3ETQA

X-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
total genus 65
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3etqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3etqA02
3FWEA 3RYKA 2E9QA 2H0VA 3DL3A 2VECA 3OD0A 5FLHA 3NSTA 2GC1A 2CV6A 4Q0PA 4KWLA 4PIXA 3ELNA 1ZZ9A 5BY5A 4PIZA 3H9AA 3RNSA 2OA2A 4KU8A 4TLFA 1ZZBA 4XFHA 2XLFA 4AXOA 5KHJA 2BNNA 2OYZA 4WZCA 2BEOA 1O7FA 5CVRA 2IXJA 3SHRA 3M3IA 4J1WA 1XRUA 3O14A 1J3QA 4XFGA 2VPVA 3CLPA 3TNQA 2ET7A 3CO2A 3FFQA 2XLAA 1O3RA 5I0TA 3TNPB 1CAXB 2XL9A 2GC3A 2OZ6A 4EV0A 1X8EA 4K8FA 1ZZ7A 4I2OA 4ONUA 3G7DA 3H1YA 5CADA 2ZKLA 2H6BA 5KHGA 5BV6A 4L11A 3D0JA 1O5LA 4QGMA 3RDIA 5JSRA 1PM7A 1VJ2A 5FPZA 4E2SA 1X8MA 1YFUA 4R52A 1JUHA 3U10A 3WW3A 3QACA 5BPXA 4LLOA 3LWCA 3S0MA 1RUOA 4HVOA 3S7IA 5FDBA 3OTFA 3UKNA 1VP6A 3RZZA 4QXKA 3E6DA 4N9HA 4I01A 3I59A 3SCFA 4PJYA 5JSPA 3FX3A 2O8QA 5KHKA 2UYBA 1X7NA 4R8HA 1WA4A 4OFGA 5I8TA 4HN1A 2Q30A 4XFBA 1FT9A 3ROUA 2PAMA 5HI0A 1TQ5A 1ZVFA 2QCSB 1ZRRA 2QNKA 1YWKA 3MDPA 4XF4A 4EROA 4BIFA 1UPIA 4NVPA 5C8WA 2IXLA 2Q1ZB 3ES4A 1L3JA 5FCCA 4LEJA 1ZZ6A 3IIAA 1O3QA 2B5HA 3CEWA 3BCWA 2B8MA 4EWAA 1UD1A 4X6RB 3KGZA 1GQGA 4I3PA 4IESA 2D93A 4XF3A 3USSA 4IERA 5F1RA 5FQ0B 1J3RA 2PYTA 4HN0A 3ACLA 3BU7A 4J1XA 3CJXA 1J1LA 4YSFA 4UBGA 4Z07A 4XFFA 5BXXA 3U11A 4H7LA 4XF1A 1CAUA 2ZCWA 4QM9A 2PTMA 4KU7A 4EWEA 1CAWB 2Z69A 3L2HA 1QXJA 2UY9A 3MYXA 4XETA 2BNMA 4XFCA 2GU9A 4DINB 5I0RA 3MPBA 4I09A 1CAUB 3OF1A 5JCTA 1X82A 1CAVA 2GH2A 4HSJA 1EPZA 2QVSB 5JAXA 5CU1A 5BUVA 3CF6E 4KL1A 3FE5A 2KXLA 5KBFA 3BPZA 4Z82A 3PNAA 2IXKA 2PHDA 4D7TA 4HMZA 4QMAA 4CYDA 4FBFA 1H1MA 4FAGA 3ETQA 1CAVB 3I7DA 1ZRCA 1NYWA 1SEFA 4HLTA 5I93A 3SCHA 2PAEA 1SQ4A 3I54A 3C3VA 2UY8A 3WW1A 1CAXA 4N9IA 4FT8A 5LRSA 2GC2A 5J48A 3OCPA 2PQQA 3FZ3A 5FLIA 1RTVA 1Y9QA 4KWJA 4XFAA 3ST7A 2CGPA 1I6XA 4F7ZA 3CL1A 4OLLA 3FHIB 4BHPA 4MUVA 2IXCA 4IEOA 1YUDA 1ZZ8A 4E2QA 2DCTA 4IEUA 4I02A 3RYPA 1RGSA 3IDCB 3UKTA 4FAHA 4KWKA 1CGPA 1DZRA 1NE6A 1O3SA 1H1IA 4JV4A 5LRRA 2FMYA 1QWRA 3LA2A 3EHKA 3IBMA 4XF9A 4MGYE 4UBHA 2WFPA 3GBFA 4PIYA 3IWZA 1HW5A 4MGIE 3HT1A 5FLJA 4JTNA 2P17A 3S7EA 3H50A 3QOPA 4GULA 2PAKA 3H1WA 4IEVA 4ZU4A 3HIFA 4L2NA 4Q29A 1ZX5A 2BGCA 1UW8A 2GAUA 5JSOA 2K0GA 4HSLA 1EP0A 2PHLA 3DKWA 4QX5A 4E2GA 5J7MA 1NZCA 2F4PA 4A2UA 4MGKE 1RUNA 4META 4I0AA 3KMHA 4HZFA 3MZHA 5J3UA 4LTAA 5E16A 4ZU5A 1ZZCA 3WW2A 3H7JA 2XGXA 2MHFA 2ETEA 4ORFA 5FQ0A 2XKPA 4P9GA 2XL7A 1WLTA 4ZU7A 2PA7A 2D5FA 4LA3A 3NL1A 3E6CC 2K9ZA 3JZVA 5I0SA 3HT2A 5I8SA 1SFNA 5D1IA 4Q0VA 1Y3TA 1DZTA 2V09A 1CAWA 2HKXA 4QM8A 1XE7A 4IEXA 3WW4A 1LR5A 4QGNA 1G6NA 3KGLA 4BH9A 3H7YA 1YFWA 3PLQA 2GC0A 2FQPA 1Q3EA 2D5HA 3HQXA 3EQEA 1J58A 2QDRA 1ZREA 2MPFA 3N4MA 3OGJA 3DV8A 3KCCA 3H3ZA 2Y0OA 4WBBA 1OI6A 2XLGA 5KHHA 4I0BA 4IEPA 1ZRDA 1LRHA 1NE4A 3EO6A 2HJIA 1ZRFA 4F8AA 2Z2SB 2XHKA 3E6BA 1OFNA 3M70A 1XE8A 2Q4SA 2XKOA 5K8SA 3UKVA 4Q0UA 3E5QA 5FPXA 2EVXA 1FI2A 4MZUA 3BB6A 4QGLA 4IEQA 3NJZA 4HVQA 4X6QB 4MGZE 3NKTA 3B02A 4IETA 2B9UA 2IC1A 4MV2A 4Q0QA 4YRDA 3H8UA 5EFUA 3LAGA 3SXWA 2CAUA 5EZWA 3GYDA 1YFYA 2OZJA 3FJSA 4RD7A 2I45A 1FXZA 3BALA 5I0UA 1GQHA 2WC2A 1Q5OA 4AQ6A 3PVBB 3H1MA 2GZWA 3D82A 4D7SA 1RL3A 2IXHA 2O1QA 5LEKA 4IEYA 4BYYA 1UCXA 4AVCA 4WVZA 1PMIA 5E1RA 2VQAA 2UYAA 4LA2A 5I91A 1WGPA 5KHIA 2BNOA 3RYRA 1EY2A 3EJKA 1Q43A 4XFIA 4AVBA 3D0SA 2IXIA 3E5UA 5LEJA 1U12A 1YHFA 1LB2A 2N7GA 4MX3A 4HVRA 4YNIA 1YFXA 4LULA 3ZDSA 1I5ZA 5C6CA 3LA7A 2D40A 1IPJA 4AQ2A 2BYVE 3ES1A 4AVAA 1DGRA 3SCGA 3E5XA 4XEZA 1YLLA 4JTOA 2H6CA 1O5UA 1O4TA 1O3TA 1VR3A 1QY4A 3E97A 4YYOA 4LUKA 3I59B 5I8YA 2QJVA 3SMHA 5T3NA 4Q0SA 5JR7B 2Q0AA 3U0ZA 4JVAA 1ZNPA 4B29A 4HBNA 3EBRA 4EWDA 3LOIA 3LZZA 3NVCA 4MH0E 2EAAA 3LA3A 1UIKA 4O9GA 1V70A 3R6SA 4O9EA 2ATFA 4LUMA 4YARA 4IEZA 1J59A 1OD5A 2EA7A 3VHRA 3NW4A 4IEWA 1NXMA 1QXRA 4XF0A 2CAVA 2MNGA 3H3UA 3RPQA 1J3PA 2OPKA 1UIJA 4UXAA 2C0ZA 1CX4A 3IDBB 1OMIA 2ET1A 1LKNA 3KSCA 1IPKA 3DN7A 5AVPA 1RC6A 1DGWA 2PFWA 1EYBA
chains in the Genus database with same CATH superfamily
1LENA 4JKMA 4FFHA 3O0XA 4ZBMA 4WVWA 2WLIB 5C9AB 2R49A 1ENRA 3NJYA 1NVPB 2GC1A 3E2EA 1Q56A 4WFFA 4TUYA 2ORXA 1YEWA 5HCAA 1V9U1 1J83A 4A3ZA 2V5YA 2HH9A 2FCUA 1LU2A 2N74A 2WWSA 5FZOB 3VBUC 3VKFC 1QJX3 2H0BA 5FKCA 1FXKB 1WD4A 4DV6O 5FMCA 2FDHA 2ODMA 3CP1A 4K8FA 3WVJA 3JD3A 1HJFA 1MS3A 1IG3A 1AL0G 5C5TA 4H55A 2HWB1 4L11A 2R72A 2EF6A 3N2GB 1Y4WA 1BHAA 3GBGA 1RUF2 3T0DA 3RT3C 2IFRA 5FY4A 5BPXA 3KLSA 5DECA 1YIFA 2A6VA 3RZZA 1BQ0A 2VNVA 2I74A 4DR4B 4Q4X1 1R1A1 2JIGA 1NLSA 4CUAA 3ABLB 1PIV2 4ZHQB 2R063 5FWEA 3HKEA 3KKYA 5B1NA 4FIPC 1B6QA 1S2KA 2A6YA 3DPRA 3CCVV 3IC7A 2DUQA 5K0UA 2J1VA 2BQPA 2Y6LA 4LJHA 2MEV1 1ZA7A 2Q1MA 1UX6A 1N34O 1PGSA 4BIUA 2PYTA 4XJUA 4OX9B 5LA6A 1SLCA 2VC9A 4AI2A 1OPMA 3PMEA 4DR5O 2OTJV 3GZTB 4QM9A 4TOIA 1ENVA 4RS5C 1U5IA 2PLV1 2DN9A 5K1PA 3MDSA 4XJZA 3CEIA 2QWPB 1ZYBA 4LK7A 3QBQA 3CSXA 1OBNA 4IE5A 4P30A 1QOSA 3SYAA 4N7UA 3PNAA 5LP6A 4AEMA 4FAGA 2LGWA 2RMU2 5LMNB 1RM1B 4A3XA 2A3XA 3I54A 2VTFA 2ZT9B 1W0OA 2QA4V 4AVSA 3MFAA 3WNXA 3STZC 2GC2A 4K6BA 2Y60A 4Q4Y2 