3ETQA

X-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
b'DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 65
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3etqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3etqA02
5BXXA 1XE7A 4MGYE 1H1MA 4HLTA 3FFQA 1XE8A 4H7LA 3BU7A 3I7DA 3MZHA 3ACLA 2PTMA 1CAUA 3OD0A 3LZZA 4F8AA 1YFXA 1OD5A 5BY5A 1ZNPA 1Y9QA 1YLLA 4YNIA 3RNSA 3RZZA 2OYZA 5F1RA 1FI2A 2CAUA 2IC1A 4IEXA 2BNNA 2QDRA 5HI0A 3SCHA 4UBGA 1V70A 3PVBB 3SCGA 4D7SA 1ZRCA 5I0RA 3FWEA 5KHKA 3IBMA 2IXLA 4WBBA 2MPFA 3H1YA 1EPZA 4N9HA 4TLFA 1O3QA 4OLLA 4EROA 4LUMA 5FLHA 4IEPA 3SHRA 4MGZE 4META 1YFYA 4WZCA 1WGPA 3BCWA 3KGLA 3TNQA 2OPKA 5EZWA 3SCFA 1J1LA 2EAAA 5FPZA 1CAVB 4HN1A 5KHGA 3RDIA 5I0SA 1HW5A 4IEUA 3I59A 1CAXA 1VP6A 2GAUA 5JCTA 4B29A 3WW1A 2GC0A 4IEQA 4I09A 3U10A 2XLFA 1ZZCA 3M3IA 1OI6A 3ROUA 4QM9A 3WW2A 4KWLA 3ES1A 4BH9A 2XHKA 1H1IA 5C6CA 1RL3A 4YARA 1Q5OA 1X82A 2Q1ZB 2ZCWA 2V09A 3EJKA 4MGIE 4ZU5A 1O5LA 1ZRRA 4HVOA 4D7TA 3I54A 3FX3A 3USSA 1UD1A 1CX4A 1VJ2A 5JAXA 2DCTA 1CAVA 2D40A 2UYBA 1DZTA 1WLTA 3GYDA 4O9GA 5KBFA 4X6QB 1UPIA 1I5ZA 4KWJA 4AQ6A 3HT2A 3BB6A 3KSCA 4JV4A 4KL1A 4I0AA 2Q30A 4KU8A 5I91A 1UCXA 3EQEA 5CVRA 5FQ0B 3S7EA 4IETA 3OF1A 4GULA 3L2HA 4O9EA 1CAWA 1J3QA 2GC1A 3C3VA 2IXIA 2O1QA 3NSTA 1UIJA 2D93A 4AVAA 1SEFA 2GC2A 4XFIA 4MV2A 1RC6A 4FAGA 2QVSB 2OZ6A 2PHLA 3LAGA 4JVAA 3U11A 3QOPA 4HSLA 1UW8A 3IWZA 1LB2A 1SQ4A 4EV0A 3B02A 4MGKE 2B9UA 3CEWA 1I6XA 4LA3A 2ET1A 4QGLA 3CJXA 4AVBA 5JSOA 4HSJA 4BYYA 1IPJA 3HIFA 2GZWA 2H6BA 3EO6A 5BUVA 3MPBA 1U12A 1J3PA 4XEZA 5I0UA 1J58A 4R8HA 4J1WA 2BEOA 1FXZA 3DV8A 1QY4A 4N9IA 2PAMA 2CGPA 4LUKA 1O3TA 4UBHA 4Q0QA 2C0ZA 2D5HA 5JR7B 5CADA 1O5UA 1ZZ8A 3H9AA 4P9GA 1WA4A 2Q0AA 1RGSA 4IEZA 1GQHA 4LTAA 4QGMA 1O3SA 4R52A 2IXKA 5I8TA 1J59A 4QGNA 4ORFA 2BNMA 1ZRDA 5KHJA 1ZVFA 2D5FA 3E6DA 4FBFA 4HVQA 3H1MA 3PNAA 1TQ5A 2P17A 2Y0OA 4I3PA 2PFWA 1PM7A 4XFFA 5FLIA 3IIAA 3H3UA 5FPXA 3S0MA 5LEJA 3OTFA 5LEKA 3NJZA 2CAVA 3E97A 2Z69A 2IXJA 5LRRA 3N4MA 4AVCA 5I93A 3G7DA 4QM8A 1OMIA 4CYDA 4I0BA 5BV6A 4LEJA 4FT8A 1RUOA 1X8EA 4E2QA 4YRDA 4J1XA 3LOIA 4YSFA 3CF6E 1LR5A 1IPKA 4Z07A 1O7FA 2IXHA 4MH0E 5CU1A 4XFAA 2B8MA 3EHKA 3VHRA 3DL3A 3IDCB 1OFNA 5J7MA 4XFBA 4XETA 3H3ZA 1QXJA 3H7YA 4Q29A 3D82A 1ZX5A 4JTNA 2BYVE 2EVXA 2QCSB 4XF1A 2Z2SB 3D0SA 3WW3A 3MDPA 3H50A 2GU9A 4Q0SA 2XLGA 4ZU4A 3KMHA 2MNGA 1J3RA 2ATFA 3RYPA 1Q43A 3DKWA 1ZREA 1DGWA 3DN7A 3EBRA 2HKXA 3E6CC 5AVPA 4KU7A 1YWKA 1YUDA 3ETQA 3E5XA 3FE5A 2ETEA 1G6NA 1O4TA 3E5QA 4L2NA 2XKOA 4AXOA 1PMIA 5E16A 5LRSA 4L11A 3ZDSA 4XF3A 1RUNA 4IESA 1Q3EA 4A2UA 2N7GA 3CO2A 3HT1A 4E2SA 2I45A 1EYBA 5J3UA 3CLPA 2BGCA 3E6BA 2QNKA 4MUVA 3JZVA 3OCPA 5I8YA 1ZZ9A 2XKPA 4PIYA 5FQ0A 5KHHA 3U0ZA 1YFWA 2OZJA 2F4PA 1VR3A 3LWCA 5D1IA 4IEVA 2Q4SA 5I0TA 1ZZ7A 4LULA 4XFGA 1EP0A 4LA2A 4XFHA 1NE4A 3H7JA 3QACA 5BPXA 3M70A 4I01A 2QJVA 4HN0A 1NE6A 1ZZ6A 3UKNA 4YYOA 3O14A 5E1RA 5JSPA 3OGJA 2XGXA 4QX5A 4K8FA 1QWRA 5C8WA 3NKTA 2MHFA 3FHIB 5FCCA 4PJYA 4Q0PA 3RYRA 4KWKA 2FMYA 5KHIA 1QXRA 4Z82A 4XF4A 3I59B 4XF9A 1CAXB 3NW4A 3SMHA 4OFGA 1YFUA 3ST7A 5FLJA 1SFNA 5J48A 2EA7A 3H1WA 3NVCA 3D0JA 2VQAA 4HMZA 3TNPB 2E9QA 3RYKA 2WFPA 3SXWA 4IERA 4XFCA 2KXLA 4E2GA 1DZRA 2VECA 4EWDA 3LA2A 2FQPA 2H6CA 1CGPA 4NVPA 2PYTA 4X6RB 2CV6A 3S7IA 3E5UA 5EFUA 3BALA 2B5HA 4HZFA 1RTVA 2OA2A 4QMAA 4IEYA 4Q0VA 3FZ3A 1LRHA 1EY2A 4FAHA 5JSRA 4PIZA 2WC2A 3H8UA 2ZKLA 2PAEA 3LA3A 4UXAA 2PAKA 2GH2A 4QXKA 1JUHA 2K9ZA 4DINB 1ZRFA 2UY8A 3RPQA 3WW4A 4EWEA 3LA7A 3UKTA 4AQ2A 4IEOA 1CAWB 4Q0UA 5T3NA 5K8SA 1FT9A 4ZU7A 4LLOA 2UYAA 1X8MA 1UIKA 1NXMA 4BIFA 5I8SA 5FDBA 4MX3A 1L3JA 2UY9A 3KCCA 1GQGA 4IEWA 4HVRA 3CL1A 3UKVA 3R6SA 3ES4A 1YHFA 4JTOA 2H0VA 1CAUB 4EWAA 4BHPA 4RD7A 1XRUA 3ELNA 3NL1A 3MYXA 4XF0A 2PA7A 2K0GA 4MZUA 2XL9A 2XLAA 2PHDA 4WVZA 1O3RA 4I02A 4PIXA 1DGRA 3GBFA 2ET7A 2GC3A 3PLQA 2PQQA 2VPVA 2HJIA 3FJSA 3IDBB 3HQXA 1X7NA 2BNOA 2XL7A 1NYWA 3KGZA 1NZCA 1Y3TA 2O8QA 4HBNA 1ZZBA 3BPZA 1LKNA 4F7ZA 4ONUA 2IXCA 4I2OA
chains in the Genus database with same CATH superfamily
1XE8A 2EINB 1JVMA 3J9SA 3USUB 1XHXA 1YFXA 5A6XA 1OD5A 4UW5A 1KECA 3O1RA 5DZFA 3VBHB 1SQPH 3IJ4A 2Y6KA 1ZYBA 5T5JA 3W7UA 5FKCA 2A06H 1XNTA 4B1LA 4QQLA 2HLDG 3AG4B 1JFFB 1RM1C 4CUCA 4UBGA 3APBA 1WCSA 2FB5A 3NAPB 3FD9A 3S6PA 2ZGNA 4WBBA 3ZYFA 3NMBA 1KFUL 3ZM8A 1EPZA 2EINC 4EROA 2CHHA 5EPAA 3IKWA 2PHFA 5LYJA 1W05A 1ZUQA 3VBHC 3SYAA 2ID4A 1JCHA 4GKKB 1YC61 2E5LB 1L0LH 2UUAO 3E8BA 2XH6A 3AG4C 5DDJ3 1XNRO 3UQ8A 5JIAA 4YW1A 3NAPC 4OXSA 2XLFA 3WDTA 4QE9A 5IYZA 1N0JA 5IWAB 2CTVA 4PDWA 5J2UA 1S0FA 2PLV2 5IYDO 1OQDA 4J9ZB 2QM8A 4YJ2A 1CAVA 1ZRIA 3E8GA 1K45A 2Y6GA 2QQNA 1DQ6A 4EQVA 2W3JA 5LZ6A 2A79B 3VGIA 2W91A 2BV4A 5A7WA 4IV1A 4UF0B 1MZEA 4IETA 2NN4A 5FY0A 5EIBC 4I0WB 2NZ9A 3FUQA 2IXIA 5KA6A 3NSTA 4CP1A 3BCCH 1DQ2A 3FYIB 4BMBA 4LO7A 4E4SA 3W5NA 2VQFO 1FYUA 4EV0A 4LA3A 5C5UA 2Y69B 2X6CA 4AVBA 1V6JA 1HRV2 1XYPA 1SQVH 3T2PA 2BRTA 4AWDA 5A32A 4RR3B 3BIEA 4XUTA 3ZRVA 2MEV3 2C26A 1QOOA 2W2IA 2YHJA 4K3AA 1RUE3 1VBE3 5FYIA 2NLRA 3QG5A 3T2MA 3M3CA 