3ET6B

The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
187
structure length
180
Chain Sequence
SAPAQEHPEATVLFSDIVGFTEIASRSSPLEVSLLDELYQRFDAAIEEYPQLYKVETIGDAYMVVCNVTVPCDDHADVLLEFALRMHEEASRVAEPVRIRVGMHSGPVVAGVVGRKMPRFLFGDTVNTASRMESHGEAGQIHISEACYCLRSKERFEIRERGNITVKGKGTMRTYLLSPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Soluble guanylyl cyclase beta
publication title The crystal structure of the catalytic domain of a eukaryotic guanylate cyclase.
pubmed doi rcsb
source organism Chlamydomonas reinhardtii
molecule tags Lyase
total genus 53
structure length 180
sequence length 187
ec nomenclature
pdb deposition date 2008-10-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00211 Guanylate_cyc Adenylate and Guanylate cyclase catalytic domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.1230 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Nucleotide cyclase 3et6B00
4WP9A 4USTA 3C16B 1AB8A 3C15B 3MAAB 4WP8A 4OYXA 1CJKB 4OYIA 1WC6A 1WC1A 4OYMA 4P2FA 4CLPA 3UVJB 1TL7A 5IV4A 3G82B 1CJTA 1U0HA 1WC5A 4OYZA 4NI2B 4CLZA 2GVDA 4CLSA 3C16A 1CS4B 1Y10A 5D0RA 3C15A 5D15A 3MAAA 1FX2A 1CULB 1CJVB 3C14B 4OZ2A 4OYOA 1CJUA 2GVZB 4WPAA 4P2MA 5D0EA 3G82A 4CLWA 4CLYA 4CM0A 4OYBA 3ET6A 3MR7A 1CJKA 1WC3A 4USWA 3UVJA 1Y11A 1TL7B 4USVA 1CJTB 1U0HB 3R5GA 2WZ1A 4NI2A 4CLUA 4USUA 4CLFA 4CLLA 1YK9A 2GVDB 1AZSB 1CS4A 2QV6A 5IV3A 1YBUA 1CULA 1CJVA 3C14A 5D0HA 4P2XA 2GVZA 4OYPA 1CJUB 4WP3A 5D0GA 4CLTA 2W01A 1FX4A 4OYWA 1WC4A 4CLKA 4OYAA 2BW7A 1YBTA 1AZSA 1WC0A 4CM2A 3ET6B 4OZ3A
chains in the Genus database with same CATH superfamily
2VPZB 3HP6A 4R0JA 5BJRA 2MSSA 3CMAS 2HNDA 5L9XA 1VRUA 5AXLA 2O67A 1KWMA 3ZZTA 4QWDA 1WG5A 4DSEA 3K5OA 1N8RT 1KEKA 3QGGA 1BD6A 3DLGB 2IM0A 4ZS6A 4UT4A 4WPAA 3B4DA 1TL1A 4ZCKA 1DBDA 4HHUA 4PQAA 2FHMA 2EFQA 4DFMA 4UZCA 3V6JA 1T03B 4DEZA 2UUWA 1S1UB 4NX9A 3M4XA 3R2DJ 2VG5B 4YUDA 1NKBA 4WZMA 3R3TA 3I0RB 4M5DB 3PJWA 4EUVA 1UP1A 5MAOA 2AJ2A 2LDYA 3EWGA 2XWXA 1VCTA 4QWBA 3CULA 3M05A 1RCOB 3W64A 2AX1A 1L5UA 4U8VA 3IR5B 3HCXA 3RYLA 4C7QA 3FMWA 2OJ3A 4GKKJ 1MU2B 3RBXA 3GFHA 4O3QA 1IJEB 3EVOA 3BEGB 1S5ZA 1PO6A 4EBCA 2MKIA 1JJCB 1VK8A 4JI5J 2OLWA 2F40A 1UKUA 1KHWA 1RHJB 3H5UA 2YWHA 2B4UA 2NREA 3CSKA 4J90A 3GSIA 3ENAA 3MAAA 4ELUA 3BN7A 5HP1A 2XMJA 3QQCD 1QUVA 2V4JB 1XMOJ 1HWLA 2CZVC 3Q8QB 4F4WA 3FCVA 3QATA 3JQJA 2QEXS 2LYVA 1KBRA 3NMRA 4B9VA 1TUWA 3CGIA 5LMNF 2K7KA 8ATCB 5D3GB 4OFZA 1FD8A 2YVSA 3MEEB 5IC6B 4DR5F 2R7OA 2PGCA 1NPKA 3DLGA 1S49A 4ED0A 3PKMA 3HVTB 4C2MA 3HMJG 4LFBJ 3AD7C 1DQAA 4ZN1A 3MD3A 5HO4A 2Y1JA 3TQEA 4OI3A 2J0XA 1U6ZA 3QO9B 4CTAB 2NYIA 3BN4A 3AOAA 2DXFA 1T03A 1NK6A 4ZPVR 3AT1B 2U2FA 1S1UA 2VG5A 3MMAB 5KFRA 4IG3B 1B0TA 2PFFB 2CQPA 4F50A 4M5DA 4LF9F 2DHXA 4OYZA 3G96A 4NLWA 2J9DA 1HNWJ 3R5JB 4PQUB 1OMSA 4LBPA 4X4SA 2RE1A 1KQGB 2C3YA 5DJBA 1I51B 4WE1B 5HATA 3VALA 4JV5F 3BQ1A 2XHCA 1SJRA 2PE8A 1ZZFA 3IO1A 1QSLA 1MU2A 4RBTA 5HL7Q 1BWVA 2C1EB 1VRQC 3ZNJ1 4K4ZA 4QWCA 1TL3B 1J5EJ 2FY8A 4ZVPB 1QDUB 4ES3A 1FKPB 2F1FA 1O0PA 3H98A 2R7SA 4NCBA 2GO8A 1UWBB 3M32A 2QV6A 3RB0A 3RR8A 1HNZF 4JUZA 4RW8A 4BC7A 2ASDA 4EO8A 1NEEA 2GW8A 2IVMA 3MM8A 1OSCA 1RWKB 2H51B 2V4JA 2AYEA 5K8MA 4J9MA 3PNIA 5IQ6A 4JP8A 3D6TB 2CJQA 1BXNA 2BE7D 3SEOA 4DOZA 5D3GA 3J7YU 5A2QY 4P9SA 3AJ1A 3QWUA 1UVNA 4NZ0A 4L75A 4TY9A 3UI3A 4PUOB 3K59A 1ACMB 3DOMB 3KG4A 2FJDB 3RW7A 1VQ6S 3HVTA 4Y0FA 2C2KB 3OUYB 5KFLA 1HBUB 2DRDA 4HHJA 1WTBA 3G82A 4WK1A 2VQEJ 1H3DA 4UOFA 3QO9A 3W62A 3JQKA 4RR5A 3DGVA 1U1RA 5KFAA 1KRPA 1SJQA 1LWXA 1BQXA 2BYCA 3TX0A 1N54B 4IG3A 3E8OA 5KFYA 3FDSA 4B3TJ 3ILLA 2AHOB 2C2OB 3PR5B 2K1RB 4PQUA 2GVDB 2CQHA 2JDJA 1UWAA 4WE1A 4WYLA 1BQNB 5I4MA 1I6JA 2OSQA 2CNNB 4OI0A 2VHGA 1N5TA 1TL3A 1KQFB 2IMWP 1OY9A 7AT1B 2XNQA 5A0YB 2W9CB 4CLPA 3UVJB 3KNAA 2KFNA 1HHQA 3D67A 4CIOA 2CQ0A 3MXHP 1UWBA 5GMDA 1YG0A 1VQSA 2CPHA 3HT0A 2IPOB 4J9QA 4W90B 4LJMA 4LFCJ 2BXJA 4DJBA 1C0TB 2GS8A 3J7AN 1HQ2A 2C42A 1KLMB 1BE4A 4LQ9A 3Q8UA 3MR2A 4GO5X 1OSDA 3ZTSA 4IO1A 2LXFA 2VPWB 4FF2A 4X4TA 3JS9A 3IP0A 5ETKA 1CC8A 4PUOA 3KHRA 3EICA 2Z4PA 2VC1A 4OV6A 3OUYA 2FHKA 4OZ5A 1VK3A 5B0FA 4NEZA 1HBUA 2V2KA 5L38A 1Q5YA 1RWOB 1H2UX 2IDEA 3OR1B 4UOCA 4F26A 2HBRB 2EFVA 2DTJA 2JEIA 3CT9A 1IM4A 1PG5B 4IFVB 3NS7B 1UA1A 4NLRA 1HQUB 2A1BA 2ZH3A 2BJDA 5FD1A 3HT3A 1O51A 2K1RA 3O1LA 2GVDA 2YH0A 4M5MA 2J6UA 4H4OA 2KI2A 5CH7B 1BQNA 1R31A 2UVVA 3I32A 4B3MJ 2XGQA 2DJWA 3HZGA 3FEZA 1TFYA 3PW5A 3EXCX 1XR5A 1QTNB 5KAKA 3NCQA 3LWMA 2EFNA 5A0YA 3BO2A 4AL6A 3UVJA 2MKSA 3BKFA 2EPIA 1GXUA 1X7VA 2FVRA 4PRFA 4I2PB 3R5GA 2QZ8A 5CYMA 2GGPB 1RAEB 2O66A 4QQBA 2AEMA 4LRFA 1WEZA 2CA9A 3W9IA 3GFYA 3THTA 3KLVA 3P45B 1OIAA 3FQLA 3AY0A 2DGUA 3HULA 1KLMA 2BW7A 3TZYA 4M5IA 2YH1A 2OTLS 1B4SA 4DG1B 5B0EA 3CJQA 1NH7A 4C0OC 2DK2A 5KFTA 3GCXP 2DD8S 3QPIA 1WORA 1S0NA 8RUCA 2BV3A 3KHLA 3VGSA 1CQNA 1R0BG 3R5DA 4I7FB 3OR1A 3VQSA 2QA4G 1D0EA 2LA6A 4DL2A 1FFGB 4DN9A 3CB4A 1FRXA 4IFVA 3V5RA 3MR7A 1QY7A 4KB7A 3P6YC 1N5SA 3ZZUA 1RYRA 4QYZK 5AE2A 5H1SV 1HQUA 2R8JA 3MMBB 1VOMA 3R5CA 3KLHB 1LWFA 4F0MA 3PJ9A 1RHMB 4ANDA 1NJZA 1S97A 4OZLA 2NYHA 2ZHAA 1NKCA 1JB0C 2CPIA 2DEIA 2RDJA 4NYOA 1PCAA 2HWIA 2Q43A 2QRRA 1YWXA 1WOSA 2HFZA 3E3XA 4KFBA 5L1JA 2IA6A 3CWJA 2GGPA 1VJWA 2QFIA 2UV8A 2Y0BB 4LR9A 3CD7A 4F4KA 1P9QC 4K4UA 1KONA 5BR8J 2HKEA 2C3MA 4WKYA 1IBCB 2DNHA 3B8HA 4LF7F 1H38A 1UZHA 1N5YA 2KFYA 2ZH8A 3D28A 2NXJA 5KG3A 1N34J 5D6GA 3NAHA 2Z56B 4QW8A 2BBEA 2N82B 2NPFA 5LSRA 3L7OA 3DFEA 5E5NA 4DG1A 1LW0B 1NJWA 3D1OA 2UXCF 1U0HB 3QT6A 1HNVB 2DR5A 4ZPWR 5F3ZA 4HI1A 1TKXB 2L9WA 4ZN3A 1XR6A 2VB6A 5U47A 1HNIB 2XQCA 4KO0B 4JI4F 1S12A 2XI2A 4JV1A 1HBNB 4I7FA 3DLLQ 3U1LA 1MROB 4DU7A 2B9XA 2KM8C 3OL7A 3BF4A 3VAIA 4LSNB 3F0NA 4X84A 3EGNA 3PHTA 4OYIA 4ELTA 5GAGU 2VDIA 2XYHB 3MMBA 1YJRA 2BKNA 2JWNA 3KLHA 5DDPC 2KRRA 4TU9A 3MECB 2ROPA 2PC6A 3PW2A 5B09A 3IBWA 2UU9F 4ZOSA 1MLAA 4KC5A 5LMUF 3BYPA 3UPFA 2M9KA 2LXUA 4OZ1A 3P4UB 2HZAA 1P8GA 4UQTA 4ETZA 3KK3B 2RQMA 3NGDA 1JLBB 2R7WA 1T02A 2NZ4A 1PJ6A 3N5FA 1XMQJ 1HR0J 3RUBL 1GT8A 4RZRA 3G6ES 1YK9A 3PX4A 3OTEA 5KFSA 4H4KA 2E9ZA 2YNFA 1NHVA 3M30B 4C0HA 1K44A 3X1LB 3GYGA 3DOLB 4I6YA 5F8MA 1HHSA 1PBAA 2OELA 2IJNA 4JV0A 3FC9A 3VGTA 3GQCA 4ZLNA 2HWTA 1VQ9S 2X1AA 4JI3J 3DRYA 1VQLS 1HIYA 3CCES 3TANA 2E5GA 5A6PA 2JEJA 2ZZTA 1U0HA 3OJSA 2J9DE 1HNVA 5DRKA 4OHYA 1TKXA 3DLEB 3C16A 2E1CA 4ED7A 1UVKA 1VBKA 4D3GA 2UVUA 5KT3A 2XEXA 4YQWA 4KO0A 1UW9A 4FS2A 4CLYA 1HBNA 2GIQA 2Z2LA 3HSZA 4DPUA 2DH9A 3AXKA 4LSNA 4NXNJ 5E41A 4IDKB 1QAYA 4ECRA 1CJTB 1E6VA 2D7SA 2VJUA 5T14A 4WFXA 2KVQE 4NEYA 2P6SA 3OL8A 4ZP9A 5E3QA 2RB7A 3M6XA 4EWTA 2HHVA 2F3JA 3DGPB 5KFXA 2W2PP 5F9NA 2CVIA 2CQIA 2DISA 3KK3A 4ED1A 5LT5A 2FLLA 3IS9B 2V5HG 3FBCA 4F8RA 1JLBA 4B3SF 5LMNJ 1R8AA 2KG1A 4AYBD 4GVBB 4I68A 1YHQS 4Q8EA 1CJVB 4G1PA 2JLGA 2GHVC 3N6MA 4GVLA 2C2DA 3DOLA 2DR8A 3HVWA 2RQCA 4PXCA 3VAKA 3EJMA 4HDHA 1YTYA 4AUKA 5K9FA 3TYTA 3CCZA 3DXSX 4ZDNA 2QG9B 3PZPA 1O5JA 3HF5A 5EHHA 4USVA 3PDNA 1LKZA 3DLEA 2IVYA 3V6DB 3BPDA 3GG1A 2XZWA 4FYWB 4E0DA 1T9YA 1FNMA 2HBZB 5T41A 1U1NA 3MFHA 2XYGB 2E5IA 1ZAVA 2G1HA 2W01A 4O44B 2E9RX 2DGOA 4QYZJ 3M2UB 4Y2KA 4F2SA 2BZ2A 3FRZA 1XC9A 1W25A 4ZVFA 2K3KA 5L46A 2XULA 2H5JB 1RU2A 5CD4H 4RLEA 2DNYA 3QMQA 2WOMB 3T5HA 2G2YA 5I3UB 4DUYJ 2VV5A 2G4BA 4IRCA 1U2FA 4ZP6A 1CJTA 5C25B 1PYSB 1XNRF 4HHHA 1V3SA 1PGZA 2K7JA 1T05A 5AXKA 2F65A 2FLOA 2OPQA 3LP0A 3DOKB 1RWVB 4M5KA 4QZVB 1VIOA 3CCSS 3UO0A 1NK7A 5K8OA 4X2BA 4HYKA 4K0KJ 2HSEB 4DFPA 4YFUA 3L9ZA 4UUXA 3PG9A 4ZA1A 3BQ2A 4XK8C 3BDEA 3RAXA 3IS9A 1FDBA 3A3NB 3TJ9A 8AT1B 2WAQD 1NZ8A 4QCLA 3OXFA 4LR7A 2Y3YA 5IWAF 4GVBA 2ZH6A 1Q82T 3V4MA 3J7A1 2J7KA 1CJVA 2OPPB 2R42A 1VQKS 2OEJA 5F8IA 3C19A 3DN9A 1B0VA 4MMOA 1NSQA 3GILA 3N5BA 2HQCA 1PKUA 3PM9A 1RT1B 1HD1A 3GFXA 4X62F 1CG2A 3PW4A 2N7CA 1DARA 1U25A 2PEBA 3DHWC 2OMOA 3EGWB 3GJQB 1RWWB 1HWUA 2ATCB 1FCAA 1WEYA 4LT6A 4I6WA 2HVDA 2CWXA 4O44A 3BKTA 3CUNA 3LGHA 5J2NA 3M2UA 2Q3PA 3D1QA 2RQKA 4C8MA 3SZ2A 2ZD1B 3QRPA 2V9WA 4WWSA 5D4NA 2FZKB 2WOMA 5I3UA 2XCPA 2XWYA 1X31C 2J6SA 5C25A 1Q4RA 3QLHB 1IBLF 3K5LA 4IOBA 4LQ3A 2JC1A 2CJAA 4K8RA 4DL3A 3CCUS 5D77A 2YKOA 5HMXA 1JMTA 4OLPA 3ZTRA 2XLIA 2H3EB 1REVB 2QSFA 1REGX 3AD8C 2BRLA 3RR7A 4V19J 3EVWA 2P9EA 4ED3A 4EO6A 4A8YA 3R2CJ 4L74A 3DLBA 3HPOA 2HHXA 1SIZA 4ZJLA 1F0XA 3K0JA 2DH7A 4HH0A 5B7WA 2YKNB 4MIWA 3J81j 5D15A 2AGPA 5HROB 5J2MB 4K4WA 2C22A 5DDRC 2KHDA 2FVSA 3W8PA 3DHXA 1HMVB 2ASLA 3OHBA 4OI1A 2XZDB 1HWIA 3G6YA 4K4XA 2LP4A 1F5CA 1U6BA 3I5AA 4EEYA 3PW7A 1D8YA 5FDLB 1RHKB 3OTOJ 3F56A 2HS4A 4FXVA 4DL7A 4A47A 1QD1A 1HNXJ 5CA5A 4O3SA 1IXKA 4FNHA 3J81Y 4FYDA 2DKOB 2A2CA 3G6XA 1RBLA 2ZD1A 2A3JA 3ET6B 4PABA 1XR7A 3C15B 3MMJA 2QLBB 3CDWA 1NHKL 3D9BA 3DLKB 3OXLA 3KUHA 3M6VA 3QLHA 2ZH4A 1Y9OA 2CQ3A 3IM9A 4UF4A 3OFFA 3BYRA 2KM8B 5GADI 4QR0A 2CJXB 2BE9B 1ZA2B 4J9RA 4DI6A 4OMFG 3KXDA 1OS5A 3GIIA 3JSMB 2WSFC 2BDPA 1MMDA 4HKQA 2KXHA 4C8YA 2B5JB 3SSQA 3DDKA 5C42B 3PFOA 5ETVA 1IJFB 3B78A 3KJNB 2YKNA 2ZC3A 1KHVA 2IY5B 2YNHA 2B6AA 5H9EK 1T9UA 2HAFA 5EUHA 4L76A 3QT8A 3BB5A 1QM9A 1AA1B 3UNGC 4KGKA 5AXMA 4O4RA 3PX0A 1A0OB 3D7SB 1VQ5S 3RBZA 1L3SA 2ERRA 2DO0A 4FZVA 4J9KA 3PXGa 3NBPB 1NDCA 1GMWD 4QU7A 2YX1A 4QIVA 3FSYA 3R97A 3NNAA 4ZIVA 3LAMA 1OYDA 3IA0A 2OFHX 1C1CB 2X3DA 3HO1A 1NK4A 2YNGB 3O3LA 1M5SA 4TLQA 2DCLA 3W65A 4PXDA 3VTIA 4GO7X 1OPZA 5D8HB 4DV5F 3QJLA 5EDWA 3ET6A 4ZLPA 2OEKA 4DN0A 1Y7PA 4OX9F 1UW4A 3Q0AA 1R8CA 2UVRA 2VOPA 4N56A 2HBQB 3DLKA 2WVCA 3CE8A 2PT0A 1RBOB 3JAMU 4JI1F 5L9NA 1UCNA 3D68A 3M8QA 2MZTA 1SBRA 3QT7A 4BDPA 4WP3A 4DDFA 4B9LA 2RIJA 4K5SA 5DETA 2GZOA 2ZDPA 1X4AA 2LLZA 3NMAA 1HPZB 2XO7A 2YY3A 3BSOA 3I31A 2AYBA 2FY1A 3JSMA 1M1KT 4K4SA 3HSJA 4DFJA 3FSXA 2OPRA 4LF6J 4LREA 5SZTA 1VISA 2OFGX 3DU5A 3NGRA 1M5KC 1F5BA 4OHVA 2IBOA 1KNZA 3D3CJ 5AE3A 1AUDA 1N5VA 2L3MA 3NOGA 4C48A 3KLIB 1UVIA 1B0PA 2CKWA 3ILOA 2M3DA 4WYWA 2G13A 2XZTB 3THPA 1Y00A 3H4BA 2JL9A 4KGMA 4JI0F 4ED2A 4K50A 1Q7LB 3NRBA 3UCGA 5KFDA 3H5YA 2YNGA 4N8OA 4RWXA 1YBUA 5J2PA 3VCDA 1GMWA 2JEFA 3UE2A 2R7QA 1Q0NA 1RWMB 2XMWA 5F8GA 4O3PA 2E1MC 4QPTA 1KR4A 4Z37A 5DM6Q 3CDEA 4ITSA 3L7UA 4ECSA 2MKKA 4BS2A 2VPXB 1I94F 1HBOB 3EMTA 3KWMA 2GJ2A 1DHMA 2B9WA 4EFAC 4I67A 2ZUAA 2EKYA 3S6EA 2YWGA 3QZ7A 4NLDA 1N32J 1GH8A 2HHWA 1WF0A 1HPZA 1RGVA 1T9TA 1J5OB 4QU6A 4A8SA 3J7YI 2FHJD 3J80Y 2V8GA 4G1QB 1VGYA 3DRRB 5F8JA 1LXJA 3I55S 1KP6A 3KJFB 5HANA 4AFFA 2ZH1A 4MK9A 1Q8IA 2G2OA 