3ETQA

X-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3etqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3etqA02
2ET7A 3TNPB 3KMHA 4HVOA 1CX4A 2PTMA 2V09A 1YFYA 4I09A 4O9GA 5CU1A 3I54A 2OYZA 1CAUA 2WFPA 4JTOA 2UY8A 1NZCA 4E2GA 3CL1A 3H50A 5J3UA 5D1IA 5KHGA 4MUVA 2GH2A 4LUMA 4E2SA 5LEKA 3UKNA 4MGKE 5FQ0B 2BNMA 4IEVA 4LA3A 4H7LA 5I0UA 5AVPA 5I91A 4KU8A 3ACLA 2IXIA 4XF0A 1UIJA 3RPQA 4WBBA 2IC1A 2Q4SA 4IEQA 4Z82A 2EAAA 4KWJA 1SQ4A 5FDBA 3U0ZA 3PNAA 4BHPA 1RL3A 3ETQA 3CEWA 4XFAA 2FQPA 5E1RA 3EO6A 3WW4A 5I0SA 2UY9A 2Z69A 2XHKA 3CF6E 1SFNA 4I01A 4DINB 1EPZA 5JSPA 4WZCA 2EA7A 1UCXA 1FT9A 2O8QA 1SEFA 4KWKA 3BU7A 3MZHA 1ZZ7A 3U11A 1X8MA 4KU7A 1IPJA 3OF1A 5CVRA 2ETEA 2PFWA 2IXCA 1Q3EA 3LA7A 3KGZA 3EHKA 1OFNA 3UKVA 2PAMA 1CAVB 1YLLA 1G6NA 4XFHA 1YUDA 1IPKA 2ET1A 1DGWA 4HSJA 2MPFA 2Y0OA 3H7YA 2XLAA 3EQEA 1LR5A 1LB2A 4IEUA 5J48A 4EWDA 3I59A 3WW2A 4EWAA 1O3SA 1RUNA 2IXJA 3FWEA 5FPXA 4ONUA 4UBHA 4TLFA 3SCFA 2ZCWA 2O1QA 1WA4A 2GC2A 3MPBA 4ZU7A 3WW1A 3IIAA 3NVCA 4QXKA 4HVQA 1RUOA 4RD7A 4XFIA 4YSFA 1VP6A 4LA2A 2XLGA 2BEOA 1LKNA 3HT1A 5KBFA 4R8HA 4MZUA 3B02A 1J58A 2N7GA 3BALA 5JR7B 2XLFA 3EBRA 3E6CC 5JAXA 3E6DA 3H7JA 2QVSB 1EY2A 4HN0A 4XF9A 4IEZA 4NVPA 4PIXA 4PIYA 1ZRDA 3L2HA 2D93A 2PAKA 3RYKA 2GC3A 4FBFA 5K8SA 2GC1A 4BH9A 3KCCA 4P9GA 1CAXA 1J3QA 3NSTA 3U10A 1ZZBA 4XF1A 2OA2A 3CJXA 4XFBA 3NKTA 4MGYE 2XGXA 3BPZA 3JZVA 2PAEA 2XL9A 3S7IA 2UYBA 2BYVE 3G7DA 2C0ZA 4Q0UA 2GU9A 1EP0A 1WLTA 3M3IA 5F1RA 1JUHA 1L3JA 1I6XA 3RNSA 4XF4A 4CYDA 3E97A 3HT2A 1LRHA 2VQAA 1VR3A 1YFUA 4XFFA 1Y3TA 3ST7A 1ZRFA 1EYBA 1J3PA 1J59A 4YNIA 3S7EA 1NE6A 5EFUA 5I93A 5JCTA 3SCHA 2D5FA 2IXHA 3MYXA 1CGPA 3E5QA 3GBFA 1CAWB 3ES4A 4IEXA 3FX3A 4JV4A 3DV8A 2MHFA 3USSA 3NL1A 1DZTA 5EZWA 4EROA 4BYYA 5C8WA 1O3QA 3IDBB 2CAVA 2QJVA 4Z07A 2D40A 4Q0QA 4IEYA 1CAUB 4XFCA 5I0TA 2H0VA 3SHRA 1RTVA 3DN7A 4ZU5A 5I8YA 4E2QA 4MV2A 5FQ0A 3DL3A 5LRSA 2HKXA 5KHIA 1ZRRA 4I2OA 4K8FA 3IWZA 1YHFA 5BV6A 4HBNA 1Q5OA 3OD0A 2XL7A 4X6RB 3QOPA 3HIFA 5JSRA 4MGIE 1YFXA 5BY5A 4Q29A 2QNKA 3LA3A 3H3ZA 4JTNA 1DZRA 3H1MA 4I0AA 1Y9QA 3RDIA 5JSOA 3WW3A 1OD5A 5KHHA 1X82A 5FCCA 1XE8A 3VHRA 2PHLA 4HZFA 1ZNPA 2MNGA 1J1LA 1PM7A 4HVRA 3MDPA 1ZVFA 4AXOA 2H6CA 5FLHA 3NJZA 4ZU4A 4O9EA 3FE5A 4UBGA 4F7ZA 4AVCA 1O3TA 5I8TA 3LA2A 3SCGA 4LEJA 3I7DA 3N4MA 3C3VA 3OCPA 4PJYA 2H6BA 3SMHA 2PYTA 3EJKA 3H9AA 2PQQA 1YFWA 2OZ6A 4OFGA 4KWLA 3TNQA 4N9HA 1I5ZA 3GYDA 4MH0E 4F8AA 3D0JA 4XETA 2B5HA 3KGLA 5LRRA 1ZREA 4I0BA 1OI6A 3O14A 4Q0PA 1NYWA 1QWRA 4UXAA 3UKTA 4WVZA 5HI0A 1TQ5A 1NE4A 2QDRA 4JVAA 1X8EA 3ZDSA 4L11A 3H1WA 4HMZA 3RYPA 4YARA 4Q0SA 3S0MA 4XFGA 4AQ6A 1FXZA 3I59B 3E5XA 2CAUA 4XEZA 4LULA 3HQXA 4LUKA 3D82A 1ZRCA 4QMAA 4I3PA 3FZ3A 4QX5A 4R52A 2Q1ZB 1O7FA 4BIFA 4I02A 1XRUA 4AVAA 3FHIB 3H8UA 4QM8A 1GQHA 1CAVA 4MGZE 4L2NA 3ELNA 4FT8A 2OPKA 4XF3A 1ZZCA 4LTAA 3KSCA 2Q30A 1O5UA 4N9IA 4J1XA 1UPIA 2Z2SB 1DGRA 2ATFA 2PHDA 4Q0VA 4YYOA 3BCWA 2WC2A 5FLJA 5LEJA 5I0RA 2I45A 2VECA 4J1WA 5T3NA 4YRDA 1UIKA 4EV0A 3LOIA 1ZZ8A 2PA7A 1O4TA 4QM9A 5BXXA 1V70A 4HLTA 3CLPA 1ZX5A 2EVXA 4QGNA 1WGPA 4D7SA 2GZWA 2K0GA 1PMIA 4QGLA 3M70A 1H1IA 4IEWA 5BUVA 3IDCB 2OZJA 5KHKA 5J7MA 4D7TA 1RGSA 1U12A 4AQ2A 2ZKLA 3IBMA 3QACA 4GULA 1J3RA 2UYAA 2Q0AA 1CAXB 3LWCA 3ROUA 5CADA 1QY4A 4X6QB 1ZZ9A 1OMIA 3H3UA 4IETA 1FI2A 3H1YA 2HJIA 2BNOA 2QCSB 3E6BA 2DCTA 2F4PA 5KHJA 3DKWA 4IERA 3OGJA 4IESA 4META 5BPXA 2CV6A 1YWKA 3PLQA 3R6SA 5FLIA 3D0SA 4FAHA 2FMYA 2CGPA 1Q43A 1QXJA 1HW5A 2BGCA 3NW4A 5FPZA 4LLOA 4FAGA 4A2UA 1RC6A 3ES1A 2VPVA 3E5UA 2KXLA 3LZZA 1X7NA 1O3RA 4MX3A 2GC0A 4PIZA 3LAGA 2K9ZA 4KL1A 3RYRA 3BB6A 3FFQA 3OTFA 2XKOA 5E16A 4OLLA 5C6CA 1NXMA 1XE7A 1ZZ6A 1QXRA 1O5LA 2P17A 1VJ2A 4QGMA 3CO2A 4ORFA 2B9UA 4IEPA 5I8SA 3PVBB 4HN1A 2GAUA 1CAWA 4B29A 1GQGA 3SXWA 2XKPA 4AVBA 1UD1A 3FJSA 1H1MA 2D5HA 4HSLA 4IEOA 3RZZA 2B8MA 4EWEA 2IXLA 2IXKA 2E9QA 1UW8A 2BNNA
chains in the Genus database with same CATH superfamily
4XVHA 4HVOA 4XUOA 3IAQA 2JVDA 3CJIB 4FLVA 5F7UA 1UF2C 3I2GA 1UWWA 5C3PA 1U5ZA 1N34B 1XYNA 2Z3YA 3CRMA 2B7YA 5K4LA 4QPKA 3FX7A 3K03A 3ALQA 5LZ6A 1OURA 5CFCC 1PVC1 2OWOA 1SA0B 3OGGA 5E1RA 2LUWA 3QBQA 2HWC3 3EO6A 2A3YA 4WM8C 2Z69A 4FTEA 4XAEA 2EA7A 1TA8A 5APAA 2EZPA 3CC7V 3POBA 1V6NA 5DN2A 2P7TC 2AZ2A 1W39A 4EZ4A 4UXNA 2NMNA 4NRMA 1GZTA 1MQTA 2ZXWC 4N43A 2ZA9A 4O4JB 1YIJV 3AMHA 4BXSV 1LB2A 2VTFA 3LEKA 4Y33A 4EB6B 1N3PA 1HJGA 4XXAA 4CCDA 4DV4O 1YC61 1W8NA 2GN7A 4CA9A 3ETGA 1ZBE3 2O1QA 4LF4B 3TEWA 3CB2A 5DMYA 1NZIA 1BKZA 4R8HA 5IWAO 2N7GA 2AZ5A 5JAXA 2VAUA 2W6IG 3OEEG 1EY2A 2RV9A 5F37A 5K0UB 4X66B 4PHZA 2PMWB 3I3EA 4NO4A 4DEQA 2GC1A 2LQTA 2OVUA 4RGKA 4MVRA 3TN92 1ZZBA 3SLIA 2DQ3A 4NIIA 3BPZA 4CDWB 4N53C 2P2KA 4DK0A 3DXRB 4X66O 2R041 1QEXA 2WN2A 3OEBA 3W59A 2VJXA 5M0TA 4Q20A 1QOOA 4XCAA 2BYVE 3ZIXA 4QX3A 4HANA 4Q0UA 5F1RA 1JUHA 3HD8B 2X10A 4CYDA 2PHFA 3RWRD 3X2QC 4PD4F 4LK7A 3W5MA 4D0QA 1NE6A 1IBMB 2E75B 3BODA 3VKOA 3CMAV 3WD5A 4J9ZB 1K12A 1VQ4V 2A71A 2MHFA 4MVUA 3ZR5A 1GQPA 1GMGA 1PK6C 1W6MB 1N4CA 2FKXA 4DS0A 5T5JA 1PM9A 3DPRA 3ABKC 