM A;  3GJR B;  2FY8 A;  1NK6 A;  3R5B A;  1JLA B;  5L38 A;  1MRO A;  3DDN A;  1U02 A;  2XYG B;  4FXW A;  2A1B A;  2M4M A;  2NZC A;  4MTP A;  3VVT A;  5IM0 B;  3DCA A;  1X7V A;  1RAH B;  1X31 C;  2G1H A;  3CDW A;  4P71 A;  3HVR A;  3DOL A;  4HAC B;  1C2P A;  4H4M A;  3ILO A;  3IR6 B;  2UXC J;  1X0F A;  2L9N A;  4OI3 A;  4TYB A;  2MLZ A;  2E9T A;  5A8W B;  2YNF A;  2J7K A;  2ZH7 A;  3RUB L;  1NK4 A;  1VBY A;  3AD7 C;  4LF8 F;  4JYA J;  4C8N A;  2Q3P A;  4LBP A;  5KFE A;  2OKQ A;  4CO4 A;  1X4H A;  2N7C A;  5KG2 A;  3PY8 A;  3ZTP A;  3CCR S;  5HAT A;  3I56 S;  1X0P A;  1KOO A;  3MOZ A;  2VBW A;  2GNK A;  4QJV A;  2VIH A;  1N5Y B;  1U2C A;  4I69 A;  3CPW R;  4HT5 A;  2RHQ B;  3PJ9 A;  2A6O A;  1QE1 B;  2DRA A;  2QLB B;  3S6E A;  1UW4 A;  4F3O A;  3CMQ A;  1DRZ A;  3ETM A;  4P9S A;  2PDA A;  3R9L A;  3T9Z A;  2LDY A;  1QDU B;  2N4C A;  3DOK A;  3KFW X;  2DGS A;  3ZZU A;  3UCU P;  1N34 F;  2V8V A;  1NZ8 A;  4M8L A;  2XS2 A;  2GIQ A;  3V6H A;  1LWE B;  4OX8 A;  1JJC B;  4J9L A;  5DG7 A;  3KTQ A;  2R8H A;  1YTY A;  2IMW P;  2VPY B;  3GSI A;  4ZPV R;  3L7P A;  4WYL A;  4DLE A;  3LAN A;  1UEK A;  1FA0 A;  4O3Q A;  3TVK A;  1RT7 A;  3L95 X;  4ES1 A;  3KYL A;  3CW2 C;  5T41 A;  2HBY B;  4CO5 A;  3A1Y G;  1U1Q A;  4ELU A;  1FEH A;  1O0P A;  2OI2 A;  3O6Q A;  4ZLN A;  2X1F A;  2ZBP A;  3KG0 A;  1R43 A;  3BPS P;  1Q82 T;  1F9H A;  4JI8 F;  5F8G A;  4RX6 A;  4ZA1 A;  1YHQ S;  2I2Y A;  3MMA B;  4HLB A;  3ZNU A;  1ITP A;  3CJ5 A;  2BRL A;  1RWX B;  4QR0 A;  4RNF A;  1YX2 A;  5D0E A;  5DM7 Q;  2BUN A;  5MAO A;  2OEK A;  3MCM A;  2PMW A;  3W5Y A;  2E1P A;  2GMJ A;  5D0G A;  5EUH A;  3KLH B;  3R8Y A;  3EE3 A;  3NL0 A;  2PO4 A;  1RA6 A;  2MKJ A;  4DV7 F;  3RTV A;  3X1L B;  2RQM A;  2OGU A;  2XS7 A;  4MKY A;  3EPG A;  1WOS A;  3SV3 A;  5H9F J;  3VAH A;  1RTJ A;  3LP2 A;  1FF2 A;  4ECY A;  3P3D A;  1N48 A;  1JJ4 A;  1FKA F;  4QR2 A;  2CPJ A;  3V2U C;  3CC2 S;  5KFU A;  4P2S A;  4R25 A;  2Y1R I;  3U1N A;  4U95 A;  2MZ1 A;  3NAH A;  4ECX A;  4NAS A;  1T3N A;  3NMA A;  4E2F B;  5EN1 A;  1VRU B;  3UDC A;  1DTQ A;  3FGV A;  1XQI A;  3GR1 A;  3MMC B;  3GFZ A;  4Y6I A;  1LXJ A;  1GMU A;  4RUC A;  1IBL J;  4RBU A;  2AIR B;  1N32 J;  3W63 A;  1RKJ A;  1N5Q A;  2PI5 A;  1RTZ A;  3CB4 A;  3KLE B;  2NR0 A;  5EWE A;  3GIR A;  2RDJ A;  4CLU A;  2FZC B;  4RO0 A;  3UW1 A;  2I0X A;  2BE7 D;  2OFH X;  4TY8 B;  2JNJ A;  4OZL A;  4ZPW R;  5KG5 