4GKJJ 5KFEA 4N76A 2UP1A 1NU4A 4KGZB 3I82A 1AZSA 5ETOA 3M8RA 4NYZA 2CPEA 4DX6A 3MOJB 4X4QA 1WKJA 1CPZA 3MM7B 1RLCL 4BBYA 2LU2A 1J27A 3EYZA 2BEFA 1KFSA 4URSA 4P52A 2W8LA 2BW2A 3AH6A 1KLNA 1IKVB 3OT9A 5CQGA 2KO1A 2WRMA 4HACA 1YITS 4X4VA 2EFOA 2QE5A 4CT8A 3GV7B 2YQ0A 4UZBA 4KGXB 4PYAA 1DURA 1UEKA 5IT0A 4QWAA 4J9UE 2KJVA 1GXLA 2EWHA 3LQVA 5GMKa 1TKTB 2P8IA 1VQOS 4LBIA 3C6TB 3GLJA 4ZVEA 3EGVA 3AODA 2ROGA 2ZKUA 1SC3B 4B3RF 1NM2A 3SMZA 3U7JA 1N52B 1X9WA 4J9SA 1GX6A 1EJ7L 3T1HJ 2HZVA 3H7HB 4DR6J 3DC2A 3IFEA 4J9PA 4G1QA 5C2CA 3A4TA 3DRRA 2RUGA 3UD3P 3IN5A 2MMYA 3V6KA 3HFVA 5ETMA 3K58A 2GQCA 2KRBA 1N33J 2RT3A 3OL9A 1IKYB 4Q2MA 1K1QA 3UDEA 1S6OA 5KFIA 5A8KB 3I5BA 3KLFB 3QJPA 2FUG9 1V5IB 1RT4A 2V2ZA 5DO2A 3W2WB 4KPYA 4DV7F 3MM7A 2Q1LA 3QBCA 2MLYA 1GMUA 4OHXA 1WJ9A 3C6UB 1U26A 1KOHA 2CFXA 3TO8A 4ZVRB 4ZKAA 1IKVA 2CQCA 5IT9Y 3ZZ0A 3AQPA 3N6LA 2ZVIA 1UFLA 1X5TA 3VAHA 3CTRA 2DH8A 3M6UA 3R7NB 3MPDA 4DUZF 2I2YA 1K47A 3AB2B 4KHMA 4CM2A 1T0TV 2FVPA 3PO4A 2MHEA 4DV0F 1SL2A 2KJWA 4G1IA 1WKKA 3IG1B 2F63A 5ETRA 1TKTA 3FGVA 4RW9B 1KKHA 3C6TA 3ZZZA 5IWAJ 3V2UC 2DNNA 3A3OB 5IC4B 4ED4A 1MW7A 4K2JA 3C14B 4A46A 1RAFB 2H54B 3C66A 2CQ1A 1JLQB 3SSSA 4DV4J 5KT7A 1S4EA 1FRIA 3MR6A 1VQNS 4QWEA 5EX3A 2XY6A 3BM7A 2R2SA 1HI1A 1EP4B 1X4FA 3UW1A 1H7XA 5CYQB 3N79A 2ZNZA 3GSDA 4LF5F 5RUBA 4X62J 2J7UA 3JB9k 1D9DA 4R8UA 4FVMA 5C24B 4U95A 3Q8PB 3GWCA 3TARA 4U96A 4ZVQB 1QAXA 3A8IA 1JJHA 4TQSA 4JI7F 2C28A 4ZVOB 3CCJS 5A8KA 2H5EA 3KLFA 2YX7A 1EQ0A 4DV2F 4CNYA 4PG4A 1FVQA 1X4CA 3I9V9 2ZZNA 3W2WA 3A13A 2Z8QA 5KFPA 2HWHA 1RWNB 4J7CA 3C6UA 4Q2LA 1LOUA 4OV1A 3Q8VA 4ELVA 5KFWA 2QJ3A 2K3IA 2QYGA 2IAJA 2HFSA 2QT7A 2V6AA 3NL0A 5ETTA 1IWAA 1ZM9A 3OTBA 2H9ZA 1N56A 3KJQB 2UXBJ 4ZITA 1Q1KA 2CPDA 2CWKA 3DI6B 2RILA 5B0AA 4OJGA 2G0IA 1YKWA 4PPDA 5IM0B 1R0AA 5DZ7A 1WKLA 2DPJA 4B9UA 1H72C 1TFWA 5DGAA 2FQQB 3PEJA 5K14B 4RW9A 1ICEB 5ETQA 5HJXA 1AFIA 3C14A 4YEAA 2AMCB 2Y1IA 2IRYA 2Q79A 2R8KA 4IR9A 2W7PA 4KE5A 2KH9A 5EGYA 2UUAF 2FGCA 4DBQA 3CMES 4LF1A 3W5YA 2DO4A 4Z7CA 2J6TA 3QYYA 4WXWA 1EP4A 3ISND 4GC6A 1ZOTA 2VODA 3KLEB 4UOHA 5CYQA 2HHTA 1CLFA 4B9TA 2OPSB 1N36F 3H90A 3HSDA 1S9FA 3NY0A 5HAOA 3UCZP 1VDHA 2V67A 3CW2C 1RE1B 5J2QA 3W9HA 1VRTB 4A8XA 4FYXB 3CCLS 1FXDA 2YWEA 4Y28C 2HFUA 1WEXA 1LWEB 5KFUA 3QGHA 4NYPA 4XPEA 1EHWA 2IMOA 1NDKA 2W2MP 2EC2A 2DHHA 4JI2F 1VBYA 4TU7A 2KTQA 5DQHA 2R8HA 1RTJA 2JNJA 4CP5A 4Y6IA 2FTRA 4M5HA 1GTEA 1Q8KA 1U1QA 4KPCA 3FZ2A 4DQQA 2R7UA 1M5OC 4M94A 5LJ3Y 3G9CA 5JUMA 3PACA 6FDRA 5IM0A 2KZMA 5KFCA 3OFGA 4YN3B 4ILMA 3OR2A 2FC9A 2AV5A 2BR0A 4PKDB 4EU0A 1FXRA 2CPFA 4DV6J 3BDPA 3CIMA 4TXSA 1CS4B 2MJNA 4ILRA 3LPYA 4M5JA 3BS9A 1KC8T 2HGLA 1VLOA 3MEKA 1VJQA 4K7QA 4L73A 3QGIA 2K06A 2CAJA 1WI6A 4C0BA 2GIRA 1KQSR 4CWBA 2OPSA 2BJ9A 2ZM6F 2UV8G 3M9NB 3OLBA 3NS6A 3KG1A 4MKVA 5HBMB 4NCGB 4B08A 3D2WA 2AWZA 3DRPA 1VRTA 1AFJA 1FX4A 3K8VA 4NRUA 3VAGA 1LWEA 3KDNA 3NCRA 4OYAA 1PILA 5H9FK 2DITA 3VF0B 4TU8A 3TR5A 2RRNA 3NP5A 4YB6A 1EX8A 4U9RA 4RU9A 2HNZB 2JVRA 2HHUA 2HFVA 3FK4A 4J9LA 2B51A 1U2CA 1WF1A 2DNRA 1S79A 4QPXA 4DV1J 3NXZA 2D9PA 3MUVP 3OVAA 1XQIA 3BO3A 2NXEA 5HMYA 3HK2A 2XM3A 1R89A 5K8PA 2CRLA 3W61A 4ATNA 2AYMA 2BQ3A 3K5MA 3ZZPA 5D4OA 1DTTA 4KR0B 1NPPA 2RRAA 4C8OA 3MGJA 1JLFA 4ZIWA 3P5BP 2MLXA 1SJ3P 1CS4A 1RT2B 4RBUA 3TVKA 1T7PA 2OSRA 2VFUA 5D0HA 4V19X 2BRKA 3CC4S 4KY3A 4C8NA 3EPIA 3PV8A 2B43A 2YWWA 3MDFA 2E1RA 4XDDA 2DR6A 3EM1A 4LRCA 1TUGB 3L95X 4DR4F 2E5LF 3VZIA 5IT4A 2B56A 1N0UA 5DLGA 4JYAJ 1FRJA 2DGTA 4DSJA 3R6LB 1H7WA 1EIYB 3GYNA 5HBMA 1PJ7A 4NCGA 3S01A 2J5AA 1IBMJ 3SBMA 4LVOP 3HHEA 3W60A 4FS1A 2L9DA 4BC9A 2HVZA 5G4DA 2AYGA 5KFJA 3I4HX 1X9MA 2EG1A 4CLWA 4F4AA 1R0CB 1F2HA 5J1PA 1SKRA 2ADCA 3GZ7A 2XSJB 4Q7AA 4O3OA 1NB2A 2HNZA 3UD4P 2COLA 4BCAA 1NNDA 1TL7B 2RD5C 1K0TA 2UUBJ 3ICLA 5GVQA 3K57A 4DS5A 2VH7A 1ROFA 3SIPB 5AJ3J 2IDLA 2UVWA 2ALYB 4RW4A 4RWWA 2KXNB 2FVCA 1XJWB 3PYFA 2V9KA 2E1AA 4L3NA 3UDLA 4DR2F 2VBZA 3GJSB 3CCTA 2HQIA 1MWYA 1W7WA 1G3OA 3BJYA 4LIRA 3DDIA 4WP8A 4ZPAA 2I1RA 3EVMA 2YNIA 3QNWB 3O6QA 2EBEA 1VBZA 1S10A 2CQ2A 2CQBA 4YB1P 2R2UA 1RT2A 4P10A 1UA0A 2V4QA 3MPWA 2DGWA 1WHVA 4DR1F 1CVJA 3RRHA 2HYIB 2N3LA 4LF8F 1RWUA 1TTHB 1WHWA 1H2TZ 4ALZA 3TA2A 4Y2CA 3U02A 1R8HA 3BH7B 3KJVB 2V8VA 4DZ6A 5ETLA 3PR4A 2MZQA 4I64A 3SCKE 3U1NA 1Q8LA 1V3RA 6FD1A 2EK6A 2NZCA 1T95A 2ZVSA 3I6PA 1U49A 3BR8A 3M2RA 1MG7A 3DCAA 3NKYA 2XSFA 3PKYA 3H8YA 4LF4F 3PO5A 3PJXA 1UVLA 2XSJA 1Z2LA 3H20A 1RISA 4G6VB 4ANCA 3UR0A 2RH3A 2XS2A 4LFAJ 3NNCA 5HJYA 1FJGF 4JI8J 3RB6A 3CO0P 1TL7A 1Q86T 4JOUA 1B99A 1Y4ZB 1X9SA 2DHAA 3Q8SB 2KDOA 3PCOB 4I1TA 4HI2A 1JK9B 4ECXA 2NUHA 5KFMA 2VKRA 3HSGA 2HHHJ 1SJFA 1L3VA 4MAKA 4RUBA 2D3UA 1SVDA 2YXLA 4JB8B 2J7WA 1M0SA 5DLFA 5KG1A 3Q83A 1B64A 2LEBA 5BYSA 4F7VA 1Q81T 3T1YF 3TUIC 2QA4S 3PIOQ 1PYTA 2GA7A 3FEXB 3HI9A 1AYEA 4F2RA 1CBKA 2FGOA 3OSNA 4RBVA 2RU3A 3KJVA 4FN5A 2YBVA 2PA8D 4URGA 5DDOC 4CO5A 3I5CA 4P2FA 3H59A 1I3OB 3CJ8A 2YPZA 4O0NA 3N4WA 3MM5B 3MAHA 3WHIA 1CEZA 1X4DA 4WU2A 5HK4A 3T5JA 4ZJQA 4YY3J 3OHAA 2EKNA 4OL8A 2MQOA 1NSPA 5IS2A 1VQYA 1YJNS 2I0XA 2CJYB 1KS2A 2A6OA 1S0VA 2Y1LB 2D1CA 3O44A 4A8MP 5JVGQ 2E7VA 1JXVA 4NZ6A 4FYYB 2OAUA 3W9JA 4X65J 3TA0A 3HZEA 1ZPWX 5KG6A 4EGLA 4ES1A 2N3OA 2R9LA 3CDUA 1W26A 3I0RA 1L3TA 5J1EB 1KVJA 2BANB 2ILYA 1H2VZ 4CI0B 3CPWR 1RADB 2ZBIA 1RABB 1RHUB 2HRYA 3I0SB 3K5NA 3TAMB 4QYRA 2LA4A 4QIGA 4O3RA 1F3VA 5MLCV 3CD6S 4ZP8A 3M6WA 3KK1B 2O1PA 4O4GB 1ZYQA 2CNOB 4KT0C 2PSZA 2ZBPA 4F3MA 3DDNA 3S7RA 3RTVA 4ZP7A 1FTRA 4FVCA 3JYTB 3ZTOA 4JI7J 3GB0A 3W66A 1S72S 1JLCB 4YOEA 4NLQA 3AJ2A 2W2QP 2I8EA 2EG2A 3CDAA 1DTQB 4GKKF 2BM0A 4J37A 2K2PA 1ZETA 5FIIA 5EWGA 3MM5A 4QR1A 4OX6A 1X5SA 1ZA1B 4RNHA 2M8DB 4YDDB 4RO0A 3LW5C 4X64J 1BMQB 2LFVA 1BLUA 2W1BA 3MEEA 4KGVB 3T5LA 3M8WA 1N0VC 2BX6A 3I96A 2LDIA 1R6YA 2VFTA 4YHHJ 4JV2A 2QFJA 4Q0BB 3KK2B 2I38A 2IC3B 3G71S 1XMOF 3MCSA 3KG0A 2AJQA 1S77D 4CTAA 3J81U 2RDIA 4CLZA 1Y10A 3AXMA 1RTIB 2SXLA 1H0HB 2IM1A 3MMAA 4P2SA 1OY8A 1FNOA 1ZM2A 3FJ2A 1IKWB 4ECTA 1H74A 2R4FA 5K8NA 2PEHA 2PN6A 2BMBA 2YWKA 3H42A 1FRMA 1JXLA 5L1KA 2BM1A 4LFBF 3CIZA 3I0SA 3TAMA 1NJIT 4DCJB 3TUZC 3QT5A 1SPBP 1DRZA 4X4NA 4O4GA 3JQMA 1IWGA 2CQGA 2DHSA 4U67Q 3BBBA 1FKPA 3WX8A 1FD2A 1TP7A 2WK4A 3JYTA 3LP2B 3PYDA 1HNWF 3IBFB 5CYJA 2U1AA 4Q5VA 1JJ2R 3HLUA 2V68A 2ASYA 4LSLB 3NGUA 1L3UA 3EDQB 1UJ5A 3MM9B 1DTQA 3M7VA 4N7TA 1BHNA 2ZITA 1J5EF 1S7IA 4ERDA 4CYUB 4ECUA 3CJ5A 3OD2A 2IHR1 1N88A 2B4VA 3JSBA 3GYXB 3F41A 1UJ6A 2ZEJA 1SC6A 2GJFA 4K2XA 2YKPA 5KFVA 3DOMA 4PYDA 5JJBA 3P49B 3K89A 1Y5IB 4Q0BA 2IC3A 3TZWA 2HHPA 1ZTWA 1S1XB 4FKXA 2F9JA 4F3QA 1U1PA 2RVJA 3TOQA 4ZPDA 3HKZD 3TZXA 1NK5A 1YQHA 4WKRA 2QYCA 1RTIA 3KNGA 2HEKA 1CJUB 1Z1ZA 5E3RA 5LXRA 1IKWA 3TI0A 4A8KA 3H2LA 2QN6B 2UUCJ 2I5JB 1RT3B 3I9ZA 4L6V3 4HEA9 4AQYJ 2GAHC 2RF2B 2RKIB 4C9DA 4NMXA 2VQEF 4YP3A 4CH0S 4RKUC 2HVIA 2UZAA 4NE9C 2FZGB 2VICA 4NMLA 2DY1A 3EUNA 1WTFA 4OJHA 4ZVUB 3C46A 4B3TF 2W9CA 4YR2A 4E8UA 1QTMA 2WTFA 4NL5A 2VQFJ 3GV8B 3LP2A 3I56S 3FVYA 1ZM3A 1SUQB 2YX4A 2B4OA 2B9YA 2P2CB 2W9AA 1ULRA 2YQ3A 1Y3KA 6AT1B 1NK9A 4IRKA 4LSLA 3NG8A 1KN6A 3O2IA 2HLTA 4PWDB 1WC3A 1QE1B 2J9CA 4G65A 3T9ZA 4PG5A 1C0TA 2V0NA 3MM9A 5IZHA 2E9TA 1E6YB 2CJBA 2BJ8A 4A8OA 3R5BA 3FBBA 5CAAA 2NCKL 1A6LA 1D1UA 3W8GA 1SI9A 2YQ1A 1PJ5A 4OYPA 1VI7A 2ACMA 4JI6J 1MMNA 4KHRA 2CPJA 2DRAA 1HI8A 2XLKA 2AX0A 2V2QA 1IQZA 3GPAA 4MKBA 2MEWA 3HKWA 4X66J 1LV5A 2G0CA 2MZSA 2ASJA 2E66A 1NB7A 1VQMS 2YTCA 3NEKA 4CO2A 2DY9A 1KQKA 1FKOB 3CNQP 1RTHB 3RBEA 1JLGB 3G4SS 2C2ZB 1FHTA 1FK9B 4DR7F 2R7RA 3TEHB 1IR1A 1RAGB 1U6FA 4DSLA 4ILLA 4GMKA 1SH2A 4BHQA 4EYIB 4DL0C 2OH2A 2WVDA 5J1NA 2GX8A 4AT1B 1CJUA 4NOHA 4CDIA 2QLJB 1CSJA 2HFNA 2VDHA 5DM7Q 1FT8A 3OTDA 2VFSA 1TELA 1XNQF 2ZHBA 3GE9A 2RKIA 1N5QA 4CNZA 1HYSB 4XDCA 3U1MA 2EK1A 2GIFA 3LPEA 3R1HA 1XN9A 2J0QD 2FZCB 5IV3A 3DM2B 3HVAA 4Z7YA 4EZ6A 3L4BC 1AXQA 2OMLA 4CT9A 3NGSA 4P72A 4I2PA 3J80U 2FD2A 1SUQA 3KFWX 2BJ7A 1H73A 2M52A 3NCPA 2XMVA 4OYXA 4PWDA 1S9EB 2ZWPA 3BSCA 3SI8A 2G1DA 1GFWB 1UEVA 2WSCC 1E6YA 5HVFA 2MJUA 3K2YA 1IBKJ 1Y0HA 2V8PA 3U27A 2UXDJ 3EPGA 3M8SA 1AUSL 2KN4A 2GVZB 2YKAA 3SYZA 3H5SA 1FO1A 2HHSA 4ED6A 2W7AA 5KT2A 5FLXU 4OLOA 3UN3A 4HL9A 2CG8A 2O3DA 2LKZA 2VKZG 5F41A 5AT1B 4TVAB 1LWCB 4ZCLA 1NMEB 2KB2A 4DR3J 1A9NB 1FKOA 4DLEA 1RTHA 2ZKTA 4IOCQ 5JXSA 1FK9A 5DS7A 4CO1A 3T3FA 2CXEA 5KG7A 2NR0A 3LGNA 2B8QA 4DV3F 4DSKA 2OTJS 4KYZA 2XTJP 3NOCA 1W2IA 5ETNA 2PI5A 3H5XA 3QGPA 2CDQA 2MB0B 5F8NA 3AQOA 1DQ8A 1BQMB 2KU7A 2QSWA 3IR6B 4V1Ak 1TU0B 2HFOA 1PBUA 2YWFA 4WK3A 5CXTA 2W25A 1HYSA 1GQEA 2FLPA 3MPYA 1NDLA 3L09A 3PYGA 3QRRA 3WZ0A 3OSPA 1NXIA 4I56A 5IQQA 1Z2ZA 1BGXT 3N6NA 4B02A 4C8ZA 3LP1B 5G0RB 5L1LA 3VAJA 3BBCA 3ENWA 1EKSA 2JSXA 3R5AA 3RRKA 2WCXA 4ECYA 1MMLA 3CD0A 1FJCA 3TUJC 2LCWA 2ZH5A 1RT5B 1S9EA 4C8LA 3EX7B 4U6PA 4UOGA 1T9WA 2WZ1A 4UUWA 2HGMA 1G6BA 4DQSA 1NHUA 2V4RA 2HZCA 2GVZA 1FERA 3SQGB 1LW0A 3UDVA 2HNDB 2DCUB 1VRUB 3W5ZA 3DNCA 1HLWA 2E5JA 3NAIA 3TAPA 1C1BB 1UMJA 4ECQA 1T9XA 4J9VA 4PPZA 2FYXA 5BR8F 5F9LA 2UUTA 1HNIA 1LWCA 2XMTA 2LQ9A 4HTJA 3M1VB 1MROA 2PIIA 3CD5A 1N34F 4NASA 3MUMP 3LUYA 2ZHOA 4U7UK 1WOOA 2L41A 3T1YJ 4CO0A 2MYFA 4XTTA 2NXUA 2VC0A 3D1HA 4Z2XA 3AD9C 2LEPA 2GCFA 1TK0A 1BQMA 2POKA 3LGMA 1KVKA 4A8QA 1ZH5A 2HURA 3MECA 4RNMA 4LBHA 1SL0A 1GX5A 3GG0A 2VBWA 2C3UA 1NKEA 1SQGA 2IJFA 1WSRA 4OI4A 1SB6A 4CLFA 3SFUA 4IH5A 3ZZYA 1WI8A 4Y34A 2V8DA 3LA0A 3ZTPA 3LP1A 4L3KA 5KT6A 3GV5B 4CLTA 1FJEB 3CJKB 1XMBA 3EZUA 4OYWA 1MWQA 2B7BB 2RMLA 3RB3A 5KFOA 4DL4A 4ZLLA 3RGIA 4DR5J 4FPIA 1WG4A 3M30A 3MAAB 1FFWB 4DUTA 4NLUA 5HP1B 1JX4A 2AGOA 5LOQA 4C3KA 1X5OA 4I69A 1S57A 4NI2B 3KKFA 4OHWA 1P27B 1DFDA 1CULB 3BGRB 3SQGA 4FPRA 2ZC4A 4PEOA 1XMQF 1HR0F 3WC2A 4CM0A 1C1BA 3QIPB 4OYBA 3OFHA 4LF9J 2HS0A 1VC0A 1YGYA 1ZS6A 4J9NA 2VUGA 5HN0A 3OFEA 2MZJA 4PWUA 1S7HA 2MQQA 4QW9A 2JLEA 3M1VA 4JV5J 1O6XA 3R27A 4N41A 1VQ7S 4USJC 4YR0A 3OVSA 2VL1A 2XMAA 2XY7A 3FSIA 4IDKA 4JI3F 2EFPA 3HHNB 3BGOP 3KTQA 1X4HA 4RUHA 3CO9A 4DQRA 4C8KA 4HH1A 3CCMS 4N77A 4CLKA 2AIRB 4NLGA 2JHEA 4MK7A 5AE1A 2AEJA 2DNQA 2HS3A 4W4MA 5K5MA 2Z2YB 2MY8A 1SJ4P 5B0DA 1HNZJ 2AJ4A 3T41A 1TUVA 3DGPA 2FVQA 3OW2R 4NXNF 2OD6A 4PXEA 2MGZB 2DGSA 2MQLA 4H4KC 1X4BA 3FCHA 4CLSA 3MZIA 1FX2A 2F9DA 1RU1A 4ED8A 5L39A 3CJKA 3SQOP 3A1YG 4Q43A 4WF9Q 2DGVA 4W92B 4OZ0A 1N48A 2R7TA 3FBFA 2RS2A 3GIKA 4ZVHA 2WB1D 5CD4A 4WIIA 3A3PB 1SH0A 3M32B 1S1WB 3ILIA 5HSPA 2ZE2B 3RAQA 2K8GA 4RW8B 