1ZYBA 2XHBA 4BK4A 3VZJA 2ARCA 1ZRRA 5F2WA 2WQ8A 3N7LA 1JJOA 3MIDA 1RFYA 1H8HG 3I97A 1Y9GA 3SJCC 3ZN6A 4DIQA 4YJ2A 2Y4UA 2ZDIA 1JMKC 1ZTEA 4CCKA 3VBUA 1JZ4A 4I9QA 1ASJ1 4WFBV 1KC8W 1KUQA 1YQCA 1JYXA 1NBMG 2QA4V 4BQWA 1SLCA 4JPRA 4HOOA 4UBGA 4PQ9A 2KG7B 3B2EE 3I7DA 2HWB2 4DV7B 4AFDA 4KFMA 4YLZA 1B35C 4DR7O 4K1ZA 1T5EA 4J41A 4IGPA 3O14A 4LIVA 1V6MA 4IV3A 3OBAA 3UM7A 3FBYA 5JPMB 1MSWD 3LE0A 1OVSA 1Q6IA 2EAKA 5A7QA 2X0LA 4J10A 3ZPYA 1XQNA 3H3LA 4QPIA 3D82A 2QWPB 1H9WA 2GP3A 3UYJA 4Z1VA 1XB9A 2WJSA 5DPNA 3OPWA 4BQ2A 4HKLA 5GZDA 4P02B 3ABLB 1AR63 4FLWA 5C7GA 2XVKA 1N0JA 1W6PA 2XHNA 4MTFA 1SG3A 2L6LA 1UPIA 2Z2SB 3DYPA 2RS51 3E22B 5JZGC 4Z8BA 1RUH2 1TME1 1YTFD 3WNLA 3RQ0A 1QNYA 2VVFA 2RS31 3LSEA 1LECA 1TMF2 1YJLA 1LEMA 4K8XA 2W0FC 1WBFA 1PL0A 4UB6Z 1UO9A 2EJRA 1YTFB 5IJRA 5KHKA 1WMFA 5CG8A 4GZ9A 4AF9A 2WNOA 1D5AA 1ZZ9A 2V4VA 5EYYA 2XJUA 1KP2A 1VQLV 4CH6A 4K8RB 5IJ9A 5KHJA 4WFEA 1ND3B 1LENA 3OGJA 5EC1C 2GMMA 3P32A 4XAAA 2QKAA 1FPN2 3T1YO 2A0LA 3JALA 3IAYA 2GC0A 5AFEA 1IGOA 2CGNA 3Q4HA 2OUJA 4IIJA 3OTFA 5E16A 4OLLA 5JI9A 3R05A 1AL23 2QSAA 2Q8CA 2JDYA 1QBZA 4Q26A 3GF6A 1IBLB 1MOFA 1I9RA 1NCRA 2W46A 3NWKA 5FKBA 2XUEA 3RYCB 2DYSC 2W2IA 3BA8A 4YG6A 3OUIA 4AQYB 3TWIA 4X1IA 2R9RB 1W28A 5JI7A 4MVOA 4B3RO 1QOTA 3O65A 4JI1O 4E2SA 5D5PA 1W05A 1R083 5EIYB 3HBZA 2ZIOA 4KU8A 5FNVA 5JDBA 2PHUA 1J5EO 4YZ2A 5I0DA 2Q4SA 2WWSA 4CP9A 1A32A 2XH6A 1COWG 2JKBA 1R3IC 3D3QA 4CCCA 3ILNA 3UT5B 4U3FH 1SFNA 1A34A 3A0RA 5FY0A 1N47A 1WNSA 4OYUA 1NUKA 2YU2A 5DEDA 3IT8A 4LFBB 5A6ZA 3ASOB 2QWOB 3L72H 5IY5B 4AGRA 4A7ZA 2AR6A 5A7PA 5FY5A 4XZPA 3WG7C 2Y0PA 3ZDVA 1Y4WA 4YVWC 1LR5A 3J9SA 2EX3A 1V6IA 4BQ1A 3I59A 3SYAA 4FPKA 1K8AW 2O0OA 2DCZA 5FZIA 1AXZA 3CKHA 2ZCWA 2HWD1 1M56B 2Q0OC 1RUC2 3N2GA 3B9IA 3OYWA 4R7CA 4RUFA 1KKCA 2PLV3 2KM2A 1ZRDA 4YG3A 1SQPH 2P4EA 4NXMO 1JHJA 5A7WB 3SH3A 3N7MA 4GB32 4LCUC 5IVEA 1N1VA 3WB0A 1F4MA 2CH7A 4FPEA 1HQLA 2WAMA 3OEHG 1YCIA 3M7AA 1DQ0A 3HT2A 1W9YA 4XFFA 3RJ2X 3L74H 2W1SA 3O1UA 5IATA 3Q8AA 3V0BA 4M3CA 3GVMA 4X89A 4Q6GA 4Z1MG 1UX7A 3UESA 3WUDA 4QXCA 3POWA 3ZRVA 5DUXA 1XNQO 5EZWA 3CS5A 5LMNO 2BTVC 1LOCA 4O4HA 3NJYA 4IQPA 2O57A 5E88A 2XPJA 1UOBA 2VZOA 4BZ4A 3K3NA 1AYN2 4HETA 1WAZA 2X05A 3AKSA 1XNQB 1N8RW 4FFIA 2NQYA 1Y67A 1G4YB 4MV2A 4E2QA 4UVCA 2EXKA 4MT8A 2H3OA 3IWZA 3KT4A 1UNBA 3HIFA 1UX6A 3OBTA 3A2FA 3H3ZA 1S4CA 2LGWA 1Y9QA 4OPAA 5J2UB 3JQWA 5JZGB 1XE8A 5EJ3A 4AI8A 1ZNPA 5DAXA 3STZC 3UGGA 3T2QA 2QWQB 5FL7G 1CX1A 2G1MA 3POIA 1DQ5A 3E86A 3I8TA 5FLHA 4Y3OA 2LROA 4O9EA 1Y4MA 2VZUA 3OGRA 1BE3H 2KA3A 3H9VA 2DBNA 3I2FA 2GV9A 4UUJC 2B5UA 1REDA 1OT5A 3AP5A 4XETA 5LRRA 1G86A 2QE7G 4JDNA 4HK8A 4CEWC 4AVVA 1W2BU 3L73H 3MDSA 2HWD3 5EZYB 1GM9A 1VMFA 5CA0A 3UJOA 1H8TC 1NJIW 3GHNA 4CU9A 3HQXA 1JQ0A 3MUZ1 4DY5A 2ZX0A 1XL4A 4LPLA 2CAZC 3J8F3 4RS5B 1O7FA 2RS33 4NIHA 1UU4A 4LORA 4HFSA 4N23A 1KFUL 4E4EA 3H8UA 3SPGA 4FTBA 4MVTA 1NTZH 2GNMA 2MEV2 2JICA 1UOGA 3JQXA 1IQDC 3VBHA 3A21A 5F2VO 4LF6O 3C7FA 1ZZCA 2RHPA 3I2IA 1OFSA 1EV13 1ODNA 2WC2A 4PDRA 4CEYB 4AVTA 3M3OA 3PIJA 1B06A 1RUD2 2HEVF 2PELA 1ZBE1 5CIRA 4J1WA 1POV1 1ZZ8A 2BUKA 3WUCA 2D6PA 2Q7HA 1MS8A 3E8FA 4D7TA 1AL21 3MIBA 1AL0G 1H2GA 4NROA 5H6RA 1SPPB 2WFF2 4IERA 1JU4A 1QJY2 1N1YA 3ZXAC 1MPXA 1YWKA 1YXWA 1FXHA 5CAZA 1OQEA 4AFAA 5A3PA 2R70A 5BMVA 3B4SA 3ZRWB 2RDQA 3VDAA 1H38A 5A2QN 4PJ0Z 3K5MA 4LHLA 4DXWA 4U2AA 2WUHA 5FMBA 1GRJA 4M3CE 3WF2A 1S2EA 3OUSA 4XDLA 4KBBA 3TJTA 4IEPA 3BIEA 4UFZA 3TETA 3U37A 1M57C 3G71V 4GJYA 1AR62 4OZXA 1R1ZA 2P3IA 3KMHA 4DEVA 4XOGA 4D6RA 5CU1A 4RUEA 1SMVA 4IV1A 3J4UH 5J09A 3VD4A 1NZCA 1QJU3 2VH9A 4JYAO 4MUVA 4Y20B 3P3NA 2A6XA 5C71A 4IXLA 1H8TB 4H7LA 2Q67A 5I0UA 2YDEA 1URXA 1UXXX 3ACLA 2OS2A 1AR82 2IC1A 1JZ2A 2VQFO 3TEZA 4YVSB 1VRBA 1SQ4A 3VKLA 3A0HZ 3A0KA 4CTEA 3F7YC 3WG2A 2D6OX 3ZXFA 2WWJA 2ZKOA 5FXWA 3K79A 4RQPC 1AILA 2WNUA 5JOZA 5T5OA 1SQFA 2VQ0A 1QXPA 3K08A 4MTGA 1VAMA 1W2NA 3PDQA 5A32A 5BR8B 2ETEA 4AEDA 2G9ZA 4EE2A 1KU9A 1JOBA 1EV11 2QKDA 4EJRA 1LU2A 3CWBH 4NMIA 1TNRA 2JDNA 1YLLA 1QLNA 4D6SA 3ACFA 3I4IA 5AC93 2MPFA 4A41A 4DUYB 4Y24A 3VBOB 4XHBA 2LFSA 1PNFA 1S0FA 1I94O 1HRV3 3N2KB 3CCLV 5FPXA 4TLFA 1H8EG 5F6KA 2ARHA 4UCTA 4A7YA 1U0AA 2W9XA 2JE9A 5IAVA 3WNXA 2YC0A 3VBRC 5T55A 3ZKYA 3S5QA 2QVSB 5BY1A 4IEZA 1AR61 2AEYA 3RYKA 4CPBD 2E63A 2WT1A 1LOFA 2DVDA 2WKKA 3OM3B 1J3QA 3NSTA 4WCEV 5J1XA 3VL8A 4XUTA 4F6RB 2R1BA 2HHHB 1JYTA 4LC1A 2GP5A 2D3RA 2A06H 5EIBC 4MO3M 4QQHA 2UYBA 5FZ0A 1PP9H 5LOVA 2DW4A 4B4RA 2QM4A 2CNAA 1WLTA 5L7OB 3M3IA 1L3JA 2BERA 2WSUA 4XF4A 3MIEA 5AFBA 2ATKC 5EBLC 2WDBA 5CFDC 2RM23 3RYHA 3AK2A 4C0BA 5J96B 1KQSU 2H94A 4DK1A 3GNEA 1NG0A 5IT6A 1EN6A 2QKCA 4TV8B 2BTOA 4ABMA 3USUA 3FX3A 1DDLA 3DXUA 1DZTA 2ZMKA 2BDRA 1IURA 2H8PC 1K5MC 1L7RA 2CHHA 3VGIA 3VHNA 4DRRA 2ZE5A 3POEA 4DFSA 1ZBE2 2OT5A 1OLMA 4BISA 2JJ6A 4LT5A 1N1SA 3OD0A 1PO11 3MIHA 4MGIE 3JYCA 3UGFA 1STMA 3FAVB 3K3OA 2P34A 4NPRA 2GTSA 3THPA 2UXCB 2OIGA 1Q8QA 4PLMA 2MNGA 1DQ2A 4K3AA 2YFUA 4P9OA 3MDPA 3WX5A 2BSKB 3WDUA 2WLNA 4RFT0 3BTAA 1O3TA 2P06A 1APNA 5DQ0A 3DGEA 1WP8A 3D0JA 