3ETQA

X-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3etqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3etqA02
2Q4SA 1CAVB 1QXJA 3MDPA 1EYBA 3BU7A 1ZZBA 1YLLA 4MGIE 3KGLA 1FI2A 4HMZA 5JSPA 4JTOA 3H1WA 4BHPA 1CAWA 2GC2A 4UXAA 2PA7A 4ZU4A 4FAGA 4I3PA 4I01A 3FX3A 2Q30A 3OTFA 3LOIA 4LUKA 1UW8A 3U11A 3NL1A 4EROA 5C8WA 1L3JA 1O3RA 4LA3A 3EO6A 3NKTA 4MH0E 1ZZ8A 3E6CC 4Q0VA 2GZWA 2HJIA 4OLLA 2GAUA 2QNKA 3LAGA 2D40A 5LEKA 3E5XA 1YWKA 5FQ0A 4GULA 1NE4A 1PM7A 1IPKA 2WC2A 5KHGA 5CVRA 2OZJA 4LLOA 3NVCA 1ZRFA 3DL3A 5FLIA 1SQ4A 2Z69A 4F7ZA 1Q3EA 1J58A 4XFAA 3OF1A 4A2UA 3E6BA 3NSTA 2P17A 1EPZA 4YRDA 3PVBB 5T3NA 4XF9A 5I8TA 1UIJA 1ZZ7A 3FHIB 4QMAA 3USSA 5E16A 5FLJA 1NYWA 2IXKA 1XE7A 1HW5A 5BPXA 3IIAA 1ZZ6A 4I09A 1UPIA 4YNIA 2CV6A 1X8MA 3BB6A 4JTNA 3RDIA 1I5ZA 3UKNA 3KMHA 5JAXA 4IEXA 5LRRA 1OFNA 1XRUA 2CAUA 5I0SA 3RNSA 1J3QA 3DV8A 3UKVA 2Y0OA 2FMYA 1PMIA 2CGPA 4QX5A 5CU1A 2XGXA 4WBBA 2GC3A 1J3RA 3MYXA 4FBFA 3CLPA 3RYKA 2UY8A 2VPVA 4E2QA 3IBMA 4XF0A 2ET7A 3RZZA 1DGRA 1QXRA 5HI0A 1CAUA 1ZRDA 3SCHA 2D93A 3G7DA 4F8AA 4IEQA 2IXIA 3VHRA 2PHLA 1TQ5A 2QVSB 4Q0SA 4LUMA 4Z07A 5D1IA 3S0MA 4N9IA 5JSRA 5I91A 1YFYA 2D5FA 5JR7B 4QM9A 2OZ6A 5KHHA 4ONUA 1JUHA 3I59B 1RC6A 1FT9A 1EY2A 2PAMA 3BPZA 4XFFA 4KL1A 1V70A 4LULA 2XLGA 1LKNA 2XLAA 5FQ0B 2WFPA 3KCCA 2C0ZA 5J48A 5FPZA 4ZU5A 4IEOA 4I2OA 3LA2A 3WW3A 4YSFA 5BY5A 1DGWA 3C3VA 3FE5A 1YFUA 3S7EA 1UCXA 5CADA 4K8FA 3QACA 2OYZA 4HVQA 1NXMA 3TNQA 4IETA 1ZREA 4I02A 1RL3A 4DINB 1SEFA 4XF3A 2IXCA 3KSCA 5KHKA 1YHFA 2UY9A 4AVAA 4Q29A 4WZCA 4MGZE 4QGMA 4META 5K8SA 1WA4A 2PTMA 1CAVA 1X7NA 3ES1A 2BGCA 3I54A 4UBHA 1Y3TA 2E9QA 