4RL1A 3MM8B 3SV4A 1NSKL 4NI2A 1OWXA 1YIJS 2F8HA 4NLVA 1OPIA 4MTPA 1CULA 2E7XA 3HXMA 1V5VA 5EN1A 4P2XA 3QAUA 2JH3A 3BGRA 5EWFA 3VHQA 4KBIA 1LNQA 3QIPA 3RW6A 4DS4A 4EZ9A 3GCWP 4PXBA 3V6DA 2PDAA 1U8SA 5FJ4A 2AJFE 2BACA 4DL6A 1SL1A 2GHWA 1WG1A 1VHIA 4Y2IA 3P96A 2H1YA 3G82B 2CG4A 1RAOA 1FI4A 1RSCA 4DSIA 2FB0A 3FMBA 3VWSA 4NCAA 4R5PB 4S0MA 3MCNA 1I5OB 1Q5VA 2DBBA 4N8NA 2MXYA 3H2UB 3V6HA 2Z0GA 3DOKA 4I0WA 3IWLA 3H4DA 4DHVA 1U1MA 2DNMA 2DT9A 3MEDB 2XCAA 2AQ4A 2MGZA 1M1GA 2HQDA 2GV1A 4CQ1A 2DIUA 2XG8A 4DUYF 3FCWA 1G2EA 1HWJA 3JXOA 2V2VA 2WVBA 1HW9A 2LEAA 2LQJA 1TK5A 5D4LA 1UFKA 3ETMA 1RHRB 3GFZA 4WCEQ 3DLJA 1S1WA 2OPPA 1I1GA 2ZE2A 1RKIA 1ZAXA 4IKAA 3MAQA 2DNLA 5IV4A 2JZ5A 4HVZA 4K0KF 3S1TA 4B9NA 5IOLA 1TK8A 2FJEB 2MLZA 4C11B 1URRA 1RT1A 1TMMA 3IAM9 4P2MA 4IH7A 5D0EA 3AJDA 2OIHA 3LH2S 2IBKA 3CXCR 3H2VE 5I3QA 1TKDA 2FJAB 2E5HA 3D3BJ 3UN5A 1S99A 4FBTA 3HHLC 3OXGA 2VFRA 2DVIA 4TLRA 5DDQC 1TMJA 4X4RA 4DX8H 4HT5A 1T94A 5D78A 3BBFA 1WWHA 2G9OA 4R5PA 2KT2A 2LVWA 3ENVA 3BREA 1LFPA 3E01B 2IRUA 1CC7A 1F3FA 5E3CA 3DYAB 2IA0A 3V81B 2WSEC 3QFWA 5CCLA 2P9GA 4WFZA 4OZ3A 1H6KX 3ETOA 3VR1A 5HQLA 1Y3JA 4H4OB 4ZLJA 1NUEA 3HHDA 2GJIA 3MEDA 1NCLA 1NSAA 2KHCA 3KUEA 1REVA 3RRGA 1UTAA 1K73T 3MPUB 2VZ9A 3QRQA 3Q86A 5KG0A 1TL5A 3WIVA 5CABA 2LXIA 1RT7B 4GRSA 3D6HB 1UETA 5B0GA 1CQMA 2XMMA 1B7FA 5CYMB 2N4CA 3CMQA 5M2RA 3D0IE 4DFKA 2RSQA 2GQ2A 2J8AA 5HROA 5J2MA 2QMWA 2GMHA 3JTNA 3EZ5A 4DF4A 1MSWD 1G7CB 3CCQS 1HMVA 3IM8A 1M1HA 1S59A 4C11A 4DR7J 5LXYA 5K20B 4LSZB 2B0GA 3N01A 2Y9HA 1PAUB 5FDLA 1IN0A 2Y1RI 4DPOA 1UVJA 4HLBA 1WC0A 3HD2A 4AXIA 3Q23A 1XNQJ 3CJ3A 1X4EA 2HAIA 2HIQA 4DPWA 2VFVA 2XYPB 4WXOA 4IH6A 3Q8RB 5DQGA 3C15A 5E2QA 1L3KA 1FKAF 5A76A 2XMUA 2DXDA 3ZXWA 3E01A 3IRXB 2ROEA 2MDAA 2KFZA 3OTOF 4Y3CA 3FUYA 3DYAA 2QL9B 2X3GA 3V81A 1UPMB 1HNXF 2HVEA 1OO0B 1FJ7A 1LWFB 2ALZA 2VOOA 2B4PA 3UWTA 3ADAC 4WIQA 4E98A 4FP9A 4J91A 1NLKL 2IYIA 3JTPA 1EB0A 1KD1T 2QIFA 4LF7J 2E1PA 3D54A 1U24A 3PRVA 2B8PA 2NSCA 4LF2A 4U8YA 2MKYA 4IO9Q 4PR6A 1RT7A 2B5JA 4KFBB 5C42A 2HQ3A 2L08A 2UXCJ 4DWIA 3DRXA 2F8MA 5GAHU 2EC0A 3PRDA 4KKOB 2JLFA 3MFIA 2ZUGA 2WBRA 4WBFA 4YS2A 3TP2A 2I9SA 4WFBQ 5LSOA 1NRKA 2M0GB 3VVUA 4JI4J 1N5YB 2QGFB 2EI5A 1F9EB 3MPVA 2AJ0A 2M8HA 3NBPA 4DV3J 4N5SA 4ZCMA 2JOQA 2CNLB 3RJMB 2MZ1A 3NWRA 2HW3A 1U2RA 3LTOA 4TYBA 1C1CA 2EFGA 3SSRA 4P7VA 4J9OA 1VFJA 4MYTA 1SQFA 4F0KA 1ELOA 3M9OB 3TVZA 4RX6A 4KQZA 1S48A 3ITHB 3M8ZA 1RCXB 3JSYA 3H25A 2UU9J 2FJWA 4FF4A 5LMUJ 3FRYA 4DF8A 1EAYC 1UEUA 1IR0A 4NA1A 3Q2SC 3IRXA 2RNEA 2PMZD 4HTIA 1VYAA 4KHPF 1D9AA 1F5AA 1URNA 4TN2A 3ONQA 2WONB 5B0BA 5B08A 4NXMF 4LRDA 4JBCA 3A8EA 4ED5A 3C2PA 2Q66A 1EKRA 1SKSA 4M8LA 4MH8A 4C3MA 4F4ZA 2KKHA 4NZ7A 5ITHA 3FZBA 4Y2AA 3C8YA 3NS5A 3KMQA 1S9GB 4H4MB 2Y0SD 4NLSA 4D3HA 1D09B 3IC1A 4KKOA 3KLIA 3HFZB 4EK2A 2YNFB 3BSNA 5F8LA 3KUGA 2KG0A 2GAGC 1IKXB 3D0GE 2X7IA 3L3CA 1U45A 2HQFA 3PX6A 4YR3A 1PIEA 4LMZA 2YKMB 4LF6F 3QWPA 5D0GA 2H5IB 3ISZA 1EETB 4LIWA 3A8KA 2ZH7A 2XGPA 3C16B 2HK3A 3ITHA 2IM2A 2DEJA 2M2BA 3DU6A 2LECA 2HHQA 4PCQA 3RBDA 3PW0A 3LWLA 1BWEA 4DCPB 1M5VC 4K5RA 2IM3A 2JFDA 3SCJE 2DGXA 1V3ZA 4OQJA 2ZWOA 3B54A 2PA3A 1TVRB 1HBOA 4TNOA 1T9VA 4F0HA 2HVHA 1RUSA 1XBWA 2R8GA 2DNPA 1E6VB 2R2RA 4B3SJ 4MJKA 4MFBB 2WONA 3UN2A 4CH7A 1TV6B 1YLXA 5DZ6A 2J8SA 2QA1A 3LOUA 2BE2B 3NGTA 2M88A 4RJVA 3US5A 2IVFB 5C5JA 3P8BB 2ZJRQ 1J5OA 2WB4A 3GTYX 3QSIA 1NZAA 2CDRB 5KFGA 2MQPA 1RDRA 2O01C 5H9EJ 2F8EX 4BLGA 1R8PA 3M8PB 1R7IA 1RAAB 1QSSA 1S9GA 4H4MA 3SV3A 2FHJA 1DQ9A 4KV8B 1YBTA 1NK8A 1SV5B 5E7OB 1LXNA 5HI7A 1APSA 4N47A 1M5HA 2JRSA 1SJ1A 1N32F 2ZH2A 1HWKA 1RT6B 1X8DA 2KT3A 5KOXA 1S6PB 4OZJA 1IKXA 1K1SA 4FXWA 2AT1B 5F0WA 2IYGA 1XERA 5A2QU 3DLHA 4QIWD 4M5LA 2YKMA 2D3ZA 2RJZA 1RAHB 3AFGA 1EETA 3M9MB 1RTDB 1EZZB 4FF3A 1XNRJ 2QLFB 3LO3A 2M5YA 4CH1A 5DG9A 3HHKA 2C3OA 4GKJF 1T8EA 4PG7A 1YZ7A 2RHSB 1QLNA 4NLPA 4IFYB 3MR5A 4XO0A 3HHLD 3THVA 2J76E 1IVZA 1HQEB 4C98A 1FESA 5KG4A 4NPOA 4R25A 3BO4A 1RACB 1TVRA 3CC7S 3AOCA 3HHLB 1RWPB 4NA3A 4QBUA 4MFBA 1U0SA 4P71A 4C3LA 2DPIA 1K0VA 1Q53A 1TV6A 5GAEI 1S1VB 1C4CA 1RP5A 1T05B 2BE2A 2OPQB 4LRAA 3LP0B 1EQMA 1JKHB 3PFEA 2FDNA 1VR6A 2KT5A 2BKPA 1F1BB 3WQPA 1AT1B 4OZ2A 3FQKA 1FEHA 3M8PA 5L1IA 3MTJA 1KOOA 4KV8A 3M8YA 5KFZA 1SV5A 3SFGA 2NUUG 1NO8A 1FNXH 2CJKA 1FXLA 4USWA 3NGKA 1IKYA 1FWKA 1RT6A 3G87A 3T1HF 1S6PA 4F25A 4DPXA 4DR6F 3TAQA 2MY7A 2EXUA 4B9MA 1X60A 3QAEA 4F4YA 3QFHA 4AD6A 1P1TA 4UY85 1S6QB 2CJ9A 1R3NA 3LALA 2X51A 4OZNA 1RTDA 3TX8A 1IBLJ 1FA0A 3VZHA 1UFWA 5A8WB 1N33F 3UDCA 4NLTA 4DPYA 4M95A 4QOTA 2FC8A 4IFYA 5J2NB 1HQEA 3PRBA 3VQTA 4WZQA 1RLDA 1FE0A 2ZDOA 3MHYA 2G2ZA 5SUHA 3T5KA 2NXNA 1DAXA 1F6TA 3IG1A 3UD5A 3UR3C 3HHLA 3PIPQ 4ETXA 1D3WA 1S1VA 5EX0A 3FNNA 1JWWA 4F4XA 4USIA 1JKHA 1JLQA 2VG6B 2VASA 1QAIA 1KTQA 4A8WA 1ZBTA 3CF5Q 4EBEA 4PWWA 3CJSA 2NLWA 2RRBA 4LUBA 4ZVTB 4ER8A 1YX2A 2BKOA 2D3O1 2VF3A 4ENOA 3LAKA 4RPFA 5C24A 1TR0A 4UQGA 1OQ6A 1UAWA 3HDSA 3FKBA 4BWJA 2R7XA 5HMWA 3O5TB 1HBMB 4DV4F 1HL6A 1YZ6A 5KFQA 1WC5A 1U09A 4Y65A 4OJ1A 1O8BA 5HLFB 4MKYA 5HQ8A 1OQ3A 2RHQB 5JMNA 2HLUA 2QLXA 1S6QA 2XBPA 2HGNA 2AW0A 4FKYA 3H40A 3IWNC 2QC3A 3IR7B 1GTHA 4GC7A 3VAMA 2AZ1A 5A8WA 2W9BB 4RW6B 2JFKA 1C4AA 2DB1A 3IRWP 4CLUA 3DI6A 2GHPA 4FBUA 2KYZA 4USMA 3PY8A 4OJ3A 2A6MA 1WDDA 1GMVA 3G8QA 2VG7B 2VD3A 5K14A 4KSEB 2MPUA 4ECVA 4DPTA 2BQUA 1Q8BA 4RNOA 1OJ4A 3G6VA 2FHOB 3L7PA 2O5DA 5BXIA 1WUUA 4E2FB 3HM9A 4WJBA 2VG6A 9ATCB 1IQTA 2DRBA 2UXBF 2JEGA 5IXUA 2ZNYA 5LJ5Y 2P6TA 2B3TB 1DZ5A 3KLEA 3KYLA 4ZVSB 4ECZA 3GIMA 1FRKA 4NLXA 2A10A 3MEGB 2A0FB 2F4VF 3IGNA 2MHNA 3BZQA 1RHQB 1TQLA 2GQQA 2YNHB 2H4WB 3R8YA 3GJTB 2B6AB 2C2NA 1HBMA 5LL6d 2DYAA 4DL5A 3F73A 2AP6A 1N6QB 3T1AA 3CJ2A 2Y8YA 5HLFA 1R8BA 1LQ9A 4DV5J 1N4LA 1WOPA 3D6FB 2Q6BA 1ZAWA 4OX9J 3CCRS 4XPCA 1M90T 3WX4A 4DQIA 4CO4A 2PO4A 4QIEA 4WU3A 2ADBA 2WVEA 4JI1J 2W2OP 4FNIA 2W9BA 4USTA 1PYOB 4RW6A 3SDEB 4ZPTR 1WC6A 4IQMA 2MSTA 2BABA 1KDNA 1VC5A 2M70A 2WHOA 4AL5A 3CJTA 1XTZA 1RAIB 2NXCA 2VG7A 1W2BR 1Q79A 1ZPVA 2NSBA 2DIVA 2MKJA 2YPYA 3PEHA 2MKCA 1V6HA 2CNKB 3M8QB 1VMBA 5LM7E 4MIBA 3MR3A 1SKUB 2X1GA 4KAIA 4YB7A 2CPXA 1KTVA 4MT1A 3TWZA 3HVRA 1ZZNA 3W63A 3BV8A 1UPPA 3Q89A 5KFHA 2D41A 4OHZA 3QIDA 3P5TL 4UTGA 2XMKA 2QA2A 1U1OA 5CZVA 2JVOA 4DX7A 5L8RC 2OPRB 2CUYA 2V8HA 1WC4A 5LSLA 4JI0J 4B3OB 2OI2A 3UNYA 3NWGA 3MEGA 4DV6F 3WIUA 1S4FA 9RUBA 2M4MA 2XLJA 3ZNUA 3OL6A 2HBYB 1C0UB 3POTB 1Y5LB 5DGBA 1NAQA 2LQ8A 4A48A 1N6QA 2DHGA 3F44A 4IYQA 4KH0B 2GMLA 1I94J 4R0EA 2N7YA 3MD1A 3AHPA 1T3OA 4KHPJ 1LK7A 1FWLA 4DLGA 1RXOB 5B0CA 3HJVA 2E29A 2CYYA 3SDEA 5J2PB 1K8AT 1YRXA 1F60B 3BQ0A 4NXMJ 1FF2A 1SXLA 2OEMA 2F5GA 2XNRA 3BGLA 2IJRA 3GR0A 1QVFR 4RNFA 4AXJA 2CQ4A 3MMCB 2OO4A 4NLYA 4X4UA 1YJVA 2ZH9A 2OUGA 3CDBA 2W2NP 3KLGB 2AU0A 2VBYA 1HD0A 2DXEA 5KT4A 4H54A 2ZOGA 1U1LA 2CPYA 1LEOA 2NS1B 2H4YB 4DV1F 4FDFA 3H0PA 2X1BA 4NLOA 4Y00A 1QAJA 1KSPA 2W7OA 4OX7A 2F7VA 4OYMA 3HJFA 4DX5A 3QJJA 4RUAA 1WNEA 4HDGA 3ISNC 1NK0A 4KJIA 3T6BA 1H98A 1LK5A 1A7GE 2OD4A 1XK8A 4M5GA 4A4JA 5F0UA 2ZOMA 4B3OA 5CZXA 2EEYA 3ZC4A 2IFXA 4QJVA 1DY3A 1UJ4A 1C0UA 3WBZA 3POTA 2EW9A 5D4PA 1S6UA 4QR2A 5I42B 1J2VA 3WDOA 1WF2A 3UFCX 5E3PA 4F3OA 1AZSB 5JVHQ 3PVXA 3HX9A 3KOAA 4JYAF 2EVZA 4DSFA 1U47A 4A8FA 1GAOA 2V63A 1OYEA 1IBMF 1RA6A 3GR1A 2D74B 2D9OA 2I6WA 1U1KA 1NPRA 4ECWA 2KYXA 4HACB 2D69A 3CCWA 3EE3A 4RW7B 4K4YA 4MYUA 4B3RJ 2QMXA 2G0JA 5BYQA 2P5VA 4USKA 3MMCA 4IQXA 2PI4A 3AOBA 3VGUA 4LRBA 3KLGA 4RUCA 2CVEA 5E3AA 2UUBF 4ID8A 2IIHA 3BH6B 2BVZA 5AJ3F 1Q16B 1VQPS 5CHCB 1K9MT 3UCUP 3RU0A 2R2TA 4KRWA 3T9NA 1QVGR 3W1YC 1YSJA 4ZPCA 4P7TA 5DQIA 4DQPA 3DXBA 3EDRB 4W98A 3AAWB 3ZZRA 4UY8T 4ZCIA 2EBGA 2QLWA 5T7LB 3HD1A 2KL8A 2AKWB 1KFDA 1FDDA 3GU0A 1BY9A 1YDLA 1SC1B 4DV7J 4F02A 1YRUA 5KFFA 1TAUA 2MQ8A 2J0SD 4ANEA 5H9FJ 4XIUA 3MCMA 3W3SA 4UW2A 1DJ0A 3D4JA 4USHA 1S0MA 1UL3A 5I42A 2DNGA 4P74A 2ZBCA 1JLEB 3PYEA 4P75A 4M63A 2NPIA 1WDTA 4DUZJ 2AJ1A 1BUXA 3KHHA 4L72B 1RT4B 4OI2A 3ELHA 5FLXY 2JC0A 1WSVA 5C7PA 4DV0J 1NBEB 1XWLA 2BJ3A 4ZVGA 4IUFA 3GIJA 1JLAB 3MCOA 3CJ0A 3MWBA 3J7Z5 2P9CA 4MKAA 4ES2A 3X3UA 1D8ZA 3Q2TC 2V50A 4IRDA 3PHEA 4RW7A 4O23A 4WFAQ 4OIXA 4EYHB 3E2EA 1JXEA 4LFAF 3IXQA 3FFIB 4JI8F 3UQSA 5IFMA 3CVKA 3D0HE 2XS5A 3I4PA 2ZJPQ 1UVMA 4LF5J 3CC2S 2C2MB 1LW2B 2BOPA 3FEYB 4QIFA 1YJUA 2RU9A 3JSRA 1GK8A 1PAEX 1WC1A 2W4DA 2E44A 2HHHF 1RQ0A 5THWA 2HPUA 3K8WA 2B7CB 4OX8A 5T7LA 1FFSB 5GMEA 4DV2J 2AD9A 3LF0A 4U7CA 4NRTA 3ULHA 3K7RA 1FTCA 4TQRA 2HK2A 3EGZA 4DZDA 4R8UB 3K5PA 1HFEL 4CRJA 1AROP 3CJ4A 1X0FA 1Q95G 3NLCA 4JI5F 1FRLA 2MQMA 1JLEA 1VQ8S 1YJTA 5HQMA 1P1LA 4TYAA 5I3PA 4KH1B 2GC8A 1RJJA 1U8WA 1JLAA 3IMQJ 2CADA 3OPKA 1NJXA 2OHDA 3FBEA 4YY3F 2IAJB 1HKAA 2OKQA 3LANA 3D66A 5J1EA 1S76D 4K4TA 2NQPA 2GNKA 1YJWS 2BANA 4K4VA 1LFWA 3BSAA 1GNKA 2UUAJ 3ZZOA 1JNZB 3FFIA 1TL4A 2MQNA 1R0AB 4DU8A 3M2VB 4PG8A 5GAHI 2XY5A 2A18A 3R6GB 2BJEA 1B3TA 1RAJA 2PMHA 5DG8A 1N36J 3KK1A 2C3PA 4RNNA 4OI6A 2BJ1A 1LW2A 4X65F 1SIWB 4FF1A 1PSDA 3C3LA 1T11A 2ZOFA 1R27B 2HNYB 4F04B 4K59A 1WHYA 4LVNP 3KMSA 2QL7B 2W24A 4PAAA 1XEZA 1RTZA 3MF5A 3TEGA 1B7YB 3ZFVA 1JLCA 1MWZA 3G2XA 2ABYA 2F4FA 1FRHA 1V9OA 4M1KA 4JI2J 3SCLE 2R8IA 2V34A 1RI7A 3TZZA 4IG0B 2Z58B 2CZ4A 2LQBA 2R7VA 4Y2MA 2WW4A 3AA8A 2C2EA 1F9FA 3MM6B 2ZZMA 4WFYA 1TKZB 5J2QB 4MIAA 1Y5NB 3OQ2A 3DMJB 4P73A 2IRXA 1U7LA 3V4IB 1YBAA 2HMIB 4Q45A 2JJ4D 2Y8WA 1WHXA 2FLNA 5D0RA 1U48A 3BGFA 1P6TA 1YRTA 3KK2A 2VIHA 3ZO7A 1FEEA 2CPZA 2KXFA 3RAMA 2X1FA 4EBDA 4O0IA 2DR7A 5M2UA 4KTQA 4HR2A 2GMJA 1RTJB 3MI7X 4AL7A 4WTOB 4X64F 5KFKA 1HA1A 2OGUA 4CZCA 4ICLB 2PMWA 2YKQA 4USUA 4CLLA 3OV7A 4AE5A 4YHHF 4X4OA 3W7BA 2Z2MA 3IWXA 2VA3A 4ZMMA 1SH3A 2HQGA 5F3TA 3M2VA 2KZZA 2CZ9A 4RU2A 5F8HA 1SCJB 1B70B 1X5PA 1BC6A 3OR2B 1KVIA 1EARA 2ZM6J 5KG2A 2XHWA 1YJ7A 1JJ4A 2HNYA 1UZDA 2F4VJ 4WP9A 4XAKA 2Z2ZA 1AB8A 2W8KA 1CJKB 2ZJQQ 1M5PC 1S0OA 2VBXA 1NJYA 4PZVA 1S1TB 2AGQA 2APOA 2L9NA 1MN7A 1SQEA 2AF6A 2H65B 2AEFA 3T19A 2XI3A 1IR2A 2E7WA 2LQ5A 3QSYB 4IG0A 5C2GA 5GAEU 3B82A 3R1LA 1NDPA 1RA7A 2HRUA 3IGVA 2WBMA 4CYUA 3W2VB 3TQ1A 3MM6A 1HHTP 2XC9A 1QUPA 2AZ3A 1TKZA 3DRPB 2WVFA 3DMJA 3DKDA 2CIMA 2QMUB 3HFKA 3V4IA 5HVHA 1Y11A 2HMIA 5M2PA 3T6JA 3D6MB 5E33A 2QL5B 1PC5A 3ENQA 3AB4B 5KG5A 2W4CA 3DRSB 4BWMA 4U7UD 5GAGI 2BA9A 4LFCF 2FJBB 4DMZA 3ZTQA 1QJHA 3RB4A 1S1XA 3P3DA 3CJRA 2RAQA 2QX0A 3MOZA 2ACYA 2N4DA 3RG6A 2FIUA 5HMZA 2XS7A 2C2RA 4ZK7M 4P6QA 1ITPA 4Q8FA 3EXYA 1G1XA 