1F5JA 3ZYIB 4CS2A 2Z5UA 3C7EA 1OZ0A 1GU3A 1UY4A 1R1BA 1O59A 4IT5A 4QB6A 2J1VA 4JX0A 3GBWA 1S0GA 4O4LB 4PA4A 1G1XB 3CCRV 1L7LA 5ACA1 1NA1A 3J7NA 2CAUA 3JD3A 5FO9B 4HK9A 4TLGA 4Q1RA 2DE0X 1OD3A 3K46A 4COWA 3RZKA 3A22A 4FZ1A 2P90A 4OHVA 5FPRA 1ORQC 2MEV1 5FZ7A 2IW5A 4BIFA 1BCCH 5DAPA 4I02A 2ZAHA 3ZHRA 4FM1A 5JXJA 1VBE2 4XABA 4MTXA 2DCKA 4GH4B 5LASA 4QPIC 4OHYA 1ZL8A 5F5IA 2JG9B 1MMMA 1WMXA 2LS6A 4Q0VA 2P67A 1RP3B 2BOJA 3ZFFA 3K59A 2VMIA 5FYYA 3DGTA 2CTPA 1UYPA 3DSQA 1QHDA 3J8F1 4YM2A 1W8FA 3CE2A 1MNGA 1VRH3 2YG0A 3S57A 4CVUA 5DM6V 4QGNA 1UU6A 5B1OA 3WXPA 2AXTZ 3VDBA 3BUCA 2VXRA 3MV11 2ZNIA 1VMJA 1TME3 1B3QA 3LSUA 3AM2A 5KUKA 1S55A 3KVBA 1WW5A 3AFKA 3H3UA 3H8OA 4RA0A 2XQRA 1SDWA 2F4PA 4BIOA 4OMDA 4DV6O 1BXHA 2AENA 4KXRA 3LDEA 2OQ7A 2EXIA 1DU3D 2JS3A 2A79B 3AXDA 1VBE3 5FZHA 4QXBA 2JRIA 2VMDA 4A2UA 3ES1A 2VO5A 4LF7B 5FYUA 5FYZA 1QJU1 2UXDO 3FFQA 2OXBA 2PYLA 2AHYA 5DG2A 5KAIZ 1RMU3 4CP1A 1AYN1 1OKQA 4R4ZA 1IXBA 2D43A 1WW4A 1BZKA 4BOWA 4YVWA 3VBBA 5D21A 2BZDA 3K5LA 4PQQA 4JI4O 3RZZA 5E1AC 3IM0A 3APQA 1UFIA 3I54A 3B7MA 4BQ5A 4FIPC 4XACA 2OCCC 3PUHA 1QH7A 1Z7S2 1U97A 1HRV2 1S0IA 1PO23 2P3JA 2IXIA 3RPQA 4CDUB 2ZGOA 2RDNA 4IE7A 4YW4A 3FHAA 4KWJA 2JENA 2JGUA 3ZHSA 3URFA 2ZABA 2YFZA 4XFAA 1BQ0A 2ZPXA 4NJ4A 4XJ9A 4LR4A 2OX0A 2CSGA 4KWUA 2WO3A 1HDJA 3V0AB 3SEEA 3VBSB 5FK7A 3MZHA 4BK5A 4KU7A 1GBGA 3OF1A 2ITCC 1OSGA 4D94A 5B5EZ 4AEKA 1NCQC 2VW0A 3HKEA 2IJKA 1AJPA 4JF3A 1K42A 1JFFB 1DYKA 1DQ4A 3C90A 1FMD2 1RUJ1 3GCWA 4HNAA 1PX3A 4XYXA 3V56A 4A44A 4IE4A 4UYBA 2VC9A 4EWAA 2C24A 5H9CA 2EULA 4JYBA 2YGMA 2DCYA 1UJWB 4L8JA 2GC2A 2YYOA 3LCPA 2X6BA 4BB3A 3IN9A 5GTHZ 1F51A 2QFEA 2XJRA 2ZGQA 3THDA 4DOUA 2A6VA 2BP6A 3TK1A 2YMZA 1XMOO 2F66C 5FZMA 1C1LA 2I07B 4BW5A 5K8SA 4BH9A 4CC5A 3I2DA 1Z5VA 2WNVB 1AZDA 4G3YC 1R1A3 5IWAB 1HW7A 3NKTA 3F2ZA 4MGYE 4FPOB 2XAFA 3QCWA 4NXNO 4C91A 1MS1A 3FYIB 2PLV1 3S7IA 4DRVA 3HPLC 3M3CA 3RYFB 2PUSA 1KQRA 4Q4Y3 2QEXV 2XAHA 5J36A 5BXZA 3E97A 4CZSA 3M2MA 3PJSK 3ZFGC 5F9TA 5GZCA 5I93A 4YW3A 3FN9A 4PDLA 4I55B 1Y7BA 3OOXA 4FSJA 1G6UA 2PQSA 3VKFC 2NN8A 1A6CA 4EROA 4X1YA 2FB5A 4JV5O 4B08A 2AC1A 1V9PA 1Y74B 5IVCA 3BYWA 4XC9A 2JEUA 2DWEC 3V65A 4PA9A 1ZA4A 4Y26A 1JTZX 1OXCA 1XNRB 4WM8B 2CU5A 5EYPB 3MUY1 3AZZA 1BMFG 4X20B 5FZOB 5LA6A 4X6RB 2ZGPA 5JOYA 2YXYA 2D3OW 3QF7A 4BLIA 1S5LZ 1H4HA 2W5FA 1YI9A 4Y1XA 3WQ7A 1WCKA 5KHHA 1X82A 5T5PA 2HLDG 3NV3A 1MG1A 2EIKC 1XMQB 3NJZA 5KAFZ 4LKSA 2P5BA 4RYDA 2YSUB 4GALA 2TUNA 1JZ5A 4B3SO 1VQ6V 1V54C 4JAAA 4MGTA 1U5IA 3KT7A 2EILB 4YIOA 1AX1A 1KBHA 5HI0A 1VEWA 3GWOA 3LD8A 4PDMA 3G6BA 1QJU2 2DYRB 1XYPA 1BEV1 2W39A 4B3SB 2VBPA 3T1LA 4NTXA 4KBZA 2P4KA 4GWNA 2JB4A 3GJAA 1AJKA 1L0NH 1ZRCA 3EYPA 2QQMA 5LK7B 1F4HA 3FC0A 4DR1B 3FHIB 1QJX3 3AZXA 4LKDA 4B4QA 4QM8A 4FLYA 4MGZE 2EIEA 3ELNA 5F6LB 3RYIA 1MABG 4DR1O 4CU6A 3JSNA 4Y4RA 3C2UA 2DMXA 3AKTA 3R66A 1ENXA 3ATGA 4A6SA 1AI5A 5I0RA 5CZKA 5IFTA 2PHRA 3ECQA 4F6EA 1LTEA 1XSQA 2ZEWA 2R042 1IPSA 4UVBA 3SYPA 3W7SA 4NTWA 1D5NA 1ZAUA 4JGZB 2GSYA 4LBOA 1QQP1 4QGLA 4CDUC 5IVJA 4I50A 2IBZH 4D8MA 1B35A 2WPDG 1AR1B 1BBT1 1QGLA 1GN2A 4G4FA 1ZBA3 2UWAA 5CYYA 3RI9A 5LATA 2BNOA 2DCTA 5L9VA 4A42A 4QB2A 4FAHA 1PX4A 2ZGLA 1UU5A 5HXVA 2ZHMA 4I0WB 3JD4A 2RMU2 4INDA 4RS5C 1GOHA 3MFCA 3N9OA 3WNMA 4ORFA 2E53A 5I8SA 3ZJZA 4FFGA 5FPBA 1TNFA 2EIKB 3SXWA 3OMNB 3SPCA 4YPJA 1SQBH 1OOPB 2WT2A 2Y6JA 2MK3A 2E26A 4YW7A 1TEIA 4BR6A 1I3HA 1VB2A 1W06A 3PMEA 2A7WA 1S0EA 4G9SB 1CAUA 2YB7A 5E79Z 4AI2A 1JVMA 1BHGA 4LF8O 1IQAA 4AQYO 4XQ4A 3S6PA 5I91A 3G67A 4Q27A 1GOGA 4YM1A 1UIJA 2JG8B 2EAAA 4W50A 4JI1B 1Q8IA 2KQXA 4GKYA 1VBD2 5LYJB 3CEWA 3GHMA 2VRZA 4Y22A 3CJHB 1CJDA 5TSWA 3AK1A 2WLIB 3M99B 5A9GA 4ZHQA 3PU3A 4GKKO 5JSPA 4SLIA 2AACA 2YEVA 1YI2V 4A7KA 5CG9A 5CA1B 2R0FA 4BMBA 1W8UA 1RUI1 3KGZA 2HVJC 3I3DA 4CPBA 5LHGA 3OG2A 4XDKA 5IE9A 2NYYA 1D4M3 2QQPA 3EQEA 4IEUA 1ENRA 5ACA2 1I7FA 4W4ZA 3FWEA 1QJEA 3FUQA 4QPYA 4BIUA 3SJQC 3K2OA 1JX9A 2BV4A 1ZBA1 4XFIA 3N9QA 4NKGB 1ND3C 3HT1A 1FNYA 3FLPA 4QQLA 2MW2B 4JI2B 4NAMA 3KCXA 5IYYA 2Y6FA 1LNSA 4PIXA 4U3JB 4PIYA 2PAKA 4U7NA 4CDXC 4ISRA 1DF5A 1O4ZA 2WLJA 2JWPA 3SPJA 3VHOA 1X36A 4KH9A 4W8JA 4AK3A 4MW8A 4BA6A 2RMKB 2HWF1 3OUHA 4NXMB 4I4TA 3WCSA 2WWUA 1EP0A 4UAPA 5IJ0B 4W65A 5GZGA 4AYUA 5BNOC 1YFUA 5C3RA 2HWF2 1SQQH 4X8AA 3Q8CA 1UZVA 5A33B 4B3TB 3ES4A 1ENQA 5FK8A 1AR92 3HWJA 1SLBA 3CCMV 1N33B 2VE1A 5ABJA 2VNOA 1EZVH 4OQ9A 3IB3A 5LMUB 1V9U3 4FP2A 4LHKA 4CEWA 5FZ8A 2QTOA 1G9AA 2B39A 1YQ5A 4JAUA 3AG4C 4TV9B 1AROP 5FZFA 3WDWA 2FDKA 4YW6A 3UL2A 3RWNA 3MHZA 2XL7A 5K0UC 5FY4A 1V9U1 4RSUA 2VTXJ 4P14A 2QNKA 5FP3A 3L9DA 1K73W 4I0AA 4FCAA 3THTA 3JATB 2YBKA 3WG7B 1RUI3 3VLBB 5JH7A 2YI9A 3T08A 1ZVFA 2EJ7A 2PY5A 3VBFA 1H8VA 3I3MA 1V6LA 4L0PA 3SCGA 5FUNA 3C3VA 3OCPA 3L70H 1JW6A 4IL6Z 4F83A 4X65O 4XQWA 2HYKA 3NXSA 1M9NA 3U07A 4XMIA 3ZFGB 5A70A 5F5CA 4MVSA 5HFLA 2WLLB 2VXJA 5LW9A 3AK0A 5IWFA 3AX4A 1RSOA 4L11A 1V9U2 1VQPV 2UUCB 3OTOB 3KV9A 5C9AB 1OA2A 3WNOA 1DGLA 5IYDO 2P3YA 1QDCA 2AW9A 1UZWA 4UV8A 3ZMNA 3CX5F 1VQ5V 3WNPA 4QXHA 2BE3A 1H0BA 1S0CA 