5JCTA 4HN0A 4MGYE 5I0RA 4RD7A 5F1RA 4IEZA 2KXLA 2IXJA 2O1QA 4EWEA 5EFUA 4CYDA 5I8YA 1UD1A 3SCFA 1QWRA 4L2NA 4LA2A 4LEJA 4X6RB 5BV6A 3TNPB 3U10A 2XL7A 1H1IA 1J1LA 5KHJA 4R52A 3H7JA 5LRSA 1FXZA 4ZU7A 2OPKA 5FPXA 4XF1A 3SXWA 4IEPA 4QXKA 3LWCA 4XFHA 4OFGA 2MPFA 2H6CA 1GQGA 3BALA 4E2GA 1RGSA 1G6NA 2DCTA 4KU8A 3WW1A 1ZX5A 2PAKA 3FFQA 4KWKA 5I93A 4B29A 2ATFA 4KU7A 3WW2A 3L2HA 3HT1A 3E6DA 2QCSB 4KWLA 4PJYA 1RUNA 3ES4A 3WW4A 5JSOA 4Z82A 5LEJA 1EP0A 4HBNA 1CGPA 3EJKA 5J7MA 1LRHA 1LB2A 2VQAA 2I45A 5C6CA 2HKXA 3ELNA 1QY4A 4Q0QA 3JZVA 4XF4A 1X82A 3H1YA 4BH9A 3ROUA 3QOPA 3E5QA 2V09A 3GYDA 3CL1A 2Q0AA 2H0VA 2ZCWA 2Q1ZB 2H6BA 1NE6A 4TLFA 2F4PA 3D0SA 1CAXA 3N4MA 4PIXA 4MGKE 4XEZA 1O3QA 2O8QA 1XE8A 3SHRA 3GBFA 5EZWA 3RPQA 2N7GA 2BEOA 3R6SA 2GC1A 1OD5A 3E5UA 4HLTA 3ST7A 4XFIA 3H50A 3D0JA 1CAXB 4XFGA 1DZTA 4R8HA 4EWDA 3IDCB 3PNAA 4Q0UA 3MPBA 4NVPA 2K9ZA 5BUVA 4FAHA 2IXLA 2B8MA 5E1RA 4H7LA 2QJVA 4N9HA 1IPJA 4HVRA 3OGJA 3IWZA 4IESA 4UBGA 4AQ6A 1VR3A 4HSLA 1ZNPA 1CAUB 2D5HA 2BNMA 4PIZA 1SFNA 3H3ZA 3E97A 3DN7A 1J3PA 1YUDA 3LA7A 1OMIA 4JV4A 4FT8A 4D7TA 1O5UA 3DKWA 3UKTA 2MNGA 4D7SA 1X8EA 2EA7A 4PIYA 3BCWA 2ET1A 4YARA 1VP6A 3CEWA 1WGPA 3LA3A 1O3TA 1UIKA 3EBRA 3NJZA 1LR5A 1NZCA 4AXOA 3IDBB 4AQ2A 1J59A 4HZFA 1I6XA 1O7FA 1OI6A 1GQHA 5I0TA 4KWJA 4E2SA 3M3IA 4MUVA 5KHIA 3I59A 3D82A 4EWAA 3FJSA 4IERA 3CO2A 1ZRCA 3H8UA 2BNOA 1Q5OA 5FDBA 3H1MA 2PHDA 4LTAA 1Q43A 4Q0PA 4IEYA 1ZRRA 4I0BA 2XLFA 2CAVA 2UYBA 1RUOA 2XL9A 1DZRA 4EV0A 1H1MA 3MZHA 4XFCA 2XKPA 4QGLA 2XHKA 1ZVFA 2B5HA 3OD0A 3H9AA 2BNNA 4O9GA 1ZZCA 2GU9A 1RTVA 3RYPA 4QGNA 3EQEA 1CAWB 2UYAA 2Z2SB 3FZ3A 3HQXA 4XETA 1O5LA 2QDRA 