2M7SA 1JQGA 3B6BA 3SXLA 5ETPA 2DR9A 3N0VA 2FJXA 2VU5A 1RYSA 2I5JA 2VJVA 3CEDA 1RT3A 4ICLA 3EZOA 5A6WA 3JTOA 3GJRB 2RF2A 1IUJA 2VPYB 4OYOA 4DR4J 4HT7A 4DXLA 3IAS9 2E5LJ 1DTTB 3ILJA 4G3IA 2W4PA 3Q24A 3CCVS 3GP9A 5A8RB 5CCMA 1F2GA 2FJVA 3G86A 1JLFB 1MN9A 1FVSA 4I6AA 2MKHA 1CJKA 3N9UC 1DLOB 1G4CA 2CQDA 4I2QB 2UUCF 2D3OR 2V69A 2ATLA 4IOAQ 2FPHX 1S1TA 2OP5A 1HI0P 1Z4UA 1HARA 3R7SB 1FDAA 4AQYF 4C6AA 2J9EA 5KFBA 1RK8A 4EMDA 4X4PA 1QE1A 1VHFA 2LU1A 4B3MF 4B17A 3TA1A 3W2VA 1R6VA 4PG6A 1FDNA 2RUSA 4CO3A 1WD6A 3MTKA 3MUTP 3OJUA 4LR8A 1YI2S 3RZAA 3G8TA 2VQFF 3IBCB 4F67A 1X4GA 4YB5A 3TJAA 2Z57B 4DR2J 1OY6A 3DRSA 3E51A 1TZ0A 3OBIA 2RQ4A 1D9FA 5HVGA 3W5XA 4ID5B 1JLGA 3A8JA 2PFDA 3BPSP 2VA2A 2RS8A 1VIXA 1U4BA 4JI6F 2KVIA 4RW4B 2BQRA 3TJ8A 2XO6A 4DR1J 5KFNA 1HW8A 4LF8J 3N28A 5ADZA 4X66F 4B9SA 3OVBA 1QSYA 3VV2B 1Q7YT 1GEHA 2YNIB 4F36A 3VVTA 3TVYA 1P9YA 5AXNA 2Z30B 1Q78A 5A8RA 1F9HA 4ZHRB 4KIAA 1PC4A 3DM2A 2GO9A 1WELA 1DLOA 7FDRA 4C97A 2DNZA 3TRGA 4NWBA 3A12A 2HIYA 4I2QA 1YVFA 1VS3A 2MTLA 2ZBQA 1ZTTA 3WC0A 4LF4J 1NH8A 2BUNA 1RWXB 3MURP 4WFNQ 2XB2D 4Q44A 2H48B 4YDXA 3Q22A 4MK8A 3B4MA 3J7ZT 1RBAA 2WW8A 1X0PA 2LMIA 5KT5A 1FJGJ 4TY8B 2QTWA 1SKWA 3K17A 4DCOB 5ETSA 4FXDA 1IM6A 2Q6CA 2V94A 1T3NA 1C2PA 3OLAA 3M2RB 3VAFA 1WACA 4FYVB 2DNKA 2B9EA 3PTWA 4J5OA 2MZRA 1MNEA 4EI2A 3AA9A 4IR1A 2J0WA 4URQU 4ID5A 1TL1B 5IT9U 2QO3A 1IBKF 1JNRB 2BOAA 2HRTA 3D5MA 2HG4A 1TAQA 2UXDF 5KTQA 3G8SA 1AW0A 1FWPA 1RZMA 1FE4A 2DNOA 4CCHA 1U02A 1RB0A 3R9LA 5DG7A 4ZPBA 1VQ4S 5BYRA 2A2DA 4M5NA 4YMEA 4TKTA 1VBXA 3GMGA 2RDDA 1VC6A 4NA2A 3JAMY 4DR3F 3I87A 3VGVA 3OTCA 7FD1A 2GFFA 1VLYA 2L48A 3S8SA 5E0OA 1ZM4A 2R3VA 5EWEA 4ZHRA 1GXTA 4ZJOA 1YJ9S 5G0RA 5KOWA 2DGQA 2PD1A 4WTYA 3SCIE 2JX2A 1JIHA 4I4BA 3KDOA 3TW0A 3TNVA 3GONA 3KHGA 1RT5A 3O8WA 3R7BB 2ZFHA 3BKUA 1XIQA 4TY8A 1SC4B 3BGUA 1R43A 3QZ8A 2VONA 3TUPA 4O3NA 1RKJA 5GADU 3NNHA 4C4WA 3GIRA 3BR9A 2ILZA 2ZBRA 3Q8YA
chains in the Genus database with same CATH topology
4WP9A 4USTA 3C16B 1AB8A 3C15B 3MAAB 4WP8A 4OYXA 1CJKB 4OYIA 1WC6A 1WC1A 4OYMA 4P2FA 4CLPA 3UVJB 1TL7A 5IV4A 3G82B 1CJTA 1U0HA 1WC5A 4OYZA 4NI2B 4CLZA 2GVDA 4CLSA 3C16A 1CS4B 1Y10A 5D0RA 3C15A 5D15A 3MAAA 1FX2A 1CULB 1CJVB 3C14B 4OZ2A 4OYOA 1CJUA 2GVZB 4WPAA 4P2MA 5D0EA 3G82A 4CLWA 4CLYA 4CM0A 4OYBA 3ET6A 3MR7A 1CJKA 1WC3A 4USWA 3UVJA 1Y11A 1TL7B 4USVA 1CJTB 1U0HB 3R5GA 2WZ1A 4NI2A 4CLUA 4USUA 4CLFA 4CLLA 1YK9A 2GVDB 1AZSB 1CS4A 2QV6A 5IV3A 1YBUA 1CULA 1CJVA 3C14A 5D0HA 4P2XA 2GVZA 4OYPA 1CJUB 4WP3A 5D0GA 4CLTA 2W01A 1FX4A 4OYWA 1WC4A 4CLKA 4OYAA 2BW7A 1YBTA 1AZSA 1WC0A 4CM2A 3ET6B 4OZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WP9 A;  4UST A;  3C16 B;  1AB8 A;  3C15 B;  3MAA B;  4WP8 A;  4OYX A;  1CJK B;  4OYI A;  1WC6 A;  1WC1 A;  4OYM A;  4P2F A;  4CLP A;  3UVJ B;  1TL7 A;  5IV4 A;  3G82 B;  1CJT A;  1U0H A;  1WC5 A;  4OYZ A;  4NI2 B;  4CLZ A;  2GVD A;  4CLS A;  3C16 A;  1CS4 B;  1Y10 A;  5D0R A;  3C15 A;  5D15 A;  3MAA A;  1FX2 A;  1CUL B;  1CJV B;  3C14 B;  4OZ2 A;  4OYO A;  1CJU A;  2GVZ B;  4WPA A;  4P2M A;  5D0E A;  3G82 A;  4CLW A;  4CLY A;  4CM0 A;  4OYB A;  3ET6 A;  3MR7 A;  1CJK A;  1WC3 A;  4USW A;  3UVJ A;  1Y11 A;  1TL7 B;  4USV A;  1CJT B;  1U0H B;  3R5G A;  2WZ1 A;  4NI2 A;  4CLU A;  4USU A;  4CLF A;  4CLL A;  1YK9 A;  2GVD B;  1AZS B;  1CS4 A;  2QV6 A;  5IV3 A;  1YBU A;  1CUL A;  1CJV A;  3C14 A;  5D0H A;  4P2X A;  2GVZ A;  4OYP A;  1CJU B;  4WP3 A;  5D0G A;  4CLT A;  2W01 A;  1FX4 A;  4OYW A;  1WC4 A;  4CLK A;  4OYA A;  2BW7 A;  1YBT A;  1AZS A;  1WC0 A;  4CM2 A;  3ET6 B;  4OZ3 A; 
#chains in the Genus database with same CATH topology
 2VPZ B;  3HP6 A;  4R0J A;  5BJR A;  2MSS A;  3CMA S;  2HND A;  5L9X A;  1VRU A;  5AXL A;  2O67 A;  1KWM A;  3ZZT A;  4QWD A;  1WG5 A;  4DSE A;  3K5O A;  1N8R T;  1KEK A;  3QGG A;  1BD6 A;  3DLG B;  2IM0 A;  4ZS6 A;  4UT4 A;  4WPA A;  3B4D A;  1TL1 A;  4ZCK A;  1DBD A;  4HHU A;  4PQA A;  2FHM A;  2EFQ A;  4DFM A;  4UZC A;  3V6J A;  1T03 B;  4DEZ A;  2UUW A;  1S1U B;  4NX9 A;  3M4X A;  3R2D J;  2VG5 B;  4YUD A;  1NKB A;  4WZM A;  3R3T A;  3I0R B;  4M5D B;  3PJW A;  4EUV A;  1UP1 A;  5MAO A;  2AJ2 A;  2LDY A;  3EWG A;  2XWX A;  1VCT A;  4QWB A;  3CUL A;  3M05 A;  1RCO B;  3W64 A;  2AX1 A;  1L5U A;  4U8V A;  3IR5 B;  3HCX A;  3RYL A;  4C7Q A;  3FMW A;  2OJ3 A;  4GKK J;  1MU2 B;  3RBX A;  3GFH A;  4O3Q A;  1IJE B;  3EVO A;  3BEG B;  1S5Z A;  1PO6 A;  4EBC A;  2MKI A;  1JJC B;  1VK8 A;  4JI5 J;  2OLW A;  2F40 A;  1UKU A;  1KHW A;  1RHJ B;  3H5U A;  2YWH A;  2B4U A;  2NRE A;  3CSK A;  4J90 A;  3GSI A;  3ENA A;  3MAA A;  4ELU A;  3BN7 A;  5HP1 A;  2XMJ A;  3QQC D;  1QUV A;  2V4J B;  1XMO J;  1HWL A;  2CZV C;  3Q8Q B;  4F4W A;  3FCV A;  3QAT A;  3JQJ A;  2QEX S;  2LYV A;  1KBR A;  3NMR A;  4B9V A;  1TUW A;  3CGI A;  5LMN F;  2K7K A;  8ATC B;  5D3G B;  4OFZ A;  1FD8 A;  2YVS A;  3MEE B;  5IC6 B;  4DR5 F;  2R7O A;  2PGC A;  1NPK A;  3DLG A;  1S49 A;  4ED0 A;  3PKM A;  3HVT B;  4C2M A;  3HMJ G;  4LFB J;  3AD7 C;  1DQA A;  4ZN1 A;  3MD3 A;  5HO4 A;  2Y1J A;  3TQE A;  4OI3 A;  2J0X A;  1U6Z A;  3QO9 B;  4CTA B;  2NYI A;  3BN4 A;  3AOA A;  2DXF A;  1T03 A;  1NK6 A;  4ZPV R;  3AT1 B;  2U2F A;  1S1U A;  2VG5 A;  3MMA B;  5KFR A;  4IG3 B;  1B0T A;  2PFF B;  2CQP A;  4F50 A;  4M5D A;  4LF9 F;  2DHX A;  4OYZ A;  3G96 A;  4NLW A;  2J9D A;  1HNW J;  3R5J B;  4PQU B;  1OMS A;  4LBP A;  4X4S A;  2RE1 A;  1KQG B;  2C3Y A;  5DJB A;  1I51 B;  4WE1 B;  5HAT A;  3VAL A;  4JV5 F;  3BQ1 A;  2XHC A;  1SJR A;  2PE8 A;  1ZZF A;  3IO1 A;  1QSL A;  1MU2 A;  4RBT A;  5HL7 Q;  1BWV A;  2C1E B;  1VRQ C;  3ZNJ 1;  4K4Z A;  4QWC A;  1TL3 B;  1J5E J;  2FY8 A;  4ZVP B;  1QDU B;  4ES3 A;  1FKP B;  2F1F A;  1O0P A;  3H98 A;  2R7S A;  4NCB A;  2GO8 A;  1UWB B;  3M32 A;  2QV6 A;  3RB0 A;  3RR8 A;  1HNZ F;  4JUZ A;  4RW8 A;  4BC7 A;  2ASD A;  4EO8 A;  1NEE A;  2GW8 A;  2IVM A;  3MM8 A;  1OSC A;  1RWK B;  2H51 B;  2V4J A;  2AYE A;  5K8M A;  4J9M A;  3PNI A;  5IQ6 A;  4JP8 A;  3D6T B;  2CJQ A;  1BXN A;  2BE7 D;  3SEO A;  4DOZ A;  5D3G A;  3J7Y U;  5A2Q Y;  4P9S A;  3AJ1 A;  3QWU A;  1UVN A;  4NZ0 A;  4L75 A;  4TY9 A;  3UI3 A;  4PUO B;  3K59 A;  1ACM B;  3DOM B;  3KG4 A;  2FJD B;  3RW7 A;  1VQ6 S;  3HVT A;  4Y0F A;  2C2K B;  3OUY B;  5KFL A;  1HBU B;  2DRD A;  4HHJ A;  1WTB A;  3G82 A;  4WK1 A;  2VQE J;  1H3D A;  4UOF A;  3QO9 A;  3W62 A;  3JQK A;  4RR5 A;  3DGV A;  1U1R A;  5KFA A;  1KRP A;  1SJQ A;  1LWX A;  1BQX A;  2BYC A;  3TX0 A;  1N54 B;  4IG3 A;  3E8O A;  5KFY A;  3FDS A;  4B3T J;  3ILL A;  2AHO B;  2C2O B;  3PR5 B;  2K1R B;  4PQU A;  2GVD B;  2CQH A;  2JDJ A;  1UWA A;  4WE1 A;  4WYL A;  1BQN B;  5I4M A;  1I6J A;  2OSQ A;  2CNN B;  4OI0 A;  2VHG A;  1N5T A;  1TL3 A;  1KQF B;  2IMW P;  1OY9 A;  7AT1 B;  2XNQ A;  5A0Y B;  2W9C B;  4CLP A;  3UVJ B;  3KNA A;  2KFN A;  1HHQ A;  3D67 A;  4CIO A;  2CQ0 A;  3MXH P;  1UWB A;  5GMD A;  1YG0 A;  1VQS A;  2CPH A;  3HT0 A;  2IPO B;  4J9Q A;  4W90 B;  4LJM A;  4LFC J;  2BXJ A;  4DJB A;  1C0T B;  2GS8 A;  3J7A N;  1HQ2 A;  2C42 A;  1KLM B;  1BE4 A;  4LQ9 A;  3Q8U A;  3MR2 A;  4GO5 X;  1OSD A;  3ZTS A;  4IO1 A;  2LXF A;  2VPW B;  4FF2 A;  4X4T A;  3JS9 A;  3IP0 A;  5ETK A;  1CC8 A;  4PUO A;  3KHR A;  3EIC A;  2Z4P A;  2VC1 A;  4OV6 A;  3OUY A;  2FHK A;  4OZ5 A;  1VK3 A;  5B0F A;  4NEZ A;  1HBU A;  2V2K A;  5L38 A;  1Q5Y A;  1RWO B;  1H2U X;  2IDE A;  3OR1 B;  4UOC A;  4F26 A;  2HBR B;  2EFV A;  2DTJ A;  2JEI A;  3CT9 A;  1IM4 A;  1PG5 B;  4IFV B;  3NS7 B;  1UA1 A;  4NLR A;  1HQU B;  2A1B A;  2ZH3 A;  2BJD A;  5FD1 A;  3HT3 A;  1O51 A;  2K1R A;  3O1L A;  2GVD A;  2YH0 A;  4M5M A;  2J6U A;  4H4O A;  2KI2 A;  5CH7 B;  1BQN A;  1R31 A;  2UVV A;  3I32 A;  4B3M J;  2XGQ A;  2DJW A;  3HZG A;  3FEZ A;  1TFY A;  3PW5 A;  3EXC X;  1XR5 A;  1QTN B;  5KAK A;  3NCQ A;  3LWM A;  2EFN A;  5A0Y A;  3BO2 A;  4AL6 A;  3UVJ A;  2MKS A;  3BKF A;  2EPI A;  1GXU A;  1X7V A;  2FVR A;  4PRF A;  4I2P B;  3R5G A;  2QZ8 A;  5CYM A;  2GGP B;  1RAE B;  2O66 A;  4QQB A;  2AEM A;  4LRF A;  1WEZ A;  2CA9 A;  3W9I A;  3GFY A;  3THT A;  3KLV A;  3P45 B;  1OIA A;  3FQL A;  3AY0 A;  2DGU A;  3HUL A;  1KLM A;  2BW7 A;  3TZY A;  4M5I A;  2YH1 A;  2OTL S;  1B4S A;  4DG1 B;  5B0E A;  3CJQ A;  1NH7 A;  4C0O C;  2DK2 A;  5KFT A;  3GCX P;  2DD8 S;  3QPI A;  1WOR A;  1S0N A;  8RUC A;  2BV3 A;  3KHL A;  3VGS A;  1CQN A;  1R0B G;  3R5D A;  4I7F B;  3OR1 A;  3VQS A;  2QA4 G;  1D0E A;  2LA6 A;  4DL2 A;  1FFG B;  4DN9 A;  3CB4 A;  1FRX A;  4IFV A;  3V5R A;  3MR7 A;  1QY7 A;  4KB7 A;  3P6Y C;  1N5S A;  3ZZU A;  1RYR A;  4QYZ K;  5AE2 A;  5H1S V;  1HQU A;  2R8J A;  3MMB B;  1VOM A;  3R5C A;  3KLH B;  1LWF A;  4F0M A;  3PJ9 A;  1RHM B;  4AND A;  1NJZ A;  1S97 A;  4OZL A;  2NYH A;  2ZHA A;  1NKC A;  1JB0 C;  2CPI A;  2DEI A;  2RDJ A;  4NYO A;  1PCA A;  2HWI A;  2Q43 A;  2QRR A;  1YWX A;  1WOS A;  2HFZ A;  3E3X A;  4KFB A;  5L1J A;  2IA6 A;  3CWJ A;  2GGP A;  1VJW A;  2QFI A;  2UV8 A;  2Y0B B;  4LR9 A;  3CD7 A;  4F4K A;  1P9Q C;  4K4U A;  1KON A;  5BR8 J;  2HKE A;  2C3M A;  4WKY A;  1IBC B;  2DNH A;  3B8H A;  4LF7 F;  1H38 A;  1UZH A;  1N5Y A;  2KFY A;  2ZH8 A;  3D28 A;  2NXJ A;  5KG3 A;  1N34 J;  5D6G A;  3NAH A;  2Z56 B;  4QW8 A;  2BBE A;  2N82 B;  2NPF A;  5LSR A;  3L7O A;  3DFE A;  5E5N A;  4DG1 A;  1LW0 B;  1NJW A;  3D1O A;  2UXC F;  1U0H B;  3QT6 A;  1HNV B;  2DR5 A;  4ZPW R;  5F3Z A;  4HI1 A;  1TKX B;  2L9W A;  4ZN3 A;  1XR6 A;  2VB6 A;  5U47 A;  1HNI B;  2XQC A;  4KO0 B;  4JI4 F;  1S12 A;  2XI2 A;  4JV1 A;  1HBN B;  4I7F A;  3DLL Q;  3U1L A;  1MRO B;  4DU7 A;  2B9X A;  2KM8 C;  3OL7 A;  3BF4 A;  3VAI A;  4LSN B;  3F0N A;  4X84 A;  3EGN A;  3PHT A;  4OYI A;  4ELT A;  5GAG U;  2VDI A;  2XYH B;  3MMB A;  1YJR A;  2BKN A;  2JWN A;  3KLH A;  5DDP C;  2KRR A;  4TU9 A;  3MEC B;  2ROP A;  2PC6 A;  3PW2 A;  5B09 A;  3IBW A;  2UU9 F;  4ZOS A;  1MLA A;  4KC5 A;  5LMU F;  3BYP A;  3UPF A;  2M9K A;  2LXU A;  4OZ1 A;  3P4U B;  2HZA A;  1P8G A;  4UQT A;  4ETZ A;  3KK3 B;  2RQM A;  3NGD A;  1JLB B;  2R7W A;  1T02 A;  2NZ4 A;  1PJ6 A;  3N5F A;  1XMQ J;  1HR0 J;  3RUB L;  1GT8 A;  4RZR A;  3G6E S;  1YK9 A;  3PX4 A;  3OTE A;  5KFS A;  4H4K A;  2E9Z A;  2YNF A;  1NHV A;  3M30 B;  