2GHYA 1EN5A 4MSVA 1O5UA 3HN3A 1JH5A 1OCCC 2Q8EA 5JXIA 1H2SB 5FZDA 2LW7A 4BPZA 2Q69A 1HNWB 1T2XA 1KD7A 2TBVA 2WN3A 2VCCA 5GONB 4QM9A 1O4TA 2VZ3A 5BXXA 1OPOA 1J83A 5EPAA 2YUEA 5EBWC 4J11A 2ZEYA 4LBLA 2F43G 4GZRB 2FYUH 1FPN3 3IDCB 5E89A 4Y1UA 3WP3A 1NCQA 2VOTA 3D36C 1QY4A 4J7KA 4H55A 3TRSB 3VL9A 2QCSB 3E6BA 1GANA 5LP6B 2C26A 2ZINA 1AR71 2LP7A 3CRQA 5FZ9A 4DR6O 4Q8KA 1WLCA 2CGPA 5FBJA 2QJ1A 4D3WA 1XPWA 1BK0A 4ZONA 4MX3A 4JAVA 2VNVA 3P5BA 2A3WA 4XXPA 1XYOA 1FXKC 2WO1A 4DV1O 5ERLA 4QPGA 4AFBA 1WZXA 2Y6KA 1VJ2A 3MW2A 1EFRG 1LGNA 5F3IA 3VZOA 3BU0A 4OI4A 2VNGA 3LDKA 1GQGA 4QE7A 1PVXA 1FFXB 3NMBA 4HSLA 5FYIA 2JG9C 4XUQA 2IXLA 4AEMA 1ROPA 3AG7A 2RR12 3W58A 5IK4A 3CC4V 4I09A 3AMMA 3KLSA 5FPLA 2QQVA 5IAXA 5IVYA 4MXVA 4XUNA 1UYXA 3RVHA 5FZGA 1GLHA 2PHTA 1R6TA 5FYSA 3OR6C 5C4WA 3NJVA 2R062 5FPVA 1T6GC 3OGVA 1QKQA 2F95B 1C8M2 4P30A 1W9FA 1WB7A 3ABKB 4ZZ5A 4EN8B 2Q5ZA 4HZ3A 4JTCB 1PGSA 2EINB 3T30A 5JPNB 5HCFA 3ETEA 2XJVA 2IVJA 3PMSA 4NRQA 5ANNA 1UCXA 3CZJA 5CKNA 5ITZA 2BGPA 1VBC2 4J7ZA 4QX8A 1IPJA 5KC6A 5CVRA 4S2HA 2PFWA 4DV0B 2F4VB 1W6NA 5C8CB 3M7MX 3NAPB 1MZ5A 4CUBA 4FPGA 1MZFA 2Q5TA 2XVLA 4DXSA 3AL6A 5J48A 3T4DA 4BIZA 4UF0B 1Q8VA 3SISA 4HXCA 5A7NA 3HQUA 4MVMA 5JUVA 1LOFC 4XIOA 5DDJ1 4FZ0A 3JCZA 4FPYA 2RS11 2HP8A 2OCCB 4YSFA 1VP6A 1CIYA 1QJX1 5HPOA 4E27A 2XLFA 1NQDA 3GGLA 3KD4A 1GP5A 3J80N 4OUEA 4BMEA 1K5MA 3LEIA 4FFHA 2QQWA 1BMV2 3I5DA 4QX7A 3U10A 1JI6A 1GO3F 3P30A 2FDIA 5H6QA 4KGQA 3JD71 4OUSA 2XONA 4N43C 3HKDA 1JZ7A 4Y5TA 4UCOA 3G7DA 3BTYA 5B3SB 4Q4Y2 2W95A 1RM1C 5IY5C 1WCUA 4DR2O 1DQ6A 1B09A 1J1TA 3S7EA 4QGPA 3EHBB 3SYQA 2ZX4A 4Y1VA 1NI8A 4I5SA 2ENRA 2WZEA 5H9QA 1FYJA 2FZ2A 3RRDA 4YW5A 2G9FA 1CQ9A 5C8WA 3K0DA 1CR7A 3OY8A 5AVAA 3SNMA 4FOQA 1PO21 4KG0A 2QJVA 4COYA 3CC2V 3JBG3 2DVGA 5H9PA 3QG5A 3RBZA 5KX5A 2OW4A 2VGDA 4XIKA 5FQ0A 1CPMA 2HKXA 2VZPA 2ZAAA 4O4IB 3N36A 2VCAA 3AG1B 1AI7A 1RHI1 5B2GB 4R8CA 2ZX3A 3HKCB 4TUYB 5BZBA 1VQOV 2AH2A 3JAMN 4YY3B 5CISA 1K33A 3OSDA 3CCEV 1UY1A 3R4SA 2FDGA 1NKGA 5FPOA 1RUE3 4V2WA 4JYYA 1BQZA 4KI5M 3PJYA 4ZU4A 3FE5A 1I5PA 2VUCA 1DGRN 2DN9A 4FOVA 1LOEA 1VP7A 2KD7A 3ZSLA 5CFDA 2FMLA 1CWPA 3IKWA 1V6KA 3SDLA 3DPRC 1OCRB 1JJ2U 2W92A 1XBLA 2UXXA 5DDJ2 3RG0A 5IVVA 4LH7A 4FXKB 1XNCA 3IC9A 1NZ6A 1HR0O 1HNXO 2VOXA 2DUPA 4XJ8A 4AVSA 5K1PA 2ZDIC 4Q4W3 4ASMB 2N74A 4DV3O 1DQ1A 1VBD3 5H2FZ 4N43B 3ZMZA 3HNYM 1P8JA 3JCUZ 2FTKA 3KSCA 4N9IA 4EN0A 4FO9A 5FZ3A 3C7GA 1Q8SA 3ASOC 3BFRA 4EB6A 1EPWA 1KGYA 3X2QB 5DG1A 4GAZA 2ZCEA 1W2UA 4ZZ8A 1AR93 4NHMA 2NNUA 3KCYA 3EFFK 1U96A 1RPRA 5BUVA 1U12A 2DJVA 2Q1MA 5HFMA 4CCNA 1LHOA 5CADA 4UI9L 3WG4A 1XU1A 4CDWA 3JAWB 2FCUA 3ILFA 3ZSKA 1OC1A 2CYFA 4IYIA 2NLJC 1CJPA 1FYUA 3OJBA 1HNZB 3SJAC 1Q8OA 1ACCA 5JIAA 1D2SA 3TYJA 3FYEB 1CZSA 4SBVA 2N05A 1LAJA 4QGMA 1HNZO 2GAUA 4LBQD 3OUFA 4WVMB 1RHI2 4B3RB 4AVBA 3FJSA 5CKMA 3I2KA 4IEOA 4LF5B 2BGOA 3T0AA 4CUAA 1RUJ2 2XJTA 1W6MA 3UO2A 2PTMA 1FJGO 4O9GA 3I2JA 2OYZA 3DPRB 1ASJ2 3H50A 5D1IA 2QDOA 3J81N 4OVEA 4OQ8A 1E1QG 1H2NA 3MLKA 1US6A 3FL7A 2R16A 2W0XA 4MXWB 3POSA 4J7JA 1IS5A 3CSXA 1SS3A 1PK6B 5BNOA 1OCZB 2NMOA 4JGYC 5FP8A 4K0KO 3ZN6B 3ETQA 4YJ2B 1TUBB 2Y0IA 2CDOA 1KDMA 1AJOA 1VF7A 1T6BX 5CB4B 3ETPA 2OYQA 1EZJA 1Y76B 4QD2A 1WD3A 2RS52 5F32A 1UKRA 2JEXA 5ABJC 1V6OA 2FDJA 2RDSA 1YRZA 3T2PA 3U11A 1XSRA 1X8MA 1MACA 2RS13 2D6LX 3AKQA 3BTXA 1AYM1 3JB4C 2J1SA 3WZ1A 1FXKB 2D97A 1OFNA 2BQPA 3N9LA 2PAMA 1CAVB 3ABMB 2PHWA 3PN1A 4IV3B 1W3VA 1W9TA 4U36A 2IU0A 1DF0A 1AP5A 2Y0OA 1KMIZ 3ZR6A 3B69A 3MHSC 2IUWA 3ENRA 1SLLA 3APBA 2Q4PA 1RUD3 2X29A 1H9PA 1MZ6A 5HV4A 2R6QA 1COV1 3J8F2 5JQGA 4LFAB 4QXKA 2JECA 3IZOA 1RUOA 1QU0A 4XHXA 1HV0A 1LKNA 5KA6A 3T1HB 2VS0A 5F5QA 3SQOA 1WP7A 2KKWA 4P9WA 5LXTA 4W4KA 2RVAA 2QQJA 1W6PB 4FBFA 1B6QA 4R50A 2ITDC 3CRRA 3KCCA 5FY9A 4CUGA 3E22A 2YIAA 3T1HO 3UK9A 2P37A 4GT1A 1QR8A 1W0JG 1F2NA 3TCUA 1J84A 1W8ZA 3M8AA 2B1IA 4JI6O 4Q8LA 2JGDB 3QD6A 1SRYA 3CNAA 4CDQB 1H6YA 1VRH1 1L8DA 1W8OA 1IOAA 4P5YA 3INAA 4UCUA 1EAH3 4YM0A 3S5AA 3K0GA 4NXNB 3RNSA 3H1HH 2VQAA 2YXSA 4RHV1 3VBUC 1G7YA 1J3PA 4JI8O 4HPKA 3LPGA 1WWYA 2E7QA 1UMIA 2JDZA 1CGPA 3UETA 4JC1A 3TN91 4IEXA 3UNPA 1ND3A 5CN0A 3SGIA 2Y6HA 4RHV3 3B8NA 2V72A 4GMP1 2CUGA 5EBMC 2R0HA 4JGYB 5LCWL 4XFCA 4RL7A 5I0TA 2JE7A 3AVSA 3BVOA 2D2CB 5CBHA 3ABLC 2Y6GA 1XNTA 4P2ZA 4AILC 2VQEO 3VDCA 3KQRA 1WMDA 3RYCA 5F5AA 1DZRA 3VQXA 3WF3A 4JQTA 1HQNA 2R1DA 5FPUA 3Q8EA 4X1IB 3E35A 4KHPB 3ZHUA 2JEMA 1AYM3 5JVDB 1ZM1A 1J1LA 4HG6B 1PM7A 3VZKA 4XZUG 3MHHC 1LOBA 1UY3A 2JB8A 5I8TA 3LA2A 5KXBA 2H6BA 5FNVB 2JDPA 3KT1A 3LGRA 4R9BA 3TNQA 1XI1A 2Q68A 2CTVA 4FFBA 5JXHA 4CP9B 3UCSC 4RGAA 4A3XA 4EN9B 5AC91 1MR5A 5FP4A 1C4RA 3VBFC 1KJRA 4RQFA 3JBG2 1BGYH 2Q7GA 4XJWA 3GB7C 1X8EA 2HWE3 4E4DX 3CU7A 1H1AA 1S72V 4LULA 2WAAA 3S3WA 3GJBA 1OHHG 3D5OA 3MAQA 2C1FA 1XRUA 4YGDA 4LITA 3RS6A 1ND2B 4UW4A 5FYBA 2VMCA 1YIFA 4NR1A 4I3GA 2QWRB 5IDJA 1OF3A 2X5IA 4M0NA 4A45A 2JS5A 5CBGA 3E2EA 4DR5O 2Q30A 2RE9A 4GJZA 4NHLA 2PHDA 2VVDA 5FLJA 5LEJA 5FLXN 2NM1A 4AE2A 1ONAA 2WLKA 1E1RG 3WHUA 3R65A 1IBKB 3CHXA 2LO1A 4YM3A 