4WVZA 5I0UA 2EVXA 3SCGA 1CX4A 2PFWA 3ZDSA 1WLTA 1ZZ9A 2PAEA 3SMHA 2GH2A 4IEWA 2OA2A 5FCCA 2B9UA 3B02A 5FLHA 4XFBA 4L11A 5BXXA 2FQPA 3I7DA 1YFWA 4MZUA 3OCPA 4P9GA 4J1XA 3NW4A 3M70A 3HT2A 2K0GA 4J1WA 3FWEA 1VJ2A 4BIFA 4HSJA 2MHFA 2XKOA 4IEVA 5KBFA 4AVBA 4BYYA 2PYTA 2EAAA 4IEUA 1YFXA 5J3UA 4HVOA 2PQQA 2ZKLA 4I0AA 1Y9QA 2ETEA 3LZZA 4JVAA 4O9EA 3ACLA 3HIFA 1U12A 4ORFA 3U0ZA 4MX3A 2IC1A 3EHKA 4AVCA 1O4TA 1O3SA 2GC0A 3KGZA 3CF6E 4YYOA 3S7IA 5I8SA 3CJXA 3PLQA 3H3UA 4MV2A 3ETQA 4X6QB 4HN1A 3H7YA 5AVPA 3RYRA 2BYVE 3O14A 2IXHA 2VECA 4QM8A
chains in the Genus database with same CATH superfamily
2VNGA 5FMDA 2UXBB 1YEWA 4JZ2A 4W6WA 2QZ2A 3ZFGB 1C3HA 3A8TA 1OD3A 2CDPA 1NZIA 3S6PA 5IVCA 1UKRA 1GWLA 5LMUB 2LROA 4CP1A 1AZDA 1W05A 2RHPA 5CA1A 3SJAC 1VQ8V 4A7ZA 4DUYO 1SDWA 1EAH1 1NE4A 3ZYGA 3S3XA 4Q6GA 2L9LA 5JQGA 4TV8A 1R1A3 5FP4A 1H8TB 1APNA 3K75B 4F7ZA 4MGSA 1U5IA 4DR1B 5J1XA 2P17A 3USSA 2YC2A 2IXKA 3C7GA 5FY7A 1OOPC 3VD3A 2YIAA 1KJRA 2W08A 1QU7A 5FWJA 2FDFA 2JDZA 4JTNA 4O2BA 1I5ZA 4P9PA 3CCVV 5J96B 2VBDA 1KYOF 2I07B 2CAUA 4R7CA 1C5IA 1J3QA 3JCZA 4NRQA 4I9QA 4DR7B 4XIKA 1NTMH 2QKAA 3SPCA 3ZMTA 5LA9A 3H8XA 4CC5A 5K1XA 2BSKB 2QTWB 3RYKA 1LR1A 2HEWF 2KA3A 1KGYA 2JDHA 3POEA 5FZEA 1TGOA 4XBQA 3ZHTA 1QXRA 1A8DA 4DV3B 4EFEA 1JS9A 2LGQA 1SLAA 2JG8A 1W6NB 1EM1A 1YQ2A 2RG4A 5IVBA 4NXMO 4N9IA 4ASLA 4XPVA 2CYFA 4PA9A 3I59B 2PAMA 3JSLA 1CEZA 3VQVA 4PHZA 4UYBA 1GK9A 1DYOA 4YSFA 4KBZA 3FE5A 4NYKA 1HN1A 3S7EA 2BSKA 3SQOA 4JRAA 1YITV 1GOGA 5D21A 4X1YA 1A6CA 1WZXA 2DMXA 4WZCA 4Y3OA 1TME3 1ULPA 4UCRA 5JZGC 1AYN2 1RUG2 2A6WA 4KGQA 1SQBH 4UW6A 3CC4V 1KITA 5DG1A 1PM4A 3ZKUA 4Y5TA 