4XYXA 1XXNA 1I6XA 2EIJB 3U37A 4F7ZA 4RQPC 4RGGA 3IMNA 4N43C 3CC7V 4EE2A 1FV2A 2PUSA 1NE6A 4DY3A 4JYAB 5JCOC 2VUJA 4BIZA 3I4IA 1H1IA 2D43A 2Y6HA 4D8MA 1SCRA 4XC9A 1AI6A 4Z8BA 1FYUA 1OHFA 4W4LA 5EYPA 4I50A 2ZMKA 2OVUA 3SQOA 5JOYA 5GLVA 4MGIE 3V56A 3HT1A 2VQEB 1UXXX 2JG9C 1DLBA 3I2JA 5A3WA 3H1JH 4ZU4A 2GP5A 4L2NA 1XNBA 1ZX5A 1C8NA 1H8HG 5J7MA 2BUKA 1VBA1 3UGGA 2GMEA 3KMHA 3H9VA 3WW2A 4XUNA 4P9YA 3K4ZA 3ABKC 3WDYA 1DF5A 2RM22 1JYIA 3H1KH 3B94A 4AI3A 4I3GA 1R1ZA 2D6LX 1P84F 1R6NA 4AEJA 3SYQA 3F95A 2IM9A 2VOVA 1QCEA 1OXCA 2L9LA 1GV9A 4UFHA 1VALA 3PTYA 5LCWL 1G1XB 1JZ2A 1LUWA 5J98B 2UU8A 4UFLA 2YGMA 1Z5WA 4FLWA 1JYXA 1WKYA 3Q8FA 5EYXA 4I0WB 1K42A 4JDOA 2ARXA 2BSKB 3W7WA 3QCWA 4QX0A 3AP5A 1OH4A 4CTEA 1OFNA 1UU6A 3M70A 5FXVA 4GMP0 5K8SA 2OUJA 3TCUA 2ERFA 4XJWA 1FXVA 4MZUA 5FPXA 2Q68A 4H13B 1AJNA 3U78A 4AOCA 4Y26A 2XWBB 4K0KB 3I2HA 2B7YA 4AVVA 3ASOC 3J8F3 2ID4A 1JOBA 4LF4B 1PMJX 3VLBB 1Z2GA 2IFWA 2ZX3A 1BGYH 4AVCA 5LBBA 3ABMC 1MA1A 4FM0A 2BGOA 3OM3B 2VULA 4CP9A 1OCCC 3GJAA 1V9PA 4HVRA 1R3KC 1F7YA 5J36A 1AP6A 2Q67A 2D40A 1IPJA 1WAZA 4ZONA 1PVC3 3RBZA 4BISA 2H6CA 2NNUA 2VWJA 4AVTA 4X1YA 5CA1B 4FPOB 1G7YA 1YITV 4ZKTB 2QJVA 3TN93 3AL5A 1K4DC 3OAAG 3K3NA 5FZIA 4CEYC 1YNAA 1YDXA 4DEQA 5JJNB 2WNVC 1F23A 2IBZH 4BPZA 3ZRVA 1OOPC 2B46X 5FIXA 1W8ZA 1KUQA 1YTFB 1SQVH 3UNPA 4JI5O 1XYNA 1WW7A 3ZM8A 5A32A 2MNGA 4K9SA 3ILFA 3AYDA 3ZN5A 1CX4A 4Q27A 4UF0B 3TEWA 3K57A 1AL22 4LFCO 1F4AA 4J9ZB 1LKNA 2UU9B 3ICXA 5DM6V 5LA6B 3UKMA 2XBO1 2FKXA 4X88A 1ZA4A 4FPGA 4P08A 3OMIB 2Y64A 3WNKA 4Q0PA 5B1BB 1S0EA 1UJWB 4JI2O 2ZX1A 2LP7A 5FPOA 1CN1A 2OA2A 1BMV2 5B1AB 2XLFA 3AG7A 5ACA3 3BTXA 3AVRA 1U96A 3OGCC 3SHRA 5LP6B 3O14A 2VPVA 3VKNA 3G71V 1N36B 3ZYBA 5T52A 4QE9A 4PDLA 1PGW2 3CRMA 1BSMA 1NQJA 1ULCA 5L3EA 3LDKA 5LGNA 1W8FA 1U5XA 4XJ9A 3GDBA 5KHGA 2F6BA 3CMAV 1AR92 4NHLA 2B4KA 2R0FA 1B06A 1B35C 1DLLA 1K34A 1ENQA 3RWRD 1JUHA 3S3XA 4D6SA 2P2KA 4UVCA 1VQOV 5F7UA 4PJ0Z 1DQ0A 5F32A 3CBNA 4JKLA 3I59A 2GNBA 2HLEA 1GP5A 4K20A 5EYPB 4GB33 2QQJA 1N33O 2Y48A 2DFCA 3ROUA 1M4WA 3AG4C 4UWDA 1OJHA 1TQ5A 1YQCA 4DXWA 4KBBA 4CH5A 4CS3A 3WOGA 4UW3A 3T1HB 2HEPA 1HRV1 4CP2A 2GV9A 4X6RB 1OCRC 1RMU2 3AKSA 4J1XA 2DVGA 2HR3A 1S0IA 1CAUA 1H9WA 3L2HA 1D0HA 2VMDA 4MGSA 1DYPA 2GH2A 3MIBA 3QD6A 4KL1A 1F8VA 3BPZA 4Z82A 2ARHA 5GZGA 1I5YA 3MPPG 3RZLA 1SFPA 2ZX2A 1EM1A 2BTQA 1HB2A 5AC92 3HR0A 2AACA 3UCSC 3M1HA 2CDYA 5IW0A 5FY7A 1QQP2 4XFAA 4KWJA 4UCVA 1VRH1 4ZHNA 5JQGA 1BMFG 1BQPA 1HNWO 4MOAA 2RDCA 1EV13 4KWKA 1NS1A 3SDLA 5TSWA 3ZMVA 2VZOA 1WA8A 1FJGO 4JV4A 3AG1B 1JQ0A 4CCEA 3ZRSA 3JARB 3IWZA 2OIGA 3AMNA 3JATB 4DZGA 1C1LA 4LO4B 4DMIA 1A3KA 1NX9A 1XYOA 3ZXGA 3QO8A 3RWNA 4AGGA 2GAUA 5JSOA 3WFVA 1F15A 4CP9B 1IXMA 3JBG1 2CYFA 2WZR1 4CCCA 2BW8A 1S77D 1SESA 1Y4MA 5E16A 3ZYGA 1Q6HA 4Q4V3 2WA3A 4Y4RA 2XKPA 2TEPA 5JXJA 1YJNV 4LA3A 2BDRA 1HNZO 3C7GA 4TXWA 4X1YB 4UFKA 2FL4A 2XMLA 1H9PA 3AKTA 2EIDA 1R083 3CWBH 5LGTA 1JH5A 2AZ0A 2UXBO 1XU1A 3GZUC 1GNYA 5IYCO 3N27A 1RUG3 3WNMA 4DV6B 3T08A 2QKDA 3VHOA 5EPAA 3DV8A 5FMDA 2MW2B 4GALA 4H37A 3VB9A 3C7FA 1RUE2 1VBE1 4IE4A 1SLLA 1VBB1 3RYIA 2XR4A 1LAJA 2A1XA 2NQYA 1PL0A 2Y69C 4RL7A 1UWWA 1ASJ3 1JUIA 3WXPA 4NXMB 2GSYA 4URAA 4YRDA 5EFUA 3SKJE 2QKAA 5L9RA 3JUUA 4WFEA 1YFYA 2OZJA 5LA1A 5KAFZ 4LO8A 1UU5A 2DU1A 4XMAA 5M0TA 3VBHC 3KF3A 4D6RA 3ACIA 4FOQA 1JW6A 3T4ZA 1FKAO 5I91A 4AVBA 1BCCH 3ZMTA 1YXBA 3CCLV 5KA5A 3WHUA 3VBFA 3A0RA 3OPZA 3K3WA 4DRRA 1IVSA 4BQ3A 4XOGA 1DGRA 4DR5B 5IY5B 2W92A 4FLXA 4CU8A 2VCBA 5IJ9A 1RUD3 3I59B 3N2KA 1XPWA 1OF4A 4COWA 2Y0PA 3U0ZA 4UCSA 3ZKYA 4A42A 1QU0A 4F83A 5EBLC 1D4M3 3LSUA 4C0HA 3WF0A 2X0LA 2IH1C 3SEPA 2P5BA 4TTGA 4FP3A 4XABA 1J59A 4PQQA 3CJHA 4P00B 3TB0A 5GM0A 3AKRA 1J3PA 5D21A 1W8NA 4GJZA 1N8RW 2DYSC 5HV0A 1AR62 4TWTA 2CK3G 3FWEA 2J42A 2DJVA 5IAXA 2V4VA 5DN6G 2IJKA 2OYZA 1APNA 2PI4A 3GALA 4AEDC 5IK7A 1XRUA 4QB2A 4XILA 4BM8A 2JJ6A 2A06H 2XJQA 5BZBA 2BTQB 5A3TA 2P6JA 3I3MA 5EZYB 5C8CC 1OUXA 5F3GA 3JD2A 3CMEV 2XVLA 3O1MA 2LM3A 2QDNA 1ZZ7A 1KYOF 5IT6A 4QXCA 5JQGB 2FHRA 3JD71 3KF5A 5FV3A 1R1BA 4QU2A 4B4QA 3I97A 4HNAA 4CDWA 1MEC3 4UCUA 5L3CA 5E88A 3UKNA 1WA8B 5ISLA 2RJZA 4ICGA 1KFUL 2EIMB 5JCOA 2NLRA 4F3JA 1FPOA 3QO5A 4FOVA 4M00A 3PVNA 5F3IA 4KG8A 1ZBA2 2AUYA 1UOGA 2W39A 2PYLA 1FMD2 1K5MA 2R7EB 1YWKA 4J7KA 2IXLA 3AB0A 4Q4W3 4B3RO 4BZ4A 3OUSA 5JXHA 1HW7A 2FMDA 2VQFO 4IHJA 4HZ3A 2EULA 1UD1A 4Y1ZA 1TUBA 3KGZA 3N9OA 1VARA 4XDKA 4IERA 4M0NA 4MVTA 2VL4A 3S30A 1EBOA 3CX5F 4PI2A 4EN7B 5CB7A 1IGOA 4LT5A 4NWWA 1OA4A 1ZWIC 3SJQC 4WF9V 1GBGA 1GAXA 4B3SO 4DINB 3V0AA 5AFBA 1W8HA 5AG2A 3JCZA 5JAXA 3TEYA 1V55C 2DFBA 5JXGA 1UL9A 5KXBA 2HBUA 1JXNA 4O2BA 5GZCA 1NI8A 4ET7A 1N1TA 4HLTA 1HR0B 3SCHA 5IK8A 2A6WA 2WLMA 3BABA 1XQ8A 4TV8A 4N9IA 1D5AA 5C4WB 4E2LA 3FB5C 2NP0A 3RYIB 5IK5A 1MZFA 5CG8A 3KQRA 2J1TA 1MQTA 3OSDA 2IXCA 4Y1VA 2CTRA 1FPN2 5CFDA 1ZBE1 3ZFGC 4GZRB 2HWC1 5F8PA 2FMYA 4Y5Z0 5LY1A 4RWUA 1V54C 2XPJA 2ZXQA 4OI0A 3IN9A 1HW5A 3QO7A 1STMA 5DAWA 3WR0A 4P2ZA 3AG2C 3S7EA 2X6BA 2XUMA 3VDCA 4QPJA 5EIBC 4JI5B 3VBUB 4JZRA 4IE6A 1AI7A 4QX5A 