2JXAA 4UFHA 4CU8A 3THOA 1VBD1 3ZX7A 3N2GB 1KB9F 3OYWB 1H1IA 2GNDA 5A3MA 3UGHA 5EWSA 2FDHA 3RZHA 4Q4V1 1PGL2 3HKBB 3SKJE 4QHBA 2EIMC 3QLQA 1M06G 4QT6A 5BPXA 1N36B 2CH7B 2LW8A 1SQVH 1QMJA 2VPVA 4YZ1A 5FZKA 3E5UA 3LZZA 2CTWA 2W47A 3OGIB 3WP5A 4KL1A 3ZXEA 1WCQA 1AJNA 4CUCA 1JUIA 1XE7A 3ZXGA 1QXRA 1OUXA 1O5LA 2QZ2A 4JI7O 4M3CB 2A73B 4DXTA 1UYYA 1WW7A 1LNQA 4LH6A 2JK5C 4G28B 1A3KA 3WY6A 1N32O 2LM3A 5BYNA 4DV2O 4XILA 3DECA 4CH4A 5L7OC 3I2HA 2DUQA 2B8MA 4P08A 1CP9A 2IXKA 2E9QA 2ZHNA 4AVAA 2ET7A 2A5ZA 4P9PA 4BW9A 1VRH2 1V54B 3OGSA 2V1DA 1GWMA 2OUHA 3ORJA 4PA7A 2QZ3A 1EV12 1S5JA 4MGKE 1JR9A 3K04A 5BNNB 5B1BC 3NNFA 4XF0A 5LY2A 1KEXA 1FV2A 2XQXA 5J2UA 2RDRA 4CCLA 5A1FA 2ZXQA 2WWWA 2LJ2A 4I01A 2DFCA 3D3AA 4PI2A 4YFZA 5FYHA 2XB6C 3OE7G 1HB3A 4PBOA 2QQKA 1VMGA 2IXCA 4WM7C 2QDNA 1K4CC 3C8XA 3PURA 4GKKB 5KUMA 1WLEA 4DZGA 1IS3A 1R64A 1DGWA 3WQ0A 2Y33A 2YY1A 5FO8B 4DW1A 5EZYA 5CA0B 1BBT2 4MGSA 4QPJA 3ME2A 3JUUA 1KS5A 2ZR3A 1NTKH 3DEMA 3SCFA 1ZBA2 5CEHA 5IFPA 1MQTC 4ZU7A 4HVQA 4AHWA 5LP6C 1S0VA 5KBFA 1OCOC 4J25A 2ZE6A 5L3GA 4NPLA 1AI6A 5GTIZ 1F7YA 4XF9A 4C1WA 3LB9A 2M7WA 2IVIB 5DDJ3 2ODMA 5FV3A 1CAXA 1FD9A 4CSWA 4CEYA 4TQDA 3CJXA 3TN93 4JI2O 2WS91 4AHXA 3AP7A 3HVDA 1JPXA 4AEJA 4CXYA 1UQXA 3VD9A 4L9BA 3T09A 1S0DA 2ZHKA 3ZYHA 3NKGA 2C0ZA 1XBFA 1I0HA 1RB8G 1RYYA 4CCJA 5HCBA 3JD73 1YHQV 4DR3O 3AG2C 1RMU1 1VBC3 4ZOLA 3AG3C 1BBT3 2CGOA 2IXHA 1SPPA 4UW3A 1DZQA 3VD5A 4LBMA 4IYHA 5K1XA 1SHWB 1UKGA 2ARXA 1IX9A 3QO5A 1PNMA 4BYYA 1C8M3 2CAVA 1GM8A 3W7WA 5BMVB 4M01A 4LR3A 3W7UA 3J7LA 1CIWA 2BFUL 4IEYA 4DPNA 3IDAA 2RJZA 1N33O 3CP1A 4C0HA 4FVVA 3LNMB 1AYM2 3ASNC 4O2BB 5LRSA 5KWRA 1UL9A 5KHIA 4WFGA 1XXNA 4K8FA 3ACGA 5LMUO 3QOPA 5A7SA 4TZDA 4BQXA 4NWVA 3PVOA 1QJZA 4CEYC 3ZFEB 5FZEA 4GMP3 1HKDA 4XTPA 5BNPB 2VMEA 4F3JA 2YBPA 1AXYA 1H8TA 4MG2A 1M57B 2HBUA 4LEJA 2AUYA 3EJKA 3GXUA 2BBVA 1M5IA 4YVSA 2JDKA 1DYPA 3ICXA 4PCRA 1OI6A 4QKNA 4PDWC 4X1KB 1VBB2 4X65B 4NIAA 1JU3A 1JOJA 1S0JA 1BJQA 2XDVA 2J1RA 2WINB 3KV6A 4QX5A 1BHAA 2HEYF 2ZD9A 5A32B 4ISQA 3A7QA 4AEDB 4DUXA 2P6JA 4GB31 5EQUA 3OMAB 4UFJA 4L2NA 1W6QA 5HBAA 1IKQA 4XF3A 2Y4TA 1TGOA 5DAWA 4QQ2A 4YYOA 5J9PC 1AJQA 3N2KA 4OI2A 4LIUA 3AG2B 1RPOA 5CBFA 3N9PA 3VDDA 4EV0A 2D7FA 2OTLV 3GZUC 1UPSA 1VLNA 3M4FA 3AVRA 5FZBA 5JJEB 2FCTA 3BPSA 1A8MA 1BEV2 4B4PA 5HXMA 4TOIA 2YS8A 3A23A 3K4ZA 4AQ2A 4XBLA 2ZKLA 3QACA 4HYOA 4Y4YA 4X6QB 3WF1A 2RS53 1DFQA 1Q7YW 3AG4B 1FATA 3KWVA 2E32A 5DUUA 2KSDA 4META 3VBRB 2UXDB 1HXS3 2RG4A 3LIHA 2WA3A 4X9QA 3R4DB 1RC6A 1DLCA 1O4YA 5J2TA 2HJDA 1I08A 1YNAA 5CFCA 5JLVA 2RCVA 4QJFB 4YFWA 4JI4B 3N9NA 3ZSEA 1ZZ6A 1X50A 3O1SA 5A3LA 5B66Z 1DGWX 2EZOA 4TN7A 4TV8A 1X9TA 5GLZA 1N34O 3MBWA 3N9MA 2V09A 1PNKA 4B8EA 1NOVA 2WFPA 3MEPA 1JZ6A 2A7AA 3D36A 5KC5A 3A4UA 4E2GA 1OCRC 5EC2C 3UKNA 2ZQMA 1AB3A 3UT0A 3MW4A 4IEVA 1QDOA 2W52A 4PBPA 2G38A 1HQWA 1OH3A 1H30A 1TE1B 1SETA 5FMOS 4IEQA 3PNAA 1CZTA 3TBDA 1N3QA 4EKWA 4LBKA 4WFFA 2FQPA 4BDVB 1BQPA 1Q81W 4ASKA 1EAH2 3FB7C 1JYIA 2XHKA 3T0BA 1RITA 2JJ1G 2AZ0A 2C5DA 2BSKA 1CXZB 5FMDA 1ZZ7A 4JDOA 1Q3EA 2HWC1 2Y8KA 3FUOA 2B46X 4U7OA 1X9PA 4DV4B 4X88A 5GJ6A 4IGOA 4LF4O 5B4XA 4AL9A 3KQ4B 1CESA 1O3SA 4LFCO 1WW6A 4OPHA 1XMOB 4MSWC 4JRAA 1JZ3A 3WW1A 1Z2GA 5KXCA 2ZGMA 2GTAA 2O14A 2BEOA 4PF1A 1R6NA 5BNNC 4AAPA 1QQP3 3JASB 3H7JA 4MVQA 4OI1A 1LR1A 4GH4A 1O9HA 1I5YA 3VV1A 1MS9A 2LRPA 5FZ1A 4ZKIA 1GN4A 2E51A 3JD72 4LMFA 3ZFFB 1U5XA 3CXHF 3IMMA 3K48A 3JZVA 4IHJA 4QKDA 3B93A 4URTA 5JOWA 2VZTA 4RQPA 3SPHA 2HYXA 3T2OA 4AR2A 1TMF1 4KUMA 3ZXDA 2ZMNA 3L71H 2ZM6O 3QH7A 2AGAA 1VR3A 2VOKA 4JV5B 1N0NA 3CXCU 4BQ3A 3NRUA 3ABMC 3VQVA 1L7QA 3KF3A 3GCXA 2FBEA 1CAWB 4H13B 1Q86W 1W0OA 3WLUA 5FZ6A 3DV8A 4CC6A 4J80A 1R093 4CP2A 1O3QA 3AYDA 3EB7A 2IJJA 3WOGA 3T3YA 4JASA 4FFKA 1AX0A 5JMOA 4ATEA 2H0VA 1V55C 1XDCA 3AKRA 4CRQA 5KMGB 2ZGNA 3M8LA 5JCOA 4Z2AA 4BU2A 1Q5OA 2A6YA 1S0BA 1BL8A 1YFXA 4K6BA 1SLAA 3BEHA 3ZMTA 4W4LA 1QJX2 1XMQO 3RDIA 3PUQA 1RUG3 2GH8A 1M90W 1XQ8A 2Z42A 1RMU2 4GWJA 4JRLA 4I30A 2TNFA 4NUBA 3NNLA 4YY3O 4AVCA 2GN3A 1IXMA 1LJ7A 2UWCA 2W91A 3K9AA 1JCHA 4CDUA 4KWLA 1I5ZA 1E5IA 4GX0A 2F1MA 2G4IA 1GYKA 2WBKA 3J7MA 1R092 5A6QA 1D4M1 3I55V 4XDJA 4QHOA 3ZN0A 1XNBA 2QGNA 3ZDSA 4DR7B 4XFGA 4AQ6A 3E5XA 3OPZA 2DVFA 4I3PA 4R52A 4K1YA 4CXWA 2TEPA 4P5HA 2Y64A 2G19A 5GLWA 1YQ8A 2ZACA 4FOYA 1AR4A 4NAOA 1FFTB 1GP6A 1HR0B 3LIGA 1VPHA 2KR2A 4ASLA 4HNAB 2VM9A 4XBNA 4Z92B 3K58A 4NTYA 1TVKB 2QM7A 1OLQA 1NLQA 3O12A 3O7OA 4J42A 1RUJ3 5T3NA 1UIKA 3DXTA 3ZCCA 1ZSPA 2EVXA 4I9WA 4D7SA 4Y5SA 4XUPA 3O9OA 2BPA2 1D2QA 4FPHA 2EIGA 4QQPA 5IYZB 1OA4A 3H1YA 3RZGA 3N35A 1R082 2WS93 5A6YA 2WO7A 2CWMA 4WV8A 4ZXKA 2OTJV 2ZKNA 1WA8A 4L99A 3FBMA 1ULPA 4ZY9A 2X5IC 1RUF2 1QXJA 1HW5A 2X6AA 2CWSA 3LEGA 3RYFA 4LLOA 3T4HB 2VWJA 2KB1A 4BJ0A 4QU1A 3LF7A 1C8NA 3LDDA 1ND2C 4LO8A 1VQKV 4IGQA 1HJFA 1PVC2 2VBDA 1XE0A 3K75B 4LO5B 4I55A 2F23A 4FJCC 1AHSA 4IUGA 5IVBA 1ALYA 3FHQA 1HIXA 1E5HA 4X1YB 2XWJB 2J1AA 2QR4A 2R063 4LXLA 2YICA 2QQIA 4FPLA 4HKOA 1Y74A 2HG5C 3JBG1 5A3WA 5CMUA 3J7AU 2EILC 5H9SA 4ZXEA 2IJHA 