1U97A 4GIQA 4ZOLB 1K42A 2Y69C 2FDGA 4JI0B 4LTAA 2P6CA 3E83A 4DY3A 4NRPA 1NZIA 1RPRA 1YIPA 4RR3C 2IJJA 4K9SA 3VL9A 1PM7A 3X2QB 3S0MA 4X1YB 1GQPA 4DEVA 4AEMA 1R6TA 4GWNA 3ORJA 3MHZA 1FXHA 4H33A 5ACA3 4GX2A 4FI9A 4MLOA 2ZMKA 4CTEA 2J1UA 4U2AA 4XFAA 3EXAA 3EVKA 4FLWA 5FTTC 4I7ZB 2WWJA 3IT8A 3X2QC 4YFZA 4K3UA 2BW8A 4X8NA 4N8MA 4P5HA 4XW3A 1HQLA 1AYN1 3T1YB 3PIGA 2QGNA 3AK0A 5AVPA 2HWC2 5F32A 2ZCEA 3FE5A 5FL7G 4CXWA 1PP9H 1OUXA 1R6KA 1LEDA 2DCJA 2VZVA 1N34O 4DUWA 1H2KA 4CCNA 4EE2A 1KRIA 3CMAV 3E6BA 3HNYM 2GMEA 2DUQA 2QDOA 4PDMA 3WP5A 2TEPA 1HRI3 3ZN1A 4ASLA 1UOGA 3ECQA 4OZXA 2BSKB 4GWMA 5F2VO 1UZZA 1H2LA 1QJU3 2VZUA 2XQRA 3OGJA 5HXMA 4YG3A 1Y76A 4JTDB 3D5OA 4IE7A 1IQAA 5L3EA 5KHIA 1ODMA 1ONAA 4XF4A 3AZXA 1GP6A 1WBLA 1GN4A 5JI7A 2R071 3OT7A 1W99A 5GTIZ 3H1WA 3RW0A 3BIWE 2CDOA 3WNNA 2ZD9A 2HEYF 3OY8A 3PJYA 1HNXO 3M1HA 4JI3B 5LCWL 3PIJA 3KKYA 4IERA 5F6KA 4EWDA 4CEWB 2XMLA 1QCEA 4OI4A 1GOFA 2BVBA 2B5HA 4LXLA 4MTFA 2OA2A 3S5QA 2RDCA 2D2CB 2JEMA 3CYOA 3HQRA 4IGGA 2C5DA 1PX4A 3H8UA 1LNQA 5FZOB 4ZBMA 2OKXA 1M90W 5J98B 2ERFA 1YQ8A 4Q20A 3D8CA 2G9GA 3SR2C 2FYUH 4D6RA 3G6EV 5T3NA 2AUYA 2E7TA 4CEWC 3AL6A 4LOTA 5D8AB 1F4AA 1Q82W 5JPNB 4DV1O 1GYKA 5GONB 4BISA 2E51A 2VMGA 1YI9A 1AXYA 3HAGA 4JTOA 2H0VA 4BQ2A 3MYXA 1GRJA 5J2TB 1HRI2 1AL0G 1D0HA 1WCKA 1UYYA 1K5MA 1R64A 1LHVA 1MQTB 1S72V 2BNOA 3ZN4A 5D8AC 4XJ9A 2O8QA 4HBNA 4AFDA 1ZZBA 3T4VA 2Q7HA 2HKOA 4TUYB 3BU7A 2PTMA 2IU0A 3AYDA 3LZZA 1VF6A 5C5TA 4LFAO 3RI9A 2YFUA 2J1SA 1YVWA 1V9U3 4YW7A 3CU7A 1HKDA 5IHRA 4UOJA 5F1RA 4B7KA 1MQTC 5FMCA 1A32A 5AFEA 4FLVA 3PVEA 1BMV2 1ZRCA 4ATFA 5ABJA 4KH9A 5LBQA 4TLFA 2RHPA 4QPYA 3SHRA 3ZFEB 1SA0B 1G8WA 2ZDIC 4HZ3A 5FZ3A 3BCWA 4KGGA 1C5HA 4UV9A 2VD7A 4G9SB 1W06A 2ZM6B 4B3SO 2VCMA 4TZDA 3QCWA 2OQ7A 3JU9A 4JI4O 1IZ3A 3A4UA 4G27B 2LFSA 3ES1A 5LOVA 4OQ9A 3ZFEC 4AYUA 1ZRRA 2VXJA 1CX4A 2R49A 2DCTA 4QKFA 1SKVA 2ADEA 1RUF1 1YXBA 3KSCA 5C4WB 3BVCA 1MSWD 3QLQA 5JOWA 1ACCA 4DR5O 2VNGA 2EBOA 5LHGA 2BWCA 2Y8KA 5DQ0A 1PNMA 4ATEA 4JAAA 5L7OB 1OT5A 3HR9A 2W46A 1WZXA 1V9U2 4GB31 3MHHC 1EAH1 2ET1A 3KB5A 5C4WC 4IDZA 5JSOA 3H1IH 1WW7A 4AI9A 2VZQA 2ZQMA 2X8KA 3T0BA 3EO6A 1R1A1 4YW6A 3ZXFA 2F4LA 3MPBA 2HEWF 5L7OC 2A7WA 5A1LA 3FB5C 1AI6A 2JGDB 3D36A 3ZHUA 4R52A 5FZ7A 2CH7B 2OIEA 1KQRA 1PIV1 1AYN3 1NCQA 3PNAA 2Z4FA 1UL9A 2PFWA 3VV1A 1RUD1 3CC4V 3M99B 1JI6A 4AVCA 5F5CA 2R043 4CDUA 2YUAA 2VVDA 4Q4W3 5A7OA 1XYNA 4FT8A 1OH3A 3UGHA 3ZFGB 4UVBA 1UF2C 2DVDA 1OSGA 4YIPA 5HXVA 3KCXA 2ZEXA 4UXNA 4YW5A 3UO2A 3QVNA 2WWWA 5T52A 4CUAA 1N4CA 1UU4A 4M3CA 2AZ0A 5EWSA 2V5YA 1TA8A 5FJKA 4TT3G 3S57A 2QWRB 1RUG3 2YU2A 1LOEA 4YM3A 2WLKA 3IMMA 1DTOA 5LA6A 3ZFGC 3N36A 3PDQA 3ZRSA 4B3RB 1NG0A 4AQYB 4NJ4A 3CXHF 1RUNA 1LHNA 2R073 3CS5A 5JIUA 3OYWB 2VBPA 4NPMA 2Y6JA 2CDPA 3ML0A 4FVMA 5JVDA 3RN4A 3CLPA 1NH2B 4B3MO 5B5EZ 1JN2P 1BQ0A 1VBB2 2KSDA 3U0ZA 2ZTNA 4LFBO 4LNUB 4GWJA 2VQ0A 1UN1A 1VR3A 3ZYIB 2Q4SA 2Z0AA 1H38A 3H7JA 1E5IA 2QQLA 5H6RA 4XCBA 1Y6XA 2BJSA 2KM2A 5LYJB 4K8FA 2BFUS 4FO9A 1VE0A 1VQNV 4YM0A 1HLCA 4KBZA 4RYDA 2XPJA 4PJYA 4AQTA 5GM0A 4ASMB 4A6OA 1FKAO 5EQUA 2EJRA 5T5PA 3ST7A 4FOQA 4L87A 4CE8A 3POYA 3CCQV 1O4YA 2R042 5CBGA 2VOTA 4Q4W2 2E9QA 4O65A 1DFQA 2WLPA 5J2UB 4I9QA 2VTFA 2Q8EA 2WL1A 1JZ5A 4IE5A 4E4DX 1DQ4A 2NNUA 4K20A 4Y1YA 5FUNA 5A7NA 3VZOA 2VBDA 4OI0A 2IM9A 3RZJA 2JEXA 5A7WB 1RUG2 2VR4A 5CN0A 4IV1B 1HB3A 2LUWA 3KV9A 4PDWC 2A6VA 2WZPP 4Q0UA 2YSUB 1AX1A 3ZXEA 1M4UA 3OGCC 1XU2A 5CG8A 4CPBA 1SQXH 3ALQA 2EIDA 3JAWA 2FDJA 4M01A 1ZBE1 3PUQA 2BDRA 1CAUB 4Y5TA 4BHPA 3NL1A 1IBLO 5KC6A 3GBFA 1COV1 2D3OW 4IV1C 5A32B 4QDSA 1S77D 4M00A 1B09A 2ZEYA 3IDBB 3J7NA 2VCAA 1OCRB 1JW6A 4XOGA 1Y3TA 3QH6A 2BQPA 3RWRD 2YMZA 1Q8OA 2QQKA 2VZPA 2QTSA 5KXBA 1HXS1 1F9KA 4OHXA 3DSQA 1GH6A 4LF6B 1H1MA 1W2NA 5GZDA 4NRMA 5DN6G 4IXLA 3RZZA 3RYIA 1K5SA 4LBKA 2ZOEB 2JENA 4GCZA 3HKEB 1OCRC 2HWC1 2UXCB 2N05A 1W0NA 5KHKA 2IXLA 1FFXB 1IHMA 2KQXA 4J9YB 2RS52 4AVVA 2AHYA 4JQTA 3WNOA 4M0HA 1J1LA 5FZHA 4R9DA 2JRIA 3THDA 2QDNA 3SYOA 1Q7YW 4LHLA 1ZZCA 1OI6A 3WCRA 2ENRA 5LA1A 3TEWA 5B66Z 1RL3A 4BOWA 4Q4V1 2QQPA 4GB33 2RR11 4MTOA 4D7TA 5A7SA 4AVSA 4AI3A 3KV4A 5FXVA 1F51A 2D40A 5ITZA 3HR0A 1OURA 4RA0A 3RBZA 4S2HA 1I5ZA 1R1A3 2UWCA 4A42A 3JAMN 1KP2A 1I5YA 3IC9A 2Z3YA 3NV1A 2SBAA 4C0BA 1HJFA 2OYQA 2WR9A 2OUHA 1REDA 4L8JA 5LP6B 2QZ3A 2YBSA 4CH4A 2RS11 3C7GA 2A6YA 2OCCB 3MGUA 2DF7A 1LB2A 3LIGA 4OQ8A 1W9YA 1LOFA 3FHAA 5H9SA 3SDLA 3VQVA 2JJ6A 1GAXA 1RUD3 1UZ0A 3CJXA 4JI5O 1N0NA 4RO2A 4BQ4A 1IS4A 4Y22B 2VCCA 2DU1A 1W6MB 1U5YA 3NJXA 3JATA 2CAZC 4J80A 1QY4A 3UKMA 5LP6C 4ZHQB 1ULGA 4LUKA 2OCCC 1JX9A 4LLFA 1QIQA 5JQGA 5B1BB 3H9AA 3L9JT 3V56A 2VTXJ 3THCA 5I8TA 5F6LB 1HNWB 4E2LA 3X29B 4QX2A 4AQSA 5F37A 3T3YA 4WV8A 3ZIWA 3TXSA 2JD9A 4JHTA 1W3VA 1NQDA 2EZOA 1XSRA 1O9HA 4QX1A 3MW3A 1QVFU 4HXCA 1I7FA 3BA9A 3VBFB 5BNQA 1Y4MA 5F3GA 1CP9A 3JD4A 5DECA 4NHYA 2DDUA 4MVOA 4ZPIA 4AOCA 1MS5A 2QQIA 5FYVA 5HBAA 4BIZA 2YDEA 3T08A 3PL0A 1CPNA 1TVGA 5B1BC 2PHXA 2HWB2 4OHWA 1EBOA 3UM7A 1HNZB 3O1OA 5APAA 3O0WA 2E53A 3ILFA 3H7YA 2VAUA 2QCSB 3VBFC 1LOAA 3WW3A 