5F37A 1LEMA 1VBD2 1OCOB 3ZMNA 2XL7A 4YFWA 3WEZA 1GN2A 1H8TA 2PLV3 1WN7A 3SXWA 2Y4UA 2ZXQA 4XFHA 1UX6A 5CKNA 3H8RA 2H6CA 2DUOA 3T2TA 5FXVA 1WLEA 1LECA 2DCTA 3OGRA 2MK3A 1W28A 1C28A 4QB2A 2PAKA 1XB9A 1OPOA 5FZKA 1POQA 2XXZA 1KJLA 4LBOA 4XIOA 5IVEA 4MTXA 1DF0A 2JG9C 2EIKC 4MW3A 4I50B 5IJ9A 3E5QA 3UT0A 1Q8PA 4LXLA 5L3DA 2XHBA 1VEWA 4LFBO 4GB33 1AHSA 2XBO1 2B9VA 4XXAA 5FYVA 3KQ4B 4W6YA 3B9CA 1CWPA 2CGNA 1GKBA 5IVJA 3OE7G 2ZKOA 4GYCB 4S2GA 4CCKA 4H7LA 3BYWA 3H42B 2CTQA 2Q1MA 5GZGA 1C57A 4HSLA 4BIZA 4AQYO 2D5HA 3IMMA 4L8QA 4X64B 3AMPA 3DPRB 3HKEB 1AJKA 4AW7A 3K4AA 3PVNA 2O57A 2RN9A 3UKTA 4QNHB 4D7SA 1QJZA 2BBVA 4YARA 4YVSB 3UT5B 4AXOA 3VBSA 1QGLA 1O7FA 2E3CA 3BABA 2PHUA 1C4RA 1O91A 3M3IA 2HWE1 4Q4V3 2BW8A 1LTEA 3OGGA 2RJKA 2JK5C 4GX5A 2UYBA 1JX9A 1ND3B 4K9SA 1XNDA 4F6RB 4B3SO 3R66A 5LA0A 3MICA 2YEVA 4UFHA 4I5SA 2W68A 4RO2A 3N7KA 3ZN6B 2B1IA 2ZNIA 3T2QA 3WDWA 2YS8A 3JALB 3MV11 2GSYA 4S2DA 3GALA 3FBMA 4JAVA 1DDLA 1K92A 4COYA 1QDCA 4FFIA 2WNOA 4XTMA 4ZONA 1NCRB 1UXXX 3KVBA 3HR0A 1AXKA 3FLRA 5AFBA 4XUTA 4I0XA 1CZTA 4OMDA 1QMJA 2DCJA 2HLEA 3QO5A 4O2AA 3CMGA 1QJX1 3U78A 1BE3H 3TK1A 3SITA 1YQ8A 4H2AA 4FQZA 3H7YA 3RYRA 3B69A 1UAIA 3B94A 3MDPA 3FKSG 5JH7B 4MGIE 2JG9A 5EYYA 2ARXA 1H9PA 2A79B 3OTFA 2WQZC 4YVWC 1W2NA 1PNMA 3R4UA 1L3JA 4ZBMA 5LL6Y 1G9AA 3BOPA 2RM21 5LB6A 2WA3A 4DEQA 1EUTA 5FZCA 4WFGA 4YZ3A 1Q8SA 5IYCO 2QNKA 5LEKA 1KS5A 4MG2A 1W6PA 4CU7A 1B09A 4D7YA 5IYBO 1LHWA 2Y6GA 4C1WA 4LKSA 4JGZB 3RFRA 4Y5SA 1Y43B 3B3QE 1NQTA 2Z69A 3DSQA 5ANQA 4BISA 4MXWA 5K4LA 1W03A 1J58A 3FX7A 2CHHA 3Q8FA 1ZA4A 1F2NA 3APOA 2XR4A 3SC7X 3FHIB 3K4ZA 5E16A 1OQEA 4PCRA 1NYWA 