1SBDA 1W9SA 2GH2A 2RQ6A 4ET7A 3BI3A 5EYPA 4LA3A 4NYKA 2YGLA 5AVPA 3DF0A 5LA6B 2UUBB 3WNNA 2GDSA 4GX5A 2ARAA 3JD2A 2C9AA 4FXGB 4AOCA 4MTOA 1MS3A 1R081 1J5EB 2YU1A 1SZTA 1AUYA 2UURA 3NV2A 3FB8C 4ZI7B 2BOIA 3JAKB 4YJ3B 1NVPB 2Y60A 4LBJA 2ZZJA 2Q9LA 2UU9B 1L1FA 5IHRA 1DG6A 1W0PA 1IG0A 4MOAA 3DYMA 4FPCA 4XFHA 4LNVA 2HJFC 2A6ZA 2QWNB 1D4M2 2V5DA 5LWBA 1XOUA 2Z4FA 5KA5A 3N3HA 1XU2A 2ZS6B 3F5WC 3BRCA 4A5UB 4FK5C 2IU3A 4QDQA 2XWBB 1Q82W 4ONUA 3RJRA 4WBNA 4GD4A 4LHSA 5FYVA 3MPBA 4YZ4A 1MA1A 1R1A1 5FXZA 2VNRA 2D44A 2IWGB 1KRIA 1DYOA 3JARA 3L2HA 1JYCA 3RYIB 3OW2U 1D7PM 4GXLA 4PA6A 5C5UA 5JJJB 1MS0A 3GM8A 5CKQA 3CCSV 1UPGA 4LNUA 3KZIZ 3ML0A 2F4LA 1OLME 3WFVA 3WVJA 3QO7A 4UW6A 5T50A 5D8AA 3W20A 1WD4A 1O8PA 3T2TA 4DXZA 1R091 2XL9A 3IAPA 3BAAA 2P5OA 5LBFA 3THCA 1BCXA 2FDFA 4JGZA 2DWRA 2HEPA 4B3TO 1VQMV 4CDXA 3MF9A 1LULA 1OUSA 4R9AA 3KZ4C 1B35B 1Y3TA 1ZRFA 4LWSA 3NAPC 5HCAA 3AYAA 3ILRA 3UKMA 3PUSA 3MYXA 4HAMA 1LHNA 5DZGA 2V5YA 1HB2A 4BQYA 1RXFA 2DYRC 4CBCA 5DN6G 4LO4B 1P7GA 5B1AC 1X4TA 5D2AA 4JI8B 1FKAO 4BM8A 4N7UA 4CCMA 5F3EA 2Z0AA 2WFF1 2BTQB 3DN7A 4ZU5A 5LMNB 1RUI2 4YW2A 3DL3A 4CS4A 3VHPA 5DZFA 3OGCC 4M00A 2YIBD 3SYCA 1SZBA 3MO4A 2ZGTA 3ZSMA 5JSRA 1QQP2 3HMYA 1SLTA 2XMLA 4ES9A 4LBQB 2ADPA 3TGUH 4D6TH 5F39A 5FCCA 3VHRA 5K9YA 4FTSA 4N53B 4OHXA 2VQEB 5GM0A 4HVRA 4JKLA 1FX5A 3KG2A 1ULDA 3H1IH 3CQOA 1F8VA 2Q8OA 2L9LA 3JD0A 3MLLA 4DUZO 4PJYA 4LO6B 2JG8A 2WZR2 4X8PA 4MH0E 3PTRB 5A3OA 1LU1A 1YF2A 2UUCO 4QDRA 3OTOO 3GZTB 1ZREA 3JSLA 3WR0A 4FLXA 4S2GA 2HR3A 3CJHA 1W8WA 3BOPA 2Q8DA 1TQ5A 4W6XA 2EALA 1LGBA 3AP9A 4HMZA 5IT9N 1KP3A 3G6EV 2XVGA 4H0LB 2YEVB 1FOD2 4GWIA 1PIV3 4QMAA 5CA1A 2Q1ZB 2Y26A 5FIXA 4OCTA 2GSMB 5GZFA 2PXJA 4P9LA 5SV8A 2D6NA 1QLEC 5DUWA 4J9YB 4ICGA 3GALA 5FXXA 1RUG2 3HNMA 5JXGA 4MLOA 5CBLA 1POV3 5LBCA 2DYSB 2W68A 4H14A 3H1KH 3MV01 4GB33 1ULCA 4XE9A 4WM7B 4GUNA 2RM22 2LGQA 3NV4A 1KXGA 2A3XA 4LF6B 4B3MO 2DOSA 1JBCA 1Y43B 5A3TA 1HRI1 1EBOA 2UXBB 3NNMA 4LBEC 2P4VA 2RDCA 1FXVA 3ABZA 1YJWV 2GZWA 5C8YB 2JG8C 3ZN4A 4U3JA 1XJAA 4DR6B 2X6CA 1RGSA 2Y69B 5KXEA 3VZNA 3FB6C 1J3RA 3LSSA 2WABA 1HRI3 2JKXA 4LKFA 4QU2A 1OCOB 1RUC3 1VQ7V 3H42B 4QB1A 5FP7A 4JKKA 3R6SA 3H1JH 2FMDA 2FMYA 2P6HA 2BGCA 1X7NA 5EJ1B 5C70A 2SLIA 3RMYA 5FO7B 1G9DA 4PI0A 2GUZA 1RUC1 4AG4A 2A3QA 1HN0A 1N36O 4QPWA 1GMMA 3QVNA 2ZX1A 3TOJA 2Y34A 3W5NA 1VF6C 4JZRA 2Q7EA 1H1MA 2D5HA 4JYAB 2VZRA 1AP6A 3OMIB 1HN1A 4UFMA 1PGW2 1CX4A 1ENVA 4RR3B 3ZIWA 4N21A 2WR9A 4JTOA 4CEWB 2DCJA 5K7PA 1N32B 4PDWB 2ZX2A 1M56C 4TV9A 4BE3A 4Z2WA 3PUIA 3IPVA 1B04A 4DW0A 5GLUA 1J95A 1NH2B 4M0HA 3D6EA 5LA9A 3OBZA 4Z82A 1GZWA 3VZLA 5LHHA 3JATA 3GDBA 4UFLA 3GZAA 5KR7A 3F7VC 2XASA 1CPNA 4DV0O 2HWC2 5JH7B 2AREA 1OH4A 4WZCA 2W1QA 1SEFA 3BU7A 4N7IA 4ZBMA 1PVC3 2QBXA 1DK1A 4DRXB 2UU8A 1AXKA 4XBFA 1VAVA 2FHRA 1YEWA 1CEZA 2VY0A 2EIJB 2R72A 3I3QA 1NTMH 4JI3B 4HSJA 3LKJA 2B9ZA 4XDOA 2XLAA 1RSOB 1PZ8A 1W6OB 4EWDA 4GMP0 4FM0A 1UN1A 3WW2A 1X33A 4I0XB 5J37A 4JI3O 4YZ3A 1OVPA 4NHKA 3K4AA 2RS32 4YXWG 3NQHA 2XLGA 2DV9A 4UVAA 1I94B 2BFUS 5C3SA 3B02A 2R32A 3ZN1A 1F31A 1SQXH 2J42A 4NVPA 5EJZB 3EVKA 3T1MA 2GC3A 4X8NA 4DNYA 3VKNA 4BWAA 2EICA 2VW1A 4XF1A 4LP8A 1BHBA 4PF5A 4HT1T 1YO8A 2PAEA 4COUA 1LOAA 4H7MA 1W99A 2NZ9A 2ZEXA 3AYCA 3O0VA 4AQTA 3RVYA 1IHMA 1KYOF 3ETDA 4KQ7A 4LHNA 3AFGA 5FJHA 2W94A 1NCQB 3ST7A 4AAXA 2XOKG 4AWDA 1PMJX 1YITV 2HEWF 4QX0A 3PIGA 2OT7A 5LP6A 1IS6A 4FFFA 4M4RA 3Q9OA 1QQCA 4JI0O 1O9GA 1QVGU 4O2AB 1MS4A 2PHXA 3ZBHA 2NR5A 3H8RA 4LF9B 3AZYA 1GFF2 1IS4A 1R6KA 2DVBA 5EK0A 3CJIA 4M3CF 1TVGA 4QWNA 4JI0B 1RVF3 4P9YA 4QPGB 5C33A 2D98A 4TQFA 4I2OA 1VBE1 2WSSG 3WQBA 2WLHA 1FFXA 1BVVA 4YZ5A 3WW3A 2Q8VA 1SA0A 1S2BA 4E4ZA 3KV4A 4ZPIA 1GK9A 4CDWC 2GNBA 1OKOA 4AZZA 2ZGRA 4JHZA 1SERA 2H6CA 1SESA 1UMHA 1FOD1 2VULA 5C4WB 2AGSA 1WPXA 3H9AA 1YFWA 4OFGA 4E4SA 1PIV2 3GYDA 5L36A 5H9RA 2E31A 2WZ8A 1MQTB 5LHIA 1Y6XA 4O4JA 1QWRA 1HNXB 5DAVA 3BABA 3D3IA 1F4NA 1NCRC 3B3QE 1A78A 3S0MA 4DV3B 1KITA 5ITZB 1ENSA 2YROA 1FAFA 1NXD1 2XUMA 1US3A 5IK7A 2RS12 3TEYA 1W6NB 3CBNA 3DUIA 5C8CA 3AMQA 1OBNA 1GZ9A 1FS0G 3NAPA 1GQHA 3B8MA 4R9CA 4EFBA 1XEQA 5K0UA 4D6QA 3VBSC 1SDDB 3WP6A 3ZM8A 3RN4A 4LJHA 4FLZA 3WU2Z 4O65A 5AG2A 2R071 3ASIA 1GNZA 3RWKX 3U14A 2WYSA 2BOCC 3JCIA 1PL4A 1OQDA 2VECA 4OUMA 3DXRA 4OXSA 2RM21 3LOIA 2PA7A 2N04A 2EF6A 1ZX5A 2FZ1A 1SQGA 3CCVV 3H8XA 4Q1PA 5F3GA 2K0GA 4CU7A 3RVZA 1AR73 4DV6B 3AZVA 4UCRA 4COZA 1YQ2A 1K5MB 3O1TA 3KV5A 4GULA 1NT0A 3LWCA 4K20A 3ROUA 3B01A 2BBAA 5FWEA 1I1EA 5FYTA 4H33A 1K9MW 1R1A2 2XR4A 2YBSA 5IVFA 2HVKC 4LK6A 1RVF1 3PLQA 5FBZA 2IH3C 2VTXA 4S2DA 1SLIA 4FAGA 5FFOC 4QHZA 2ZEZA 1LOGA 1O8SA 4LF5O 3SPIA 2Y38A 2VCBA 4Q2FA 2DVAA 1AVMA 3ABTA 1WPBA 4XMAA 3CDZB 3PVBB 1P4RA 4B29A 4W6WA 1QU7A 1YI7A 2XKPA 2Z79A 1PV0A 4MGQA 4GX1A 4ITCA 3ZS8C 4AI3A 1UW8A 4OHWA 3OY8B 1PD3A 2ZT9B 4WVVA 3KF5A 2XT9A 2J1UA 4KGGA 3VBUB 2VZ1A 1R73A 3QNEA 2UY8A 5KX5B 4JKMA 4X64O 5J3UA 1PNLA 2A70A 3O0XA 3K57A 5GZEA 2AYHA 5LEKA 3WF0A 1EUUA 4K0KB 5FQ0B 1WUVA 4UW5A 4XJAA 2R061 1UAIA 2KG7A 3J26N 4O4IA 3NO8A 1XOYA 2Q6AA 