1RXFA 2NYYA 4Q0SA 2VUAA 5FY4A 4PBPA 2AEZA 3EBRA 2CWSA 5DN2A 1MS3A 4N21A 1AJKA 1YWKA 4CCEA 4LKSA 1XNCA 3EHBB 3E5QA 1OCCB 1LHOA 4L2NA 4CP9B 5JPMB 4X20A 3M7AA 1OD3A 4Q4Y2 2BE3A 1UYPA 2JECA 3VBSB 5J3UA 5K0UA 4YY3O 4RUEA 4P14A 2DW4A 1CZTA 4GKXA 1IX9A 4KMQA 4RGAA 2F4PA 3PTYA 5JDBA 4XBQA 5I0TA 2F4VO 3DYPA 5K9YA 4XFHA 1SQBH 1S76D 4CDXA 5M0TA 1TMF3 4YVWB 3S3XA 1I1EA 3K58A 1Q81W 1VF6C 1ZZ6A 3RSJA 3U07A 2GN3A 1QWRA 2VMDA 1VQ9V 3FHIB 1H9PA 1GP5A 3RYRA 4CU6A 2WAAA 3K48A 1MG1A 1YFUA 2WLJA 5KC5A 2ZIOA 2EA7A 3GDBA 3VDDA 1A8MA 3FFZA 2M6YA 3WT3A 1XL6A 4DUVA 1OQEA 4W6XA 4YVWC 1MZ6A 1GZWA 1ZBE3 1XOUA 4IW3A 4FPLA 4NVPA 1YQCA 2UU8A 1SF9A 5L3BA 4RGGA 3ASOB 2RV9A 2W87A 2VNRA 4GAZA 3S3WA 3C7FA 4CC6A 3TJTA 4UFHA 4H3WA 3GHMA 2CNAA 4BWAA 2LTNA 4QPIA 4PQQA 3TN92 2PAEA 2PAKA 1HXS3 4DINB 1RIRA 5A33A 3ETPA 5FZMA 1JU4A 4MX3A 4NTXA 2XJTA 3SYQA 2QBXA 1NBMG 1ULDA 3PUIA 1CPYA 3WHTA 2Y4UA 3ASOC 4HVRA 1G9CA 1GWLA 1REFA 3ELNA 1DF4A 4TYSA 2QJ1A 4MW8A 1RUJ2 4OULA 4S2FA 2A71A 3FAVB 5LY2A 1KP3A 3O0XA 4I02A 4O4JA 3C3SA 1QLNA 4O4IA 3M3EA 3PLQA 4UFMA 2PQQA 2QKDA 1QJY1 1XREA 2BZDA 2GTAA 2XL7A 5A6YA 2ARHA 4BPZA 1EZVH 4X65B 4JV5B 1TMF2 4Y4YA 1F7YA 1XE7A 1REEA 3FFQA 1N3OA 2Q9LA 1Q56A 5JOYA 3ETEA 2AEYA 4TXWA 4YNIA 1ODNA 3RNSA 2WSUA 4DXSA 5A3NA 5B1OA 5FWEA 4JI7B 4JI8B 3W20A 5FBJA 4Q4V3 2CGOA 2RR13 3NKGA 1OPMA 1ZM1A 5I0RA 1WW6A 4W50A 2QQWA 2QWOB 4NIGA 3CRCA 4L92A 3B00A 4X62O 4K35A 3MDSA 1VQPV 2R7EB 2RS33 4IEPA 4CXYA 4WZCA 4LP8A 2ZIMA 3L75H 5EZWA 2IVJA 1H2SB 1WJZA 2PYLA 5KUMA 2VZ1A 4JYAO 5A70A 4HN1A 1AP5A 3H0OA 2GC0A 5AC91 1VBD2 4OX9B 2W68A 3B3QE 3JXSA 4L97A 3GBWA 1PNGA 5LA6B 5KR7A 4MGIE 3EJKA 1SFYA 4AFAA 1VF5B 3J7MA 3SITA 1OPOA 1IKQA 3R4DB 1XOYA 3TRSB 1WLTA 3C7HA 1YO8A 4TTGA 1JYNA 2BUKA 4YGCA 2W1UA 4XAAA 3Q8CA 3ZHVA 3EQEA 4KP4A 1YSCA 3J81N 4GULA 4J6GA 5BXZA 1AR71 4DR3O 2WSVA 1P8JA 3BOWA 4NIIA 2E74B 3AK3A 5A7QA 5EYPB 3FMGA 2Y6FA 1FXVA 2A6XA 1SQ4A 1IG0A 5HCAA 4UCTA 4MGKE 1QJEA 2OIIA 3A0RA 3R0RA 5CFCA 5DXDA 2EXIA 2VW0A 4BYYA 4LFCB 3IAYA 5LWBA 2H6BA 3K59A 1IBMO 4A41A 1NY72 1FOD2 5I0UA 5T5OA 2RS32 2WA3A 2W1SA 4DK0A 1O3TA 3MIDA 4PA4A 3LPGA 1WA4A 5DUWA 4NXMO 5EZYA 4QX8A 4UFJA 5FKBA 1ULFA 4IEZA 1GQHA 4TWKA 1CIWA 4NMIA 1XBFA 3N2KA 4DO2A 4XDOA 4HVQA 1PMJX 2R9AA 5JOXA 3E97A 4NPLA 3O65A 4NAOA 1CX1A 5LBCA 1DYOA 4V1PA 1AR5A 1SMVA 4HG6B 4MGQA 4C0HA 2VGDA 4AI0A 1NZ6A 3JAWB 2JDKA 4MSVA 5C9AA 2VQEB 2R70A 1PX3A 1QGLA 4DV4B 5IK8A 4Q4X1 2ZEWA 3WSOA 4K8ZA 1OKOA 4WM7B 2HWF1 4KG8A 5HV4A 2V7QG 4XF1A 3SH3A 5HFMA 4N90A 3H50A 5LHIA 2GP3A 2AZ2A 1N47A 2J1RA 3K77A 3JASB 1S0CA 3LDEA 4Y20A 4YGEA 4EFEA 2ZA9A 4CCOA 2FD8A 4DV6O 3ZDSA 3CRQA 4DUZO 3CO2A 1EZJA 1KJRA 2P3KA 4WM7C 4LHSA 3RYIB 2JD4A 4R7CA 3RS6A 5T50A 2JGUA 5FWJA 1HQNA 3LEIA 1HQWA 4LH7A 4ZHNA 5FUIA 2P34A 1HR0O 3CJHA 4AG4A 3M70A 5CG9A 3MIGA 2HWE2 5DZGA 4ET7A 1XB9A 3E1F1 1SESA 2FBEA 4FZ0A 2RM22 1CQ9A 2CDYA 3N35A 3I3EA 1DLBA 1ST8A 4OZOA 4HL0A 1WLDA 3BEHA 4XF9A 2V4AA 1YF2A 2NN8A 2HEVF 5LW9A 1NLSA 3ZJZA 2DBNA 1VMJA 2G19A 3LKJA 2WT2A 4CEYA 4C8DA 2FL4A 2BOJA 3HQUA 1FV2A 5SV8A 5ITZB 2HVKC 4LORA 3KCYA 3CIHA 4Q0VA 3LDCA 1QJY3 5K4LA 4U36A 2RVAA 4YGDA 5DMYA 1PO23 1RINA 4PI2A 4IL6Z 2VS0A 5E79Z 2E7QA 3OUJA 1LR1A 3N9OA 5IYCO 4BE3A 5H5NA 3P30A 1SQQH 2ZMNA 2WNVB 3I5DA 1XNQB 2WLLA 3KCCA 4W4KA 1LJ7A 4JPRA 4JI6B 3ICXA 4JKKA 2RNBA 5F3IA 3CCSV 1YHFA 3PJQA 2QQUA 4NXNB 5IUQA 3A22A 1CIYA 4G28B 2Q7GA 1SFPA 3WG1A 4XBLA 5LXTA 4X66B 4BQWA 2JDNA 2WNVC 4YGBA 4FPCA 5T5LA 1FPN2 4GKJB 1WLEA 1LKNA 4QPGA 4GXLA 3MZHA 3C2UA 5JQGB 3AFKA 4IE6A 4J7ZA 1RVF2 3ZXDA 1LOFC 3WB1A 2EIMB 1JMKC 4GJYA 4D7YA 4X64B 4DRXB 3SKVA 5AC93 2LROA 4C91A 4FXGB 1XQ8A 1WMFA 1XMQB 1N36O 1BHAA 3HKCA 5FO9B 4JYYA 1BLZA 3WQBA 4FOYA 2XAJA 2ZXWB 3FWEA 2MPFA 3H1YA 4WVWA 1WP8A 3K4DA 5JJEB 4XACA 1W9SA 2WKKA 5JXIA 2EIMC 5JXGA 2BFUL 3FN9A 5CKMA 4RL7A 1PO22 1JTZX 5C93A 1S4CA 3VQYA 3WNPA 3H3LA 1AR73 2UXXA 3CB2A 3WW1A 3U10A 2ZXWC 4DXRA 4Y1XA 2JG8A 4PA7A 5KX5A 4R50A 1QJFA 3N2GA 3LSUA 1ND2A 4AL9A 4GZ9A 1W6OA 4O2AA 1SQFA 2CTQA 1R081 2B1IA 3J7HA 2CL2A 2ES3A 5FPBA 1RUC1 3W59A 3U4XA 3WQ0A 2EIJB 4JV4A 1IG3A 2BOIA 4DV0B 1UCXA 2UXDB 2E31A 1DGWX 3S7EA 3VKLA 2VVEA 3DYMA 2WO3A 4MSWC 2GMPA 5LB6A 2O1QA 1JS9A 4TV9B 2Y33A 4CDXB 4MV2A 2UURA 2Z5UA 1AF9A 1PVC2 4EN9B 1IKPA 2OVUA 3TN91 1I6XA 4V2VA 2G1MA 2VZTA 2EIJC 4BQ5A 3W7SA 4DR1O 2YS8A 1P7BA 1OF4A 3BTYA 3VDDB 2VOVA 4ZXKA 3HVDA 3A0BZ 2Q5TA 4CDXC 4J1WA 1GZWB 2GV9A 1HDJA 5AG2A 1WA6X 2JXAA 1FXKB 2WO2A 4Q4X3 3ETDA 3PMSA 4OMCA 2HWF3 4UAPA 5L3FA 3RMYA 2IXKA 4Q26A 4YPJA 3ZHSA 3WF2A 1ZRDA 1RUI2 2WYSA 3VDDC 4LR3A 4JI2B 4IUGA 4FLYA 4CU8A 1C1FA 4XFFA 2HEPA 5A33B 4I0XA 3JCUZ 1Q8QA 1FXKC 5D5PA 3O1TA 2BTQB 1XBLA 5EIBD 3MW2A 4NB5A 5BR8B 4HOOA 5J09A 1POV0 4MH0E 3EHKA 4QXCA 1QH6A 2JDYA 1OFNA 3AMPA 1S0JA 4XFBA 4QPIC 3BKZA 2CUGA 4O7XA 2JK5C 4O4JB 5FFOC 2Z2SB 1MZ5A 4O4IB 2KA3A 4ZU4A 5FZDA 5HPOA 1DGWA 3GZEA 1M1KW 3CRRA 3ZMSA 1S2KA 1BKZA 3H1KH 2ORZA 2P2KA 3H01A 4WFAV 2P5OA 1GO3F 3SGIA 2XKOA 4W4ZA 4UB6Z 3JB8A 1W0PA 1LOCA 4QHZA 3MEPA 2WLNA 4J25A 3MIHA 4HKLA 5LGNA 1G9BA 4Q27A 2C1FA 4FQ4A 4AEDA 4LO6B 