3DKWA 1DQ5A 3DC6A 4C1XA 4XUQA 1LGCA 3B3QE 1THZA 5FO8B 4LFCB 1YYNA 4LTAA 3N9LA 1NLRA 1WLCA 1OFSA 5HXVA 1PZ9A 3QNEA 2XL7A 1H4HA 4W4KA 3NJXA 3E6CC 4QHZA 4DOUA 5IJ9B 1WMEA 5L9BA 1RUC1 3N2KB 2I07B 4LLFA 4TQFA 1XE7A 3CCRV 4H33A 4MW8A 1NA1C 3ZN4A 4IW3A 4NHKA 4ZXEA 2VBPA 2VAUA 5TISZ 1LHOA 4RR3A 2XLGA 3CJHB 2WNVA 1SCSA 2IH3C 5A3OA 4K1ZA 2LW7A 3PJSK 5H9SA 1ZRFA 2ZQMA 4CP0A 3AZYA 1AYN3 1TVKA 1RHI1 4CDUA 3E5QA 5F5IA 4EN9B 4B7EA 1MG1A 1W9TA 4HVQA 5FZBA 1QJEA 3ZN6A 2ZINA 4IETA 3WT3A 2IJJA 2WFF2 4RS5B 4RHV3 1N33B 3WQ7A 3B5LB 4PQ9A 2PQSA 5IWAB 4BLIA 2VOKA 3AXEA 1W0NA 2X8KA 4LA2A 2DOSA 1YI7A 4Q1PA 1VBC3 2BOBC 1YHFA 1PK6C 1LB2A 4MX3A 4LULA 4U7NA 1M5IA 4QB1A 2ZOEB 3T2MA 2WLPA 1AR1B 4HNAB 4XUOA 4CDWB 2BYVE 1XMQO 1VIBA 2DMXA 1CXZB 1OD3A 2HVKC 1F5FA 4N43B 1VR3A 1QY4A 1JZ3A 1AXZA 1RP3B 2ZD9A 3NNMA 4AEKA 4KP4A 1FOD3 1WCDJ 1PO23 3WP3A 4ES8A 3AK1A 1DGWX 1ZNPA 1GRJA 1X59A 2C24A 2EAAA 3B00A 3VKLA 4YVSC 3T4HB 1HKDA 2PHWA 3MW2A 2GN7A 1ND3C 4UFJA 4IHJB 4Q8KA 1TNRA 4XZPA 4CU6A 4Q4X2 1HNWB 3ABTA 1K92A 5FUNA 3L73H 4Q6GA 4W6YA 2E74B 2ARBA 1SACA 3ABKB 4CUBA 2E33A 4DEVA 3B69A 1VBD1 3OD0A 3ABUA 4UFZA 3ZDVA 4KWLA 4QPGC 2RJKA 2BOCC 3SITA 1REEA 4GMP1 3AK0A 5IHRA 2XAFA 5EIBD 5J37A 4J1WA 1XSQA 4O2BB 1WZXA 1DF4A 1PO13 1W9YA 2IVJA 4U7OA 3ZN1A 3IAPA 4TV8B 5IYZA 5T5JA 4CDXC 1N1VA 4EV0A 1HRI2 3RSJA 4I2OA 2HEYF 4A7ZA 3P3NA 4AHWA 2PLV2 1NT0A 4QX3A 3TGUH 4GKYA 5G04L 1XHZA 1MQTB 5E8AA 5B1OA 3GVMA 5CFDB 1KP2A 3FKSG 3TRSB 3AYEA 3U75A 3CJIA 2DYRC 1HDJA 2AEZA 3SNMA 2UXBB 3OMAB 1RUF3 5H2FZ 5T5LA 5DG2A 2W08A 5A7QA 4XQWA 5J1XA 3ASOB 4W4ZA 4O2AA 4YM1A 2QNKA 3J7AU 3O1TA 2KG7A 2HLDG 1XE0A 4QX1A 3D6EA 3K9SA 3ES4A 1PGL2 3AZWA 3ABMB 4YVWC 5ITZA 3IAYA 3BCWA 4B3TO 4FFBA 3Q8BA 4WBNB 1H8VA 1J1TA 3ENRA 2YXHA 1OCCB 2DWDC 4CCJA 4Q8LA 3CCUV 3ETGA 3T4VA 4TLGA 2FZ2A 4YJ2A 2AH2A 2QFEA 3CYOA 2D3OW 1RUH2 3GZEA 4XFFA 3S57A 4ITCA 3SPHA 3WUCA 3EVKA 2Z69A 1W2UA 2VH9A 1XL6A 3MPBA 2BP6A 4JAUA 3AP6A 4HSJA 2YIAA 1OVSA 4FP2A 3FE5A 1F4NA 5IYYA 2G9ZA 1LEMA 1ZRCA 4J7ZA 1Q8PA 1CZVA 2DU0A 2WNVB 4WFHA 3HPNA 5J48A 1S5JA 5FLIA 2XQRA 3L2YA 1YQ6A 4GA9A 1R64A 4FFGA 4CDUB 5JMOA 1CEZA 3VDAA 4Q4Y3 5T54A 2A73B 4YJ3A 3ZN6B 1O3SA 5IVYA 2HWE1 2WYSA 1R091 3IBMA 1RPOA 2LW1A 4LR4A 2EIEA 3LKJA 3I2DA 3BVOA 5FPVA 4IUGA 4ZI7B 5FR3A 3B77A 1FD9A 2GALA 3ILNA 4DR1O 1P4RA 1VP7A 4FFKA 2BGCA 2HHHO 1HN1A 3N9NA 3LDRA 4HSLA 4R50A 1W05A 3SYPA 1ALYA 5EWSA 4A2UA 4QX8A 1AILA 2ZZJA 4META 1JYWA 3MZHA 2E53A 5J3UA 1BS3A 2XGXA 3T2QA 4ZU7A 1BHBA 1SFNA 3ASNC 4PDWA 2IZWA 1UY1A 2RM23 5FY1A 1KDMA 1LHUA 4IEXA 2E3CA 2F43G 4WM7A 4BQWA 1PP9H 4B1MA 2PMWB 1G9AA 3OGJA 3AG4B 1G8MA 3KCXA 3DTUB 2R043 5EJZB 2PXJA 2BVBA 3ZR6A 1AJPA 2R061 4ASLA 4QE7A 1K12A 2XHKA 1NQDA 1CWPA 2YEVB 1HQNA 1MS4A 2PN5A 1J84A 1FI2A 2Y6GA 1VB4A 1QJX2 3FX7A 5IVVA 1PMHX 2YICA 4W50A 1IBLO 5B3SC 3FJSA 4LKEA 1M90W 2Q69A 4HOOA 3BIEA 1UZVA 3AKPA 2BTVC 2A0LA 3ITQA 1KKCA 4B3RB 1IQAA 1IKQA 2K46A 5J96B 2B1GA 2BNOA 5IYZB 1K5SA 2VQFB 3HKBA 4HG6B 4YPJA 3RJRA 2XDVA 4ASKA 3ES1A 4M3CA 1WLDA 5CBLA 2RS12 3CJIB 4B3SB 3IM0A 4WCEV 3NNGA 4Q26A 1XNRO 4JZGA 5FPUA 3SH3A 5GJ6A 4L8QA 4O2AB 2PELA 2JD4A 4GX0A 4OYUA 2BE3A 1C8M2 4GH4A 1GN6A 2WZEA 1ENXA 2ZMLA 2QDOA 2XOMA 5ITZB 5A3UA 2QGNA 4QAWA 4FFBB 4XF0A 4MHRA 3H3UA 1UOBA 3VKOA 2ZM6B 5FLXN 3T0AA 4DW0A 3ZHTA 3ZHSA 2QQUA 3KSCA 4TZDA 4YJ2B 3CS5A 1FV3A 1EYBA 4JYCA 4LE4A 3POSA 4CU7A 3HKCA 1AL23 3OJBA 4YG3A 1SKVA 5L7OA 2ZJCA 1RPRA 3WDXA 4V2VA 3MFCA 1SLIA 2DTWA 2VQTA 1WW6A 4CDQA 3VHPA 4O4HA 5LBCA 1FFXA 4BOWA 2AGSA 3WCSA 1QJU2 3PVEA 2JD9A 1W6QB 1GM8A 1H2LA 4ONUA 3PIGA 4IV1A 4A5UB 3PUAA 3KV9A 1UXZA 1AYM2 3RJ2X 5LXTB 2Y69B 1PM7A 4FFFA 1SLBA 4YJ3B 3CPWU 4DV1B 4S2DA 3S0MA 3HN1A 3S7IA 2QM7A 1WJZA 4XJAA 5BR8B 2JIZG 2OXBA 4AHXA 1OLME 4EFBA 3OG2A 1WMXA 3FX3A 2WNUC 3HOBA 3S6PA 1WA4A 1X9TA 5A6QA 2IJIA 4XFBA 1C28A 1LGBA 4FM2A 2VS0A 2CU5A 3VBHB 4FPCA 1T6BX 2YXSA 3J8F1 4XAAA 3PVOA 5DUWA 2B5HA 1UU4A 3D36C 3OTOO 2B8MA 3CXHF 2VGDA 2C26A 4V2WA 3OY8B 3K4DA 4HN0A 1CQ9A 3BUCA 1RIRA 2UUBO 5D2AA 4PDWB 2QWQB 1RMU3 3OYWA 1FNYA 3ZYJB 3C3SA 3VZNA 4COZA 3EMRA 1H8TC 2KXLA 5FP4A 1GZWA 2D44A 4JKKA 4CYDA 3ETQA 1P7BA 4NIDA 5LYJA 3TN91 1SQ4A 1AX1A 1CPMA 4CP1A 3NAPC 2JRIA 5IAVA 1H4GA 2PQQA 5IDJA 3ST7A 5IJRA 3SPIA 1XMQB 3H1HH 1OCZB 3KT1A 1S5HC 1URXA 1YUDA 1W2TA 5FZ7A 4E2QA 1QQP3 1MS0A 4XHBA 1RGSA 3H8OA 1N3OA 1NXD1 1VPHA 4WFGA 5C8YA 3UESA 1JMKC 3BEHA 3ZXAC 4X20A 4M4RA 2VZQA 2WFPA 3I3BA 3AXDA 3ZHRA 3BCCH 1POQA 2DURA 1VMJA 3M3QA 4DR6O 1E1RG 4AEDB 1PVC2 1DDLA 1HN0A 1AXKA 1UW8A 3HKBB 3ZXJA 4BWAA 1QXPA 5ACA1 2G9FA 1A32A 2LUWA 3LFMA 4LPLA 4HANA 4OQ8A 3T2OA 3JALA 2GTSA 1JMUB 3OGGA 1JZ5A 4M3CB 1ROPA 1CX1A 4CS2A 3J7MA 1RUJ1 5I8SA 4Q20A 3BI3A 3KT4A 3LDCA 4FTBA 1GMMA 2VXRA 3KD4A 4NXNO 2LALA 5FPAA 4AW7A 4OUEA 4AF9A 2JEUA 4PI0A 5CAZA 1C4RA 3MHZA 2ZNJA 4GB31 4GKJO 4I0BA 5FYHA 3U4SA 1LRHA 2QUOA 2FDJA 1RUE3 1AHSA 3Q4HA 4DR3O 3CRCA 2WQZC 2ZXWC 4JF3A 3MHSC 2KM2A 3OUIA 4A41A 4M01A 2FZ1A 3HKCB 2P67A 4BMEA 3BODA 1NKDA 5L7OB 1UKRA 4JTAB 4Q0QA 3H8UA 2Q8EA 2D3RA 5EZWA 3MBWA 4UFIA 1S55A 2RHPA 5L3DA 1XB9A 3BALA 