A;  4JI5 J;  1Q7Y T;  2GIF A;  3MAA B;  2G1D A;  4WWS A;  3M6X A;  2YNF B;  1WC5 A;  4RPF A;  4Q43 A;  2ZJQ Q;  4DV1 J;  2NYH A;  4EYH B;  1XER A;  2IM0 A;  1RTJ B;  3EDR B;  3ULH A;  3KUE A;  1MN7 A;  2QA2 A;  1N52 B;  2HLT A;  3DOL B;  2RS8 A;  2MPU A;  4HAC A;  5DRK A;  3DLJ A;  5IT0 A;  5A2Q U;  5IM0 A;  1MWQ A;  1E6Y A;  4OYM A;  3W2W A;  2H9Z A;  2ZH1 A;  4Y00 A;  3WQP A;  5F8H A;  1TFY A;  3P49 B;  3G6X A;  4JI5 F;  3J7Z T;  3D6H B;  4ZPA A;  1TAQ A;  2F9D A;  5T7L B;  3CC7 S;  2B4P A;  4KAI A;  4NZ6 A;  1ZTT A;  4DN9 A;  1SBR A;  2CPD A;  2DNN A;  2ZH5 A;  3HD1 A;  2FVR A;  3ZTO A;  1N36 J;  1RHK B;  3HHL C;  1KN6 A;  1Y11 A;  3HVW A;  4X4S A;  1S6P B;  4Q0B A;  3FSY A;  1ZM9 A;  1H2U X;  2IM2 A;  2W2N P;  3HSD A;  4HHU A;  4J5O A;  1FCA A;  4WK3 A;  2VQE F;  3PFE A;  3MM5 A;  4KR0 B;  3TQ1 A;  3QT7 A;  4RBT A;  3TOQ A;  4CO1 A;  2LYV A;  2NSB A;  4TU7 A;  3B54 A;  2DPJ A;  4WZM A;  1IM4 A;  4OZ5 A;  1OY9 A;  4DV0 F;  1WJ9 A;  4B3S F;  3NNC A;  3GG1 A;  1AZS B;  4XDD A;  1N36 F;  3PO5 A;  1RT5 B;  1UP1 A;  5H9F K;  2BM0 A;  3Q23 A;  1WHW A;  3LP0 B;  4UQG A;  5G4D A;  1MLA A;  1VI7 A;  1UVM A;  3TZZ A;  3PZP A;  3NP5 A;  4DX5 A;  3PW0 A;  3IAS 9;  4I68 A;  3OLA A;  1D9F A;  3RB6 A;  3R97 A;  2DH7 A;  5J1N A;  3J7Y I;  4YUD A;  1CPZ A;  2F4F A;  3THV A;  2HMI A;  4ZIV A;  2KXN B;  1VRU A;  3HSZ A;  3AQO A;  4YOE A;  2V67 A;  1BWV A;  5HO4 A;  2X3G A;  4OZJ A;  4OLP A;  5HQL A;  3T5K A;  4OX6 A;  3MUM P;  3LP2 B;  5A8K A;  1WG4 A;  6FDR A;  3A8I A;  3K59 A;  3OW2 R;  1VOM A;  2D9P A;  2V2V A;  4DX6 A;  1CJU B;  5LSO A;  2R7Q A;  5DM6 Q;  2ZH4 A;  1S6P A;  1HI1 A;  1O51 A;  3H90 A;  3GII A;  1QSS A;  4KPY A;  3MMJ A;  3WX4 A;  5F3Z A;  2BAN A;  4KTQ A;  1MML A;  2FLL A;  2NS1 B;  4OL8 A;  2KXH A;  2VDH A;  1HBM B;  3HFK A;  3KNG A;  2LU2 A;  4LIR A;  4MMO A;  4ED3 A;  4W90 B;  3V6K A;  4NRT A;  3QIP B;  5BXI A;  2AGO A;  3C3L A;  1S9E B;  4DV7 J;  2HVE A;  2IM1 A;  1FJE B;  3GCX P;  3WHI A;  2EEY A;  3DOK B;  4B08 A;  3K5O A;  4ANE A;  3OR2 A;  4O3S A;  3DRY A;  1FD2 A;  2MJU A;  4I56 A;  4DCP B;  4PAB A;  4F4Z A;  4OZ2 A;  1IJF B;  3J81 Y;  3EJM A;  3C6T A;  3ISZ A;  4QBU A;  3OTO J;  4F4Y A;  3ILL A;  1I6J A;  3HKW A;  3RAM A;  4RU2 A;  2JDJ A;  4NLD A;  3W3S A;  4ILM A;  2FJX A;  2ZBI A;  2C2K B;  5LSR A;  2DCL A;  2BMB A;  3OTB A;  1SL0 A;  3MR3 A;  3ZTS A;  5M2P A;  3NGD A;  1JJH A;  2Z8Q