4CSWA 2WNOA 2ZX0A 1P7GA 5AVAA 3LWCA 5D1IA 5IJRA 2VZSA 1U96A 3C8XA 4DIQA 5BPXA 2RQ6A 1JH5A 1NE6A 3UKNA 3PUHA 2ZR2A 1GZ9A 3K46A 4XUQA 1B35A 3VZMA 3UJQA 2O0OA 1EUUA 3PHMA 4E27A 1GKFA 2VWKA 2RJZA 1VBA2 4JGZA 3EB7A 3GHNA 5FY8A 1J5EO 2OS2A 2WSSG 2BOBC 3SXWA 1NTZH 1GNYA 5L19A 1PNFA 1U5XA 4S2GA 2NMNA 1VBC2 3ZRWB 5FY5A 4LOSA 2D6NA 4HPKA 4JKLA 3T4HB 1AR61 1WWYA 1RITA 4A4AA 2ZGOA 3KV5A 4HNAA 3KV6A 4EKWA 1GLHA 2UYAA 4PDRA 1NXMA 4BIUA 1MABG 5K7PA 2Q73A 1W2AX 1PV0A 4BU2A 5FP7A 1XEQA 4RSUA 2Q8DA 4NTWA 1O3RA 4CDWA 2XVKA 1JODA 4LE3A 1PO12 2JE8A 2B9ZA 4R4XA 5CYYA 4QPKA 1WPXA 3I4IA 3APQA 1DDLA 1KJLA 4LO5B 2JS3A 1KS5A 2R061 3M3QA 4F7ZA 4FPOB 3I7DA 1Q8PA 4DUYB 4F8AA 1OQ1A 4L0PA 3N9PA 1KUQA 3Q4HB 1FMD1 4MVUA 1HV1A 4DR6O 3I2DA 1ZSPA 3ITQA 3N2KB 2QWPB 5LBFA 1K7DA 1G6UA 1GWMA 1H4GA 2VTXA 4ZZ5A 1VPHA 5SV5A 3AK2A 1THZA 2EIGA 2GTSA 2B4KA 3ZR6A 3N27A 3RYFB 3MIEA 3BTAA 3RJ2X 3LEKA 3VKNA 4AFMA 4XJ8A 3C3TA 2BU9A 2XWBB 1JFFA 2HHHO 4IEUA 4JYBA 1CAXA 5FY7A 5JCTA 2XTAA 5FYTA 4Q2FA 4LO8A 1UKRA 2A5ZA 5DM6V 3DF0A 1GU3A 2WRAA 4O61A 3K5OA 1DIWA 4KWLA 4BH9A 3A23A 4EJRA 1ENQA 4PBOA 3NNLA 3KZIZ 3UYJA 3FX3A 3W9AA 2GBOA 3CCUV 3SQOA 1Z7S3 2WLMA 1YTFB 5EC1C 1GN2A 5E6HA 3WG2A 1S0BA 2JVDA 5FPAA 3TETA 4GX0A 5F9TA 1C8M1 1G9DA 3BB6A 4MVRA 3N3HA 5JOZA 1XDCA 4NPRA 3ZN5A 3BRCA 4DV7O 1H8VA 2HYXA 4DR7B 2JEUA 3L2HA 3K4ZA 2J22A 5EYXA 5IT9N 1VQ6V 1AYM1 4LNVA 3CBNA 4QD2A 3CJHB 1QJX2 2Y38A 2PHLA 2BCCH 3J7AU 1Y43B 2FCVA 2GSMB 4I4TA 3B94A 4WFGA 2QKAA 4M3CF 1SLCA 5FYHA 1POV3 2WQ4A 3LF7A 4BK5A 4UCOA 4P30A 4PF1A 2LM3A 2E26A 4B3TB 5FZ0A 3GJBA 5F2WA 2E7AA 5A3TA 4QGPA 1OVPA 3VQWA 4EN7B 1AL21 3OR6C 1WP7A 4FFFA 4AK3A 4GMP0 3GZAA 4UBHA 1XSQA 4CCCA 1MEC1 1RHI3 3ZKUA 2M7WA 3NV4A 4FFKA 2KKWA 4RR3A 2IBZH 2EXKA 3VBUB 4COWA 2D6MA 4DR4B 2VY0A 4K6BA 5LMUB 2KG7A 4YW4A 1L1FA 5H9PA 4CYDA 3WG3A 5FOBB 1HP8A 4IQPA 1Z7S2 1VQ5V 4ZOLA 4J1XA 1QQP3 1LENA 1AI5A 1TE1B 5CU1A 1S2EA 1XNAA 4JDNA 3ZSMA 3CZUA 1QXJA 5LA2A 2LO1A 2PMWB 1RP3B 4JTNA 3VBUC 2X53S 4X1YA 1ASJ2 3FL7A 5J9PC 3H8RA 3E89A 3ACIA 5IVYA 3PUAA 3RYPA 4LH6A 2HKXA 5A3PA 2J42A 3P6BA 1YDXA 4LE4A 4QPGB 2E32A 1V6IA 3ABLB 1Z5WA 4AXOA 1PMIA 4WFEA 5LRSA 4QE7A 2R30A 2Y6LA 5FP3A 1ENVA 4QJFB 3ABMB 3K0DA 2BGCA 3JZVA 4E9KA 4V2WA 4XXAA 4JZ2A 3MAQA 3WVJA 1JHJA 4XMIA 2OZJA 1JYIA 1V6MA 1GBGA 4TN7A 4FPHA 4QPGC 5FO7B 4JI1O 4LA2A 1NTMH 3ABLC 4H2AA 2YXHA 1PGL2 4XTMA 1RHI2 1NQTA 1M57B 1GFF2 1R3KC 1NXD1 1AR63 4A7ZA 2W94A 4LF4B 3ABMC 1D7PM 1UZVA 3MLKA 3SYCA 4XQDA 1JR9A 4N43B 2G38A 1D4M1 4XYXA 1U5IA 3LFMA 1Q8IA 4JRAA 1YQ6A 3STZC 2TUNA 3BPSA 3KVBA 2JG8B 3OBZA 4D6QA 2WQ8A 4CP0A 4IE4A 3N2GB 1QQP2 1M57C 2CTRA 3LDDA 3T1HO 1TUBA 2CWMA 1CGPA 1W6OB 4O2AB 4QHOA 3M8AA 4PDVA 4X6RB 2RCVA 1PZ9A 3E5UA 5EFUA 1JJ2U 3MF9A 3PURA 3J7LA 2XQXA 2QUOA 4N43C 1RUH2 4LC1A 1NUKA 4PIZA 3NNFA 3AYCA 1WA8A 1PGW1 5GKAC 2JG8C 5CA0B 1TUEB 4FVVA 2R063 4PF5A 2VUCA 4EWEA 3LA7A 3BUCA 1BL8A 1LGCA 4RQPB 1VMGA 4CEWA 1XE0A 4MW3A 1BEV2 2EXHA 1N33B 2WS91 5FDBA 1FMD3 2LFRA 5C8YA 2ZBJA 5CISA 1GQGA 4WFBV 3CCJV 2RJKA 3DEMA 2P67A 1RUI1 5L73A 1AI4A 3UV9A 3ZSEA 2XJQA 1KFXL 4URTA 5IT6A 2ZGRA 4LF9B 1NH2D 4Q1RA 5IJ9A 3FYEB 1XXNA 3WP4A 4RQPC 5D8AA 1XMOO 1EV13 3GM8A 1NZCA 4ABMA 5FZCA 5GZFA 3EYPA 4HETA 1O91A 4QKNA 4ZZ8A 4HLTA 5CFDA 4FPJA 1VQKV 3CE2A 4YIOA 3UL2A 5J2TA 2YB7A 1YLLA 3SPHA 1BYHA 1QEXA 4JQRA 1N32O 1ULOA 3AL5A 2IC1A 5HI0A 5FYSA 2UUBO 1E1QG 1MOFA 3PVBB 5BMVA 2Q68A 1J95A 2A3YA 1NA1B 4X1IB 2ZDIA 4FLUA 1KITA 1VB4A 2ITCC 3ZMUA 1C8M3 3GXUA 2XDVA 4BK4A 2WZR1 2YICA 1R1ZA 2F43G 5B1AB 4AHWA 2P6HA 2WLHA 3RWNA 3UNPA 1DLLA 1AYM3 1OZ0A 4DQAA 5DEDA 2P4VA 1CWPA 4H13B 1NA1C 1KS4A 3JB4C 1SA0A 4ZU5A 4ZS2A 4HVOA 4UI9L 4D69A 1YJLA 5FO8B 3TCUA 3OTOO 1TME1 1RMU2 4CCMA 4LF7O 2UYBA 5B1AC 1VBA1 4O9GA 3RJRA 5DG2A 1JOBA 4NIHA 2Z79A 4A3XA 1XQNA 1AL23 4I0AA 2L9LA 3AKPA 1MS4A 4BR6A 3F95A 4OI1A 5LBEA 1NOVA 2BGOA 4O9EA 1J3QA 1H4HA 2E63A 2I2SA 1MEC3 4HKOA 2X05A 4O2BA 3CMGA 1K12A 4XFIA 1Y4WA 3RT3C 4BJ0A 2OZ6A 4XQWA 4BA6A 3VBRB 2O57A 1EN5A 1UMIA 1VRH1 1B35B 3GZUC 1FS0G 3J8F3 5C4WA 1DF0A 3AP7A 2JS5A 3ON7A 4HAMA 2XUEA 1A78A 1ZAUA 1IPJA 4WZFA 3ILRA 5FYUA 2FDFA 4J10A 4XUNA 5L9VA 3N9QA 4DV5O 3N9LA 3NV3A 3VBRC 1OHFA 3DXTA 4DNYA 1ZZ8A 4QKDA 2RE9A 1B35C 2BOCC 1VIBA 4HPKB 1IS5A 2LS6A 2WWSA 1XHZA 1FNZA 5DUXA 5FLIA 4ES9A 3ZMZA 1NCRB 2UWAA 1CJPA 1GNZA 4HNAB 2CAVA 1AR81 3N4MA 2A3XA 2JKXA 5LGUA 2XJRA 1YI7A 4GQ7A 1DYPA 5BYNA 4IT5A 1BBT2 2NMOA 5FP9A 1UPGA 3N7KA 3N9NA 3AVRA 4HT1T 1NCRC 1IBKB 3AMNA 4CUGA 1VRBA 5FJHA 1WW4A 4KHPB 4PLOA 1R3LC 5L3DA 4MVZA 1OA2A 4LBEC 3P1IA 1F23A 4BXFA 4K21A 1OCOB 1LHUA 3NO8A 1H2MA 1D4M3 1AR1B 1V6KA 3J8F2 1Q3EA 2IJKA 1D2DA 4RWUA 4FPKA 3NV2A 5JLVA 2HFEC 2ZAHA 1GANA 1OLMA 3QNEA 4XDKA 1LESA 4PIYA 1P49A 3WQ1A 5FZBA 4LBQB 3QO7A 4WF9V 1OCOC 3ABTA 4IEVA 4BCUA 1ENXA 3AYAA 2TBVA 2A75A 2B46X 3AP6A 4TV8B 3JBG1 1OXCA 2XXZA 2ZINA 2QA4V 1Z5VA 1R093 4HONA 4QQOA 4YYOA 3ZS8C 4CXXA 2AYHA 4QX5A 3OYWA 3K9SA 5LHHA 5FCCA 3CEIA 2C6SA 4XIOA 5IVVA 2PHWA 1B6QA 2XBO3 2VL4A 2FMYA 1G86A 2VW1A 1AJNA 1CAXB 4LNUA 2WS93 3FHQA 1SFNA 2GH8A 1CONA 3OR7C 4R6ZA 1QJX1 