4AQSA 4LXLA 4X64B 2ARCA 1VQ8V 1V55B 2ZDIC 4O4HB 1PMIA 2KSDA 3HNBM 4WZFA 3UJOA 1Q8VA 2DW4A 1EY2A 5EBMC 1Q43A 4B3TB 3D0SA 1XYPA 2QEXV 3JAKB 1QBZA 1QQCA 1BVVA 3LA7A 3FL7A 4QGPA 4R9CA 3JSNA 2VWKA 2B1IA 4N90A 1DZQA 2XONA 5FYTA 2RE9A 5F5CA 3SMHA 4LFBB 5LASA 3PN1A 1V54B 3W7SA 2ADPA 3WG1A 3G6EV 1EV11 4LF5B 3ME2A 1V70A 3NNJA 1LECA 3C7EA 2ATFA 3AG2B 1ULDA 2ENRA 1LOBA 1OD5A 2Q8CA 1CESA 2BGPA 5JPMB 3ZXFA 2FB5A 4Z92B 1UIJA 3DYMA 1HJGA 4BLJA 3LSDA 2VZSA 2YPDA 4DV4O 4AILC 2TNFA 4RYDA 1WW4A 2QQVA 3ATGA 3BPSA 3OEAA 2RDRA 3E1F1 3O12A 2YB7A 3OYWB 1AR63 5EP9A 4Q4V1 5AVAA 1AR72 5FZ0A 2PHXA 2V4AA 1N0JA 1T5EA 5KHJA 4QB6A 2BNNA 2BEOA 2D6OX 1GNHA 1RVF1 3JD4A 2K9PA 1HQLA 1ZM1A 1I3HA 1R081 2HHHB 5LYJB 1HB1A 3FC0A 3A22A 3RZGA 3MIHA 1RJ8A 1U5ZA 2RVAA 2JDHA 2ADEA 1DYOA 2ORZA 2ILMA 3NQHA 1RUG1 4KH9A 5LGUA 4UVAA 5BV6A 2UUAO 3CC2V 2HWD1 2JDPA 1JZ7A 2PHTA 1RYYA 5LY2A 1YFUA 4R52A 5DABA 3UM7A 3LWCA 4NROA 2CHHA 1W6PB 3VQVA 3FLTA 4X20B 5LL6Y 2IU3A 2JENA 4LBNA 3WDVA 3CCJV 1ASJ1 1Z5VA 4DO2A 1S0VA 3RW0A 4U3FH 5A7WB 3ZRXA 1GLHA 2CL2A 1IXBA 2J1EA 1UAIA 5FY0A 5A7PA 1B09A 4YLZA 3MDPA 1Z7S1 2Z79A 2JDNA 4BIFA 5H9CA 1ZBA3 5F5QA 1YHQV 1FMD3 1IHMA 3IIAA 4LP8A 3LF7A 4W65A 4C1WA 4JTDB 5F6LB 1PK6B 3KT7A 3JALB 1W6NA 2YXYA 1J3RA 2A5ZA 2P3JA 4LIUA 4UBGA 1GANA 3HBKA 1YRZA 4X66B 4LBQD 3ZLIA 1YIJV 1GM9A 3MW3A 4IL6Z 4ZOLB 1G6UA 1DK1A 4PF5A 2QZ2A 3HKDA 3MIDA 4D0QA 1RUD1 4K35A 1CAVB 4Y3OA 4YVSB 1OZ0A 2ADDA 2ZAHA 1VMHA 4D3WA 1XREA 1O91A 3WB2A 5B2GB 1ND2C 4JYBA 1Q6IA 1D4M1 1GP6A 3Q4HB 4UVBA 5KAIZ 5CNAA 4RUFA 4B1LA 4OX9O 3K77A 5FPLA 3G6BA 4IEUA 4OPAA 1CGPA 1DZRA 2WINB 5KUMA 5FYBA 1XNRB 1ZRIA 4N8MA 5EBWC 2JG8A 2R9IA 1POV3 1FPN3 1AZDA 3DEMA 3NRUA 4WM8A 5LW9A 4QU1A 1CZSA 2YBPA 2PAKA 1OSGA 5CYYA 2F23A 4YGDA 2VY0A 1OQ1A 5ABJC 2JX9A 2JDUA 5FAXA 3I2GA 1CP9A 4RO2A 1E1QG 1W2AX 2P6HA 3POYA 1RUNA 2R9RB 1O9HA 2QQNA 3WEZA 5LWBA 2ETEA 2SLIA 3TWIA 3HNYM 1W59A 1AR4A 4Q0VA 1Y3TA 4BAYA 2ZHKA 2EIKB 3AP4A 1OCOC 2Z4FA 4GYCB 3E35A 4JGZA 3ZPOA 1G6NA 2VQEO 5JXIA 1Q6UA 5GLUA 1MEC1 2GH8A 2OKXA 2MPFA 4E4HA 5JVDB 4LOSA 3H3ZA 2Y0OA 1ODNA 1UZ0A 3HBZA 4YY3O 1N32B 3GCWA 3K2OA 4JX0A 3E6BA 4Y1XA 4Q0UA 1SRYA 3BYWA 4Q4W1 3N7KA 2WL1A 1EN6A 4HONA 1QLEC 1KP3A 4HPKA 1SA0A 4X6QB 1FX5A 3NKTA 5FREA 3FBMA 3CCSV 3X2QC 1FXZA 4BU2A 1L1FA 1GQHA 1R6KA 2ZE5A 2JDKA 2WFF3 2F4VO 1COV1 5GZEA 4KHPO 2EAKA 1WGPA 5KHIA 4HKLA 2ZCEA 5EC2C 2YU1A 3B8NA 1NCRC 4FO9A 4K3UA 3E5UA 4CBCA 2OT5A 2EINB 3J7NA 3VZLA 2N7GA 4DPNA 1NTKH 3ZDSA 4TYSA 2OUHA 4JAVA 3RS6A 4I30A 4CS4A 3OBAA 2UUBB 4AVAA 5CBGA 4OVEA 1TME2 5FXZA 5JOWA 1L0LH 2RCVA 1EZVH 1WB8A 3E97A 3F7VC 4JV5B 3N35A 2WLLA 2TBVA 4MSWC 4LF4O 1ZLZA 2XXZA 5EK0A 5JR7B 2Q0AA 4EEQA 4X8NA 2IU0A 4LF9O 2VBBA 3TBDA 2GSMB 3UQ8A 2P6CA 4OHVA 3WG2A 4LUMA 2VTXA 4IEZA 1LGNA 3FB6C 3U14A 4AI9A 1VQ9V 2CAVA 3J9SA 3BTZA 1TUEB 1HV0A 2GMMA 5FO9B 2AXTZ 5C9AA 4XBQA 1W6NB 4U36A 1VQ7V 1Q7YW 1AVBA 2A3WA 5C70A 1KS5A 1W9SA 1CIWA 4Q4X3 2H0VA 3WF3A 4LO7A 4WV8A 3NSTA 5A6YA 3ZMNA 2D6NA 1JU3A 1TEIA 3ASNB 3ELNA 4NMIA 4BB3A 5BXZA 4YW3A 3ZJZA 1NZ6A 5CMUA 4DUZO 1FXKA 4DR6B 1HXS2 4IYHA 4MG2A 3HKDB 4XFGA 2WT1A 4AGRA 2YGLA 3Q8AA 5HFMA 2LW8A 2W2IA 4J11A 2ZGUA 2WN2A 2OZ6A 3WSOA 4RGAA 2RS52 4P9JA 3ZR5A 2C6SA 2RQ6A 1HRI3 1FYJA 1S0CA 5FOJB 1UYPA 5H9PA 4JI3O 2CTVA 3O1SA 2NPIA 1L8DA 2PLV3 4HVOA 3DXTA 2FDGA 3JSLA 2A7WA 2WBKA 2YI8A 4N9HA 1NU1H 2WS91 1AYN1 1W04A 3N7LA 2UYBA 3ZVXA 4R8HA 4NXNB 2VZPA 5B3SB 3GNEA 5HI0A 4G27B 2VOTA 3LPFA 5A2QN 2W68A 2EILC 4NOTA 3VV1A 1EPWA 3CKHA 4GKJB 1LOFC 5DMYA 2HBTA 4Y5TA 5FCCA 4LEJA 1O6UA 1W6MA 4BXSV 5C71A 1BHGA 4X62O 1H2SB 5IE9A 1YQ5A 4NTYA 5CKNA 4GWMA 3L74H 2SBAA 1UY3A 4FTEA 5F1RA 4OI1A 1PX3A 1ULOA 3VZMA 4OI2A 4LBJA 1T6GC 1US6A 3KHCA 4LE3A 1REFA 3W9AA 5GKAC 4IGQA 2XVKA 1RUH3 3VBSA 1LU1A 4B3MO 1EPZA 1D2SA 4W6XA 3WF4A 2GNDA 2IXKA 1ONAA 2EBOA 4YXWG 1JOJA 2ZE7A 4YW2A 2R6QA 2E5LB 2ZE8A 4YGCA 1FOD1 1PO21 1VBA3 1SBDA 1V00A 4RHV2 4NHYA 4DV7B 1HV1A 1BBT2 2WLQA 4L9BA 3ACHA 1X33A 1J95A 4IEOA 3T4DA 1GNZA 4HKWA 4C7UA 1BEV2 4HPKB 4OZXA 2JE7A 3BIWE 4AAXA 2RDQA 1VF6A 3KG2A 2FMLA 1VBC2 4MGYE 2ZACA 4UBHA 3J81N 2R1BA 1IOAA 4MVUA 4L8JA 2DDUA 4AGVA 3LEGA 4FXGB 3FYEB 4Q29A 1DTOA 4CVUA 1AJQA 4C90A 2Y38A 1X9PA 1O9GA 2VTXJ 2F93B 4HT1T 1BE3H 4CE8A 3A0HZ 4DK0A 1SQQH 5I0SA 3RI9A 3EHBB 4UW4A 2LS6A 2HWF2 1POV0 1CAWA 2WLLB 4HL0A 4P14A 2BERA 4LHNA 1XNKA 3TEXA 3WW4A 4QGNA 3KGLA 2KR2A 3H7YA 3PLQA 2GC0A 2WNUB 2E76B 2D5HA 3WDUA 3HQXA 5CBFA 1K8AW 3M7AA 4MGTA 2KQXA 1RUF1 2DTYA 5D5QA 4XTMA 1GN3A 3NXSA 2N04A 2X7RB 5EIYB 2N05A 1XNDA 2CH7A 1NE4A 2UUAB 1Q8IA 4QDSA 2ES3A 1PIV1 3VBRA 5KC5A 3J7LA 3UKVA 3ZRWA 1GQPA 3SEEA 3O1PA 4UXNA 3AJYA 1PO12 5EV7A 4QQ2A 4FLYA 1XU2A 2UURA 3BOPA 2UXNA 5I0UA 4AWDA 1NR7A 2WAMA 1DQ4A 2RG4A 1WW5A 1PM9A 2IXHA 4YFZA 3VZJA 5GONB 4IT5A 4ES9A 1Y6XA 2VQAA 3B4SA 4PA7A 5KMGA 3B93A 4KUMA 2YIBD 2IXIA 2G19A 4PT6A 3NAPB 1K45A 4FK5C 1S0JA 4XAEA 5C7GA 4INDA 3ACFA 4S2HA 3ZFEC 4QPWA 1M56C 4NXMO 3M3CA 5CA1A 4FTSA 5DAPA 3M3OA 2RMU1 1O3TA 2ETNA 3NO8A 2YUEA 4JCKA 5JOXA 3PUQA 1SETA 5T3NA 1TE1B 2RS13 1LHVA 4Q4Y1 4MH0E 1X4TA 4LBMA 