5GTIZ 4FK5C 1BZKA 2DYRB 5C8CB 1ZZ6A 3N36A 4OHWA 2CV6A 3VL8A 3DKQA 4MVTA 1WBLA 3F7YC 4K0KB 1XL4A 5A3LA 2YXSA 3VQWA 4TWTA 5EIBC 5CU1A 4IIJA 2HWC1 4X1IB 4RR3A 3CBNA 3TRSB 3DYPA 3THPA 3JB8A 3NAPA 1NTKH 4Y1VA 4XF0A 2ET7A 5ERLA 5IJ9B 5AC92 2BOIA 4Q4W2 1LAJA 1DF4A 4FLZA 4C7UA 2QVSB 3LD8A 4MHRA 3POJA 4LMFA 3LNNA 1KMIZ 3OD4A 3FFZA 5CFDC 1YYNA 4JYYA 4Q4W1 4XMAA 1G9BA 3WCRA 4Z2WA 2ZXWB 5JCOC 1PO12 1HJFA 1H8HG 1MS3A 4XZPA 3OEAA 4K7JA 3BCCH 4KG8A 3LEMA 3FB7C 1JI6A 2BTQB 2MEV2 1PL0A 1YJNV 5FY9A 1AP5A 2HG5C 3RZLA 4O4HA 1UOBA 4XF3A 3AXDA 1QQP1 3RVHA 3WG7B 4LBQA 4Q20A 2P2KA 2GMPA 4IYHA 4NUBA 1S1AA 3CCJV 2C2AA 1YQ6A 3BUCA 3UETA 5JCOA 4TV8B 1UD1A 3SCFA 2P67A 2ETNA 2ID4A 3QBQA 2EBOA 5IY5C 2LRPA 3KG2A 2OPKA 1OCCC 5BNNC 4BPZA 4QXKA 1YNAA 4ZI7B 1OLQA 4RS5B 1VF5B 2XJSA 1H4GA 4HL0A 3MF6A 4LF8O 1QHDA 1EN5A 1W2UA 1E5HA 2EULA 4NWWA 1EAH3 3MUZ1 1DYPA 3QCWA 2NN8A 2R1DA 4QT6A 5FZLA 4ES9A 3SEPA 4J80A 2JKBA 4DR5B 3CC2V 3E83A 4HBNA 2D6OX 1VLNA 3W7WA 3ZHUA 2DW4A 2BWCA 2X5IC 1BBT2 3PU8A 3KS7A 4AFCA 5LP6A 2NPIA 4PBPA 4OI1A 1VQ4V 2OCCB 4FO9A 1UFIA 1SQXH 3N3HA 1VB4A 2OW4A 1RUH3 2R16A 2C26A 1QHTA 4TOIA 5FYHA 4U3JA 3UNPA 1SLTA 4BK4A 1R091 1QJX3 4BU2A 4IV1A 2WLJA 1IBKB 2BU9A 4W6XA 4DXSA 2ZABA 4FTBA 3ZIAG 3FB5C 4X20B 4LE4A 2QJVA 4QX0A 4AQ6A 5CA0B 4GH4B 1Q7YW 1AI4A 1TG7A 3BVOA 1AJQA 3JD1A 3RVZA 3ZFFC 2KD7A 2DDUA 1Y7BA 4Y1XA 4AQTA 3JD4A 1PIV1 4RR3C 3VBFA 2ET1A 2P4VA 2RDRA 3CEWA 3EBRA 1OCZC 1MZ5A 3K79A 4FFBA 4LLFA 3L70H 4MVZA 3VDCA 4CCDA 5KXDA 1T6BX 3I2IA 1NUKA 4OI4A 3WG1A 3I59A 2VZRA 3CO2A 3CPWU 4FCAA 4NIDA 5F2WA 4IEYA 5BNPC 2P22C 1CJPA 1RUOA 1X4TA 2XL9A 2XHKA 3T1LA 3ZS8C 4LITA 1ZZCA 5KUMA 