A;  2LU1 A;  4OZN A;  1S12 A;  3KWM A;  1M1K T;  2DR9 A;  4H4K A;  2YBV A;  1KLN A;  2YQ0 A;  4JP8 A;  3G6E S;  4MK7 A;  1W26 A;  2OMO A;  4QU6 A;  3C19 A;  1HD1 A;  2YNG B;  5KFR A;  5DGA A;  2ZZT A;  1V3R A;  1VQ7 S;  2WTF A;  4JI1 F;  4C0H A;  1VQN S;  2FJA B;  3A3P B;  5F0U A;  3FMW A;  3A3O B;  3OD2 A;  4O4G A;  5L1J A;  4RLE A;  3RRG A;  2FTR A;  4J9U E;  1VQP S;  1QUV A;  2XWX A;  1WG1 A;  4C3L A;  4WKY A;  4RR5 A;  3LQV A;  3UCZ P;  4B9M A;  3FVY A;  3AJ2 A;  3W62 A;  1N54 B;  2YNH B;  2NUH A;  3UN5 A;  4AND A;  4TY9 A;  3SYZ A;  2KFN A;  2Z2Z A;  4FXV A;  4MYT A;  4Q2L A;  1V3S A;  2VFV A;  3PYG A;  1N0V C;  2XB2 D;  2DKO B;  4FDF A;  4IDK A;  4QWA A;  4K2X A;  5JVG Q;  1R0A A;  1UWB A;  1K47 A;  1QAX A;  3IG1 A;  2HRT A;  3LF0 A;  3EXY A;  4PYD A;  1GXL A;  4JUZ A;  4ETX A;  1HLW A;  1UPM B;  2J6U A;  1RIS A;  3VAL A;  2PII A;  1TL1 A;  2B6A A;  2V8G A;  3LGM A;  2MZQ A;  3CJS A;  2W4D A;  1PYT A;  3ET6 A;  1XWL A;  1A7G E;  4KKO B;  4X4V A;  4WFY A;  4DU7 A;  3IS9 A;  4QW9 A;  4YN3 B;  1R3N A;  3MM7 A;  1YK9 A;  1DLO A;  1P1T A;  2DK2 A;  3H5Y A;  2BBE A;  3MWB A;  4FYX B;  4WE1 B;  3T9N A;  4NI2 B;  2GVZ A;  3IO1 A;  4DV0 J;  1DY3 A;  2RD5 C;  3CDU A;  2ZH3 A;  2R42 A;  4M5H A;  4JI3 F;  4LBH A;  3DRP B;  4NLV A;  1GX6 A;  2N4D A;  1UZH A;  2DO4 A;  1XR5 A;  3FFI B;  4ZVS B;  3O8W A;  2B0G A;  3V6D A;  4QU7 A;  3NS5 A;  4NLX A;  4RKU C;  5ETP A;  1VDH A;  3D3B J;  4QPX A;  2K06 A;  4X65 F;  2AYB A;  2DGW A;  5GAE U;  1LXN A;  4RUA A;  1FDD A;  2YH0 A;  4DL3 A;  1Q81 T;  3FSI A;  3IAM 9;  1IBM J;  3F0N A;  5C25 B;  5D3G B;  4BDP A;  3SSR A;  3W66 A;  1TL3 B;  3G82 A;  1T9Y A;  3RBE A;  1BQX A;  1OY6 A;  2H5E A;  4KSE B;  1CJV A;  1BGX T;  3BKT A;  4X65 J;  4JI7 F;  5A8R A;  1X4C A;  4ECQ A;  2A18 A;  1YKW A;  3RB3 A;  2HK2 A;  2HHX A;  5A8W A;  1NDC A;  2HQG A;  5KOW A;  5KFI A;  3CCU S;  1HI8 A;  5AT1 B;  1S1V A;  4DR2 J;  3V6D B;  5BR8 J;  1X9W A;  3EZU A;  2V4Q A;  5BYR A;  2W4C A;  2MQO A;  4DS4 A;  1ZM3 A;  3NGK A;  2BM1 A;  2V34 A;  4U8V A;  3OR2 B;  1YRT A;  2MQ8 A;  2KFY A;  3AFG A;  2QZ8 A;  1RLC L;  4NI2 A;  4QWD A;  2XQC A;  4DL5 A;  1NJW A;  2HFS A;  1S9E A;  1QD1 A;  1TUG B;  2VPW B;  3UNG C;  1SKR A;  1ZH5 A;  5FDL B;  4AQY F;  4KKO A;  3CGI A;  1LFP A;  2LQB A;  1KVI A;  2HHW A;  2Z56 B;  5F8I A;  2EBE A;  2RIL A;  2AHO B;  5D6G A;  4PKD B;  1VRQ C;  4LF6 J;  3QID A;  1RT4 