4NYKA 4O9EA 5FZEA 3KZ4C 4LWSA 5FYZA 2EXHA 4AR2A 3WY6A 4UF0A 1W6MB 4L97A 5FYVA 5J2UA 4LF8B 1C8M3 2GTAA 5A3NA 1AUYA 4DB5A 5AVPA 1DGWA 4WFAV 5J09A 4P02B 3A8TA 2HJFC 3ETEA 5FRAA 1YI9A 3HN3A 5FLHA 4UCTA 3T09A 4PIXA 3VBSB 4TLFA 5DUUA 1XOUA 4AI0A 4K21A 3VQXA 5A1LA 3ABLC 5FZMA 2JS3A 4QIWF 2B5UA 3VQWA 3T1MA 3SPGA 1HRV3 1NY72 4SBVA 4CZSA 3N9QA 2XL9A 1QR9A 5BNPA 1K3EA 1SLTA 4E4SA 2P5OA 3PU8A 2DUOA 2ZGNA 3MUY1 1QJU3 2VW0A 1W39A 2Y4TA 1WD3A 2ZXWB 1VJ2A 4E2SA 2JIJA 1SQBH 3U10A 2XAHA 5FDBA 2W0XA 4JYYA 1W99A 4FXKB 1AYM3 2UXDB 3P5BA 3NV3A 4PJYA 1JS9A 1W90A 2X6AA 4H7MA 4R7CA 2Q8OA 1Y67A 1C5IA 2AW9A 1ZVFA 2ZGKA 2WLHA 1F4MA 1PNKA 1UPIA 5C8WA 2Z5WA 1JPXA 5I0DA 5A1FA 1VRH3 4YY3B 5ABJA 1KS4A 4EWAA 3I8TA 4OMCA 3QF7A 4DR7O 2Q73A 2NN4A 3OFNG 5LBEA 4FZ1A 2EIJC 3AM2A 4OHWA 1GH6A 5FKBA 1WLEA 2G4IA 4NWVA 5FY8A 2CTPA 4EWEA 1CAWB 3MIFA 5BYNA 1QXJA 2R042 2BNMA 2BWAA 5I0RA 4XMIA 5JZGA 2EXJA 3N9PA 1CR7A 1N3QA 2OCCB 2D3PA 4DXRA 2F4VB 2QM8A 1K73W 2XUEA 4Y1YA 2PHDA 1A8MA 4KHPB 3BHPA 2QWRB 3A21A 2AHZA 4BJ0A 2XJSA 2PAEA 3KWVA 2WRAA 2ZHMA 1KQSU 2CH7B 4QNHB 1VF7A 1RTVA 1Y9QA 2VZ1A 3VBRB 1GOFA 2CTQA 4ABMA 4A6SA 2ZPXA 2WWUA 2EALA 1HDKA 3ZRWB 3K75B 3OT7A 1FAYA 3IDCB 3JARA 4DFSA 2AREA 4DUWA 5B66Z 2QTWB 4EFEA 4I0XA 1MSWD 3JATA 3ZHUA 3WDTA 5T5PA 4M4PA 4LF9B 4JGYC 3W7TA 3BY6A 1AL21 3WF1A 4JTNA 1HR0O 4YM0A 3HWJA 5D8AA 2ZBJA 4TT3G 5KMGB 2JB8A 4MXVA 2K0GA 4E2GA 3KZIZ 5F5AA 5GZDA 4Y4YA 4CC6A 4HZFA 3MHHC 1BMV1 4YM3A 2JVDA 3ZN0A 4OUSA 5IYDO 4YIPA 4CCLA 3GZAA 1U5YA 3JZVA 5IT9N 4ZS3A 1PGW1 2V09A 2WLNA 2HKXA 4MXWB 1QNMA 5GLWA 1WNSA 4DUZB 3THTA 5FJKA 1QH6A 3PHMA 3BGAA 1AR91 4N7IA 4JZ2A 3A4UA 3H01A 4LWSB 4H0LB 1QF3A 1V6KA 1OI6A 3N7MA 5BNOA 5JOZA 3WG4A 5KHHA 4Y22B 5FZCA 3ZXKA 3UK9A 3B01A 5J2UB 4P9PA 3KS7A 1BJQA 2HJIA 3ZKUA 4FPJA 2P3KA 3A2FA 1C5HA 1M57C 3VDDA 4JI3B 3A0BZ 2CWMA 2AR6A 1F5JA 1L0NH 3AYAA 4MGZE 2WT2A 2QJ1A 2R9AA 1V6NA 3RN4A 1H38A 3ML0A 2B45X 2I45A 5IVBA 2QQLA 2VMEA 1R3LC 2WWWA 2TUNA 3ZIXA 3IKWA 3W7UA 3ZFFA 1RMU1 1QEXA 2XAGA 3RRDA 4X62B 4ARXA 1YJKA 5F2VO 3DPRC 3ZIAG 5JVVA 5BNPB 5K0UC 3J4UH 5H5NA 2JJ1G 4LBKA 4V1PA 2ZEWA 1NG0A 1SQXH 5GLZA 4OUMA 2Q4PA 3SCGA 3PUHA 4UV9A 3ECQA 3WP6A 4R9AA 5HPOA 5AC91 1K7DA 4YW4A 4B3MB 1ZL8B 4NRQA 1IURA 5IWAO 2Z5UA 4PD4F 1DYKA 5B1BC 2YV8A 4JVAA 4HBNA 2WAOA 5FJHA 1UMIA 5B1AC 5FZ6A 3M8LA 5LP6C 4DRXA 4XDOA 4QKDA 5LB6A 1LOFA 5ABJB 2VM9A 2JKBA 2EJRA 1Q86W 4RAIA 1UO9A 2VNRA 4CXXA 1UN1A 4URTA 3PMSA 3DL3A 1TZOA 5IFPA 4PV1B 4YZ4A 1ZZ9A 3KV5A 5JZGB 3GM8A 4LO5B 1OCOB 4MHUA 5T50A 2YZ4A 5EZYA 3M3IA 5LOVA 3LDEA 2W3JA 1QVFU 1AR73 1XOYA 1CJPA 3HQRA 1C57A 4YGEA 4KBZA 2E6VA 1ACCA 4Q1RA 2QQMA 3FFQA 2PHFA 2VCCA 3C90A 2DYCA 1O3RA 5I0TA 3B9CA 2P4EA 1SDWA 4LBEC 1XNQO 3AFGA 2X5IC 1W3XA 2VCMA 5FMBA 2XJRA 3ZHVA 5FXXA 1S72V 5HCBA 5H6QA 1K9MW 4O4IB 1XEQA 4AQYO 5T55A 3WW3A 1P7GA 1WPXA 1Q81W 4I0XB 1QLEB 1H30A 1RUE1 5FMOS 4AFAA 2O8QA 2P1BA 3K0DA 1OH3A 3K58A 4YHHO 2A71A 4OFGA 3WG7C 1NKGA 1FT9A 1YI2V 2PAMA 5K4LA 3TK1A 2HG5C 1GYKA 5D8AB 4GUNA 4J6GA 2X29A 2WPDG 1AROP 3RZHA 2IUWA 4QX7A 2VXJA 1GUIA 3EXUA 3MIEA 1AR5A 1Z0HA 3N7JA 3P32A 2YG0A 1F4HA 4WVVA 1Y9MA 4FJCC 4J80A 4P5HA 4ZPIA 3AMMA 2C4XA 3SJCC 4XF1A 4KQ7A 2B9VA 4KU7A 4IGOA 3VDBA 1OLQA 4YW7A 3CE2A 3AG1C 1V6IA 1COWG 2QVSB 3CIHA 4ZY9A 2IWGB 5H9RA 3NNLA 3P3PA 5C4WA 5I93A 2P34A 3K51A 5BNOB 2Q0OC 4B4RA 1JOYA 1IQDC 1S0FA 1M06G 4LH7A 1AJOA 2L35A 1GM7A 5B4NA 1UY2A 3VDDB 4NJ4A 4GLXA 4FM1A 5FZKA 1EAH1 3OGRA 2XG3A 1KGYA 2ZEXA 3V0BA 2R072 2W1SA 1QWRA 4AQTA 5FYSA 5DN2A 5JR2A 4Z1VA 3WZ1A 1B04A 2VW1A 1SPPA 2ZR2A 5LA0A 3PU3A 2UXCO 3VBUA 1ZAUA 1WN7A 3FB7C 3ZFFB 2FDIA 1AR61 2A6ZA 1Q8QA 4I9WA 3SR2C 4YZ5A 5FXWA 2VMFA 4XXAA 1OV9A 2JB4A 3QH6A 3G6JB 4YG0A 2W87A 1BQZA 2YC0A 2YUAA 3PURA 4Y33A 2FD8A 3RVYA 2WN3A 3WUDA 4ORFA 3MICA 3ZFEA 4R6ZA 2PA7A 5DDJ2 2XNDG 5SV5A 4D69A 2WSUA 4NHXA 4QXHA 2NMOA 1D7PM 2XHNA 3GB7C 1W03A 1LR5A 5FPBA 5C3SA 2FQPA 3UYJA 3RVZA 4NKGB 1KJRA 2VZTA 2WO1A 3FHQA 4OQ9A 1SQPH 2ADQB 1SG3A 4DRXB 2EILB 3VD9A 4UOJA 3VD3A 1IZ3A 4EKWA 2CDOA 1V6LA 4AG4A 1UYYA 2W0FC 4XHXA 3O1VA 3KCYA 5KA6A 1ZBA1 3E8GA 1FMD1 4RS5A 3BB6A 3JAMN 4LKFA 4KI5M 2IC1A 2YS8A 4WVMA 1W0PA 1WUVA 4I7ZB 4S2GA 3G80A 3MI8A 2ZGSA 1GFF2 5H9QA 5LOVB 1RL3A 1SHWB 4F6RA 5FZFA 4NN0A 4XVHA 1E5RA 4BQ2A 4DV2O 2R1DA 3SPJA 5C3PA 1VRBA 4FI9A 1I08A 1DQ2A 4A6OA 3K5NA 3AYCA 1U12A 2QSAA 1Y76B 2J7MA 4J7JA 4DR7B 1AI4A 4YNIA 1IX9A 4AE2A 4RQPA 1JBCA 3FAVB 5C6CA 3BTYA 3K04A 3FHAA 4N43A 1LEDA 2DQ3A 4MVRA 1VBD3 4X65O 2W46A 1F2NA 3JQXA 4CH6A 3N36A 1K97A 1I5PA 2BVVA 1TME3 4PLNA 4PA9A 3DECA 2JECA 1LOEA 4EWDA 4CH4A 2RV9A 2JG9A 1UZWA 4O9GA 3R6SA 3NWKA 1POV1 1FPN1 4PA3A 4AFMA 1L7LA 4IEWA 2VMHA 2Z3YA 2RS32 3FN9A 2OPWA 3RWKX 2QQPA 2W1QA 2WS92 2EICA 2ET1A 4TWKA 1TMF1 3WNOA 1AJKA 1MABG 5CG9A 4UT5A 4JPRA 1OT5A 2CV6A 1QJY2 2XQXA 5DEDA 1NLQA 5C33A 1UZZA 1MPXA 4NIAA 4MVMA 2CGNA 1UMZA 1G9FA 3VGIA 1XJAA 4KU8A 4XFHA 1XBFA 2IW5A 2OX0A 3WINE 3WU2Z 1J3QA 5A70A 2GMPA 3PIJA 2ZX4A 1UMHA 1UPSA 1HXS3 1K4CC 4Y24A 2J1UA 3SPCA 2ZM6O 1AI5A 3OB8A 4MYEA 1L7QA 2DVFA 4FVVA 2YHJA 1JTZX 2BZDA 2XWJB 4JAAA 