5EP9A 5FWJA 2DYCA 2YV8A 1NQJA 4Q4W2 2CDYA 4YGBA 3RFRA 2NP0A 2WYFA 3H0OA 4JTAB 3WW4A 3X29B 1S5HC 1REFA 1W0KG 4QDSA 1UOFA 4DXRA 3U4XA 2O8QA 2ZNJA 4QPIB 1SC5B 1AR81 1D0GA 2WO2A 1FNZA 2ZE7A 4PT6A 5CFDB 1O6UA 3JB8A 3O1PA 3EHKA 5L9RA 2R073 3C3SA 2ZR2A 1ZLZA 2CTQA 1US2A 1X59A 5AC92 1IPKA 2OPWA 2CY6A 3O1RA 5J98B 3P1IA 4UFIA 2FCVA 4QQOA 2W87A 3LQCA 1F9KA 1G8WA 1RUNA 2EXHA 4IV1C 4RR3C 3WQ1A 1NAEA 1YDXA 3IIAA 5DAQA 1NLSA 4GX2A 4LA2A 5LBQA 1RUF3 1XNAA 4UT5A 2YXHA 1R3JC 3NV1A 5FZLA 1ULGA 4IE6A 2FL4A 2D93A 4JI6B 1DLBA 5E8AA 1FPOA 3ZN5A 2VD7A 3SC7X 5FY1A 5IJ9B 1QIQA 2HWB3 4XJZA 1KJLA 1WJZA 5GW7A 3MLJA 3PVNA 4JZ2A 2K46A 3GZEA 3JALB 2VCMA 4LBNA 1LRHA 3Q4HB 2OQ6A 4IIJB 1JXNA 2FD8A 4ASUG 5JCTA 3AK3A 1IVSA 1W0NA 1JYNA 3GBFA 1NY72 3JAWA 4JYCA 1NCRB 4JV4A 3LFIA 4RHV2 3WDXA 2VMFA 5F2SA 3ITQA 2ID4A 3TXSA 1JOYA 1LHVA 3B9CA 4HL0A 1FAYA 1DLLA 3L9JT 1NU1H 5I8YA 1H2KA 1GV9A 1F4AA 4AI0A 2Z5WA 4KHPO 1OLRA 4GH4C 1YHFA 4WVMA 3POGA 3HEIA 4TSFG 1DP0A 5LGTA 3W7TA 3VUOA 1SF9A 5FREA 3AMPA 4GKJO 3WNKA 3AJYA 3UT5A 2BCCH 3AP4A 1BSMA 4FPPA 2JX9A 1Q90D 1SACA 1VMHA 2RMU1 5JJNB 4MXWA 5GLTA 3KHCA 1MEC2 2PYTA 4N9HA 2SBAA 4F8AA 3P3PA 1PK6A 3ON7A 5BNOB 3OPTA 1VB4A 1LCLA 3WDTA 1TUBA 1VIWB 3O5SA 4UXAA 4UV9A 1NYWA 3UKTA 2ORXA 4MHUA 5DECA 3GWKC 5CB4A 2QDRA 4Q4W1 1BZWA 1Y76A 3H1WA 3W21A 1P49A 1RUF1 1FXZA 3I59B 4MYEA 3FZ3A 5FY7A 1OCZC 4B7EA 2QKSA 4A3ZA 1FXKA 5IUQA 1RJ8A 1CAVA 5FKCA 1GUIA 1WKYA 1V00A 2BVBA 5LB6A 3AEIA 1JS9A 3HQRA 5A7WA 5ACA3 2CDPA 1QJY1 4CZZA 2YXLA 3CJIC 1F23A 4OZOA 5EHDA 4WFHA 3LOBA 5JQGB 4IV3C 5B1NA 1YVWA 1NR7A 1W8HA 2VU9A 4N8MA 3OR7C 3EXAA 1PMIA 5L3DA 3KHBA 5LXTB 2OZJA 3B77A 3POJA 4AI9A 1A8DA 1QJFA 2YUAA 4DB5A 1TAEA 1AYN3 2Q0AA 3AC0A 3V0BB 1G9CA 1OMIA 1KS4A 4Q4X2 3RT3C 2WFF3 3O0WA 2C9KA 1S2KA 3E83A 5JR2A 2XBO2 2ADQB 4PLOA 2JGDA 1WB8A 4KG8A 3LPFA 3CYOA 3M3QA 4JQRA 4CDQA 3CIHA 4O4HB 3NJXA 5FPZA 2ZMLA 1O3RA 4E2LA 4CS3A 3LAGA 2K9ZA 4ATFA 3CCQV 4YW1A 3HR9A 1ZA7A 4E8DA 4TYSA 4HPKB 3ZYJB 1AL22 3E89A 3E8HA 5IK8A 1RHI3 2DFBA 1ZRIA 1UMZA 2ZTNA 3D8CA 4LE3A 2C2AA 4K21A 2DTYA 2RMU3 5JZGA 1PNGA 1Y9MA 1NKDA 2X8KA 2D3SA 4JGYA 4RO2A 4QX2A 2AHZA 1VE0A 3ZIAG 3C7OA 2K2SA 1VF6A 2VMHA 5JWPA 2ARBA 3IDEA 3B00A 3OEAA 5B1AB 4WBBA 4Q4X3 1PO13 3MICA 4BHPA 1YJ9V 1CONA 4QAWA 1M1KW 3E8BA 2J1EA 1IKPA 5FOBB 2UUBO 5JVDA 4UFKA 4AW7A 1W9WA 1EPZA 1QNMA 2ZGKA 3O1OA 1LESA 5HCHA 4KWKA 1K34A 3B94A 4RS5A 4ZS2A 3LA7A 3CCUV 4RGGA 1P7BA 4XBQA 4FFBB 4BLJA 3DCQA 4O7XA 3K3WA 5LA1A 5IK5A 4LFBO 5FZ4A 3VBHB 2UU9O 5F8PA 3I56V 5B4NA 2IH1C 1E5RA 3P6BA 4NN0A 2Y6LA 1K5SA 1K4DC 3WF4A 3ZMUA 2M6YA 4DUWA 3TXQA 4LQRA 4EZHA 2ZZQA 2QQUA 1M4WA 4FQZA 1ND2A 1DCSA 4K9SA 4AFMA 1N1TA 5FMOL 4WFAV 4MZUA 1ST8A 4TSVA 5LY1A 2VUAA 3E6CC 5E6HA 5LL6Y 3WT3A 2X5IB 1UY0A 4OI0A 4HKWA 1W90A 1GICA 4YVSC 4P9GA 2VWKA 4I7ZB 1EAH1 1FV3A 4XW3A 1NQTA 3FFZA 2JIZG 2HKOA 2W1WA 4BWOA 4GCZA 2I74A 4FLUA 2B45X 3WEZA 3TB0A 5C5TA 3ZRWA 4XQDA 4XJUA 4P00B 4RFRB 3K5OA 4H37A 3CZUA 1J59A 4ARXA 4PLNA 4OULA 5EFUA 3SCHA 2ERFA 4YWAA 3HKBA 3U75A 4C8DA 1QNWA 3HNBM 4NWWA 3IGAC 1WBLA 2DUOA 2E7AA 1THZA 1AX2A 1W2AX 3IDBB 2VR4A 4IDZA 4BQ4A 4Q0QA 4IV1B 4Q4Y1 1VBB1 4Y20A 2JE8A 2QUOA 2PI5A 5D8AC 2OIIA 4YHHB 2J7MA 4D69A 4D7YA 4HBNA 5D5QA 4CCOA 2L35A 4Q29A 2WAOA 5JSOA 1BYHA 3RW0A 1JMUB 2AEZA 4E4HA 1MVQA 2WT0A 5DZEA 3SKVA 3BKZA 3WDVA 1RIRA 5L9BA 1IDSA 1NLRA 2IJIA 1L0LH 1DGSA 2WNUB 4J6GA 2B42B 5BNNA 3I3BA 4UWDA 1ULEA 3M1HA 3ZYBA 1JOPA 3CMGA 1HP8A 4BAYA 1HRV1 2B5HA 3KGLA 3FB5C 1JODA 1V6JA 3IC7A 1BLZA 3R0RA 5L3BA 3ZRSA 3HOBA 1XNKA 4WVZA 4DUZB 1UZ0A 2RJ2A 2HWE2 2GMPA 1NE4A 3PL0A 2JD4A 4QNHB 4JVAA 5L19A 4TT3G 3VBOA 3WV6A 3RYPA 4B1MA 1K3EA 3G6JB 3GBGA 4ZKTB 2UUAB 4R6ZA 3RMXA 1AR83 4O61A 4XDPA 3ZXLA 4H2AA 4K7JA 4AI1A 2UUAO 3ZVXA 1K5JA 1PGW1 2MEV3 2XXZA 4J1XA 4E9KA 1DGRA 1BEV3 4DV5B 1YXBA 2DDUA 2EIDA 4F6RA 5C8CC 3AG3B 3R4UA 5CA6A 2I45A 3VN4A 5ISLA 1AVBA 4EFEA 2BVVA 3OFNG 5LK5A 4B7KA 1HDKA 3NR7A 3I49A 2WS92 5LOVB 2ZGSA 4DV5O 1BVP1 1V70A 4HLTA 2E5LO 2NLRA 1AR5A 3EMRA 1K45A 3K4DA 5L7OA 1WGPA 4K40A 4IEWA 5J7MA 2P22C 2ADDA 3RYHB 3IBMA 1GSLA 4QKBA 1CAXB 2UXNA 3N27A 2X53S 2XBO1 1RUH1 3K77A 3ACIA 3PUAA 1UZYA 3USUB 3FLTA 2CV6A 5L3EA 4EN7B 1FPN1 3D0SA 3B5LB 4DV1B 2HWB1 3B40A 3NW4A 1RJ7A 1SFPA 4AGGA 2PZSA 3IIIA 4PIZA 5CA3A 1POQA 1GTOA 2RNBA 3RYRA 3ZFFC 3BB6A 2XAGA 4B3NA 4ZOLB 1NXMA 4Q5OA 3OBRA 3V64A 2B9UA 5FTTC 3H01A 1V0AA 2DQ0A 1JHNA 4LOSA 3W9AA 3ABUA 3FAVA 1NR1A 2QQLA 2HLEA 1DIWA 1GZCA 3CPWU 2HH9A 4NPMA 3B09A 4FVMA 1PO12 1KFXL 2CTRA 1ZWIC 3CL1A 5KHGA 4LUMA 1GN3A 4NOTA 4O2BA 3DC6A 4TWKA 2ETNA 2Y48A 5C9AC 5FRAA 3SJBC 3ZRXA 3U4SA 1GN6A 3U0ZA 4AEDC 2YIBA 1AR72 2JDHA 2XNDG 3ZFEA 5LBBA 1BMV1 4O4LA 2EBOA 4LLFA 1E57A 1S76D 5BNPA 3ZMOA 4EYUA 1NA1B 1FT9A 3AG1C 1D2DA 1K92A 5FJKA 4NIDA 1QR9A 4FOWA 2ILMA 2E33A 4WF9V 4Q4X1 3KB5A 2A1XA 3UKVA 4LFCB 2RR13 1G6NA 1YUDA 3LSDA 3KKYA 5FMCA 1SBEA 1H4GA 4X1KA 2GALA 3RZLA 1ZL8B 2F4VO 2JG9A 5C4WC 1Z78A 4YIPA 3G4SV 3T4ZA 2H0BA 4DUYO 1M93A 2YPDA 3BALA 1W6QB 3F5TA 4KNCA 4GKXA 1XHXA 3WB2A 1UZZA 5L73A 4NHXA 3SH4A 4FQ4A 3ZYGA 2C4XA 