4C0H A;  1K44 A;  3X1L B;  3GYG A;  3DOL B;  4I6Y A;  5F8M A;  1HHS A;  1PBA A;  2OEL A;  2IJN A;  4JV0 A;  3FC9 A;  3VGT A;  3GQC A;  4ZLN A;  2HWT A;  1VQ9 S;  2X1A A;  4JI3 J;  3DRY A;  1VQL S;  1HIY A;  3CCE S;  3TAN A;  2E5G A;  5A6P A;  2JEJ A;  2ZZT A;  1U0H A;  3OJS A;  2J9D E;  1HNV A;  5DRK A;  4OHY A;  1TKX A;  3DLE B;  3C16 A;  2E1C A;  4ED7 A;  1UVK A;  1VBK A;  4D3G A;  2UVU A;  5KT3 A;  2XEX A;  4YQW A;  4KO0 A;  1UW9 A;  4FS2 A;  4CLY A;  1HBN A;  2GIQ A;  2Z2L A;  3HSZ A;  4DPU A;  2DH9 A;  3AXK A;  4LSN A;  4NXN J;  5E41 A;  4IDK B;  1QAY A;  4ECR A;  1CJT B;  1E6V A;  2D7S A;  2VJU A;  5T14 A;  4WFX A;  2KVQ E;  4NEY A;  2P6S A;  3OL8 A;  4ZP9 A;  5E3Q A;  2RB7 A;  3M6X A;  4EWT A;  2HHV A;  2F3J A;  3DGP B;  5KFX A;  2W2P P;  5F9N A;  2CVI A;  2CQI A;  2DIS A;  3KK3 A;  4ED1 A;  5LT5 A;  2FLL A;  3IS9 B;  2V5H G;  3FBC A;  4F8R A;  1JLB A;  4B3S F;  5LMN J;  1R8A A;  2KG1 A;  4AYB D;  4GVB B;  4I68 A;  1YHQ S;  4Q8E A;  1CJV B;  4G1P A;  2JLG A;  2GHV C;  3N6M A;  4GVL A;  2C2D A;  3DOL A;  2DR8 A;  3HVW A;  2RQC A;  4PXC A;  3VAK A;  3EJM A;  4HDH A;  1YTY A;  4AUK A;  5K9F A;  3TYT A;  3CCZ A;  3DXS X;  4ZDN A;  2QG9 B;  3PZP A;  1O5J A;  3HF5 A;  5EHH A;  4USV A;  3PDN A;  1LKZ A;  3DLE A;  2IVY A;  3V6D B;  3BPD A;  3GG1 A;  2XZW A;  4FYW B;  4E0D A;  1T9Y A;  1FNM A;  2HBZ B;  5T41 A;  1U1N A;  3MFH A;  2XYG B;  2E5I A;  1ZAV A;  2G1H A;  2W01 A;  4O44 B;  2E9R X;  2DGO A;  4QYZ J;  3M2U B;  4Y2K A;  4F2S A;  2BZ2 A;  3FRZ A;  1XC9 A;  1W25 A;  4ZVF A;  2K3K A;  5L46 A;  2XUL A;  2H5J B;  1RU2 A;  5CD4 H;  4RLE A;  2DNY A;  3QMQ A;  2WOM B;  3T5H A;  2G2Y A;  5I3U B;  4DUY J;  2VV5 A;  2G4B A;  4IRC A;  1U2F A;  4ZP6 A;  1CJT A;  5C25 B;  1PYS B;  1XNR F;  4HHH A;  1V3S A;  1PGZ A;  2K7J A;  1T05 A;  5AXK A;  2F65 A;  2FLO A;  2OPQ A;  3LP0 A;  3DOK B;  1RWV B;  4M5K A;  4QZV B;  1VIO A;  3CCS S;  3UO0 A;  1NK7 A;  5K8O A;  4X2B A;  4HYK A;  4K0K J;  2HSE B;  4DFP A;  4YFU A;  3L9Z A;  4UUX A;  3PG9 A;  4ZA1 A;  3BQ2 A;  4XK8 C;  3BDE A;  3RAX A;  3IS9 A;  1FDB A;  3A3N B;  3TJ9 A;  8AT1 B;  2WAQ D;  1NZ8 A;  4QCL A;  3OXF A;  4LR7 A;  2Y3Y A;  5IWA F;  4GVB A;  2ZH6 A;  1Q82 T;  3V4M A;  3J7A 1;  2J7K A;  1CJV A;  2OPP B;  2R42 A;  1VQK S;  2OEJ A;  5F8I A;  3C19 A;  3DN9 A;  1B0V A;  4MMO A;  1NSQ A;  3GIL A;  3N5B A;  2HQC A;  1PKU A;  3PM9 A;  1RT1 B;  1HD1 A;  3GFX A;  4X62 F;  1CG2 A;  3PW4 A;  2N7C A;  1DAR A;  1U25 A;  2PEB A;  3DHW C;  2OMO A;  3EGW B;  3GJQ B;  1RWW B;  1HWU A;  2ATC B;  1FCA A;  1WEY A;  4LT6 A;  4I6W A;  2HVD A;  2CWX A;  4O44 A;  3BKT A;  3CUN A;  3LGH A;  5J2N A;  3M2U A;  2Q3P A;  3D1Q A;  2RQK A;  4C8M A;  3SZ2 A;  2ZD1 B;  3QRP A;  2V9W A;  4WWS A;  5D4N A;  2FZK B;  2WOM A;  5I3U A;  2XCP A;  2XWY A;  1X31 C;  2J6S A;  5C25 A;  1Q4R A;  3QLH B;  1IBL F;  3K5L A;  4IOB A;  4LQ3 A;  2JC1 A;  2CJA A;  4K8R A;  4DL3 A;  3CCU S;  5D77 A;  2YKO A;  5HMX A;  1JMT A;  4OLP A;  3ZTR A;  2XLI A;  2H3E B;  1REV B;  2QSF A;  1REG X;  3AD8 C;  2BRL A;  3RR7 A;  4V19 J;  3EVW A;  2P9E A;  4ED3 A;  4EO6 A;  4A8Y A;  3R2C J;  4L74 A;  3DLB A;  3HPO A;  2HHX A;  1SIZ A;  4ZJL A;  1F0X A;  3K0J A;  2DH7 A;  4HH0 A;  5B7W A;  2YKN B;  4MIW A;  3J81 j;  5D15 A;  2AGP A;  5HRO B;  5J2M B;  4K4W A;  2C22 A;  5DDR C;  2KHD A;  2FVS A;  3W8P A;  3DHX A;  1HMV B;  2ASL A;  3OHB A;  4OI1 A;  2XZD B;  1HWI A;  3G6Y A;  4K4X A;  2LP4 A;  1F5C A;  1U6B A;  3I5A A;  4EEY A;  3PW7 A;  1D8Y A;  5FDL B;  1RHK B;  3OTO J;  3F56 A;  2HS4 A;  4FXV A;  4DL7 A;  4A47 A;  1QD1 A;  1HNX J;  5CA5 A;  4O3S A;  1IXK A;  4FNH A;  3J81 Y;  4FYD A;  2DKO B;  2A2C A;  3G6X A;  1RBL A;  2ZD1 A;  2A3J A;  3ET6 B;  4PAB A;  1XR7 A;  3C15 B;  3MMJ A;  2QLB B;  3CDW A;  1NHK L;  3D9B A;  3DLK B;  3OXL A;  3KUH A;  3M6V A;  3QLH A;  2ZH4 A;  1Y9O A;  2CQ3 A;  3IM9 A;  4UF4 A;  3OFF A;  3BYR A;  2KM8 B;  5GAD I;  4QR0 A;  2CJX B;  2BE9 B;  1ZA2 B;  4J9R A;  4DI6 A;  4OMF G;  3KXD A;  1OS5 A;  3GII A;  3JSM B;  2WSF C;  2BDP A;  1MMD A;  4HKQ A;  2KXH A;  4C8Y A;  2B5J B;  3SSQ A;  3DDK A;  5C42 B;  3PFO A;  5ETV A;  1IJF B;  3B78 A;  3KJN B;  2YKN A;  2ZC3 A;  1KHV A;  2IY5 B;  2YNH A;  2B6A A;  5H9E K;  1T9U A;  2HAF A;  5EUH A;  4L76 A;  3QT8 A;  3BB5 A;  1QM9 A;  1AA1 B;  3UNG C;  4KGK A;  5AXM A;  4O4R A;  3PX0 A;  1A0O B;  3D7S B;  1VQ5 S;  3RBZ A;  1L3S A;  2ERR A;  2DO0 A;  4FZV A;  4J9K A;  3PXG a;  3NBP B;  1NDC A;  1GMW D;  4QU7 A;  2YX1 A;  4QIV A;  3FSY A;  3R97 A;  3NNA A;  4ZIV A;  3LAM A;  1OYD A;  3IA0 A;  2OFH X;  1C1C B;  2X3D A;  3HO1 A;  1NK4 A;  2YNG B;  3O3L A;  1M5S A;  4TLQ A;  2DCL A;  3W65 A;  4PXD A;  3VTI A;  4GO7 X;  1OPZ A;  5D8H B;  4DV5 F;  3QJL A;  5EDW A;  3ET6 A;  4ZLP A;  2OEK A;  4DN0 A;  1Y7P A;  4OX9 F;  1UW4 A;  3Q0A A;  1R8C A;  2UVR A;  2VOP A;  4N56 A;  2HBQ B;  3DLK A;  2WVC A;  3CE8 A;  2PT0 A;  1RBO B;  3JAM U;  4JI1 F;  5L9N A;  1UCN A;  3D68 A;  3M8Q A;  2MZT A;  1SBR A;  3QT7 A;  4BDP A;  4WP3 A;  4DDF A;  4B9L A;  2RIJ A;  4K5S A;  5DET A;  2GZO A;  2ZDP A;  1X4A A;  2LLZ A;  3NMA A;  1HPZ B;  2XO7 A;  2YY3 A;  3BSO A;  3I31 A;  2AYB A;  2FY1 A;  3JSM A;  1M1K T;  4K4S A;  3HSJ A;  4DFJ A;  3FSX A;  2OPR A;  4LF6 J;  4LRE A;  5SZT A;  1VIS A;  2OFG X;  3DU5 A;  3NGR A;  1M5K C;  1F5B A;  4OHV A;  2IBO A;  1KNZ A;  3D3C J;  5AE3 A;  1AUD A;  1N5V A;  2L3M A;  3NOG A;  4C48 A;  3KLI B;  1UVI A;  1B0P A;  2CKW A;  3ILO A;  2M3D A;  4WYW A;  2G13 A;  2XZT B;  3THP A;  1Y00 A;  3H4B A;  2JL9 A;  4KGM A;  4JI0 F;  4ED2 A;  4K50 A;  1Q7L B;  3NRB A;  3UCG A;  5KFD A;  3H5Y A;  2YNG A;  4N8O A;  4RWX A;  1YBU A;  5J2P A;  3VCD A;  1GMW A;  2JEF A;  3UE2 A;  2R7Q A;  1Q0N A;  1RWM B;  2XMW A;  5F8G A;  4O3P A;  2E1M C;  4QPT A;  1KR4 A;  4Z37 A;  5DM6 Q;  3CDE A;  4ITS A;  3L7U A;  4ECS A;  2MKK A;  4BS2 A;  2VPX B;  1I94 F;  1HBO B;  3EMT A;  3KWM A;  2GJ2 A;  1DHM A;  2B9W A;  4EFA C;  4I67 A;  2ZUA A;  2EKY A;  3S6E A;  2YWG A;  3QZ7 A;  4NLD A;  1N32 J;  1GH8 A;  2HHW A;  1WF0 A;  1HPZ A;  1RGV A;  1T9T A;  1J5O B;  4QU6 A;  4A8S A;  3J7Y I;  2FHJ D;  3J80 Y;  2V8G A;  4G1Q B;  1VGY A;  3DRR B;  5F8J A;  1LXJ A;  3I55 S;  1KP6 A;  3KJF B;  5HAN A;  4AFF A;  2ZH1 A;  4MK9 A;  1Q8I A;  2G2O A;  4GKJ J;  5KFE A;  4N76 A;  2UP1 A;  1NU4 A;  4KGZ B;  3I82 A;  1AZS A;  5ETO A;  3M8R A;  4NYZ A;  2CPE A;  4DX6 A;  3MOJ B;  4X4Q A;  1WKJ A;  1CPZ A;  3MM7 B;  1RLC L;  4BBY A;  2LU2 A;  1J27 A;  3EYZ A;  2BEF A;  1KFS A;  4URS A;  4P52 A;  2W8L A;  2BW2 A;  3AH6 A;  1KLN A;  1IKV B;  3OT9 A;  5CQG A;  2KO1 A;  2WRM A;  4HAC A;  1YIT S;  4X4V A;  2EFO A;  2QE5 A;  4CT8 A;  3GV7 B;  2YQ0 A;  4UZB A;  4KGX B;  4PYA A;  1DUR A;  1UEK A;  5IT0 A;  4QWA A;  4J9U E;  2KJV A;  1GXL A;  2EWH A;  3LQV A;  5GMK a;  1TKT B;  2P8I A;  1VQO S;  4LBI A;  3C6T B;  3GLJ A;  4ZVE A;  3EGV A;  3AOD A;  2ROG A;  2ZKU A;  1SC3 B;  4B3R F;  1NM2 A;  3SMZ A;  3U7J A;  1N52 B;  1X9W A;  4J9S A;  1GX6 A;  1EJ7 L;  3T1H J;  2HZV A;  3H7H B;  4DR6 J;  3DC2 A;  3IFE A;  4J9P A;  4G1Q A;  5C2C A;  3A4T A;  3DRR A;  2RUG A;  3UD3 P;  3IN5 A;  2MMY A;  3V6K A;  3HFV A;  5ETM A;  3K58 A;  2GQC A;  2KRB A;  1N33 J;  2RT3 A;  3OL9 A;  1IKY B;  4Q2M A;  1K1Q A;  3UDE A;  1S6O A;  5KFI A;  5A8K B;  3I5B A;  3KLF B;  3QJP A;  2FUG 9;  1V5I B;  1RT4 A;  2V2Z A;  5DO2 A;  3W2W B;  4KPY A;  4DV7 F;  3MM7 A;  2Q1L A;  3QBC A;  2MLY A;  1GMU A;  4OHX A;  1WJ9 A;  3C6U B;  1U26 A;  1KOH A;  2CFX A;  3TO8 A;  4ZVR B;  4ZKA A;  1IKV A;  2CQC A;  5IT9 Y;  3ZZ0 A;  3AQP A;  3N6L A;  2ZVI A;  1UFL A;  1X5T A;  3VAH A;  3CTR A;  2DH8 A;  3M6U A;  3R7N B;  3MPD A;  4DUZ F;  2I2Y A;  1K47 A;  3AB2 B;  4KHM A;  4CM2 A;  1T0T V;  2FVP A;  3PO4 A;  2MHE A;  4DV0 F;  1SL2 A;  2KJW A;  4G1I A;  1WKK A;  3IG1 B;  2F63 A;  5ETR A;  1TKT A;  3FGV A;  4RW9 B;  1KKH A;  3C6T A;  3ZZZ A;  5IWA J;  3V2U C;  2DNN A;  3A3O B;  5IC4 B;  4ED4 A;  1MW7 A;  4K2J A;  3C14 B;  4A46 A;  1RAF B;  2H54 B;  3C66 A;  2CQ1 A;  1JLQ B;  3SSS A;  4DV4 J;  5KT7 A;  1S4E A;  1FRI A;  3MR6 A;  1VQN S;  4QWE A;  5EX3 A;  2XY6 A;  3BM7 A;  2R2S A;  1HI1 A;  1EP4 B;  1X4F A;  3UW1 A;  1H7X A;  5CYQ B;  3N79 A;  2ZNZ A;  3GSD A;  4LF5 F;  5RUB A;  4X62 J;  2J7U A;  3JB9 k;  1D9D A;  4R8U A;  4FVM A;  5C24 B;  4U95 A;  3Q8P B;  3GWC A;  3TAR A;  4U96 A;  4ZVQ B;  1QAX A;  3A8I A;  1JJH A;  4TQS A;  4JI7 F;  2C28 A;  4ZVO B;  3CCJ S;  5A8K A;  2H5E A;  3KLF A;  2YX7 A;  1EQ0 A;  4DV2 F;  4CNY A;  4PG4 A;  1FVQ A;  1X4C A;  3I9V 9;  2ZZN A;  3W2W A;  3A13 A;  2Z8Q A;  5KFP A;  2HWH A;  1RWN B;  4J7C A;  3C6U A;  4Q2L A;  1LOU A;  4OV1 A;  3Q8V A;  4ELV A;  5KFW A;  2QJ3 A;  2K3I A;  2QYG A;  2IAJ A;  2HFS A;  2QT7 A;  2V6A A;  3NL0 A;  5ETT A;  1IWA A;  1ZM9 A;  3OTB A;  2H9Z A;  1N56 A;  3KJQ B;  2UXB J;  4ZIT A;  1Q1K A;  2CPD A;  2CWK A;  3DI6 B;  2RIL A;  5B0A A;  4OJG A;  2G0I A;  1YKW A;  4PPD A;  5IM0 B;  1R0A A;  5DZ7 A;  1WKL A;  2DPJ A;  4B9U A;  1H72 C;  1TFW A;  5DGA A;  2FQQ B;  3PEJ A;  5K14 B;  4RW9 A;  1ICE B;  5ETQ A;  5HJX A;  1AFI A;  3C14 A;  4YEA A;  2AMC B;  2Y1I A;  2IRY A;  2Q79 A;  2R8K A;  4IR9 A;  2W7P A;  4KE5 A;  2KH9 A;  5EGY A;  2UUA F;  2FGC A;  4DBQ A;  3CME S;  4LF1 A;  3W5Y A;  2DO4 A;  4Z7C A;  2J6T A;  3QYY A;  4WXW A;  1EP4 A;  3ISN D;  4GC6 A;  1ZOT A;  2VOD A;  3KLE B;  4UOH A;  5CYQ A;  2HHT A;  1CLF A;  4B9T A;  2OPS B;  1N36 F;  3H90 A;  3HSD A;  1S9F A;  3NY0 A;  5HAO A;  3UCZ P;  1VDH A;  2V67 A;  3CW2 C;  1RE1 B;  5J2Q A;  3W9H A;  1VRT B;  4A8X A;  4FYX B;  3CCL S;  1FXD A;  2YWE A;  4Y28 C;  2HFU A;  1WEX A;  1LWE B;  5KFU A;  3QGH A;  4NYP A;  4XPE A;  1EHW A;  2IMO A;  1NDK A;  2W2M P;  2EC2 A;  2DHH A;  4JI2 F;  1VBY A;  4TU7 A;  2KTQ A;  5DQH A;  2R8H A;  1RTJ A;  2JNJ A;  4CP5 A;  4Y6I A;  2FTR A;  4M5H A;  1GTE A;  1Q8K A;  1U1Q A;  4KPC A;  3FZ2 A;  4DQQ A;  2R7U A;  1M5O C;  4M94 A;  5LJ3 Y;  3G9C A;  5JUM A;  3PAC A;  6FDR A;  5IM0 A;  2KZM A;  5KFC A;  3OFG A;  4YN3 B;  4ILM A;  3OR2 A;  2FC9 A;  2AV5 A;  2BR0 A;  4PKD B;  4EU0 A;  1FXR A;  2CPF A;  4DV6 J;  3BDP A;  3CIM A;  4TXS A;  1CS4 B;  2MJN A;  4ILR