3THOA 3CRRA 4JI7O 1JX9A 2RS53 5E1AC 3IGAC 3MEPA 5K9YA 3V0BB 1EFRG 5D5PA 2GBOA 3SCFA 2CTWA 1SPPB 1XQNA 3LCPA 4JGYA 3VD5A 1UYZA 4XBLA 2IJHA 3HJRA 1EN5A 1RUI1 4WBNA 4OCTA 3OUHA 3V65A 5J2TB 2PGGA 1VMFA 4NUBA 1O3QA 4ASUG 3JCUZ 3OUFA 1QHDA 3O9OA 4QQOA 4RA0A 3USSA 4PDMA 4DV1O 3ZFEB 3L9JT 4EZHA 3ACLA 1J1LA 5GTIZ 2HWE3 5FBJA 2GUZA 3K5OA 1AR82 5BR8O 3U11A 1LCLA 4H7LA 2ZCWA 2XT9A 3E83A 4XETA 3CRAA 5FYIA 2GU9A 4IXLA 4AHYA 4H14A 4CEYA 4K1YA 4N53C 1XNTA 1G9DA 5A3MA 5JUVA 4BDVB 2VMIA 4D7TA 4HMZA 1OOPA 4ARYA 1H1MA 2JGDA 3EB7A 3WQ0A 3ILRA 3I5DA 1NYWA 4QPYA 2WDBA 3BAAA 1US3A 3RZMA 1OURA 3H8RA 5ANNA 3I2KA 3RYFA 3PUIA 3CU7A 1DCSA 5FFOC 1QH7A 1NUKA 3K4AA 4IV3C 4BHPA 4MUVA 3VBFC 2WKKA 1ZZ8A 4YFWA 3APBA 1HIXA 4I02A 2VVEA 3UKTA 4P9IA 1BBT3 3AZVA 1VMGA 4WVMB 2VZ3A 1VB2A 3LA2A 3EHKA 4AI1A 1F51A 4ZI7A 1BEV3 1YF2A 3SKVA 2LGQA 3MAQA 1DQ6A 1P8JA 5FYCA 5FLJA 4F6RB 3TEZA 3H50A 1N0NA 4DV3O 4P5YA 3M4FA 5CZKA 1SDDB 3E8FA 3WQ1A 1V9U2 3FLPA 4RQPB 3N9MA 3OBTA 4XCAA 1B35A 1GOHA 1TVGA 3OEHG 1NH2D 5FQ0A 5E89A 3KVBA 1H1AA 1AXYA 2XB6C 1JN2P 4OI4A 1S2EA 4GXLA 1BCXA 1KEXA 2Y26A 2VU9A 2A3QA 2Y33A 2VVFA 1HRI1 2HWB2 2LRPA 1ZSPA 4FPKA 1WMDA 2HWF3 2JG9B 4JI1O 3K03A 1Q3EA 3K46A 4GWIA 2RR11 4TN7A 2LROA 2OIEA 2ZR3A 5CIRA 2KD7A 3FMGA 1R1A2 4MSVA 1XNQB 4QJFB 2AENA 4GQ7A 2YEVA 3V64A 1WP8A 1V6OA 3CMGA 1S1AA 2P90A 3ZBHA 3OPTA 4AQYB 2XKOA 2WABA 3RYCB 3NJZA 4CDWC 4YW1A 4YIOA 3BN6A 3LAGA 1PGL1 4YHHB 2LTNA 2MEV2 1KBHA 1ZX3A 4FLTA 2YFUA 2R16A 5JMCA 2H8PC 3JB4C 3WD5A 4KGGA 1YO8A 1VAKA 2DCKA 3WG3A 2BOIA 1VQ4V 3PL0A 4UB6Z 5FP7A 5FO7B 3T1LA 3ON7A 1RUH1 3I3QA 1K5MC 4HETA 5J9PC 2JXAA 1NCQC 3PJYA 3SH5A 1E79G 1MR5A 2QBXA 3H8XA 5JDBA 2X5IA 1D2DA 5DAXA 1J5EO 1VQNV 4XEZA 1VAVA 2ZEZA 5FNVA 4DV5B 3AP9A 3Q8EA 2ZKOA 4QHBA 1GKBA 2UUCO 2GHYA 3L70H 4X64O 2F1MA 3EBRA 3POIA 4JGYB 5FZAA 3W58A 3AK3A 4ISQA 1JZ8A 1W2OA 3VL9A 4JI8O 3R0RA 2R30A 1D4VB 4JRAA 1SC5B 1KXGA 2A75A 5LBFA 3ZMZA 1Q8OA 2C0ZA 2JDZA 2Q9LA 2OS2A 2W52A 3LSQA 2V72A 1MQTC 2GUZB 4P9XA 5CFDC 3PJQA 4LFBO 5CEHA 2QQKA 1N3PA 1US2A 4GX1A 3ASIA 1VBA2 5A80A 4MVSA 2JKXA 5BY1A 1JVMA 4FPFA 4IE0A 2UXCB 4CEYB 4LF5O 4JRLA 2QM4A 4TUYB 3MW4A 4WZCA 1V6MA 1GMGA 1OOPB 4CPBD 4BXFA 2JGDB 1OLRA 1S2BA 4XUPA 1W6QA 1IG0A 4FSJA 2Y6KA 3RQ0A 2VQUA 2GC3A 3POJA 3RYFB 4LF6O 5LXTA 2ZGPA 1DLCA 3H1YA 1KMIZ 5FOBB 2LQTA 4JI6B 2EXKA 2XJVA 2V73A 4J42A 5JSRA 4QX2A 5HFLA 1M57B 4P9LA 1FNZA 5FPZA 4PDVA 3BKZA 1I7FA 1REDA 3LE0A 2H94A 2HFEC 2BTOA 5IUQA 2HYXA 3ALQA 3UETA 1I5XA 5A3LA 3WDWA 3VBHA 1WMFA 2Q30A 3ETPA 1PNLA 3RFRA 2QCSB 3DYPA 4AFCA 3HKEB 2DCJA 1QJX1 1ZZ6A 5LHIA 3K5MA 4RR3C 2CDPA 4D6QA 3OY8A 3CEWA 3DPRB 1K3IA 5CFCC 4XDLA 3DCQA 1YC61 1B35B 4JDMA 4IESA 4MT8A 5K0UB 3CB2A 4QHOA 1PV0A 5FQ0B 4AHCA 3TYJA 2D2CB 4QPIC 4Z07A 3GCXA 5CN0A 3X29B 4CDUC 3ZYPA 4ZKIA 4EYUA 4LC1A 2UY9A 2YMZA 5FK8A 3NMBA 4BK5A 4MTFA 4EQVA 1MSDA 2R0HA 4N21A 4E8DA 5BUVA 4XURA 3QLQA 2WA4A 4DV2B 4QMAA 4JI0B 3I7DA 1SEFA 2VNGA 4YGBA 5DUVA 2UY8A 2RS11 1PZ8A 3IDAA 3FUOA 1FFTB 3APOA 2YYOA 2BFUL 1P49A 1OCRB 1E57A 2P4VA 4LCUC 1GWLA 4X65B 2OQ6A 5FWJA 3SGIA 1RUJ3 4X66O 1SQFA 1PNGA 2AYHA 4R9BA 5SV8A 2P37A 1C8M1 1VLNA 1DU3D 2L6LA 4E8CA 2ZAAA 2VUAA 1W2NA 4XF9A 2O0OA 4AEDA 5DQ0A 4QKBA 4ZXKA 2CE4A 3PUSA 3EYPA 1MACA 4IIJA 2XBO2 5C8CA 4E4EA 4I50B 3HIFA 3I49A 1Y66A 4NIHA 1WBLA 4G3YC 1EP0A 1JODA 1UYXA 3MLLA 3LPGA 5IJ0A 4G4FA 3QVNA 3WP5A 2X5IB 5A6XA 4FLVA 1QOTA 3H7JA 3K59A 4JGSA 3S3WA 2G1MA 1JU4A 4IYIA 4IGGA 1I9RA 5FNVB 1BK0A 1BYHA 4X9QA 1QDOA 1LR1A 5JI9A 3K08A 2XTAA 3K48A 1QJU1 4HXCA 3OUJA 1XSRA 2PI5A 4NHMA 1BLZA 1HB3A 4RFT0 3AKQA 4NTWA 5IFTA 4AL9A 3WG7B 4XTPA 1AYM1 3O0WA 1GP4A 1PX4A 2PYJA 1G9CA 5K1XA 1QMJA 2X53S 4B7KA 3MF9A 1Q90D 4NO4A 1SERA 4IEPA 1ZRDA 2Y0IA 1KRIA 3T1YO 1CZTA 4COVA 3BRCA 3G67A 4JI7B 4PA4A 5DG1A 3B9IA 1OLMA 4CU9A 1ZUQA 4JDNA 1UOJA 3UT5A 2VMCA 2QE7G 5G05L 2BJSA 1U97A 1SLAA 4PDRA 1HRV2 2P22C 3CJIC 3DGEA 5JPNB 4JQTA 1XMOO 3I56V 1RXFA 4LOTA 2CGOA 4D7SA 4HYOA 1ENSA 1GZCA 2WUHA 2W6IG 4EJRA 4HAMA 2YBKA 3RGBA 3JAKA 2CSGA 1MVQA 3DSQA 3LD8A 1N32O 3E8HA 1KU9A 3E8BA 2W95A 4J9YB 1LUVA 1I5ZA 3IFXA 2ZMNA 3ZFGA 3STLC 5JJEB 2QQWA 5A1AA 4JTOA 5IVCA 1XBLA 4QWNA 2CNAA 1JJ2U 5EJ1B 3ZSKA 3AL6A 3CQOA 4GKKO 1VRH2 1JHNA 4ZIBA 4GX5A 4BQXA 2RNBA 1RVF3 3LOIA 3T3YA 1PNMA 2WYFA 4E4ZA 2Q5TA 2ITDC 4YARA 2DUPA 3CZUA 2EA7A 2VQ0A 3LFIA 3RPQA 4IE7A 2HWD3 4UXAA 2B39A 3OPWA 3U4XA 3DN7A 4QKNA 5FUIA 4DK1A 5A32B 4DS0A 3ZEDA 2V7QG 2UWBA 2AZ5A 4MTXA 2PFWA 5IVJA 2D7FA 1MNGA 4FZ0A 5B5EZ 4JV5O 2D98A 1PVC1 5A3PA 4CRQA 1O4ZA 3JBG2 2ZGOA 1NA1A 2WZR2 1RB8G 2RJ2A 3APQA 1UX7A 1ZZBA 3ZYFA 1OVPA 1Z7S3 3FLRA 5LBQA 4R8CA 3AEIA 4N53A 4X8AA 1R6TA 2JICA 1BZKA 4DV3B 2ET7A 4ATFA 5HBAA 2CY6A 2XLAA 1WLWA 4X8PA 2EIBA 2W1WA 2DYSB 3G7DA 1FAFA 1OQDA 2H6BA 1YZBA 4EZ4A 1M4UA 4MTOA 1JR9A 1W6PA 2WQ4A 4IV3A 1N34B 1D2QA 3QACA 4BCUA 1VBE2 2BOJA 3I3DA 5A7WA 4QXKA 3C7HA 3E6DA 1S0DA 1F35A 1VBB2 4O65A 2UXXA 3B2EE 1K5QA 4PDWC 4JI1B 3GWOA 1X7NA 1GWKA 4FPYA 3T2PA 4IIJB 4WFBV 1SBFA 5IVEA 5C8CB 4WM7C 3CC4V 3KHBA 1H2MA 3JYCA 2Y34A 4LKSA 1UKGA 5FY5A 1PK6A 2JK5C 1EAH2 1FS0G 