1D2SA 4GALA 4NHMA 3O9OA 1ORQC 4E2GA 2B1GA 2XASA 4JTAB 2FQPA 5A3OA 5EBMC 2CV6A 3ZPOA 1JZ8A 1LOBA 3B5LB 1HWYA 2QSAA 4P9XA 4QMAA 3A2FA 2DCKA 4ARXA 3FX7A 1OLRA 3U1XA 4FM2A 2B7YA 2A9HA 4DV3B 2QKCA 2FCTA 3ZYHA 1SHWB 2UY8A 2C2AA 4DW0A 3WF0A 5IWFA 1ULCA 5K8SA 1FT9A 5C8CA 1BHBA 3VB9A 3FB6C 4TOIA 4AILC 3WP3A 1FATA 2EIEA 3AZWA 3UKVA 3AG1B 3ASIA 2W9XA 4I4TB 2N04A 2ZACA 4QWNA 4W65A 3JD1A 2VULA 4BXSV 3MV01 3AB0A 5TSWA 4J7JA 3AP5A 4EFBA 3I2HA 4DXZA 4NTYA 3ZYRA 2XB6C 4JF3A 1R092 5LATA 3I2GA 3AG1C 1LECA 1LODA 1QNMA 4FPEA 4UCVA 1CAUA 4DV2B 3OEEG 1AJOA 5FNVB 2XBO2 3URFA 4TSVA 2VXRA 2LW1A 4GYCB 2AGSA 2QQOA 1YCIA 2VJXA 1HX6A 4I3GA 4WM8B 3K2OA 1GM9A 2KG7B 2RJLA 2VCBA 1W6QA 1TME3 3ZHRA 1W9FA 2VMIA 2LGWA 3AX4A 2DYRB 4N9HA 4KFMA 5C7GA 4WFFA 2D6OX 4BMEA 4MGZE 2F23A 2ARAA 1ZBA1 2HWD3 3JALA 1FJGB 2YG0A 5DDJ2 2DVGA 4AGGA 1JA8A 2EAAA 2RMU3 4D3WA 4PELA 1DCSA 3HKEA 2I07B 3H1LH 3KZ4C 2J1VA 1YJNV 4WM8C 4BIOA 4CU7A 1J83A 2SLIA 4YHHO 4K0KB 1FFXA 1JYCA 2I74A 1PM4A 2ADDA 2DYRC 2ZABA 3AP9A 3WW2A 2XHKA 2W39A 5JMCA 1VRH3 5FMOS 1KBHA 4ZI7A 5CA1A 3IAPA 1Q6HA 3MUZ1 1UNBA 3WB0A 4P9OA 2O14A 3ZN6A 3IDAA 2P1BA 5IYBO 3GYDA 4ZS3A 5KBFA 2WFF3 1TEIA 4KWJA 3HT2A 3T1LA 4LJHA 2Q30A 2DVFA 4CVUA 1DLCA 3A8TA 2HR3A 4AVAA 1RSOB 4QU1A 1OC1A 1SPPA 1RFYA 5DAPA 3EMRA 5E89A 2MEV2 1EFRG 3QO8A 4DYLA 2PHUA 2WLIB 5BNNB 1RUE2 1AILA 1VBE2 4H44B 2VO5A 5BUVA 2GNDA 4MG2A 3Q9OA 1WPBA 3WY6A 5CA3A 1XU1A 5LP6A 4U7OA 4RHV3 2HWD2 1TUBB 3ZHTA 5JR7B 2P5BA 2ETNA 3ZBHA 1KDKA 5FYYA 5LY1A 2RMU2 1L8DA 1YJ9V 1H6XA 4Z2WA 4ORFA 1I94O 1W6PB 4AI2A 4UW3A 5BNNC 4Y22A 3B09A 4UWDA 1WA8B 5B4NA 2YC0A 1W6MA 4KGQA 3WF4A 2P37A 5ACA2 1NVPB 2IXJA 1XYOA 4L9BA 4ZHQA 4AEJA 5BNPB 4E8DA 1GR3A 4C90A 3NNJA 5T54A 4LF5B 5C8YB 1YJWV 1UX6A 3N7JA 1WNSA 5F5AA 4YSFA 5ISLA 4XMAA 2JDMA 5FRAA 2WFF2 3ZXKA 2E3CA 1MPXA 5L9RA 3HKDA 2QWNB 3VZKA 1WB7A 2XVGA 1ZX5A 5A9GA 3VBFA 4TLGA 3LDRA 5IJ9B 4IHJB 5BNPC 4GKYA 3JBG3 2ZZQA 2IUWA 3WDWA 1NAEA 1S0EA 2IU3A 4X8PA 4P9JA 5DG1A 5IVFA 3GB7C 1PVXA 2ARBA 1N3QA 4FMTA 1FD9A 1WAZA 3QH7A 2Y48A 5CFDB 1G6NA 4UFIA 2GMMA 2VMCA 4XF3A 4IESA 2E76B 1V6NA 1W59A 1GSLA 2Z5WA 2D3RA 3IB3A 4EN0A 4MUVA 1UY2A 3E22B 1QJU2 3AXDA 5L3CA 1BMFG 2F93B 4H0LB 3NJYA 5GZEA 1F5JA 5BMVB 4RHV2 5LMNO 1EP0A 5CFDC 1G1XB 4CP9A 3QACA 4FOVA 3K75B 1LGBA 3GF6A 1O9GA 2XJSA 1W8OA 3VBSA 5C8WA 3CDZB 3RZKA 1N3PA 2PY5A 4QPWA 4DR2O 1O4ZA 3NW4A 1NS1A 2UUCO 1DBNA 4IYIA 5IATA 1SZXA 3A0HZ 4YVWA 3WB2A 5FZ6A 3CCEV 1PNKA 2XOMA 1NU1H 3OMAB 3O12A 4QB2A 4CPBD 2A70A 4NAMA 2VQTA 1DQ5A 1OA4A 4EEQA 1EPWA 1DK1A 1W3XA 1O8SA 2Y60A 2PGGA 1WCQA 1OOPB 2MW2B 1NQJA 3CXCU 1YIJV 2P7TC 1JUHA 4MHUA 1ZRFA 1N8RW 1GM8A 4CCDA 4O2BB 3RVHA 3K57A 1MR5A 3OBTA 4H14A 1V55B 2D7FA 1Y74A 1S5HC 1H9WA 1OOPC 2PA7A 2VMFA 4MZUA 2EICA 4WVZA 2UUAB 1AXKA 2ET7A 3JD71 4QHBA 4MHRA 2XOKG 4EB6A 4GD4A 1Q6UA 1XNRB 2X10A 1NYWA 1ZBA3 1AVMA 1AR91 4J11A 1V55C 4YG6A 2RG4A 2IXCA 4E4HA 4CZSA 3G6JB 1JZ4A 4PLMA 5DAQA 2WN3A 3FAVA 2Y64A 4H55A 2BP6A 2FCUA 4JGYA 3GWKC 4D8MA 3J80N 3CCVV 3D3IA 3SJAC 4IL7A 1ULPA 2QTOA 2WUHA 1M5IA 2DWRA 4WVMB 1SERA 3K5LA 2PHRA 4CCLA 2D97A 4FK5C 3RFRA 2X6AA 1TNRA 4I30A 2VZOA 4UVAA 2GNBA 2UXBO 5CBFA 5FPZA 2VQFB 4XVHA 2VZRA 1MVQA 2WBKA 3I59A 1VP6A 1FAYA 2UU9O 3W7XA 2ZE8A 5CBHA 2CU5A 3MFAA 1O5LA 3I54A 2QM7A 4XBFA 4AFCA 2D3SA 2WO1A 1UD1A 5JAXA 2B45X 2JX9A 2BVVA 1MMMA 4DB5A 5IVEA 3K03A 3CC7V 2ZHNA 4QB1A 1JMUB 4OYUA 3AKTA 4I9WA 4QDQA 3WDVA 1B06A 1B3QA 2DFBA 4P9PA 5FZFA 5FPLA 2Q1MA 2K46A 4BLIA 5FYBA 1BCCH 3I2JA 1OH4A 4PHZA 4AAXA 2HBUA 4B4RA 3N9MA 1CD3G 5EJZB 4JVAA 5EIYB 5FZKA 1GN3A 3BTZA 5KXEA 4F6EA 2GP5A 5CB4B 1APNA 4XZUG 4GKKO 3Q8EA 2E5LO 2ZX4A 1CEZA 5FZ8A 3FLPA 3DCQA 4LCUC 2XAGA 2PLV1 2J7MA 5IWAO 1QDOA 4QDRA 4G3YC 4UFZA 4KG0A 2AR6A 4Q0QA 5EYPA 4BQ3A 1ENRA 1AYN2 2Q0AA 3H9VA 1N34B 4XXPA 5BZBA 1ZVFA 3I3MA 2YZ4A 4JAVA 2ORXA 3G6BA 4LWSB 1TQ5A 1NT2B 2DOSA 3H3UA 1US2A 5ANNA 3ME2A 4R9BA 1JJOA 5C8CB 3C7OA 1TZOA 2XVLA 3RZMA 1QXPA 1HRV1 3VUOA 1O7FA 2IXHA 3B40A 3O7OA 1ZWIC 4MS2A 5FYMA 1PZ8A 3VBOA 3OUSA 3GCWA 3PU8A 2IH1C 4XABA 2WWUA 4Q29A 3LQCA 2JJ1G 5C3PA 1KU9A 1UJWB 3AYEA 4XPVA 4NIAA 3ETGA 1SZTA 5C8CC 5LASA 3WV6A 2YXYA 4JASA 1HNXB 5CZKA 2VE1A 2JICA 1WCDJ 4QB6A 4P9WA 1HW7A 3KT4A 4OMDA 2R072 1X9PA 1XNDA 2X7RB 2YC4A 4OGQB 1O4TA 1UOJA 1MS1A 4JI0O 1QH7A 4QX3A 1YRZA 2YIAA 4LHNA 4WM7A 5FMBA 4W6WA 1JOJA 3CKHA 2XJUA 1N1YA 3T4DA 3MPPG 3JASA 4IGOA 4A44A 2ZX2A 2XKPA 3VD3A 2VBBA 2IVIB 1W6QB 3CCRV 1RJ7A 1XNBA 1YI2V 5IVBA 4GT1A 1QNYA 1WLWA 1W28A 4I01A 1QR9A 1KXGA 3TYJA 4DV1B 4Z1MG 4B4QA 3JALB 2XGXA 2DWDC 3TEZA 4CBCA 3ZR5A 4ISRA 2V5DA 1QXRA 4O4HA 2TNFA 5DUVA 1M56B 1H6YA 3JUUA 2EAKA 1SBFA 3T1YO 4LK6A 1W6NA 2Q7EA 1IQDC 4M4PA 2FTKA 1RUF3 4B8EA 4MVTA 2XAFA 3ZXAC 4ZI7B 5CA1B 5IJ0A 3OOXA 1G9AA 4Y26A 3R4UA 1X4TA 4I55A 3STLC 3ZN6B 2MEV1 3JD73 3DXRA 4LFAB 4CCKA 5A7PA 3QBQA 4ITCA 1N1VA 3WDUA 3JSNA 5FK8A 1M56C 1S5LZ 1AR93 3THOA 1OHHG 1SQGA 1OA3A 3UKTA 3SKJE 1X33A 4LMFA 4BQYA 1EAH3 1X8MA 4YJ3A 3OPZA 4ASUG 2UY9A 4UW4A 3CL1A 1SPPB 3ES4A 3OGRA 3E8HA 1BSMA 3BN6A 3IN9A 3U78A 2AH2A 2NQYA 3K4AA 1KB9F 4WCEV 2XLAA 4B3SB 