B;  4C8Y A;  3OL9 A;  2BVZ A;  2QYG A;  2VOP A;  1XNR J;  5M2R A;  2ZC3 A;  2QFJ A;  3MM6 B;  2WVF A;  2FIU A;  3MOJ B;  4F02 A;  2XNQ A;  3LGH A;  4RUB A;  4JI0 J;  3HUL A;  3NCR A;  1F1B B;  2EG2 A;  2V50 A;  1T11 A;  4F50 A;  2FC9 A;  4ZJQ A;  1TKZ B;  4DPW A;  2D3O R;  4LSL B;  1CS4 B;  5HMZ A;  4LF6 F;  4ZCM A;  2J0W A;  2CJK A;  3VTI A;  2DNM A;  4R5P B;  3R27 A;  2AX0 A;  1B70 B;  4KRW A;  2PT0 A;  2VBZ A;  3CJT A;  3FSX A;  3T6J A;  2AYG A;  3I96 A;  3HHK A;  3KLI A;  5HL7 Q;  3TI0 A;  1RTI B;  3PW2 A;  1NB2 A;  3RYL A;  2VFT A;  5KT4 A;  1PBA A;  3NY0 A;  1VQK S;  1EQM A;  3B4D A;  5LMN F;  3TAM A;  2QO3 A;  5DQH A;  1WAC A;  1FXR A;  1JIH A;  2LQ5 A;  3BGF A;  2KDO A;  3M1V A;  4LBI A;  3B6B A;  4RWW A;  5JUM A;  1M5P C;  4MK8 A;  2VG5 B;  3VAI A;  1WI8 A;  3M8Q A;  1ZZF A;  2CQ0 A;  4DQQ A;  1SH0 A;  2OML A;  4G65 A;  3RW6 A;  5IXU A;  1TV6 B;  4UY8 T;  1U0H B;  5IT9 Y;  3U1L A;  3VAF A;  1TL7 A;  3C6T B;  5C5J A;  4CRJ A;  2Y0S D;  1DTT A;  1XN9 A;  1S1W A;  8ATC B;  2GGP B;  4B3T J;  1L5U A;  4DX7 A;  2QV6 A;  4FF4 A;  4PR6 A;  7FDR A;  1SJR A;  1S7H A;  2XNR A;  1S76 D;  4LF7 F;  1YQH A;  3V81 B;  3C16 B;  4XTT A;  3HMJ G;  4CZC A;  4YR2 A;  2G2Z A;  5IOL A;  4USJ C;  2MB0 B;  1FTR A;  3I9Z A;  2HFO A;  2FLO A;  1RT2 A;  1NSQ A;  2DHS A;  3J7Z 5;  1S0V A;  1T8E A;  4B3T F;  1WC4 A;  3EGV A;  4DDF A;  2HWT A; 
#chains in the Genus database with same CATH homology
 3ET6 A;  4OYM A;  4WP9 A;  4OYW A;  1YK9 A;  3MR7 A;  4NI2 B;  2GVZ A;  4UST A;  1TL7 B;  1WC3 A;  5IV4 A;  2BW7 A;  1Y11 A;  2GVD A;  1WC0 A;  3UVJ B;  1CUL A;  1CJU A;  4OYB A;  3MAA A;  4P2M A;  4WPA A;  1AZS B;  1AB8 A;  4CLS A;  3G82 A;  3ET6 B;  1YBT A;  4CLL A;  4CLT A;  1CJV A;  1CS4 A;  4CM2 A;  4USU A;  2WZ1 A;  5D0R A;  4CLK A;  3G82 B;  4OYA A;  4NI2 A;  1CJT A;  1CJV B;  1CJU B;  3C16 A;  4CM0 A;  3R5G A;  4USW A;  4WP8 A;  3C14 A;  2GVZ B;  4CLF A;  4CLP A;  4OYX A;  1CJK B;  4OYI A;  3C15 A;  4WP3 A;  1CS4 B;  4OYP A;  4USV A;  2W01 A;  4OZ2 A;  1U0H A;  5D0E A;  4CLY A;  1AZS A;  5D0G A;  4CLW A;  1CJK A;  1FX4 A;  5IV3 A;  5D0H A;  4OZ3 A;  1Y10 A;  3C15 B;  1YBU A;  2GVD B;  3UVJ A;  1WC6 A;  4CLZ A;  1CUL B;  1U0H B;  1TL7 A;  4OYZ A;  4P2F A;  3C14 B;  2QV6 A;  4CLU A;  4OYO A;  3C16 B;  3MAA B;  1WC5 A;  1FX2 A;  1CJT B;  1WC1 A;  1WC4 A;  5D15 A;  4P2X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...