2WNEA 2AHYA 4FLUA 5IJ0B 3W7XA 4CPBA 4M3CF 3ZIWA 1JZ6A 3RG0A 1GQGA 4I3PA 1QJZA 1W6OA 4PLMA 2XJTA 3I2IA 3HPLC 1ODMA 1WA6X 5C93A 3AMQA 1K33A 3LIGA 3IIIA 1OCZC 3ETDA 4MO3M 1QGLA 4ZOLA 2YPJA 1WCUA 1YQ8A 1QKQA 1MS8A 1CAUB 5JCTA 1X82A 1CAVA 1VF5B 2G38A 2FDKA 3IZOA 4YVSA 2JEXA 1HB4A 5EJ3A 4FMTA 3R4UA 1ND3A 1YXWA 5JWPA 4FPPA 5CA0A 4LO6B 3R65A 4J10A 3Q9OA 4Y1UA 4NAOA 2NN8A 5CKMA 1A6CA 3D3IA 4XIKA 1J5EB 1WBFA 3VD4A 3AMPA 4LORA 3UT5B 5LMUO 2XOKG 4OMDA 2QWOB 5DPNA 2UUCB 4QPGA 1IBKO 4XJ8A 2YDEA 1WCQA 3U07A 4P9OA 4JHZA 1NH2B 5EYYA 3CDZB 4COYA 1S0BA 3HEIA 2R073 3GBFA 3USUA 4JI4O 2CUGA 3HQUA 1TGOA 1BXHA 2E5LO 4JI8B 3ZXEA 3H1WA 3URFA 4FFIA 4CDXA 4TV9A 2ZZQA 2PHLA 3JAWA 4GH4C 2W1UA 4DV7O 4B08A 3JASA 4MGKE 4LNUA 4BIOA 4UFMA 1AR71 5FZ8A 1LJ7A 1NCQA 4JHTA 2YFZA 2MHFA 3ZFGB 5FZ1A 2VG9A 3HR9A 3LSSA 1KFXL 3HT2A 1DZTA 3R05A 2ZGTA 5DDJ3 1XL4A 1VAMA 2A7AA 5L7OC 3JD72 5FYUA 4DXZA 4BH9A 5JVDA 5FP3A 5LK5A 1COV3 3ZMOA 5JIUA 4LKDA 1S76D 4OULA 2WO3A 3KCCA 4CDQC 3AC0A 4YVWA 1MVEA 4QKFA 5C3RA 2E51A 4LF6B 4MVZA 3ZMUA 3DF0A 1N47A 4LITA 4BK4A 1LOAA 4MVOA 1TG7A 2Q4SA 4IV1C 5FPRA 2ZIMA 1W9FA 3B02A 4KXRA 2B9UA 1XUQA 1NA1B 2K1EA 4LHSA 3SXWA 3RZKA 2YY1A 1YQ2A 1JYCA 3OBZA 2BU9A 1L7RA 3ORJA 1S3JA 5F39A 4BA6A 2LFRA 1KD7A 4N53B 1KQRA 3R4DB 3DC5A 5E1RA 3WLUA 5KC6A 1RJ7A 3KQ4B 3OE7G 4UB8Z 1TMF2 4Q2FA 2WAAA 5FL7G 4D7YA 4J25A 5KWRA 5LEJA 2A9HA 3AVSA 5JIAA 2VJXA 4QPKA 1OA2A 4Z2WA 4CXWA 4IV3B 2XVGA 1HLCA 4CUCA 3VBFB 1VQPV 2X09A 1UNBA 3PDQA 4AK3A 3VZOA 2FCVA 4J41A 3VD7A 1NTMH 3A23A 3GBWA 3KVAA 3MUZ1 5ERLA 4XXPA 4JI2B 2R70A 5EXOA 3NVCA 4NTXA 4DY5A 1WWYA 1ZBE2 5HXMA 3CZJA 5BNQA 1QVGU 2HWC2 2D6KA 4LBLA 5BMVA 2BV4A 5IATA 3AG3C 2YC4A 2AC1A 1W6OB 5CFCA 1LESA 4R4ZA 2ZX0A 4Y20A 1RC6A 3BTAA 3SC7X 2RS33 2VRZA 4PBOA 1F31A 2WS93 1M9NA 2VECA 2JWPA 4QPIA 1VE0A 3EFFK 3VOUA 1RUI2 3ZCCA 4P9WA 5F9TA 2P7TC 1QJY3 2RMKB 4DUYO 1ND3B 3LSEA 5CA3A 1XNCA 5CA0B 1RUC2 4LF8O 3ACGA 2E7AA 3TNPB 1PM4A 5FZ4A 3POFA 5GLTA 3TOJA 4O4JA 2V4DA 1JYVA 1AB3A 1DGRN 4KG0A 4EB6A 1CVNA 1Y7BA 4K3AA 4XACA 3OTFA 2MK3A 4QPGB 3UJQA 3MD0A 3BA9A 4FPHA 4K40A 3R4SA 1WP7A 5KHKA 3USUB 5ANQA 4RGKA 1XI1A 5I8TA 1RHI2 4QDRA 4DUXA 4XF4A 4CDXB 1DGLA 4TV9B 4LNVA 2BWCA 2LO1A 3JAWB 1K5MB 2W94A 3T1YB 2E26A 4DRVA 2Q7GA 3K06A 3JASB 1XC6A 2ARAA 3CD6V 3OGVA 4LNUB 1GSLA 2F95B 4C91A 3JXSA 1NCQB 1EUUA 1QJFA 3DXRA 2DYRB 3LUTB 2YBSA 3CJXA 1TUBB 1I94O 2UXDO 4I4TA 4W6WA 4BQ1A 1XMOB 4XFCA 2Q1FA 1AP5A 3DXUA 1AR83 4RFRB 1FJGB 1W8UA 3D5OA 3WB1A 2BFUS 5CU1A 3CF6E 1SZTA 2JDMA 3V0AB 4JC1A 4FBFA 4AFDA 3O7OA 2Z0AA 3H3LA 4YVWB 2OWOA 1TME1 1SS3A 1CAXA 4HK8A 3JCIA 5LRSA 2J1AA 1N1YA 3AZZA 3G4SV 4GIQA 1E5HA 5C3OA 2D6MA 1SZXA 4XW3A 2GDSA 1SF9A 3CL1A 4KFMA 4A7YA 2Y8KA 2WJSA 1AX2A 2DCTA 2ZGLA 3ZHQA 2K2SA 2RR12 2R32A 2A6XA 4DV0O 3AMHA 3ZYRA 4EN8B 4GKKB 1N4CA 1HNZB 4BQ5A 4NAMA 4XDQA 4PIYA 2EIKC 1BKZA 2VUCA 4L92A 3H1LH 2OCHA 4UUJC 5FZ3A 1VQLV 3QOPA 4GULA 4RQEA 4H44B 1VBD2 2IVIB 4A45A 1PKXA 1MZ5A 1MZEA 1NZCA 1CIYA 1PIV3 1VQ5V 5FK7A 2J1SA 4BQYA 3MF6A 3P1IA 3ZSLA 2KB1A 1V9U3 4P9GA 1HXS1 4GD4A 2LJ2A 1QOOA 1GZTA 2QR4A 4O4LA 3BU0A 5JH7A 4DO0A 2WNUA 1VQKV 4I55A 1KD1W 2DBIA 2X05A 2RS51 3OBRA 3I3EA 3CCMV 1SFYA 1DQ1A 3EQEA 4B8EA 2QDRA 2XHBA 2HWB3 3N4MA 2M6YA 4ZZ5A 5HV4A 3OD4A 4WBBA 5DAVA 4UI9L 4KMQA 3D36A 5BMVB 2Y6FA 4RR3B 1R1A3 3DUIA 4F8AA 4AFBA 2EINC 5CFCB 3KV4A 4U3JA 4CEWC 4Y20B 4L99A 2D97A 4IQPA 2RMU3 3VBOC 1PVXA 4QGLA 4UV8A 3WCRA 1TVKB 4XBFA 4QPIB 3D3AA 3T2TA 2PF4E 4LBOA 3MLJA 3D8CA 2CAUA 3GYDA 4XUTA 2W6JG 2NM1A 5GONA 3E89A 2ZGMA 1H8TA 2X10A 2JE9A 2WC2A 3LDBA 3PVBB 1KITA 1OPOA 1OQEA 1K5JA 1GWMA 4L0PA 2MEV3 2P3IA 4WVZA 4DW1A 5A6ZA 3IC9A 2UYAA 1RSOA 3NAPA 4A4AA 2Q7EA 5A9GA 4GT1A 2JS5A 3TJTA 1QNYA 4XFIA 3NJVA 4CZZA 4XE9A 1NZIA 3OGIB 1JJOA 1FXHA 1G9BA 4O4JB 4CCKA 2WT0A 2EJ7A 2HP8A 3FD9A 2KKWA 4EB6B 3ZS8C 3T30A 5GZFA 3A0NA 3L71H 2WO7A 1OUSA 4QQPA 1WCSA 1RITA 1SBEA 4BE3A 4Q0SA 2VVDA 4IDZA 3M99B 3GF6A 4EN0A 5FZGA 3W59A 4B29A 3LZZA 1QR8A 4RHV1 2GN3A 4BR6A 3LA3A 1BBT1 1Y74A 4RSUA 4PHZA 3W20A 1AX0A 1OF3A 1ULGA 2EZPA 4UAPA 5F2SA 2HWE2 1BEV1 2DWRA 3JD1A 1R092 1RINA 3KB5A 3NW4A 2E7QA 1AVMA 4B4PA 2YU2A 4BMBA 4DXTA 1VBC1 3SLIA 3IDBB 4NR1A 1NTZH 5LMUB 1IS3A 3DXRB 2JDIG 4NB5A 3OW2U 2HJDA 4ISRA 4I4TB 1W3VA 1IBKB 3EXAA 2HYKA 3VUOA 3P6BA 2YSUB 2P4KA 2QTSA 4JI4B 1E5SA 2JG8C 1SQGA 4FPEA 5C5UA 1OA3A 4AXOA 2VO5A 5CVRA 2IXJA 2NZ9A 3NR7A 4WM8C 4AYUA 1DFQA 3CLPA 3GXUA 2FTKA 3CO2A 2OYQA 2Q8DA 1CAXB 4QDQA 1UPGA 1DBNA 2HWF1 2O57A 2OQ7A 2ZKLA 4FQZA 3LIHA 3NKGA 4ASMB 1DHKB 1DP0A 4QGMA 2NR5A 3H0OA 2F4LA 1O8PA 2NLJC 5FBZA 1X8MA 5FP8A 4LLOA 2VCAA 3IDEA 3BFRA 2CWSA 3RMYA 2Q5ZA 1LULA 4I01A 2R062 3HVDA 4LBQA 2OTLV 2NMNA 1TA8A 3ZMSA 2ZDIA 4JGZC 2ZE6A 3OEBA 1SZBA 2YIDA 1AF9A 2GP3A 3ZSMA 5DAQA 3WP4A 1PO11 3UL2A 5E79Z 2KG7B 4CCNA 2XJUA 2DVBA 3ZOIA 3HD8B 4U2AA 1QU7A 1R3JC 1KC8W 4PCRA 3RMXA 1LHWA 2GDFA 3E22A 2P06A 3S5AA 3TXSA 4O4LB 3VZKA 2FCTA 5JH7B 4KGQA 1DGSA 1UFIA 4CCOA 4I55B 1JFFA 4LF7O 1H2KA 4I09A 4M3CE 4YG6A 5LATA 2DV9A 5BNNC 3I55V 4CH3A 5FYYA 1ZTEA 2PHUA 1XNAA 1JHJA 2VMGA 5FZ9A 3C3VA 