4D94A 2KR2A 2EZPA 2GC3A 2KD7A 4NRQA 1AX2A 2ZZJA 2WN2A 1K97A 4JI3O 2W08A 1XPWA 3AKSA 4ES8A 2WNVA 4JI4B 1F15A 3KVAA 2WNUA 4NWWA 2PELA 1L7RA 3IMNA 4YVSA 5JVVA 1PIV3 4H7LA 4HK8A 3KLSA 1PL0A 5BY5A 1WMXA 3SH5A 2WAMA 3QF7A 4UFLA 3NRUA 4GWIA 2CAUA 3ACFA 3C7EA 4OVEA 1LU1A 3J4UH 4DZGA 3JSLA 2DUOA 3SCHA 2B5UA 1DU3D 5J1XA 4DR5B 3ZHQA 1RUF2 2GDFA 1DQ0A 4C1XA 4RFRB 4A7KA 2WLQA 1H0BA 4LUMA 5FLHA 1HRI1 1YFYA 5EP9A 1UXXX 3POSA 4DRXA 1CVNA 4XQ4A 4XDJA 1HJGA 1OF3A 3HKDB 2R72A 5I0SA 1CZSA 1HW5A 2GAUA 3J26N 4I09A 4GB32 3QO5A 4KBBA 5F7UA 1EAH2 3T2OA 4AVTA 3IDEA 5FV3A 3ZMVA 2YI8A 3DKQA 3OUFA 4LITA 3C90A 5GJ6A 4DY5A 1R1A2 3OGSA 3UT0A 2VZ3A 2W0FC 1BMV1 1W8NA 4AR2A 5GW7A 4JHZA 3APOA 3MW4A 4P9YA 4UCSA 4GZRB 4DOUA 4A3ZA 5IVCA 1UAIA 3L2YA 1M9NA 2QE7G 5C3RA 1V9PA 1PIV2 2R0HA 3WG7B 2D93A 1SEFA 2UXNA 1RC6A 4ZKIA 1UY1A 4HFSA 1S0DA 1RUD2 4OHYA 1O8PA 1T5EA 3WLUA 1SACA 2ZM6O 1ENSA 3B93A 3LSSA 1PM9A 1XI1A 1BHGA 5J96B 2JDZA 5DUUA 1HRV3 4TV9A 3WG7C 1OCCC 1J3PA 3T09A 4XEZA 3MHSC 5FZ9A 3B69A 4ZY9A 4ARYA 4E4ZA 1UWWA 2YXSA 2P3JA 3OSDA 3AXEA 3VBSC 1O5UA 5H9CA 2EIBA 1H2GA 1RGSA 4DMIA 4PA3A 2MK3A 4CP2A 1OFSA 3VN4A 2JB8A 1MVEA 3I49A 5KXDA 1GV9A 3GJAA 1XC6A 4K1YA 3BOPA 2P17A 2Y0OA 4B3MB 5LEKA 2D6KA 2JDUA 4LFBB 1V9U1 2XUMA 4QM8A 1FXKA 1H2NA 1X8EA 2IH3C 1QKQA 3AKRA 2A3QA 3AG7A 1COV3 3K08A 1Y9MA 4LKEA 2Y4TA 1Y74B 1FYJA 2ZX1A 2ARXA 1YTFD 2GNTA 1SLLA 3D3QA 1J1TA 1H8EG 4KWUA 1GP4A 4EB6B 2XLGA 1JUIA 2BTQA 1Q43A 3DKWA 1UXZA 3E6CC 3AZZA 5FMOL 2J1AA 4LQRA 3POIA 3S30A 1S1AA 4JDOA 2YROA 5E16A 2ZMLA 2HWC3 1PK6A 5F2SA 4JGYB 3B4SA 1PZ7A 3TBDA 2WNEA 3JQWA 3EFFK 3WDYA 3F5TA 4BW9A 1ZZ9A 3U37A 5FQ0A 5KAIZ 1UY4A 1W39A 1YFWA 4XFGA 1NE4A 1UU6A 1C57A 4HK9A 5EYYA 1LHWA 1SG3A 4PT6A 1ZA7A 4OCTA 3O14A 1K34A 1M06G 1R3JC 4JGYC 4OPHA 3NKTA 5I0DA 3Q8AA 4COUA 3AVSA 1IBLB 3POJA 4Z82A 1O6UA 3L74H 3I59B 2X29A 1ZBE2 2KB1A 5DAWA 2G9FA 2P22C 3SPCA 2Q8CA 5FZEA 4Y1UA 2WFPA 2HG5C 4RQFA 3VKFC 3RI8A 1COV2 1DZRA 2VECA 3POEA 4B3RO 4AQYO 4RAIA 3JARB 1X36A 1D2QA 4N7IA 1VBB1 1STMA 1BGYH 1HXS2 4FAHA 4Y5Z0 5JSRA 2WC2A 3PU3A 3FBMA 4QXKA 4JYCA 2JIJA 2RS13 2AACA 2QTWB 2P3YA 3VD4A 4M0NA 1UIKA 2VNVA 1JZ7A 5I8SA 5C3SA 4BQXA 4AI1A 3ZRWA 4CC5A 2F1MA 1W2UA 2Y26A 3AM2A 4QQPA 1JYXA 5IK4A 3H1JH 2DVAA 2R041 1D4VB 4Q4W1 3TEXA 1PHMA 3RRDA 1JYWA 5F3EA 2YXLA 4IIJB 3ZXJA 4QAWA 2F95B 1Q86W 3JQXA 5FP8A 2ARCA 4NHKA 4DO0A 1XNKA 3N7MA 3RYHA 2AZ5A 1ZTEA 2WZEA 1TNFA 1OKQA 4KNCA 5F5IA 2JWPA 5J37A 4Y1VA 1YQ5A 3ACLA 5JUVA 2R16A 2Q8VA 1RUG1 3AKQA 4Q4V2 2RR12 1QLEB 4XHXA 4FM0A 1W0KG 4I5SA 3VD5A 1DP0A 3F5WC 4YG0A 3WDXA 3MI8A 4FFBA 3K9AA 4FPYA 3GNEA 3U75A 3OGVA 1WB8A 3CD6V 1V70A 4D6SA 3T1CA 1VAVA 1O3QA 3UGFA 1MZFA 3Q4HA 2R6QA 2WQZC 3SCFA 1QLEC 1UFIA 3VBOB 2FDIA 4G4FA 3I55V 3MV11 1ND3B 2RS12 1JYTA 4WFHA 4JI5B 5A3WA 5A6ZA 3JD2A 5ANQA 2V1DA 5B2GB 3RYFA 4FP2A 1GTOA 4ISQA 3OFNG 4LF6O 5CMUA 5FY9A 4J42A 4W8JA 1UOBA 1G9FA 2VQUA 5G05L 3VBOC 5FZLA 1KC8W 1SRYA 2NP0A 1SLIA 1YXWA 4COZA 4XILA 1ND3C 4CZZA 4L8QA 3NNMA 4YXWG 3SH4A 1VALA 2A1XA 1JHNA 3DECA 1LGNA 2UXCO 1FX5A 4D6TH 2VMHA 5CNAA 3HNBM 2RS51 1TVKA 4XAEA 4L99A 1Y9GA 4PJ0Z 3U11A 3CCMV 1UY0A 2K9PA 3IWZA 5G04L 4ZXEA 2QE3A 3B02A 2FDHA 2IWGB 3HPNA 3LSEA 4QGLA 1SC5B 5KMGA 1RXGA 4O4HB 4PV1B 4COYA 1IXBA 1LNSA 1E1RG 2ZNIA 4M3CE 3OG2A 1W6NB 1H8HG 3WNXA 2PAMA 2CGPA 4TQDA 3DC5A 2HYKA 5IJ0B 2VMEA 2H94A 3IIIA 4J41A 4I55B 1LAJA 3DXRB 1UMZA 1EN4A 3JAKB 4MXVA 4R8CA 5KHJA 1A3KA 5DAXA 4YY3B 5JH7A 4EN8B 5FPXA 1US3A 3BGAA 3OB8A 1WD3A 5IFTA 5FYCA 4Q8KA 3AG3B 4YJ3B 3VBBA 3U4SA 2F4VB 4LEJA 3ZYGA 5FYZA 1VLNA 2F17A 2JJ2G 1N1TA 1UOFA 1POQA 4W4LA 3VD9A 1GWKA 1AR4A 3VBUA 3O1VA 2Q1FA 4CA9A 3WFVA 3RG0A 4QX0A 1AX0A 1GICA 3AG3C 2DWEC 2LRPA 2YU1A 2WNUB 4D0QA 4IGPA 2ZHKA 4A6SA 3RZGA 1US6A 4YVSB 4Y33A 2QR4A 3H8XA 2A7AA 4AW7A 4FXKB 2P4EA 3QTCA 5C70A 3ZO0B 4O4LB 1HNWO 2FHRA 2I45A 3T1MA 3LEMA 1EYBA 3L71H 1TGOA 3MLJA 1HDKA 2CK3G 2HWB1 3PUSA 2WNUC 4LKDA 2V72A 4X1KB 1S2BA 3HD8B 1Y66A 4YVSC 3FKSG 1VBB3 5AFBA 4RS5B 1UO9A 2QJVA 2AHZA 1HNZO 5JSPA 1SLTA 1GUIA 1FFTB 4GJZA 3P32A 5D2AA 3A0NA 1HV0A 3VHNA 1L0NH 2ZHMA 2OX0A 2VG9A 4GX1A 1KD7A 2YGLA 4HMZA 3IPVA 4RS5C 3RGBA 1RB8G 4Q4Y1 5FMDA 4UUJC 1QDCA 1S55A 1WN7A 1QJY2 3R65A 1X50A 2FZ1A 1LOGA 4N43A 1IURA 4HZFA 4AE2A 1RTVA 1URFA 4YZ2A 5GLZA 3FZ3A 2ADQB 4GLXA 5JCOC 4MYEA 4AGRA 3CX5F 2GH2A 4MGTA 3WG4A 5BNOB 3MD0A 4LLOA 1BS3A 2RDNA 1SCRA 1QR8A 3LB9A 4X62B 5CA6A 1GZCA 3R6SA 2A3WA 3WR0A 1T6GC 3FB7C 2DURA 4XF0A 2DCYA 4JYAB 2CE4A 5CA0A 2PHDA 5A80A 3MBWA 3W7TA 5BNOC 4RQPA 3WOGA 3ZYJB 2R0FA 4LBQD 3VD7A 3O1SA 2C9AA 4YZ1A 5IK5A 4MOAA 5AC92 1SBEA 3OD0A 3I8TA 5LK5A 3ACGA 5GALA 3UJOA 2YPDA 4FZ1A 3E86A 2QEXV 2PN5A 4IEXA 4K7JA 1ZA4A 2XHBA 2OWOA 4SBVA 4CH6A 3ZN0A 2B9VA 2YC2A 3IBMA 1IPSA 4E4EA 3I3QA 1SBDA 2VU9A 4DR3B 5IYZB 1RUJ1 5FZIA 4PDWB 3WF1A 4UV8A 4N23A 4LIUA 3LFIA 2X6BA 3TNQA 5IW0A 3L9DA 1AR72 2XJVA 3ABZA 4YJ2B 3K06A 3RVYA 5EJ3A 1CAVB 2H8PC 2RS53 1TMF1 2IFRA 1QJZA 4QKBA 4JCKA 4XHBA 3K5MA 1IBMB 4X65O 4JV5O 4QM9A 1NA1A 4MXWA 1DGSA 5B3SB 3M8LA 5C6CA 4X1IA 3CJIA 5GLWA 1YYNA 1Q5OA 2BGPA 3TB0A 3CRMA 3KQRA 