2R7EB 1ZUQA 4XFBA 1QJY3 2XGXA 2XJSA 1VQ9V 3EXUA 3ZLIA 1SFYA 3VDDB 1D4VB 2JDIG 4QX1A 2ZM6B 5BNPC 3T1CA 3MIFA 4JDMA 1LODA 3TEXA 2DWDC 1IBMO 1H2MA 2E3CA 1GWLA 3O1VA 2GU9A 4CP0A 4IE5A 1I6XA 2PI4A 5GLVA 3ZSJA 3FD9A 2A75A 1RUE2 4N90A 1H6XA 1EYBA 1HX6A 3SYOA 3BTZA 1E5SA 1G8MA 2B1GA 2VZQA 5JOXA 1WCSA 4YVWB 4DR2B 3VBRA 4DR4O 1MEC1 2R49A 2XAQA 2ZGUA 3AJZA 4C1XA 3MIGA 3L75H 4Z07A 4CH5A 5J2TB 1NY71 5CFCB 4AHYA 3WDYA 4DR4B 1GKFA 2JDMA 4QE9A 1LUWA 3HBKA 1QLEB 2ZE8A 4MADA 3WHTA 1CVNA 1HXS2 3DTUB 5BV6A 1REEA 3FMGA 4UOJA 4LO7A 2Q73A 1XNDA 5BY5A 4YGCA 3H1MA 4EEQA 1OD5A 1IZ3A 1CD3G 3T4VA 1YZBA 2ZXWB 4DV7O 2EIJC 3OT7A 4Q4V2 1VBA3 2VQTA 3V0AA 3VBSA 2VL4A 4F7ZA 5GALA 2ZHLA 2RJKA 4A4AA 3POYA 4QIWF 4ARYA 1H2LA 3HKEB 1BS3A 3T0DA 2IFWA 1JFFA 3AL5A 4Q0PA 3QO8A 5A1LA 1NH2D 4V1PA 1W3XA 5CNAA 1ULOA 3LUTB 1W2OA 1K3IA 3DYOA 1KD1W 1OPMA 2ZBJA 4GQ7A 3ZYPA 2IM9A 1GKBA 1QF3A 3JD1A 1E79G 3KM5A 2P1BA 1W59A 4DO0A 2J22A 5JVVA 2W08A 2BJSA 3ZOIA 4LTAA 1EM1A 2E76B 2WNVA 4Q4V3 1LUVA 3BA9A 1Q56A 4MVZA 2WA4A 4K35A 5L3CA 2O8OA 4UB8Z 3M3EA 4WVWA 2QM8A 4DO2A 3JASA 1FMD3 3M70A 5HV0A 2VVEA 1HXS1 5FZAA 1LHUA 1GWKA 2EXJA 3CCJV 5T5LA 2UYAA 4CE8A 2VBBA 2JDUA 1UOJA 3OD4A 2E6VA 3T1YB 2RN9A 4IHJB 1COV2 4RQPB 3N7KA 4W6YA 3UQ8A 2BWAA 2F6BA 1Q43A 1KKDA 1UY2A 2KXLA 1IBLO 2E74B 2WLMA 2QE3A 1VALA 2CE4A 4WM8A 3LEMA 4X20A 1OF4A 5FZOA 1FJGB 1PMHX 1CAWA 1QCEA 1VBA1 4CDQC 3HPNA 2R072 2VZSA 1MS5A 3AB0A 1GM7A 1PKXA 4NB5A 1ULFA 4PDVA 1YFYA 2QTSA 2ZOEB 1GNYA 1JN2P 3IJ4A 2DTWA 5KMGA 2CL2A 1UYZA 1VBB3 4FPJA 2BNMA 4WZFA 2OCHA 3LNNA 1QOSA 1C57A 3ZX6A 1F35A 2P6CA 4GWMA 1OQ1A 3IFXA 2JDAA 3WG3A 4L92A 4X64B 1PM4A 5FDBA 5A6XA 1NT2B 1XUQA 1Y66A 4OX9B 1HWYA 4FLTA 2G9GA 4AHZA 3VDDC 3BN6A 5I0SA 3AKPA 2EIMB 2UY9A 3F95A 1CPYA 3CF6E 4DINB 5IYBO 2HFEC 5FP9A 5FXVA 2R9IA 1XHZA 4Y1YA 5B3SC 4RAIA 1PIV1 5DUVA 5FYCA 4OX9O 3VD7A 5LBEA 1WLDA 1PHMA 5EIBD 3PJQA 2BU9A 1RINA 5JIUA 2VG9A 1TUEB 1RUD1 2ET1A 3WINE 4R4XA 3H7YA 3HN1A 3ZYRA 4FI9A 1KDKA 4OGQB 2YIDA 2IXJA 3AMNA 3H1LH 3PU8A 5G05L 5TISZ 3CEIA 1WA4A 5KLVH 2WZPP 5LA0A 4RD7A 2HWE1 3KS7A 2DURA 4QPGC 5A7OA 3VQWA 2CK3G 3CMEV 3JXSA 1CZVA 2HWD2 1J58A 5JR7B 1SCSA 1WCDJ 5LGNA 3E6DA 3O1MA 4I50B 2VOVA 1QH6A 4B1LA 2WNEA 1Q6HA 1S3JA 4LFAO 1RVF2 4NRPA 1TVKA 2OA2A 4MW3A 4Y5Z0 1YYNA 1JYWA 3N7JA 1WLWA 1GNHA 3U1XA 1SCRA 3BGAA 1NA1C 4JGSA 4Y1ZA 2WRAA 4FP3A 4MS2A 2IFRA 2VOWA 3WB1A 2JIJA 1F15A 5LGUA 4L87A 1M4UA 2HWF3 4X62B 5IYZA 4G2KA 1NX9A 2D5FA 3E5QA 2VQUA 1RUH3 4F4LA 1AF9A 1OOPA 4JGZC 3USSA 1WA8B 3NL1A 1Z0HA 2VMGA 4HONA 4X62O 2D40A 2W1UA 1CAUB 3C7HA 2DU1A 2W3JA 3LSQA 1DHKB 2BW8A 5C3QA 4DY3A 3HB3B 3HAGA 1VIBA 1XC6A 2V4AA 1HV1A 3K9SA 1VARA 3RZMA 1UXZA 4COVA 2A9HA 1O91A 2UWBA 3LA3A 4GYCB 4JTNA 4FPFA 1WA6X 1XNRO 5LYJA 1VQNV 4Y22B 2BRTA 2VUJA 2A6WA 2PHLA 2GNTA 4HZFA 4XCBA 1I5XA 2WLIA 4ZHQB 3FKSG 4YGEA 1OOPC 5A1AA 4GKJB 3N4MA 2PQQA 3NNGA 2OZ6A 4URAA 3VQYA 3S3XA 1SBFA 1AI4A 4C7UA 1W03A 1QHTA 3VOUA 3SITA 3LDRA 4YARA 4Q0SA 5B1BB 2XTAA 1R3KC 4ZI7A 1HB1A 1LHWA 2X7RB 2WNVC 2BWCA 5C3OA 3JAKA 4KP4A 4YJ3A 4DR5B 2ZJCA 5EXOA 1C5HA 1CN1A 1XREA 2OPKA 4P9JA 4DQAA 3AXEA 3KVAA 1DTOA 1LEDA 4B3MB 1IBKO 3WSOA 3ZMSA 2GDFA 1RXGA 2ATFA 4UCVA 2J1TA 1D0HA 3VB9A 3BCWA 2YPJA 1VQ8V 2UXBO 3D4KA 4FMTA 2PN5A 2I2SA 4WBNB 4YG0A 1JYVA 4RQEA 3RI8A 3AP6A 5T54A 2R30A 4PA3A 4I4TB 3VBHC 2GMEA 3QTCA 1SKVA 4P9IA 5IJ0A 1PZ7A 4JTDB 1Z7S3 1U5YA 3JARB 3E1F1 5EYXA 1POV0 1ODMA 2EIBA 3QH6A 4TTGA 4LNUB 5H5NA 1DF4A 1FI2A 5A33A 1NS1A 2HJIA 4OHZA 1GR3A 3UJQA 1G9FA 5D8AB 3DKWA 3ZXKA 2XJPA 5L3FA 5JMCA 3DC5A 3ZPOA 2YC2A 2WLQA 5F3CA 5ABJB 3A0NA 3A0BZ 1GOFA 2LTNA 2PLV2 4CDXB 1ZX3A 1FMD1 1GP4A 2VW2A 2V73A 3ZYFA 4JCKA 4DUVA 4DV2B 3J7HA 3RGBA 3BCCH 1BK1A 5C6CA 3OB8A 3BHPA 3SR2C 3BIWE 5A80A 5SV5A 2P17A 4LWSB 2K1EA 1G9BA 4K3UA 3CO2A 2B4KA 3I2OA 4ES8A 3HJRA 1DBNA 3G80A 3MD0A 3L2YA 5A3UA 1UD1A 3AYEA 2E7TA 3ZKUA 1OJHA 1MEC3 4RWUA 2QTWB 4EWEA 1OCCB 1VBC1 4JI7B 3STLC 4NE9A 3TNPB 4XPVA 1ASJ3 4ZS3A 4PV1B 3PVEA 2D6MA 5EV7A 2R9AA 2VQFB 1TME2 2BTQA 3VD3A 3VBFB 5A3NA 4MHRA 3WG1A 3W7XA 1FOD3 2LW1A 4KMQA 4CH3A 3OUJA 4IL7A 4LF8B 3ZFGA 1RL3A 1Q6UA 1W04A 2JJ2G 4LBQA 4C90A 2WLLA 3JU9A 3PHMA 1JA8A 1N3OA 4H3WA 5BR8O 5IYCO 2YC4A 2P3KA 4N53A 3NNJA 1NVPD 3MI8A 3VKMA 1PO22 3E8GA 5C9AA 3ZO0B 4AGVA 2K9PA 1COV3 5ANQA 4PELA 4A6OA 5FPAA 5CB7A 1XILA 3ZMVA 4R9DA 3Q8FA 1OHFA 4XTMA 1MZEA 2WLPA 1GH6A 2WZR3 5FR3A 1HRI2 4UBHA 2F17A 5FOJB 1Z7S1 5IW0A 2R043 1C1FA 4GLXA 1JZ8A 3NVCA 3WCRA 5GONA 5FYMA 5C93A 4K8ZA 3U78A 1BT8A 5JCOC 2XBO3 2WQZC 2JD9A 3EBRA 2WZR1 4HN0A 3MF6A 5G04L 1S77D 2HHHO 4TXWA 1K7DA 4ZIBA 3ZXJA 3MFAA 3VZMA 4WM7A 2GBOA 3WP4A 2DU0A 4EQVA 5GKAC 2EINC 1GAXA 4DR3B 3ZHVA 3POFA 3IMNA 2C6SA 1MVEA 4XDQA 5FUPA 5C8YA 2LFRA 1S1AA 2XJQA 3RZJA 1YJNV 4YNIA 3HR0A 3RSJA 4LF9O 4BXFA 4LOTA 3UO3A 4BCUA 4DYLA 1RUG1 2JIGA 2Q1FA 3C3TA 2ADEA 2QQOA 1K5QA 3BVCA 3SHRA 2PYJA 2ZIMA 1RTVA 1VAKA 1Q8PA 2GUZB 3SH5A 1PZ9A 4TWTA 1C8M1 3ZHQA 2WSVA 2UXCO 2V4DA 4AQSA 1TZOA 1EN4A 4GA9A 2VZVA 3CRAA 3CRCA 2W6JG 4YHHO 2YHJA 1F5FA 1YQ6A 1Z5WA 1KECA 4RR3A 2BOBC 3DKQA 2WIIB 4PDWA