A;  3LPY A;  4M5J A;  3BS9 A;  1KC8 T;  2HGL A;  1VLO A;  3MEK A;  1VJQ A;  4K7Q A;  4L73 A;  3QGI A;  2K06 A;  2CAJ A;  1WI6 A;  4C0B A;  2GIR A;  1KQS R;  4CWB A;  2OPS A;  2BJ9 A;  2ZM6 F;  2UV8 G;  3M9N B;  3OLB A;  3NS6 A;  3KG1 A;  4MKV A;  5HBM B;  4NCG B;  4B08 A;  3D2W A;  2AWZ A;  3DRP A;  1VRT A;  1AFJ A;  1FX4 A;  3K8V A;  4NRU A;  3VAG A;  1LWE A;  3KDN A;  3NCR A;  4OYA A;  1PIL A;  5H9F K;  2DIT A;  3VF0 B;  4TU8 A;  3TR5 A;  2RRN A;  3NP5 A;  4YB6 A;  1EX8 A;  4U9R A;  4RU9 A;  2HNZ B;  2JVR A;  2HHU A;  2HFV A;  3FK4 A;  4J9L A;  2B51 A;  1U2C A;  1WF1 A;  2DNR A;  1S79 A;  4QPX A;  4DV1 J;  3NXZ A;  2D9P A;  3MUV P;  3OVA A;  1XQI A;  3BO3 A;  2NXE A;  5HMY A;  3HK2 A;  2XM3 A;  1R89 A;  5K8P A;  2CRL A;  3W61 A;  4ATN A;  2AYM A;  2BQ3 A;  3K5M A;  3ZZP A;  5D4O A;  1DTT A;  4KR0 B;  1NPP A;  2RRA A;  4C8O A;  3MGJ A;  1JLF A;  4ZIW A;  3P5B P;  2MLX A;  1SJ3 P;  1CS4 A;  1RT2 B;  4RBU A;  3TVK A;  1T7P A;  2OSR A;  2VFU A;  5D0H A;  4V19 X;  2BRK A;  3CC4 S;  4KY3 A;  4C8N A;  3EPI A;  3PV8 A;  2B43 A;  2YWW A;  3MDF A;  2E1R A;  4XDD A;  2DR6 A;  3EM1 A;  4LRC A;  1TUG B;  3L95 X;  4DR4 F;  2E5L F;  3VZI A;  5IT4 A;  2B56 A;  1N0U A;  5DLG A;  4JYA J;  1FRJ A;  2DGT A;  4DSJ A;  3R6L B;  1H7W A;  1EIY B;  3GYN A;  5HBM A;  1PJ7 A;  4NCG A;  3S01 A;  2J5A A;  1IBM J;  3SBM A;  4LVO P;  3HHE A;  3W60 A;  4FS1 A;  2L9D A;  4BC9 A;  2HVZ A;  5G4D A;  2AYG A;  5KFJ A;  3I4H X;  1X9M A;  2EG1 A;  4CLW A;  4F4A A;  1R0C B;  1F2H A;  5J1P A;  1SKR A;  2ADC A;  3GZ7 A;  2XSJ B;  4Q7A A;  4O3O A;  1NB2 A;  2HNZ A;  3UD4 P;  2COL A;  4BCA A;  1NND A;  1TL7 B;  2RD5 C;  1K0T A;  2UUB J;  3ICL A;  5GVQ A;  3K57 A;  4DS5 A;  2VH7 A;  1ROF A;  3SIP B;  5AJ3 J;  2IDL A;  2UVW A;  2ALY B;  4RW4 A;  4RWW A;  2KXN B;  2FVC A;  1XJW B;  3PYF A;  2V9K A;  2E1A A;  4L3N A;  3UDL A;  4DR2 F;  2VBZ A;  3GJS B;  3CCT A;  2HQI A;  1MWY A;  1W7W A;  1G3O A;  3BJY A;  4LIR A;  3DDI A;  4WP8 A;  4ZPA A;  2I1R A;  3EVM A;  2YNI A;  3QNW B;  3O6Q A;  2EBE A;  1VBZ A;  1S10 A;  2CQ2 A;  2CQB A;  4YB1 P;  2R2U A;  1RT2 A;  4P10 A;  1UA0 A;  2V4Q A;  3MPW A;  2DGW A;  1WHV A;  4DR1 F;  1CVJ A;  3RRH A;  2HYI B;  2N3L A;  4LF8 F;  1RWU A;  1TTH B;  1WHW A;  1H2T Z;  4ALZ A;  3TA2 A;  4Y2C A;  3U02 A;  1R8H A;  3BH7 B;  3KJV B;  2V8V A;  4DZ6 A;  5ETL A;  3PR4 A;  2MZQ A;  4I64 A;  3SCK E;  3U1N A;  1Q8L A;  1V3R A;  6FD1 A;  2EK6 A;  2NZC A;  1T95 A;  2ZVS A;  3I6P A;  1U49 A;  3BR8 A;  3M2R A;  1MG7 A;  3DCA A;  3NKY A;  2XSF A;  3PKY A;  3H8Y A;  4LF4 F;  3PO5 A;  3PJX A;  1UVL A;  2XSJ A;  1Z2L A;  3H20 A;  1RIS A;  4G6V B;  4ANC A;  3UR0 A;  2RH3 A;  2XS2 A;  4LFA J;  3NNC A;  5HJY A;  1FJG F;  4JI8 J;  3RB6 A;  3CO0 P;  1TL7 A;  1Q86 T;  4JOU A;  1B99 A;  1Y4Z B;  1X9S A;  2DHA A;  3Q8S B;  2KDO A;  3PCO B;  4I1T A;  4HI2 A;  1JK9 B;  4ECX A;  2NUH A;  5KFM A;  2VKR A;  3HSG A;  2HHH J;  1SJF A;  1L3V A;  4MAK A;  4RUB A;  2D3U A;  1SVD A;  2YXL A;  4JB8 B;  2J7W A;  1M0S A;  5DLF A;  5KG1 A;  3Q83 A;  1B64 A;  2LEB A;  5BYS A;  4F7V A;  1Q81 T;  3T1Y F;  3TUI C;  2QA4 S;  3PIO Q;  1PYT A;  2GA7 A;  3FEX B;  3HI9 A;  1AYE A;  4F2R A;  1CBK A;  2FGO A;  3OSN A;  4RBV A;  2RU3 A;  3KJV A;  4FN5 A;  2YBV A;  2PA8 D;  4URG A;  5DDO C;  4CO5 A;  3I5C A;  4P2F A;  3H59 A;  1I3O B;  3CJ8 A;  2YPZ A;  4O0N A;  3N4W A;  3MM5 B;  3MAH A;  3WHI A;  1CEZ A;  1X4D A;  4WU2 A;  5HK4 A;  3T5J A;  4ZJQ A;  4YY3 J;  3OHA A;  2EKN A;  4OL8 A;  2MQO A;  1NSP A;  5IS2 A;  1VQY A;  1YJN S;  2I0X A;  2CJY B;  1KS2 A;  2A6O A;  1S0V A;  2Y1L B;  2D1C A;  3O44 A;  4A8M P;  5JVG Q;  2E7V A;  1JXV A;  4NZ6 A;  4FYY B;  2OAU A;  3W9J A;  4X65 J;  3TA0 A;  3HZE A;  1ZPW X;  5KG6 A;  4EGL A;  4ES1 A;  2N3O A;  2R9L A;  3CDU A;  1W26 A;  3I0R A;  1L3T A;  5J1E B;  1KVJ A;  2BAN B;  2ILY A;  1H2V Z;  4CI0 B;  3CPW R;  1RAD B;  2ZBI A;  1RAB B;  1RHU B;  2HRY A;  3I0S B;  3K5N A;  3TAM B;  4QYR A;  2LA4 A;  4QIG A;  4O3R A;  1F3V A;  5MLC V;  3CD6 S;  4ZP8 A;  3M6W A;  3KK1 B;  2O1P A;  4O4G B;  1ZYQ A;  2CNO B;  4KT0 C;  2PSZ A;  2ZBP A;  4F3M A;  3DDN A;  3S7R A;  3RTV A;  4ZP7 A;  1FTR A;  4FVC A;  3JYT B;  3ZTO A;  4JI7 J;  3GB0 A;  3W66 A;  1S72 S;  1JLC B;  4YOE A;  4NLQ A;  3AJ2 A;  2W2Q P;  2I8E A;  2EG2 A;  3CDA A;  1DTQ B;  4GKK F;  2BM0 A;  4J37 A;  2K2P A;  1ZET A;  5FII A;  5EWG A;  3MM5 A;  4QR1 A;  4OX6 A;  1X5S A;  1ZA1 B;  4RNH A;  2M8D B;  4YDD B;  4RO0 A;  3LW5 C;  4X64 J;  1BMQ B;  2LFV A;  1BLU A;  2W1B A;  3MEE A;  4KGV B;  3T5L A;  3M8W A;  1N0V C;  2BX6 A;  3I96 A;  2LDI A;  1R6Y A;  2VFT A;  4YHH J;  4JV2 A;  2QFJ A;  4Q0B B;  3KK2 B;  2I38 A;  2IC3 B;  3G71 S;  1XMO F;  3MCS A;  3KG0 A;  2AJQ A;  1S77 D;  4CTA A;  3J81 U;  2RDI A;  4CLZ A;  1Y10 A;  3AXM A;  1RTI B;  2SXL A;  1H0H B;  2IM1 A;  3MMA A;  4P2S A;  1OY8 A;  1FNO A;  1ZM2 A;  3FJ2 A;  1IKW B;  4ECT A;  1H74 A;  2R4F A;  5K8N A;  2PEH A;  2PN6 A;  2BMB A;  2YWK A;  3H42 A;  1FRM A;  1JXL A;  5L1K A;  2BM1 A;  4LFB F;  3CIZ A;  3I0S A;  3TAM A;  1NJI T;  4DCJ B;  3TUZ C;  3QT5 A;  1SPB P;  1DRZ A;  4X4N A;  4O4G A;  3JQM A;  1IWG A;  2CQG A;  2DHS A;  4U67 Q;  3BBB A;  1FKP A;  3WX8 A;  1FD2 A;  1TP7 A;  2WK4 A;  3JYT A;  3LP2 B;  3PYD A;  1HNW F;  3IBF B;  5CYJ A;  2U1A A;  4Q5V A;  1JJ2 R;  3HLU A;  2V68 A;  2ASY A;  4LSL B;  3NGU A;  1L3U A;  3EDQ B;  1UJ5 A;  3MM9 B;  1DTQ A;  3M7V A;  4N7T A;  1BHN A;  2ZIT A;  1J5E F;  1S7I A;  4ERD A;  4CYU B;  4ECU A;  3CJ5 A;  3OD2 A;  2IHR 1;  1N88 A;  2B4V A;  3JSB A;  3GYX B;  3F41 A;  1UJ6 A;  2ZEJ A;  1SC6 A;  2GJF A;  4K2X A;  2YKP A;  5KFV A;  3DOM A;  4PYD A;  5JJB A;  3P49 B;  3K89 A;  1Y5I B;  4Q0B A;  2IC3 A;  3TZW A;  2HHP A;  1ZTW A;  1S1X B;  4FKX A;  2F9J A;  4F3Q A;  1U1P A;  2RVJ A;  3TOQ A;  4ZPD A;  3HKZ D;  3TZX A;  1NK5 A;  1YQH A;  4WKR A;  2QYC A;  1RTI A;  3KNG A;  2HEK A;  1CJU B;  1Z1Z A;  5E3R A;  5LXR A;  1IKW A;  3TI0 A;  4A8K A;  3H2L A;  2QN6 B;  2UUC J;  2I5J B;  1RT3 B;  3I9Z A;  4L6V 3;  4HEA 9;  4AQY J;  2GAH C;  2RF2 B;  2RKI B;  4C9D A;  4NMX A;  2VQE F;  4YP3 A;  4CH0 S;  4RKU C;  2HVI A;  2UZA A;  4NE9 C;  2FZG B;  2VIC A;  4NML A;  2DY1 A;  3EUN A;  1WTF A;  4OJH A;  4ZVU B;  3C46 A;  4B3T F;  2W9C A;  4YR2 A;  4E8U A;  1QTM A;  2WTF A;  4NL5 A;  2VQF J;  3GV8 B;  3LP2 A;  3I56 S;  3FVY A;  1ZM3 A;  1SUQ B;  2YX4 A;  2B4O A;  2B9Y A;  2P2C B;  2W9A A;  1ULR A;  2YQ3 A;  1Y3K A;  6AT1 B;  1NK9 A;  4IRK A;  4LSL A;  3NG8 A;  1KN6 A;  3O2I A;  2HLT A;  4PWD B;  1WC3 A;  1QE1 B;  2J9C A;  4G65 A;  3T9Z A;  4PG5 A;  1C0T A;  2V0N A;  3MM9 A;  5IZH A;  2E9T A;  1E6Y B;  2CJB A;  2BJ8 A;  4A8O A;  3R5B A;  3FBB A;  5CAA A;  2NCK L;  1A6L A;  1D1U A;  3W8G A;  1SI9 A;  2YQ1 A;  1PJ5 A;  4OYP A;  1VI7 A;  2ACM A;  4JI6 J;  1MMN A;  4KHR A;  2CPJ A;  2DRA A;  1HI8 A;  2XLK A;  2AX0 A;  2V2Q A;  1IQZ A;  3GPA A;  4MKB A;  2MEW A;  3HKW A;  4X66 J;  1LV5 A;  2G0C A;  2MZS A;  2ASJ A;  2E66 A;  1NB7 A;  1VQM S;  2YTC A;  3NEK A;  4CO2 A;  2DY9 A;  1KQK A;  1FKO B;  3CNQ P;  1RTH B;  3RBE A;  1JLG B;  3G4S S;  2C2Z B;  1FHT A;  1FK9 B;  4DR7 F;  2R7R A;  3TEH B;  1IR1 A;  1RAG B;  1U6F A;  4DSL A;  4ILL A;  4GMK A;  1SH2 A;  4BHQ A;  4EYI B;  4DL0 C;  2OH2 A;  2WVD A;  5J1N A;  2GX8 A;  4AT1 B;  1CJU A;  4NOH A;  4CDI A;  2QLJ B;  1CSJ A;  2HFN A;  2VDH A;  5DM7 Q;  1FT8 A;  3OTD A;  2VFS A;  1TEL A;  1XNQ F;  2ZHB A;  3GE9 A;  2RKI A;  1N5Q A;  4CNZ A;  1HYS B;  4XDC A;  3U1M A;  2EK1 A;  2GIF A;  3LPE A;  3R1H A;  1XN9 A;  2J0Q D;  2FZC B;  5IV3 A;  3DM2 B;  3HVA A;  4Z7Y A;  4EZ6 A;  3L4B C;  1AXQ A;  2OML A;  4CT9 A;  3NGS A;  4P72 A;  4I2P A;  3J80 U;  2FD2 A;  1SUQ A;  3KFW X;  2BJ7 A;  1H73 A;  2M52 A;  3NCP A;  2XMV A;  4OYX A;  4PWD A;  1S9E B;  2ZWP A;  3BSC A;  3SI8 A;  2G1D A;  1GFW B;  1UEV A;  2WSC C;  1E6Y A;  5HVF A;  2MJU A;  3K2Y A;  1IBK J;  1Y0H A;  2V8P A;  3U27 A;  2UXD J;  3EPG A;  3M8S A;  1AUS L;  2KN4 A;  2GVZ B;  2YKA A;  3SYZ A;  3H5S A;  1FO1 A;  2HHS A;  4ED6 A;  2W7A A;  5KT2 A;  5FLX U;  4OLO A;  3UN3 A;  4HL9 A;  2CG8 A;  2O3D A;  2LKZ A;  2VKZ G;  5F41 A;  5AT1 B;  4TVA B;  1LWC B;  4ZCL A;  1NME B;  2KB2 A;  4DR3 J;  1A9N B;  1FKO A;  4DLE A;  1RTH A;  2ZKT A;  4IOC Q;  5JXS A;  1FK9 A;  5DS7 A;  4CO1 A;  3T3F A;  2CXE A;  5KG7 A;  2NR0 A;  3LGN A;  2B8Q A;  4DV3 F;  4DSK A;  2OTJ S;  4KYZ A;  2XTJ P;  3NOC A;  1W2I A;  5ETN A;  2PI5 A;  3H5X A;  3QGP A;  2CDQ A;  2MB0 B;  5F8N A;  3AQO A;  1DQ8 A;  1BQM B;  2KU7 A;  2QSW A;  3IR6 B;  4V1A k;  1TU0 B;  2HFO A;  1PBU A;  2YWF A;  4WK3 A;  5CXT A;  2W25 A;  1HYS A;  1GQE A;  2FLP A;  3MPY A;  1NDL A;  3L09 A;  3PYG A;  3QRR A;  3WZ0 A;  3OSP A;  1NXI A;  4I56 A;  5IQQ A;  1Z2Z A;  1BGX T;  3N6N A;  4B02 A;  4C8Z A;  3LP1 B;  5G0R B;  5L1L A;  3VAJ A;  3BBC A;  3ENW A;  1EKS A;  2JSX A;  3R5A A;  3RRK A;  2WCX A;  4ECY A;  1MML A;  3CD0 A;  1FJC A;  3TUJ C;  2LCW A;  2ZH5 A;  1RT5 B;  1S9E A;  4C8L A;  3EX7 B;  4U6P A;  4UOG A;  1T9W A;  2WZ1 A;  4UUW A;  2HGM A;  1G6B A;  4DQS A;  1NHU A;  2V4R A;  2HZC A;  2GVZ A;  1FER A;  3SQG B;  1LW0 A;  3UDV A;  2HND B;  2DCU B;  1VRU B;  3W5Z A;  3DNC A;  1HLW A;  2E5J A;  3NAI A;  3TAP A;  1C1B B;  1UMJ A;  4ECQ A;  1T9X A;  4J9V A;  4PPZ A;  2FYX A;  5BR8 F;  5F9L A;  2UUT A;  1HNI A;  1LWC A;  2XMT A;  2LQ9 A;  4HTJ A;  3M1V B;  1MRO A;  2PII A;  3CD5 A;  1N34 F;  4NAS A;  3MUM P;  3LUY A;  2ZHO A;  4U7U K;  1WOO A;  2L41 A;  3T1Y J;  4CO0 A;  2MYF A;  4XTT A;  2NXU A;  2VC0 A;  3D1H A;  4Z2X A;  3AD9 C;  2LEP A;  2GCF A;  1TK0 A;  1BQM A;  2POK A;  3LGM A;  1KVK A;  4A8Q A;  1ZH5 A;  2HUR A;  3MEC A;  4RNM A;  4LBH A;  1SL0 A;  1GX5 A;  3GG0 A;  2VBW A;  2C3U A;  1NKE A;  1SQG A;  2IJF A;  1WSR A;  4OI4 A;  1SB6 A;  4CLF A;  3SFU A;  4IH5 A;  3ZZY A;  1WI8 A;  4Y34 A;  2V8D A;  3LA0 A;  3ZTP A;  3LP1 A;  4L3K A;  5KT6 A;  3GV5 B;  4CLT A;  1FJE B;  3CJK B;  1XMB A;  3EZU A;  4OYW A;  1MWQ A;  2B7B B;  2RML A;  3RB3 A;  5KFO A;  4DL4 A;  4ZLL A;  3RGI A;  4DR5 J;  4FPI A;  1WG4 A;  3M30 A;  3MAA B;  1FFW B;  4DUT A;  4NLU A;  5HP1 B;  1JX4 A;  2AGO A;  5LOQ A;  4C3K A;  1X5O A;  