3WHTA 4MS2A 1TAEA 1F9KA 2VOXA 3OCPA 4LR3A 1X50A 2ZHLA 4C8DA 4U3JB 3THPA 2RDSA 5DZGA 4XDPA 1JYTA 1CD3G 1MS1A 4FAHA 4G2KA 3LNNA 5FZHA 2O14A 3UO3A 4AZZA 1QLNA 1H8TB 1AR93 1GR3A 3QTCA 3B09A 5HCFA 4FQ4A 1RSOB 5LZ6A 4NPMA 2C1FA 2JDYA 3AJZA 2XBO3 5L3FA 5F3CA 3D4KA 3LB9A 2RN9A 1LOCA 5CB4A 4I0AA 3QG5A 4ZU5A 4AAPA 4XZUG 4X1KA 1KECA 3W5NA 4BQ4A 5C9AC 2W5FA 4MXWA 4KWUA 3OR7C 4LQRA 5KX5A 2PHRA 4LH6A 1NY71 5K7PA 3C8XA 5L73A 2E7TA 3AK2A 1H6YA 2W9XA 3F7YC 4F4LA 5A7OA 5L36A 4DUYB 2Q6AA 4KNCA 4YWAA 1FXKC 2XAJA 1Y74B 4Y22A 2ZABA 1NR1A 3VKMA 4WM7B 2WSSG 2O8OA 2VD7A 2XASA 4CUGA 1DIWA 3POGA 2WR9A 4PELA 3JQWA 1S4CA 1PHMA 5IVFA 2EXIA 4R4XA 5FUPA 3MV11 2KA3A 4GWNA 3JB8A 3ZSEA 2YC2A 4OGQB 5AC93 3J8F2 3ZYHA 3BA8A 4X1IA 1EZJA 3L72H 4MV2A 1ULFA 3SYCA 2H3OA 5KXCA 4UCOA 2RM21 2JE8A 4AQ6A 2VNOA 1PNFA 2AGAA 2GZWA 5E6HA 3D82A 4YZ2A 5CBHA 1GKFA 4G9SB 1UCXA 1Y43B 4FOWA 3L9DA 3CNAA 4AHZA 1ND2A 1GICA 2C2AA 4BW5A 4QQLA 1Y9GA 2EIGA 2R041 4M0HA 4XQ4A 4GJYA 1W8TA 3IAQA 2C9AA 3DKQA 1QDCA 1I94B 1LNQA 1YLLA 1ZL8A 3TN92 2YXLA 3K0GA 2AZ2A 3C3TA 4NE9A 1IKPA 4YYOA 4LUKA 2FDFA 1DG6A 2DVAA 3MLKA 4LBQB 1E5IA 4E9KA 2G9GA 5EQUA 4ZZ8A 3VBSC 2Q7HA 1UIKA 5T5OA 3U1XA 1RM1C 1BL8A 2W91A 3OEEG 1OC1A 4TQDA 2B9ZA 3RZJA 1UZYA 3M2MA 2AEYA 4ZS2A 3IPVA 5FP9A 4GH4B 2ZHNA 2DWEC 4K8XA 1OMIA 3POEA 5KXEA 4DNYA 2J1RA 3E22B 3RYKA 3ZX6A 4DV0B 2E9QA 2OIIA 4OHZA 5ACA2 2QQOA 1JFFB 4F6EA 4RN5A 4QXBA 1VF6C 5BY5A 4PIZA 4MTGA 5IK4A 3WNPA 5FY9A 3ZPYA 1O7FA 3JBG3 4E27A 2WZR3 1CPYA 4Y5SA 3K79A 1CPNA 2RDNA 1RUJ2 2WLKA 5DXDA 2VBDA 4FPLA 3INAA 5LHGA 1XILA 4CDQB 3LEMA 1FFXB 2FYUH 4NRMA 4DR2O 4O4IA 5CADA 4GWJA 1GN2A 2XAQA 1NVPD 1D0GA 4BW9A 1O5LA 3OGSA 3RDIA 1N1SA 3UT0A 1YJLA 4K8RB 4PBPA 1IBMO 3O1OA 4IV1B 1RUOA 1A78A 4GB32 1VP6A 1W8WA 4GKXA 3F5TA 3ZO0B 5DUXA 2HVJC 1JCHA 1T2XA 1KB9F 2ZIOA 1GN4A 2UWAA 1VBE3 5A33A 1R3IC 1UF2C 1VBB3 3Q8CA 1NBMG 2OCCC 1ZRRA 3QH7A 5GALA 2VZRA 4EROA 4FOYA 1NCRA 4E4DX 4HKOA 5APAA 1D5NA 2Q1ZB 1WCKA 5EC1C 3F5WC 5JLVA 5KR7A 2A70A 3GJBA 1G86A 1VQMV 5CB4B 1H6XA 4MVQA 2Y6JA 2DVDA 1EAH3 3ZSJA 4LFAO 4XF3A 3FBYA 4X1KB 2ZS6B 2EX3A 4CC5A 3VBRC 1W0JG 3PTRB 2E63A 5KX5B 4A44A 1BK1A 4S2FA 2VUDA 5B4XA 3LOBA 1YSCA 1EUTA 2CAZC 3OF1A 1I0HA 2W47A 4XIOA 4UW5A 4GX2A 2NYYA 2BBVA 5C3QA 2A79B 4C0BA 1G4YB 3TAYA 4XCBA 4CSWA 1GZWB 2M7WA 3VBBA 4W8JA 4DR1B 4I9QA 2HEVF 4XBNA 3M3EA 2V1DA 3M7MX 3LGRA 4OHYA 3FZ3A 1B3QA 1GK9A 1H0BA 3AG3B 3I2OA 1EV12 3WNLA 4GZ9A 2ITCC 1NOVA 3MGUA 4A7KA 4XPVA 3J80N 5JI7A 4CEWA 2VR4A 1I1EA 2A3YA 3O5SA 1HNXO 1YVWA 4X1IB 4FLZA 1BZWA 3VBOA 4TSVA 3ZX7A 3VN4A 4TSFG 1YCIA 4DYLA 4K8ZA 1W8OA 3NNFA 5C8YB 3JD0A 5CA6A 1ORQC 1WPBA 1H8EG 3O1RA 2DE0X 4IGPA 2BCCH 1ND2B 3WX5A 3WQBA 4Q4V2 4LMFA 3THCA 2WLJA 2X6CA 1RVF2 3P30A 3K3OA 1G8WA 1WLTA 1R082 3UGFA 2BPA2 1NT2B 3OR6C 4L87A 1GOGA 2D5FA 2WSVA 2ZKNA 5D1IA 4B3NA 1W9WA 2RJLA 4CXYA 1QQP1 4Q5OA 3E86A 1RUG2 3LQCA 4DR4O 4QM8A 1KJLA 2QE3A 3HNMA 4OZOA 2JEMA 3FUQA 2HWD2 1IBLB 2ZGRA 3GWKC 1J58A 3NV4A 3JD73 2JJ2G 1A8DA 1CONA 1NQTA 1UQXA 1QHTA 1ASJ2 2BBAA 4CCDA 3THDA 2ZNIA 4YZ1A 3A7QA 3IPVB 3EO6A 4JQRA 2YIBA 4H2AA 3VQYA 1HWYA 2VZVA 5A7NA 5BNPC 5F37A 2HEWF 5L9VA 5LHHA 2V5DA 1Z7S2 3VHNA 1IS6A 3SISA 4OXSA 4JTCB 4X89A 1Q82W 4NPRA 1JI6A 3KV6A 2WO2A 4QD2A 3CHXA 2E32A 3BVCA 2OT7A 3MIGA 1Q5OA 4FVMA 3SH4A 4LIVA 4DIQA 3BOWA 5LEKA 1JOPA 1MS9A 1X36A 1VEWA 5DZFA 1Y76A 2LFSA 5H6RA 4HFSA 3FAVA 5LMNO 4XDJA 1C1FA 3FYIB 5L3GA 1H2NA 3OMNB 3M8AA 1YFXA 1O59A 1TMF3 2DF7A 2WIIB 1IPSA 5F3EA 1RUD2 3J26N 4AQ2A 3DYOA 3C2UA 3X2QB 3WF2A 4LF7B 1D4M2 4PA6A 1PD3A 4JYAO 4NIGA 3S5QA 3IT8A 3SJAC 5A33B 5JZGC 5AFEA 2F17A 4QT6A 4R9DA 3CXCU 3LDDA 1NCRB 1BVP1 4COUA 2R071 1ZBE3 1QXRA 3RYHA 2HWC3 2YI9A 3UV9A 3T0BA 2WZPP 4O7XA 2PZSA 4DV5O 4HK9A 5JJJB 5KUKA 3B8MA 1QNWA 1BT8A 3WNNA 3AFKA 1NJIW 4MW3A 3FB8C 2EZOA 5KLVH 1DF0A 1NAEA 4YW5A 2QKCA 3H9AA 3NV2A 3RNSA 2B42B 3H1IH 3HAGA 2FBEA 1YTFD 1V6JA 2DCYA 4DQAA 1RUI3 5BNNA 1ULPA 4DXSA 2ATKC 5DDJ1 3TNQA 5D8AC 4UYBA 3CCEV 5GW7A 1CJDA 1X8EA 1YJWV 3IB3A 4NIIA 3LNMB 3IMMA 1MEC2 1HX6A 1XHXA 4GCZA 1RUC3 3FFZA 1HQWA 1ST8A 4H3WA 3D0JA 2XJPA 3DGTA 4OPHA 2VW2A 3OTOB 2QTOA 5DZEA 1PPJH 1YJ9V 4Z1MG 1Z78A 2Z42A 4CEWB 3I2FA 4YZ3A 3H42B 1LODA 2VOWA 3VBOB 1URFA 5A7SA 1R73A 4LK6A 2QQIA 5JSPA 4K0KO 3LEKA 1ULEA 1O4YA 2D3SA 2PY5A 4HN1A 4Q4W2 1XDCA 5J2TA 2C9KA 2ZGQA 4O61A 2XH6A 3B7MA 4NVPA 1TNFA 1RHI3 2GNTA 1L3JA 1U0AA 2D6PA 2E31A 5BNOC 4JI6O 3ZXDA 1Q8SA 3RI8A 3UO2A 2WWJA 1OKQA 2HKOA 2D93A 1SMVA 3W21A 3L75H 3OOXA 3POWA 5FYMA 3LEIA 1COV2 3BU7A 1QIQA 3VDDC 3NV1A 4YSFA 5L19A 3CCQV 2WLIA 5BXXA 4QQHA 3SYOA 2PTMA 4DUVA 3O65A 4K7JA 2VZUA 3MYXA 3R66A 3KM5A 1EN4A 5KBFA 3MO4A 2OW4A 3JU9A 5FZOA 5CKQA 3ZFFC 1RFYA 3WW1A 2DCZA 4G28B 5L3BA 4FT8A 3IJ4A 2WQ8A 5FZLA 2CGPA 2ZEYA 3AZXA 4PF1A 1MZ6A 4OLLA 3N2GA 5GTHZ 3FHIB 1UOFA 3K9AA 5IY5C 3UGHA 3GHMA 4CA9A 1W0KG 2UU9O 4FCAA 3RYPA 4SLIA 5EHDA 1M1KW 5HCHA 1W28A 4NPLA 5LRRA 4YM2A 5LA9A 4XQDA 1MMMA 2RS31 4NRPA 4Z2AA 2RR13 2JGUA 4JI0O 2JG8B 1LOGA 4ZHQA 5LK7B 2F66C 2P17A 2J22A 3N3HA 5KXDA 1C3HA 4WM8B 4IEVA 5IWFA 1N36O 3VL8A 4N23A 1HP8A