1VJ2A 1HN1A 1IDSA 1QNWA 2Q69A 2Q5ZA 5GZGA 4NXMB 5A1FA 5HV0A 1DZTA 1PK6B 4P08A 4HYOA 5EXOA 2IJHA 1F5FA 4P5YA 4JI7O 3BFRA 4JI8O 3H42B 1UU5A 1CZVA 2PQSA 2Q6AA 2XNDG 1UQXA 2GUZA 2ZKNA 4WBNA 3PN1A 5FQ0B 5B3SC 2PYJA 3OF1A 3E35A 1IVSA 1NLRA 3C3VA 1T6BX 2DU0A 3ZDVA 4OPAA 1K3EA 2LJ2A 2ZEZA 3VKMA 3VDBA 1XJAA 4NOTA 5C3QA 2LQTA 3WF3A 3LAGA 2WA4A 3O1PA 1PK6C 3ZOIA 3IC7A 1VBD1 3VL8A 3CEWA 1F8VA 2ODMA 4COVA 5FXXA 4DXWA 1MACA 1GKBA 4OX9O 1W8ZA 3LCPA 3FB8C 3WNMA 4Q4X2 1WKYA 2HWF2 3VBRA 3H1HH 4JTCB 2PXJA 1KYOF 2D5HA 5CADA 5FIXA 3TWIA 1E5RA 4FPGA 2PUSA 4DV6B 5JJJB 1MS9A 1O3SA 4DUZB 3PTRB 3R66A 2WYFA 2D5FA 1K4CC 3E6DA 4IV3A 3ZKYA 3T4ZA 3ZIXA 2RMKB 1V6LA 5LEJA 5H6QA 3NJZA 3A21A 4MVQA 2Z69A 1JOYA 3ZMNA 1G7YA 3G7DA 5L36A 2AW9A 3TGUH 4HKWA 2AENA 3OE7G 4B4PA 4YLZA 3LOIA 2DYSB 1HR0B 1DG6A 1YNAA 3OGGA 2B8MA 2ATKC 3R4SA 1NJIW 2HWB3 5D21A 1NY71 1FOD1 4FP3A 4LFCO 3WP6A 2RS31 3T0DA 1NCRA 3MDPA 3A7QA 2P90A 2ZXQA 3W21A 5KA5A 4UVCA 1DHKB 3RYHB 3UK9A 4BW5A 3DN7A 4QPJA 4KU7A 1YUDA 2DYSC 5DZEA 3AG2B 2EALA 3DXUA 1LULA 4XUPA 2VOWA 2ZS6B 1DYKA 1P84F 3CWBH 2N7GA 3HT1A 3VOUA 5E8AA 4P9IA 2HP8A 1Y76B 3K0GA 5HCBA 3OCPA 5I8YA 4Q4Y3 5JR2A 1JPXA 4FFBB 2WIIB 3LDBA 3SJBC 3LSQA 3EXUA 3AG2C 4LBNA 1AROP 3OY8B 2D6PA 4LF8B 2P4KA 3PJSK 4ICGA 4HN0A 5E1RA 3VZNA 3P5BA 2X0LA 2VQEO 2ITDC 4DV4O 1W9TA 4B08A 4OUSA 3V64A 4DXTA 2N74A 3CC2V 4LBQA 1B04A 2VVFA 1LUVA 2L6LA 4BDVB 2JDIG 3NVCA 3D0JA 1R083 3RYKA 1NVPD 5CEHA 1YIFA 4TV8A 1YEWA 1RUC3 1GMGA 2C4XA 2QKSA 3VHOA 3RYCA 1V54B 2LW7A 4PD4F 1GNHA 2DTWA 3BALA 2QZ2A 3UT5A 4NIDA 4IEYA 3O5SA 5IY5B 2FZ2A 1LRHA 2ZX3A 3AZVA 2PHTA 3B9CA 1N36B 5HCHA 3AP4A 1MA1A 5EV7A 2DN9A 3OBAA 4M4RA 1W8FA 2JDPA 2HWE1 1M93A 1K5MB 2GSYA 5LK7B 3TN93 1TVKB 5JWPA 4PDLA 2RM21 1Y67A 1V54C 5A3UA 4BZ4A 3ZXLA 2XAQA 1AI7A 3UESA 5IY5C 2JIGA 4KQ7A 4FTSA 2NM1A 3MO4A 3IGAC 4FLXA 5LBBA 5KMGB 1K5MC 5FY1A 1RUJ3 3FJSA 5JZGA 1VEWA 4URAA 3WQ7A 3T30A 4I2OA 5ABJB 2CY6A 3B77A 3HWJA 4EZ4A 3ZCCA 3F7YC 3RZLA 3ZX7A 3SJCC 1JZ3A 3TXQA 4K8RB 2OYZA 1H30A 1VAMA 1R082 5JH7B 3B2EE 3ILNA 2YEVA 3CMEV 4MO3M 1RUC2 5TISZ 3ZX6A 1I3HA 4CS3A 1XNQO 5ABJC 4QT6A 4JI6O 5LOVB 1QOTA 2WABA 5CIRA 1F4MA 5FNVA 3KGLA 3IM0A 2WINB 1E5HA 4NXNO 2ZGMA 2VUJA 2IZWA 1FPN1 4WM8A 4FQZA 4B29A 4DR1B 3P3PA 4QQ2A 5E1AC 4X66O 3M3IA 3SPIA 1RVF1 2GNMA 2EXJA 4MVMA 4P2ZA 4GKJO 1F35A 2J1TA 3NR7A 1FV3A 2Q1ZB 1VBD3 2WZ8A 1F31A 2DUPA 1QF3A 3GBGA 4FCAA 1WW5A 2J1EA 2Y34A 1W8UA 5KXCA 4X64O 2AXTZ 3LIHA 5KAFZ 3DGTA 1XMQO 4X6QB 3L72H 3LE0A 1QOSA 2BBVA 1BQZA 5EJ1B 1Q6IA 3HBKA 4KU8A 1OUSA 1AVBA 4XDQA 5EBWC 5F5QA 2BPA2 1CAWA 4UFKA 5B1NA 1BK1A 2DTYA 1PO21 3LGRA 4FAGA 1A34A 4R4ZA 2DJVA 2GN7A 5FP4A 3LPFA 3SPJA 2WPDG 3OW2U 4MT8A 1LEMA 4AAPA 2H0BA 2GZWA 5CKNA 2JG9A 4A45A 2ZPXA 3DC6A 1I5XA 1NCQB 2BTOA 3POBA 4C7UA 3B7MA 3IPVB 1RSOA 2DCZA 2BEOA 4EYUA 4N9IA 4B3NA 4BWOA 4R9CA 4CDUB 2HLEA 1FOD3 3AFGA 4YW3A 2R1DA 1PNLA 5L3GA 3JD0A 4A7YA 3D36C 4BQ1A 2BNMA 2WLIA 3I56V 3THTA 5BNNA 2RDSA 4LT5A 1H1AA 1WMDA 1K4DC 4FBFA 4DV0O 4QIWF 1Z2GA 2UXDO 1BCXA 1NCQC 4M3CB 1SZBA 2GDSA 2VOXA 5IAXA 1PVC1 1U5ZA 1PL4A 3I2OA 3D6EA 4CDUC 2VNOA 1BZKA 4I0BA 4MTGA 2BTVC 5IK7A 1RUOA 4YRDA 1BXHA 3CF6E 2FMDA 3ABKB 2CYFA 1C3HA 1W6PA 3DL3A 3IDCB 5FOJB 4GX5A 5J7MA 2DBIA 2FKXA 4OUEA 3K5NA 3D82A 1HB1A 3LNMB 3L70H 3D0SA 5JVDB 5H9QA 2GU9A 3ZIAG 3KM5A 5BNPA 1WUVA 3OBRA 2PI4A 2MNGA 2WDBA 1J5EB 1XUQA 4JAUA 3E5XA 1W0OA 3ABKC 3KS7A 1C1LA 3ABUA 1KKDA 3D3AA 2RDQA 3K3OA 1LUWA 3CSXA 4JI2O 1GOHA 4IHJA 1KMIZ 3OMNB 1BT8A 1OLQA 4U3FH 5KWRA 4DRVA 1DQ1A 1F4HA 3H8OA 3I2KA 1T2XA 1AR62 3DTUB 5BR8O 2K2SA 1UZWA 3DPRA 1OCZB 2P3IA 3M7MX 5FK7A 5IYYA 2HVJC 3G4SV 3E22A 2HWE3 1IS6A 4AHCA 3JCIA 2Y0IA 2RM23 3WUDA 3IFXA 4PCRA 1R3IC 2DQ0A 5F3CA 4MXWB 3SEEA 3CJIB 3HB3B 5H2FZ 4XDPA 3THPA 1OCZC 4U3JA 4KI5M 5KLVH 1UY3A 2PYTA 1K73W 1CJDA 3TK1A 1YITV 1UZYA 2R062 3HEIA 4DR6B 3GVMA 1NLQA 5GZCA 2ZKLA 1PD3A 2GUZB 4WBNB 1FMD2 1JZ2A 2K9ZA 3VDCA 2R32A 3WW4A 3CJIC 1JYVA 4F6RA 3T2TA 5CKQA 1UX7A 2EIKB 1UMHA 1L3JA 5C33A 2R9RB 5FZ1A 3OJBA 1NKDA 3LUTB 4Y5SA 5GTHZ 3OEAA 1XRUA 1OOPA 5GLTA 2K0GA 4KXRA 2XL9A 2XAHA 2RN9A 3ZFFA 1EV12 4UB8Z 2HHHB 4UT5A 5FAXA 1VBC1 3K3WA 4CDQA 1X7NA 3KGZA 2EIKC 3RQ0A 3RVZA 4XJUA 3OAAG 2AREA 5JXJA 4CCJA 3KT7A 2ZGPA 4CH5A 3M3OA 1FPN3 4YZ3A 4YFWA 3JCZA 4Q8LA 1Y9QA 4FLTA 2YY1A 1GN6A 1RVF3 2LW8A 4PA6A 3BY6A 4N7UA 4IV3B 4JZRA 4NROA 1A8DA 4DV7B 1I0HA 4NUBA 1D0GA 1C8M2 1W2BU 1VQMV 1UKGA 2D43A 3ZPYA 4NKGB 1PO11 2ZGSA 2VOKA 1KDMA 2WT1A 1AYM2 1J84A 4LIVA 4IV3C 3DYOA 1VQ4V 4WVMA 3NNGA 4IEQA 4Q5OA 3HMYA 3GWOA 4XTPA 5J36A 5FUPA 4RUFA 4RFT0 1KD1W 4XDLA 4ZONA 1X82A 2ZCWA 4E8CA 4JGSA 4LF8O 3VDAA 4DUYO 2ZJCA 3KG2A 3Q8FA 2PF4E 1R6NA 1AL22 4QX7A 3MLLA 3I3DA 1UPIA 1K92A 4XUOA 3O0VA 1DZQA 4KL1A 2ZE7A 1MEC2 4FPPA 3V0BA 5I91A 3V0AA 5CVRA 3KT1A 1HIXA 4FFIA 3F7VC 2GHYA 3LDKA 1UIJA 3BI3A 1LU2A 2GC2A 3ZMTA 1W90A 3FLRA 3JATB 3GZTB 3HJRA 2ZHLA 4GH4A 3UO3A 4F4LA 1GOGA 4HSLA 2VH9A 4P02B 1H8TA 4QNHB 3MF6A 2JDHA 5FREA 1N1SA 4PLNA 4LHKA 2EF6A 1PVC3 3AEIA 4HSJA 1JBCA 2V4DA 3CP1A 1U12A 3OPTA 4Y1ZA 4R8HA 2E33A 5CB4A 2C0ZA 3RYCB 3KHBA 