4I69 A;  1S57 A;  4NI2 B;  3KKF A;  4OHW A;  1P27 B;  1DFD A;  1CUL B;  3BGR B;  3SQG A;  4FPR A;  2ZC4 A;  4PEO A;  1XMQ F;  1HR0 F;  3WC2 A;  4CM0 A;  1C1B A;  3QIP B;  4OYB A;  3OFH A;  4LF9 J;  2HS0 A;  1VC0 A;  1YGY A;  1ZS6 A;  4J9N A;  2VUG A;  5HN0 A;  3OFE A;  2MZJ A;  4PWU A;  1S7H A;  2MQQ A;  4QW9 A;  2JLE A;  3M1V A;  4JV5 J;  1O6X A;  3R27 A;  4N41 A;  1VQ7 S;  4USJ C;  4YR0 A;  3OVS A;  2VL1 A;  2XMA A;  2XY7 A;  3FSI A;  4IDK A;  4JI3 F;  2EFP A;  3HHN B;  3BGO P;  3KTQ A;  1X4H A;  4RUH A;  3CO9 A;  4DQR A;  4C8K A;  4HH1 A;  3CCM S;  4N77 A;  4CLK A;  2AIR B;  4NLG A;  2JHE A;  4MK7 A;  5AE1 A;  2AEJ A;  2DNQ A;  2HS3 A;  4W4M A;  5K5M A;  2Z2Y B;  2MY8 A;  1SJ4 P;  5B0D A;  1HNZ J;  2AJ4 A;  3T41 A;  1TUV A;  3DGP A;  2FVQ A;  3OW2 R;  4NXN F;  2OD6 A;  4PXE A;  2MGZ B;  2DGS A;  2MQL A;  4H4K C;  1X4B A;  3FCH A;  4CLS A;  3MZI A;  1FX2 A;  2F9D A;  1RU1 A;  4ED8 A;  5L39 A;  3CJK A;  3SQO P;  3A1Y G;  4Q43 A;  4WF9 Q;  2DGV A;  4W92 B;  4OZ0 A;  1N48 A;  2R7T A;  3FBF A;  2RS2 A;  3GIK A;  4ZVH A;  2WB1 D;  5CD4 A;  4WII A;  3A3P B;  1SH0 A;  3M32 B;  1S1W B;  3ILI A;  5HSP A;  2ZE2 B;  3RAQ A;  2K8G A;  4RW8 B;  4RL1 A;  3MM8 B;  3SV4 A;  1NSK L;  4NI2 A;  1OWX A;  1YIJ S;  2F8H A;  4NLV A;  1OPI A;  4MTP A;  1CUL A;  2E7X A;  3HXM A;  1V5V A;  5EN1 A;  4P2X A;  3QAU A;  2JH3 A;  3BGR A;  5EWF A;  3VHQ A;  4KBI A;  1LNQ A;  3QIP A;  3RW6 A;  4DS4 A;  4EZ9 A;  3GCW P;  4PXB A;  3V6D A;  2PDA A;  1U8S A;  5FJ4 A;  2AJF E;  2BAC A;  4DL6 A;  1SL1 A;  2GHW A;  1WG1 A;  1VHI A;  4Y2I A;  3P96 A;  2H1Y A;  3G82 B;  2CG4 A;  1RAO A;  1FI4 A;  1RSC A;  4DSI A;  2FB0 A;  3FMB A;  3VWS A;  4NCA A;  4R5P B;  4S0M A;  3MCN A;  1I5O B;  1Q5V A;  2DBB A;  4N8N A;  2MXY A;  3H2U B;  3V6H A;  2Z0G A;  3DOK A;  4I0W A;  3IWL A;  3H4D A;  4DHV A;  1U1M A;  2DNM A;  2DT9 A;  3MED B;  2XCA A;  2AQ4 A;  2MGZ A;  1M1G A;  2HQD A;  2GV1 A;  4CQ1 A;  2DIU A;  2XG8 A;  4DUY F;  3FCW A;  1G2E A;  1HWJ A;  3JXO A;  2V2V A;  2WVB A;  1HW9 A;  2LEA A;  2LQJ A;  1TK5 A;  5D4L A;  1UFK A;  3ETM A;  1RHR B;  3GFZ A;  4WCE Q;  3DLJ A;  1S1W A;  2OPP A;  1I1G A;  2ZE2 A;  1RKI A;  1ZAX A;  4IKA A;  3MAQ A;  2DNL A;  5IV4 A;  2JZ5 A;  4HVZ A;  4K0K F;  3S1T A;  4B9N A;  5IOL A;  1TK8 A;  2FJE B;  2MLZ A;  4C11 B;  1URR A;  1RT1 A;  1TMM A;  3IAM 9;  4P2M A;  4IH7 A;  5D0E A;  3AJD A;  2OIH A;  3LH2 S;  2IBK A;  3CXC R;  3H2V E;  5I3Q A;  1TKD A;  2FJA B;  2E5H A;  3D3B J;  3UN5 A;  1S99 A;  4FBT A;  3HHL C;  3OXG A;  2VFR A;  2DVI A;  4TLR A;  5DDQ C;  1TMJ A;  4X4R A;  4DX8 H;  4HT5 A;  1T94 A;  5D78 A;  3BBF A;  1WWH A;  2G9O A;  4R5P A;  2KT2 A;  2LVW A;  3ENV A;  3BRE A;  1LFP A;  3E01 B;  2IRU A;  1CC7 A;  1F3F A;  5E3C A;  3DYA B;  2IA0 A;  3V81 B;  2WSE C;  3QFW A;  5CCL A;  2P9G A;  4WFZ A;  4OZ3 A;  1H6K X;  3ETO A;  3VR1 A;  5HQL A;  1Y3J A;  4H4O B;  4ZLJ A;  1NUE A;  3HHD A;  2GJI A;  3MED A;  1NCL A;  1NSA A;  2KHC A;  3KUE A;  1REV A;  3RRG A;  1UTA A;  1K73 T;  3MPU B;  2VZ9 A;  3QRQ A;  3Q86 A;  5KG0 A;  1TL5 A;  3WIV A;  5CAB A;  2LXI A;  1RT7 B;  4GRS A;  3D6H B;  1UET A;  5B0G A;  1CQM A;  2XMM A;  1B7F A;  5CYM B;  2N4C A;  3CMQ A;  5M2R A;  3D0I E;  4DFK A;  2RSQ A;  2GQ2 A;  2J8A A;  5HRO A;  5J2M A;  2QMW A;  2GMH A;  3JTN A;  3EZ5 A;  4DF4 A;  1MSW D;  1G7C B;  3CCQ S;  1HMV A;  3IM8 A;  1M1H A;  1S59 A;  4C11 A;  4DR7 J;  5LXY A;  5K20 B;  4LSZ B;  2B0G A;  3N01 A;  2Y9H A;  1PAU B;  5FDL A;  1IN0 A;  2Y1R I;  4DPO A;  1UVJ A;  4HLB A;  1WC0 A;  3HD2 A;  4AXI A;  3Q23 A;  1XNQ J;  3CJ3 A;  1X4E A;  2HAI A;  2HIQ A;  4DPW A;  2VFV A;  2XYP B;  4WXO A;  4IH6 A;  3Q8R B;  5DQG A;  3C15 A;  5E2Q A;  1L3K A;  1FKA F;  5A76 A;  2XMU A;  2DXD A;  3ZXW A;  3E01 A;  3IRX B;  2ROE A;  2MDA A;  2KFZ A;  3OTO F;  4Y3C A;  3FUY A;  3DYA A;  2QL9 B;  2X3G A;  3V81 A;  1UPM B;  1HNX F;  2HVE A;  1OO0 B;  1FJ7 A;  1LWF B;  2ALZ A;  2VOO A;  2B4P A;  3UWT A;  3ADA C;  4WIQ A;  4E98 A;  4FP9 A;  4J91 A;  1NLK L;  2IYI A;  3JTP A;  1EB0 A;  1KD1 T;  2QIF A;  4LF7 J;  2E1P A;  3D54 A;  1U24 A;  3PRV A;  2B8P A;  2NSC A;  4LF2 A;  4U8Y A;  2MKY A;  4IO9 Q;  4PR6 A;  1RT7 A;  2B5J A;  4KFB B;  5C42 A;  2HQ3 A;  2L08 A;  2UXC J;  4DWI A;  3DRX A;  2F8M A;  5GAH U;  2EC0 A;  3PRD A;  4KKO B;  2JLF A;  3MFI A;  2ZUG A;  2WBR A;  4WBF A;  4YS2 A;  3TP2 A;  2I9S A;  4WFB Q;  5LSO A;  1NRK A;  2M0G B;  3VVU A;  4JI4 J;  1N5Y B;  2QGF B;  2EI5 A;  1F9E B;  3MPV A;  2AJ0 A;  2M8H A;  3NBP A;  4DV3 J;  4N5S A;  4ZCM A;  2JOQ A;  2CNL B;  3RJM B;  2MZ1 A;  3NWR A;  2HW3 A;  1U2R A;  3LTO A;  4TYB A;  1C1C A;  2EFG A;  3SSR A;  4P7V A;  4J9O A;  1VFJ A;  4MYT A;  1SQF A;  4F0K A;  1ELO A;  3M9O B;  3TVZ A;  4RX6 A;  4KQZ A;  1S48 A;  3ITH B;  3M8Z A;  1RCX B;  3JSY A;  3H25 A;  2UU9 J;  2FJW A;  4FF4 A;  5LMU J;  3FRY A;  4DF8 A;  1EAY C;  1UEU A;  1IR0 A;  4NA1 A;  3Q2S C;  3IRX A;  2RNE A;  2PMZ D;  4HTI A;  1VYA A;  4KHP F;  1D9A A;  1F5A A;  1URN A;  4TN2 A;  3ONQ A;  2WON B;  5B0B A;  5B08 A;  4NXM F;  4LRD A;  4JBC A;  3A8E A;  4ED5 A;  3C2P A;  2Q66 A;  1EKR A;  1SKS A;  4M8L A;  4MH8 A;  4C3M A;  4F4Z A;  2KKH A;  4NZ7 A;  5ITH A;  3FZB A;  4Y2A A;  3C8Y A;  3NS5 A;  3KMQ A;  1S9G B;  4H4M B;  2Y0S D;  4NLS A;  4D3H A;  1D09 B;  3IC1 A;  4KKO A;  3KLI A;  3HFZ B;  4EK2 A;  2YNF B;  3BSN A;  5F8L A;  3KUG A;  2KG0 A;  2GAG C;  1IKX B;  3D0G E;  2X7I A;  3L3C A;  1U45 A;  2HQF A;  3PX6 A;  4YR3 A;  1PIE A;  4LMZ A;  2YKM B;  4LF6 F;  3QWP A;  5D0G A;  2H5I B;  3ISZ A;  1EET B;  4LIW A;  3A8K A;  2ZH7 A;  2XGP A;  3C16 B;  2HK3 A;  3ITH A;  2IM2 A;  2DEJ A;  2M2B A;  3DU6 A;  2LEC A;  2HHQ A;  4PCQ A;  3RBD A;  3PW0 A;  3LWL A;  1BWE A;  4DCP B;  1M5V C;  4K5R A;  2IM3 A;  2JFD A;  3SCJ E;  2DGX A;  1V3Z A;  4OQJ A;  2ZWO A;  3B54 A;  2PA3 A;  1TVR B;  1HBO A;  4TNO A;  1T9V A;  4F0H A;  2HVH A;  1RUS A;  1XBW A;  2R8G A;  2DNP A;  1E6V B;  2R2R A;  4B3S J;  4MJK A;  4MFB B;  2WON A;  3UN2 A;  4CH7 A;  1TV6 B;  1YLX A;  5DZ6 A;  2J8S A;  2QA1 A;  3LOU A;  2BE2 B;  3NGT A;  2M88 A;  4RJV A;  3US5 A;  2IVF B;  5C5J A;  3P8B B;  2ZJR Q;  1J5O A;  2WB4 A;  3GTY X;  3QSI A;  1NZA A;  2CDR B;  5KFG A;  2MQP A;  1RDR A;  2O01 C;  5H9E J;  2F8E X;  4BLG A;  1R8P A;  3M8P B;  1R7I A;  1RAA B;  1QSS A;  1S9G A;  4H4M A;  3SV3 A;  2FHJ A;  1DQ9 A;  4KV8 B;  1YBT A;  1NK8 A;  1SV5 B;  5E7O B;  1LXN A;  5HI7 A;  1APS A;  4N47 A;  1M5H A;  2JRS A;  1SJ1 A;  1N32 F;  2ZH2 A;  1HWK A;  1RT6 B;  1X8D A;  2KT3 A;  5KOX A;  1S6P B;  4OZJ A;  1IKX A;  1K1S A;  4FXW A;  2AT1 B;  5F0W A;  2IYG A;  1XER A;  5A2Q U;  3DLH A;  4QIW D;  4M5L A;  2YKM A;  2D3Z A;  2RJZ A;  1RAH B;  3AFG A;  1EET A;  3M9M B;  1RTD B;  1EZZ B;  4FF3 A;  1XNR J;  2QLF B;  3LO3 A;  2M5Y A;  4CH1 A;  5DG9 A;  3HHK A;  2C3O A;  4GKJ F;  1T8E A;  4PG7 A;  1YZ7 A;  2RHS B;  1QLN A;  4NLP A;  4IFY B;  3MR5 A;  4XO0 A;  3HHL D;  3THV A;  2J76 E;  1IVZ A;  1HQE B;  4C98 A;  1FES A;  5KG4 A;  4NPO A;  4R25 A;  3BO4 A;  1RAC B;  1TVR A;  3CC7 S;  3AOC A;  3HHL B;  1RWP B;  4NA3 A;  4QBU A;  4MFB A;  1U0S A;  4P71 A;  4C3L A;  2DPI A;  1K0V A;  1Q53 A;  1TV6 A;  5GAE I;  1S1V B;  1C4C A;  1RP5 A;  1T05 B;  2BE2 A;  2OPQ B;  4LRA A;  3LP0 B;  1EQM A;  1JKH B;  3PFE A;  2FDN A;  1VR6 A;  2KT5 A;  2BKP A;  1F1B B;  3WQP A;  1AT1 B;  4OZ2 A;  3FQK A;  1FEH A;  3M8P A;  5L1I A;  3MTJ A;  1KOO A;  4KV8 A;  3M8Y A;  5KFZ A;  1SV5 A;  3SFG A;  2NUU G;  1NO8 A;  1FNX H;  2CJK A;  1FXL A;  4USW A;  3NGK A;  1IKY A;  1FWK A;  1RT6 A;  3G87 A;  3T1H F;  1S6P A;  4F25 A;  4DPX A;  4DR6 F;  3TAQ A;  2MY7 A;  2EXU A;  4B9M A;  1X60 A;  3QAE A;  4F4Y A;  3QFH A;  4AD6 A;  1P1T A;  4UY8 5;  1S6Q B;  2CJ9 A;  1R3N A;  3LAL A;  2X51 A;  4OZN A;  1RTD A;  3TX8 A;  1IBL J;  1FA0 A;  3VZH A;  1UFW A;  5A8W B;  1N33 F;  3UDC A;  4NLT A;  4DPY A;  4M95 A;  4QOT A;  2FC8 A;  4IFY A;  5J2N B;  1HQE A;  3PRB A;  3VQT A;  4WZQ A;  1RLD A;  1FE0 A;  2ZDO A;  3MHY A;  2G2Z A;  5SUH A;  3T5K A;  2NXN A;  1DAX A;  1F6T A;  3IG1 A;  3UD5 A;  3UR3 C;  3HHL A;  3PIP Q;  4ETX A;  1D3W A;  1S1V A;  5EX0 A;  3FNN A;  1JWW A;  4F4X A;  4USI A;  1JKH A;  1JLQ A;  2VG6 B;  2VAS A;  1QAI A;  1KTQ A;  4A8W A;  1ZBT A;  3CF5 Q;  4EBE A;  4PWW A;  3CJS A;  2NLW A;  2RRB A;  4LUB A;  4ZVT B;  4ER8 A;  1YX2 A;  2BKO A;  2D3O 1;  2VF3 A;  4ENO A;  3LAK A;  4RPF A;  5C24 A;  1TR0 A;  4UQG A;  1OQ6 A;  1UAW A;  3HDS A;  3FKB A;  4BWJ A;  2R7X A;  5HMW A;  3O5T B;  1HBM B;  4DV4 F;  1HL6 A;  1YZ6 A;  5KFQ A;  1WC5 A;  1U09 A;  4Y65 A;  4OJ1 A;  1O8B A;  5HLF B;  4MKY A;  5HQ8 A;  1OQ3 A;  2RHQ B;  5JMN A;  2HLU A;  2QLX A;  1S6Q A;  2XBP A;  2HGN A;  2AW0 A;  4FKY A;  3H40 A;  3IWN C;  2QC3 A;  3IR7 B;  1GTH A;  4GC7 A;  3VAM A;  2AZ1 A;  5A8W A;  2W9B B;  4RW6 B;  2JFK A;  1C4A A;  2DB1 A;  3IRW P;  4CLU A;  3DI6 A;  2GHP A;  4FBU A;  2KYZ A;  4USM A;  3PY8 A;  4OJ3 A;  2A6M A;  1WDD A;  1GMV A;  3G8Q A;  2VG7 B;  2VD3 A;  5K14 A;  4KSE B;  2MPU A;  4ECV A;  4DPT A;  2BQU A;  1Q8B A;  4RNO A;  1OJ4 A;  3G6V A;  2FHO B;  3L7P A;  2O5D A;  5BXI A;  1WUU A;  4E2F B;  3HM9 A;  4WJB A;  2VG6 A;  9ATC B;  1IQT A;  2DRB A;  2UXB F;  2JEG A;  5IXU A;  2ZNY A;  5LJ5 Y;  2P6T A;  2B3T B;  1DZ5 A;  3KLE A;  3KYL A;  4ZVS B;  4ECZ A;  3GIM A;  1FRK A;  4NLX A;  2A10 A;  3MEG B;  2A0F B;  2F4V F;  3IGN A;  2MHN A;  3BZQ A;  1RHQ B;  1TQL A;  2GQQ A;  2YNH B;  2H4W B;  3R8Y A;  3GJT B;  2B6A B;  2C2N A;  1HBM A;  5LL6 d;  2DYA A;  4DL5 A;  3F73 A;  2AP6 A;  1N6Q B;  3T1A A;  3CJ2 A;  2Y8Y A;  5HLF A;  1R8B A;  1LQ9 A;  4DV5 J;  1N4L A;  1WOP A;  3D6F B;  2Q6B A;  1ZAW A;  4OX9 J;  3CCR S;  4XPC A;  1M90 T;  3WX4 A;  4DQI A;  4CO4 A;  2PO4 A;  4QIE A;  4WU3 A;  2ADB A;  2WVE A;  4JI1 J;  2W2O P;  4FNI A;  2W9B A;  4UST A;  1PYO B;  4RW6 A;  3SDE B;  4ZPT R;  1WC6 A;  4IQM A;  2MST A;  2BAB A;  1KDN A;  1VC5 A;  2M70 A;  2WHO A;  4AL5 A;  3CJT A;  1XTZ A;  1RAI B;  2NXC A;  2VG7 A;  1W2B R;  1Q79 A;  1ZPV A;  2NSB A;  2DIV A;  2MKJ A;  2YPY A;  3PEH A;  2MKC A;  1V6H A;  2CNK B;  3M8Q B;  1VMB A;  5LM7 E;  4MIB A;  3MR3 A;  1SKU B;  2X1G A;  4KAI A;  4YB7 A;  2CPX A;  1KTV A;  4MT1 A;  3TWZ A;  3HVR A;  1ZZN A;  3W63 A;  3BV8 A;  1UPP A;  3Q89 A;  5KFH A;  2D41 A;  4OHZ A;  3QID A;  3P5T L;  4UTG A;  2XMK A;  2QA2 A;  1U1O A;  5CZV A;  2JVO A;  4DX7 A;  5L8R C;  2OPR B;  2CUY A;  2V8H A;  1WC4 A;  5LSL A;  4JI0 J;  4B3O B;  2OI2 A;  3UNY A;  3NWG A;  3MEG A;  4DV6 F;  3WIU A;  1S4F A;  9RUB A;  2M4M A;  2XLJ A;  3ZNU A;  3OL6 A;  2HBY B;  1C0U B;  3POT B;  1Y5L B;  5DGB A;  1NAQ A;  2LQ8 A;  4A48 A;  1N6Q A;  2DHG A;  3F44 A;  4IYQ A;  4KH0 B;  2GML A;  1I94 J;  4R0E A;  2N7Y A;  3MD1 A;  3AHP A;  1T3O A;  4KHP J;  1LK7 A;  1FWL A;  4DLG A;  1RXO B;  5B0C A;  3HJV A;  2E29 A;  2CYY A;  3SDE A;  5J2P B;  1K8A T;  1YRX A;  1F60 B;  3BQ0 A;  4NXM J;  1FF2 A;  1SXL A;  2OEM A;  2F5G A;  2XNR A;  3BGL A;  2IJR A;  3GR0 A;  1QVF R;  4RNF A;  4AXJ A;  2CQ4 A;  3MMC B;  2OO4 A;  4NLY A;  4X4U A;  1YJV A;  2ZH9 A;  2OUG A;  3CDB A;  2W2N P;  3KLG B;  2AU0 A;  2VBY A;  1HD0 A;  2DXE A;  5KT4 A;  4H54 A;  2ZOG A;  1U1L A;  2CPY A;  1LEO A;  2NS1 B;  2H4Y B;  4DV1 F;  4FDF A;  3H0P A;  2X1B A;  4NLO A;  4Y00 A;  1QAJ A;  1KSP A;  2W7O A;  4OX7 A;  2F7V A;  4OYM A;  3HJF A;  4DX5 A;  3QJJ A;  4RUA A;  1WNE A;  4HDG A;  3ISN C;  1NK0 A;  4KJI A;  3T6B A;  1H98 A;  1LK5 A;  1A7G E;  2OD4 A;  1XK8 A;  4M5G A;  4A4J A;  5F0U A;  2ZOM A;  4B3O A;  5CZX A;  2EEY A;  3ZC4 A;  2IFX A;  4QJV A;  1DY3 A;  1UJ4 A;  1C0U A;  3WBZ A;  3POT A;  2EW9 A;  5D4P A;  1S6U A;  4QR2 A;  5I42 B;  1J2V A;  3WDO A;  1WF2 A;  3UFC X;  5E3P A;  4F3O A;  1AZS B;  5JVH Q;  3PVX A;  3HX9 A;  3KOA A;  4JYA F;  2EVZ A;  4DSF A;  1U47 A;  4A8F A;  1GAO A;  2V63 A;  1OYE A;  1IBM F;  1RA6 A;  3GR1 A;  2D74 B;  2D9O A;  2I6W A;  1U1K A;  1NPR A;  4ECW A;  2KYX A;  4HAC B;  2D69 A;  3CCW A;  3EE3 A;  4RW7 B;  4K4Y A;  4MYU A;  4B3R J;  2QMX A;  2G0J A;  5BYQ A;  2P5V A;  4USK A;  3MMC A;  4IQX A;  2PI4 A;  3AOB A;  3VGU A;  4LRB A;  3KLG A;  4RUC A;  2CVE A;  5E3A A;  2UUB F;  4ID8 A;  2IIH A;  3BH6 B;  2BVZ A;  5AJ3 F;  1Q16 B;  1VQP S;  5CHC B;  1K9M T;  3UCU P;  3RU0 A;  2R2T A;  4KRW A;  3T9N A;  1QVG R;  3W1Y C;  1YSJ A;  4ZPC A;  4P7T A;  5DQI A;  4DQP A;  3DXB A;  3EDR B;  4W98 A;  3AAW B;  3ZZR A;  4UY8 T;  4ZCI A;  2EBG A;  2QLW A;  5T7L B;  3HD1 A;  2KL8 A;  2AKW B;  1KFD A;  1FDD A;  3GU0 A;  1BY9 A;  1YDL A;  1SC1 B;  4DV7 J;  4F02 A;  1YRU A;  5KFF A;  1TAU A;  2MQ8 A;  2J0S D;  4ANE A;  5H9F J;  4XIU A;  3MCM A;  3W3S A;  4UW2 A;  1DJ0 A;  3D4J A;  4USH A;  1S0M A;  1UL3 A;  5I42 A;  2DNG A;  4P74 A;  2ZBC A;  1JLE B;  3PYE A;  4P75 A;  4M63 A;  2NPI A;  1WDT A;  4DUZ J;  2AJ1 A;  1BUX A;  3KHH A;  4L72 B;  1RT4 B;  4OI2 A;  3ELH A;  5FLX Y;  2JC0 A;  1WSV A;  5C7P A;  4DV0 J;  1NBE B;  1XWL A;  2BJ3 A;  4ZVG A;  4IUF A;  3GIJ A;  1JLA B;  3MCO A;  3CJ0 A;  3MWB A;  3J7Z 5;  2P9C A;  4MKA A;  4ES2 A;  3X3U A;  1D8Z A;  3Q2T C;  2V50 A;  4IRD A;  3PHE A;  4RW7 A;  4O23 A;  4WFA Q;  4OIX A;  4EYH B;  3E2E A;  1JXE A;  4LFA F;  3IXQ A;  3FFI B;  4JI8 F;  3UQS A;  5IFM A;  3CVK A;  3D0H E;  2XS5 A;  3I4P A;  2ZJP Q;  1UVM A;  4LF5 J;  3CC2 S;  2C2M B;  1LW2 B;  2BOP A;  3FEY B;  4QIF A;  1YJU A;  2RU9 A;  3JSR A;  1GK8 A;  1PAE X;  1WC1 A;  2W4D A;  2E44 A;  2HHH F;  1RQ0 A;  5THW A;  2HPU A;  3K8W A;  2B7C B;  4OX8 A;  5T7L A;  1FFS B;  5GME A;  4DV2 J;  2AD9 A;  3LF0 A;  4U7C A;  4NRT A;  3ULH A;  3K7R A;  1FTC A;  4TQR A;  2HK2 A;  3EGZ A;  4DZD A;  4R8U B;  3K5P A;  1HFE L;  4CRJ A;  1ARO P;  3CJ4 A;  1X0F A;  1Q95 G;  3NLC A;  4JI5 F;  1FRL A;  2MQM A;  1JLE A;  1VQ8 S;  1YJT A;  5HQM A;  1P1L A;  4TYA A;  5I3P A;  4KH1 B;  2GC8 A;  1RJJ A;  1U8W A;  1JLA A;  3IMQ J;  2CAD A;  3OPK A;  1NJX A;  2OHD A;  3FBE A;  4YY3 F;  2IAJ B;  1HKA A;  2OKQ A;  3LAN A;  3D66 A;  5J1E A;  1S76 D;  4K4T A;  2NQP A;  2GNK A;  1YJW S;  2BAN A;  4K4V A;  1LFW A;  3BSA A;  1GNK A;  2UUA J;  3ZZO A;  1JNZ B;  3FFI A;  1TL4 A;  2MQN A;  1R0A B;  4DU8 A;  3M2V B;  4PG8 A;  5GAH I;  2XY5 A;  2A18 A;  3R6G B;  2BJE A;  1B3T A;  1RAJ A;  2PMH A;  5DG8 A;  1N36 J;  3KK1 A;  2C3P A;  4RNN A;  4OI6 A;  2BJ1 A;  1LW2 A;  4X65 F;  1SIW B;  4FF1 A;  1PSD A;  3C3L A;  1T11 A;  2ZOF A;  1R27 B;  2HNY B;  4F04 B;  4K59 A;  1WHY A;  4LVN P;  3KMS A;  2QL7 B;  2W24 A;  4PAA A;  1XEZ A;  1RTZ A;  3MF5 A;  3TEG A;  1B7Y B;  3ZFV A;  1JLC A;  1MWZ A;  3G2X A;  2ABY A;  2F4F A;  1FRH A;  1V9O A;  4M1K A;  4JI2 J;  3SCL E;  2R8I A;  2V34 A;  1RI7 A;  3TZZ A;  4IG0 B;  2Z58 B;  2CZ4 A;  2LQB A;  2R7V A;  4Y2M A;  2WW4 A;  3AA8 A;  2C2E A;  1F9F A;  3MM6 B;  2ZZM A;  4WFY A;  1TKZ B;  5J2Q B;  4MIA A;  1Y5N B;  3OQ2 A;  3DMJ B;  4P73 A;  2IRX A;  1U7L A;  3V4I B;  1YBA A;  2HMI B;  4Q45 A;  2JJ4 D;  2Y8W A;  1WHX A;  2FLN A;  5D0R A;  1U48 A;  3BGF A;  1P6T A;  1YRT A;  3KK2 A;  2VIH A;  3ZO7 A;  1FEE A;  2CPZ A;  2KXF A;  3RAM A;  2X1F A;  4EBD A;  4O0I A;  2DR7 A;  5M2U A;  4KTQ A;  4HR2 A;  2GMJ A;  1RTJ B;  3MI7 X;  4AL7 A;  4WTO B;  4X64 F;  5KFK A;  1HA1 A;  2OGU A;  4CZC A;  4ICL B;  2PMW A;  2YKQ A;  4USU A;  4CLL A;  3OV7 A;  4AE5 A;  4YHH F;  4X4O A;  3W7B A;  2Z2M A;  3IWX A;  2VA3 A;  4ZMM A;  1SH3 A;  2HQG A;  5F3T A;  3M2V A;  2KZZ A;  2CZ9 A;  4RU2 A;  5F8H A;  1SCJ B;  1B70 B;  1X5P A;  1BC6 A;  3OR2 B;  1KVI A;  1EAR A;  2ZM6 J;  5KG2 A;  2XHW A;  1YJ7 A;  1JJ4 A;  2HNY A;  1UZD A;  2F4V J;  4WP9 A;  4XAK A;  2Z2Z A;  1AB8 A;  2W8K A;  1CJK B;  2ZJQ Q;  1M5P C;  1S0O A;  2VBX A;  1NJY A;  4PZV A;  1S1T B;  2AGQ A;  2APO A;  2L9N A;  1MN7 A;  1SQE A;  2AF6 A;  2H65 B;  2AEF A;  3T19 A;  2XI3 A;  1IR2 A;  2E7W A;  2LQ5 A;  3QSY B;  4IG0 A;  5C2G A;  5GAE U;  3B82 A;  3R1L A;  1NDP A;  1RA7 A;  2HRU A;  3IGV A;  2WBM A;  4CYU A;  3W2V B;  3TQ1 A;  3MM6 A;  1HHT P;  2XC9 A;  1QUP A;  2AZ3 A;  1TKZ A;  3DRP B;  2WVF A;  3DMJ A;  3DKD A;  2CIM A;  2QMU B;  3HFK A;  3V4I A;  5HVH A;  1Y11 A;  2HMI A;  5M2P A;  3T6J A;  3D6M B;  5E33 A;  2QL5 B;  1PC5 A;  3ENQ A;  3AB4 B;  5KG5 A;  2W4C A;  3DRS B;  4BWM A;  4U7U D;  5GAG I;  2BA9 A;  4LFC F;  2FJB B;  4DMZ A;  3ZTQ A;  1QJH A;  3RB4 A;  1S1X A;  3P3D A;  3CJR A;  2RAQ A;  2QX0 A;  3MOZ A;  2ACY A;  2N4D A;  3RG6 A;  2FIU A;  5HMZ A;  2XS7 A;  2C2R A;  4ZK7 M;  4P6Q A;  1ITP A;  4Q8F A;  3EXY A;  1G1X A;  2M7S A;  1JQG A;  3B6B A;  3SXL A;  5ETP A;  2DR9 A;  3N0V A;  2FJX A;  2VU5 A;  1RYS A;  2I5J A;  2VJV A;  3CED A;  1RT3 A;  4ICL A;  3EZO A;  5A6W A;  3JTO A;  3GJR B;  2RF2 A;  1IUJ A;  2VPY B;  4OYO A;  4DR4 J;  4HT7 A;  4DXL A;  3IAS 9;  2E5L J;  1DTT B;  3ILJ A;  4G3I A;  2W4P A;  3Q24 A;  3CCV S;  3GP9 A;  5A8R B;  5CCM A;  1F2G A;  2FJV A;  3G86 A;  1JLF B;  1MN9 A;  1FVS A;  4I6A A;  2MKH A;  1CJK A;  3N9U C;  1DLO B;  1G4C A;  2CQD A;  4I2Q B;  2UUC F;  2D3O R;  2V69 A;  2ATL A;  4IOA Q;  2FPH X;  1S1T A;  2OP5 A;  1HI0 P;  1Z4U A;  1HAR A;  3R7S B;  1FDA A;  4AQY F;  4C6A A;  2J9E A;  5KFB A;  1RK8 A;  4EMD A;  4X4P A;  1QE1 A;  1VHF A;  2LU1 A;  4B3M F;  4B17 A;  3TA1 A;  3W2V A;  1R6V A;  4PG6 A;  1FDN A;  2RUS A;  4CO3 A;  1WD6 A;  3MTK A;  3MUT P;  3OJU A;  4LR8 A;  1YI2 S;  3RZA A;  3G8T A;  2VQF F;  3IBC B;  4F67 A;  1X4G A;  4YB5 A;  3TJA A;  2Z57 B;  4DR2 J;  1OY6 A;  3DRS A;  3E51 A;  1TZ0 A;  3OBI A;  2RQ4 A;  1D9F A;  5HVG A;  3W5X A;  4ID5 B;  1JLG A;  3A8J A;  2PFD A;  3BPS P;  2VA2 A;  2RS8 A;  1VIX A;  1U4B A;  4JI6 F;  2KVI A;  4RW4 B;  2BQR A;  3TJ8 A;  2XO6 A;  4DR1 J;  5KFN A;  1HW8 A;  4LF8 J;  3N28 A;  5ADZ A;  4X66 F;  4B9S A;  3OVB A;  1QSY A;  3VV2 B;  1Q7Y T;  1GEH A;  2YNI B;  4F36 A;  3VVT A;  3TVY A;  1P9Y A;  5AXN A;  2Z30 B;  1Q78 A;  5A8R A;  1F9H A;  4ZHR B;  4KIA A;  1PC4 A;  3DM2 A;  2GO9 A;  1WEL A;  1DLO A;  7FDR A;  4C97 A;  2DNZ A;  3TRG A;  4NWB A;  3A12 A;  2HIY A;  4I2Q A;  1YVF A;  1VS3 A;  2MTL A;  2ZBQ A;  1ZTT A;  3WC0 A;  4LF4 J;  1NH8 A;  2BUN A;  1RWX B;  3MUR P;  4WFN Q;  2XB2 D;  4Q44 A;  2H48 B;  4YDX A;  3Q22 A;  4MK8 A;  3B4M A;  3J7Z T;  1RBA A;  2WW8 A;  1X0P A;  2LMI A;  5KT5 A;  1FJG J;  4TY8 B;  2QTW A;  1SKW A;  3K17 A;  4DCO B;  5ETS A;  4FXD A;  1IM6 A;  2Q6C A;  2V94 A;  1T3N A;  1C2P A;  3OLA A;  3M2R B;  3VAF A;  1WAC A;  4FYV B;  2DNK A;  2B9E A;  3PTW A;  4J5O A;  2MZR A;  1MNE A;  4EI2 A;  3AA9 A;  4IR1 A;  2J0W A;  4URQ U;  4ID5 A;  1TL1 B;  5IT9 U;  2QO3 A;  1IBK F;  1JNR B;  2BOA A;  2HRT A;  3D5M A;  2HG4 A;  1TAQ A;  2UXD F;  5KTQ A;  3G8S A;  1AW0 A;  1FWP A;  1RZM A;  1FE4 A;  2DNO A;  4CCH A;  1U02 A;  1RB0 A;  3R9L A;  5DG7 A;  4ZPB A;  1VQ4 S;  5BYR A;  2A2D A;  4M5N A;  4YME A;  4TKT A;  1VBX A;  3GMG A;  2RDD A;  1VC6 A;  4NA2 A;  3JAM Y;  4DR3 F;  3I87 A;  3VGV A;  3OTC A;  7FD1 A;  2GFF A;  1VLY A;  2L48 A;  3S8S A;  5E0O A;  1ZM4 A;  2R3V A;  5EWE A;  4ZHR A;  1GXT A;  4ZJO A;  1YJ9 S;  5G0R A;  5KOW A;  2DGQ A;  2PD1 A;  4WTY A;  3SCI E;  2JX2 A;  1JIH A;  4I4B A;  3KDO A;  3TW0 A;  3TNV A;  3GON A;  3KHG A;  1RT5 A;  3O8W A;  3R7B B;  2ZFH A;  3BKU A;  1XIQ A;  4TY8 A;  1SC4 B;  3BGU A;  1R43 A;  3QZ8 A;  2VON A;  3TUP A;  4O3N A;  1RKJ A;  5GAD U;  3NNH A;  4C4W A;  3GIR A;  3BR9 A;  2ILZ A;  2ZBR A;  3Q8Y A; 
#chains in the Genus database with same CATH homology
 4WP9 A;  4UST A;  3C16 B;  1AB8 A;  3C15 B;  3MAA B;  4WP8 A;  4OYX A;  1CJK B;  4OYI A;  1WC6 A;  1WC1 A;  4OYM A;  4P2F A;  4CLP A;  3UVJ B;  1TL7 A;  5IV4 A;  3G82 B;  1CJT A;  1U0H A;  1WC5 A;  4OYZ A;  4NI2 B;  4CLZ A;  2GVD A;  4CLS A;  3C16 A;  1CS4 B;  1Y10 A;  5D0R A;  3C15 A;  5D15 A;  3MAA A;  1FX2 A;  1CUL B;  1CJV B;  3C14 B;  4OZ2 A;  4OYO A;  1CJU A;  2GVZ B;  4WPA A;  4P2M A;  5D0E A;  3G82 A;  4CLW A;  4CLY A;  4CM0 A;  4OYB A;  3ET6 A;  3MR7 A;  1CJK A;  1WC3 A;  4USW A;  3UVJ A;  1Y11 A;  1TL7 B;  4USV A;  1CJT B;  1U0H B;  3R5G A;  2WZ1 A;  4NI2 A;  4CLU A;  4USU A;  4CLF A;  4CLL A;  1YK9 A;  2GVD B;  1AZS B;  1CS4 A;  2QV6 A;  5IV3 A;  1YBU A;  1CUL A;  1CJV A;  3C14 A;  5D0H A;  4P2X A;  2GVZ A;  4OYP A;  1CJU B;  4WP3 A;  5D0G A;  4CLT A;  2W01 A;  1FX4 A;  4OYW A;  1WC4 A;  4CLK A;  4OYA A;  2BW7 A;  1YBT A;  1AZS A;  1WC0 A;  4CM2 A;  3ET6 B;  4OZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...