3RMXA 2B39A 3FC0A 2ADPA 1U0AA 2PI5A 3UT5B 2W47A 2IJIA 3I2FA 1YHQV 4GA9A 4NN0A 3HNMA 4XE9A 5LA0A 2OW4A 4XIKA 1NKGA 4I3PA 4DR7O 4N53A 1NR1A 2R9IA 2W1WA 1COWG 3V65A 4FTEA 1V6OA 3OTFA 1RUI3 4S2DA 3BA8A 2AGAA 4I50A 3OPWA 4JI1B 1LR5A 4Y4RA 3AJZA 2EJ7A 2ZKOA 3MFCA 2F66C 1CPMA 1HN0A 4FIPC 1W8TA 4X20B 3CRAA 4LWSA 4B3TO 2W6JG 3GGLA 3SPGA 2BYVE 5K0UB 3M2MA 1AHSA 1JXNA 3MUY1 3KMHA 5JZGB 2ATFA 1D4M2 2GALA 1VP7A 3MIFA 4Q1PA 5CB7A 2G9ZA 1DGRN 2OUJA 3T1HB 3DGEA 2DE0X 3BVOA 1V0AA 2BBAA 3B8MA 3SEPA 4A2UA 4E2SA 3WU2Z 1G4YB 3WUCA 3CPWU 5K0UC 1AZDA 4DR4O 3UGGA 5LMUO 2B42B 1Z7S1 1R73A 1VQ7V 3ASNB 2YEVB 1IGOA 5JZGC 3HKBA 2Q4PA 3G80A 3KWVA 1XILA 2WZR3 1ZZ7A 4LULA 2G4IA 4X9QA 1RJ8A 3GCXA 1PGW2 3W7WA 3WNLA 4DFSA 2C9KA 3VZJA 1VARA 3P3NA 1ASJ1 1D5NA 1ZL8A 2WS92 1Q90D 3KHCA 1S0GA 4LBJA 3B9IA 3ASNC 4H7MA 3VQXA 3LEGA 3SMHA 4K1ZA 2OQ6A 4TQFA 4QPIB 1O59A 2VQAA 4FSJA 4IYHA 1VBA3 1XMOB 1POV1 4RGKA 2Q0OC 2KXLA 1IOAA 3U14A 1I5PA 4UYBA 3S7IA 2XONA 3WINE 1EM1A 3NWKA 1VBC3 4Q6GA 4AHZA 3O1UA 4OHVA 1PGL1 1N32B 4XCAA 5E88A 3W5MA 3LA3A 1JZ6A 3HN1A 1RHI1 2VC9A 4NE9A 3POWA 4PA9A 1I9RA 4Y3OA 1WD4A 2NPIA 2ZT9B 2DVBA 2UUBB 1CAWB 5FXZA 1BZWA 3JYCA 3OGIB 3WD5A 2ZGKA 4FM1A 3SC7X 3WXPA 2HJDA 3SISA 4UW6A 4LF4O 4XC9A 1VIWB 2XWJB 4RD7A 4YW2A 1DGRA 1QQP1 3F2ZA 3W58A 4OUMA 2JG9B 4RN5A 5B4XA 2VPVA 2BERA 4YM1A 2WZR2 4XJWA 2Q8OA 1FPOA 1S0IA 3AK1A 1RUH1 1PO13 3JD3A 1C4RA 4NO4A 3BU0A 1K8AW 5BXXA 1SDWA 2A6WA 4CH3A 2JKBA 3OTOB 4QXBA 1KEXA 1AR83 2L35A 4LF7B 4NWVA 5K1PA 1WCUA 1BEV1 1URXA 1LCLA 1FI2A 2JG9C 1TG7A 2D98A 2UWBA 1TME2 1LTEA 3SLIA 2Z42A 4P9LA 2QDRA 5FPOA 1N33O 3SCGA 4H37A 4AFBA 3VZLA 2YI9A 1ULEA 5DABA 4P00B 5IAVA 4K40A 5FLXN 1VMFA 1WGPA 1SCSA 2EULA 4QU2A 2ILMA 1E79G 2X09A 3B01A 4XBNA 4PI0A 5HFLA 1AP6A 3RDIA 4LF9O 2W0XA 5FZ4A 3K04A 1OBNA 5HCFA 3K3NA 4K8XA 3NQHA 1PMHX 1VRH2 3ROUA 4PQ9A 4INDA 4EN6B 3INAA 1UYXA 3WNKA 2C24A 4BLJA 2ZE6A 1QMJA 4DV5B 2HJFC 3USSA 4XZPA 1AUYA 1W04A 2PZSA 4BM8A 1W03A 4XJZA 5IDJA 2EILB 3ZSLA 3FUOA 4AQ6A 3G71V 4IGQA 2X5IA 5CFCB 1KQSU 2ZGQA 4Z8BA 3FBYA 2GC1A 1L7QA 3SJQC 3O1MA 3VLBB 4G2KA 3MIBA 3M4FA 4QQHA 2XR4A 3DPRB 1CESA 3QOPA 3OMIB 1AR82 2W1QA 3WZ1A 2A0LA 3ZVXA 2EILC 2DFCA 1BK0A 5EZYB 1QJX3 4DUXA 3KF5A 5A1AA 1AJQA 3LSDA 2DMXA 3A0KA 5CFCC 2QQVA 2K1EA 4HANA 3HIFA 1AB3A 1E5SA 2OTJV 1RMU1 1QU0A 4AZZA 3SYPA 3DV8A 1BJQA 2ZNJA 1VB2A 3DPRC 4Y24A 4U3JB 5FPUA 2W52A 5LGTA 2V4VA 5A6QA 4P9GA 3USUA 3TOJA 1EV11 1BVVA 3ZYPA 2OT7A 2CTWA 2QQJA 4QGMA 4CS2A 3VBHA 1J59A 4QGNA 2HBTA 5C9AB 3H1MA 1W0JG 1VAKA 1IXMA 1VQLV 3POFA 5LRRA 4FFHA 3NAPA 1CXZB 2WJSA 3D4KA 4F6RB 2W5FA 4AEKA 4A5UB 3NXSA 1S3JA 4Y20B 1MS0A 4E2QA 3NJVA 3ZRXA 4UCUA 3GALA 3LD8A 1IPKA 3CNAA 4RQEA 4B7EA 3WX5A 5C9AC 3H3ZA 2XG3A 3JBG2 3ZFFB 4CRQA 2ZR3A 4CDQB 3VKOA 1ZLZA 1ZREA 1ASJ3 3OUHA 4LO4B 4J7KA 2YPJA 5EC2C 1P4RA 1OJHA 3AMQA 2ETEA 2YIBD 3ZYBA 1M4WA 2DYCA 4L11A 4Z1VA 4JX0A 3ZFFC 2W95A 4X8AA 5JMOA 1F4NA 4DPNA 1C28A 4CDQC 4GMP1 4UF0A 1W9WA 2JE7A 2JE9A 1JQ0A 1BBT1 5GLVA 1K9MW 4LBOA 3OUIA 1WLCA 1HB4A 2O8OA 4YWAA 1UPSA 3WHUA 3I2IA 4CEYB 5EK0A 2DQ3A 2NLJC 2MHFA 2YGMA 1GZTA 4X88A 4NHLA 4KWKA 1IBKO 1NI8A 4OHZA 3ZXGA 2XHNA 4KHPO 1GMMA 3OM3B 4B1MA 5FR3A 3AJYA 1MS8A 3ZSJA 3TNPB 3I3BA 4U7NA 3Q8BA 3J8F1 1GK9A 4XFCA 4OI2A 4CEYC 4JKMA 3HN3A 3LA2A 1QU7A 2H6CA 2P06A 5IE9A 4DK1A 2YFZA 2YBPA 3S5AA 2D6LX 2WLLB 2QFEA 3ZSKA 1NTKH 3BABA 3POGA 5LL6Y 5CBLA 5EHDA 4NYKA 2CTPA 4BAYA 1K5QA 4KUMA 1RUH3 1QBZA 3V0BB 3V0AB 2BWAA 3RPQA 5JXHA 4DS0A 2WT0A 2LALA 1VMHA 2VUDA 2JIZG 1KGYA 5LXTB 4JDMA 5FPRA 3JARA 2XJPA 1YQ2A 2HH9A 4LPLA 1VQOV 3IZOA 3QD6A 4GH4B 3IAQA 2D3PA 4DRRA 1BEV3 2RJ2A 1H8TB 3E8FA 3VHPA 3CZJA 1TAEA 2OT5A 1W2OA 1EN6A 4EWAA 4JC1A 3KQ4B 3BYWA 4ASKA 2EX3A 4PIXA 1ZBA2 1X9TA 3BTXA 1SLAA 3HKCB 1D5AA 1JOPA 3HQXA 5GLUA 4YHHB 1BE3H 1ZX3A 2E75B 2OCHA 4GH4C 3BPZA 5ERLA 4ONUA 4MGYE 2ZGTA 1H8TC 2DV9A 1YJKA 4F3JA 1W8WA 1ZNPA 4IIJA 3OD4A 3HPLC 5F8PA 5CAZA 5LA9A 4DV3O 4MGSA 1K33A 4W6YA 2QWQB 2BNNA 4N53B 2OTLV 1QHTA 4Z2AA 2LGQA 1XL4A 4D7SA 1EUTA 2BSKA 1IS3A 3N7LA 4I50B 3UETA 2ZGLA 4OLLA 5KX5B 4META 1ND2B 1V00A 1DF5A 2OPKA 4FLZA 2W92A 4CU9A 4SLIA 4Z92B 1JU3A 2D44A 4FPFA 5KHGA 4N53C 1R091 2JB4A 4DW1A 3WCSA 2CSGA 3LOBA 2ZGUA 1SDDB 4FJCC 1H1IA 2XBO1 4YARA 1NT0A 2V09A 1ND2C 2Y0PA 3OEHG 4DV2O 4AI8A 1S5JA 2CGNA 1ND3A 1C5IA 3BODA 5C71A 1RMU3 5A3MA 1I94B 2VRZA 2OIGA 4FOWA 5FZOA 1PKXA 2XT9A 3E2EA 3LNNA 3HKBB 2W6IG 2FMLA 3G67A 5DDJ1 1ROPA 2IW5A 4CUBA 5GONA 2QVSB 1FJGO 1FNYA 1RPOA 1UW8A 1ZL8B 4YZ4A 2B9UA 1W2TA 3B8NA 3K51A 4R9AA 3RWKX 5H9RA 3UCSC 1NX9A 4K0KO 4TWTA 1MQTA 3OEBA 1CN1A 2YIBA 1G8MA 2WO7A 3TAYA 3ZMOA 1J58A 2QQMA 4I0XB 5FPVA 1FXZA 1C8NA 3L73H 1QQCA 3ATGA 4TUYA 3T2QA 2A73B 2WAOA 4NHXA 1A6CA 4LR4A 1S0VA 4JZGA 5DPNA 4LKFA 1MSDA 3AMMA 3TEYA 1I08A 3IIAA 4AGVA 5JI9A 3FLTA 1OLME 5I93A 5FZGA 1NR7A 1HB2A 1R1BA 1OMIA 5BV6A 3RZHA 5LMNB 3ZFEA 1UYZA 2Q67A 3KD4A 3SNMA 4ZKTB 5FZAA 4Z07A 3JAKA 1RUE1 2R1BA 1VBE1 3VHRA 4XETA 4GMP3 2H3OA 2EVXA 1BBT3 3AC0A 2HWD1 1PPJH 3ZEDA 2VM9A 2YIDA 4DR2B 5A2QN 2UUCB 4EZHA 4AEDB 3CCLV 2RMU1 4MTXA 1J3RA 5K1XA 1GM7A