3RYPA 5CG9A 4DZGA 5F3GA 3ZN1A 1O5LA 3KV4A 5IJ0A 3OJBA 4BOWA 2OUJA 1DIWA 2YU1A 3V56A 2GH2A 3OTOO 3B93A 4PDWA 1K97A 5FUPA 4O61A 1AL23 1IBMO 1PVC1 1J5EB 1BS3A 1S0VA 1X50A 2E51A 5IK8A 3RYIB 4IW3A 3AMMA 4J1WA 1W04A 3WB0A 4MXWB 2TEPA 2GUZB 3AZVA 3CXHF 3K46A 1V6IA 3I49A 1MACA 3OMNB 1H2SB 3MIGA 1FPOA 2XH6A 3VKLA 3AP6A 1RMU1 5IAXA 5CAZA 1GTOA 2P6CA 4CDQB 1KD7A 3J8F2 3STZC 2FYUH 1G7YA 4FPJA 4JGYB 4G4FA 5FYSA 2DCZA 3AZWA 1F15A 2Q4SA 3GZEA 2FHRA 3JD72 4LT5A 1AX0A 1NCQC 4XHBA 1V55B 1AR83 1S2KA 3FC0A 2QWPB 4CBCA 2QBXA 3ZO0B 4TUYB 1VMFA 2OX0A 3HAGA 1LNQA 4L97A 3EO6A 1ODMA 3LSEA 3QNEA 2Z4FA 4FXGB 2D40A 3KVAA 3E5XA 2OT7A 4E4EA 3JU9A 2JDIG 1YSCA 4QPWA 5E6HA 4BWAA 2YBKA 1W9SA 1UY2A 5J2TB 4UW5A 3TCUA 1VQ6V 3OY8B 3OM3B 1R083 1FD9A 2NR5A 4FOYA 4FFFA 2XBO3 5FZAA 3OGVA 3DPRC 1RUJ3 2RDNA 1EN4A 3T4VA 3O1VA 3EHBB 3ZR5A 5HCBA 4YW1A 2YPJA 1IXMA 5FFOC 5KC5A 1GICA 4IDZA 2P7TC 3VDAA 1UPIA 5F3CA 3EXAA 3UKNA 1UYXA 1VE0A 5LBCA 4XJUA 4PDWB 2W6IG 4WVMB 2JEXA 3TOJA 5F3IA 2Y0OA 4TQFA 4BB3A 4NPMA 1JODA 1IG0A 4Y24A 4CDUA 1YJWV 3IBMA 3FMGA 3OBZA 1DGRN 3E8BA 4GAZA 4XXPA 1SBDA 2VZOA 3MI8A 3W7UA 1W9WA 1QH6A 2WIIB 4QM9A 4CTEA 1TUBA 1W9TA 1V9U2 2XLGA 3LGRA 3ZMVA 1AVMA 3POBA 3N35A 1NA1C 2PHWA 1RMU2 3PVEA 2OYZA 1YTFB 4ARXA 4ZXKA 1LOFA 1JPXA 1RL3A 4QQHA 1YHFA 1AR4A 1ZBA1 2EILC 5K8SA 1OV9A 1OUSA 1RUC3 2DYSB 1Z5VA 4UOJA 2HJFC 1DYKA 4I0XB 5F1RA 4PF1A 3M8LA 1OA3A 1M1KW 1HXS2 2HLDG 1ASJ3 2R1BA 3DC6A 4I0WB 3ABKB 5A7WB 4DR3B 2D6KA 3UGFA 3TNPB 1PNFA 2VOTA 4IV3C 3KM5A 1GP5A 1I0HA 2MPFA 3U4SA 3T1YO 1HWYA 3N7MA 3ZYRA 1FAYA 4DUVA 2HWB3 4AF9A 3WW1A 4DXZA 4G3YC 4LHKA 4QD2A 2NNUA 5FZ0A 3K5NA 5HPOA 1TUEB 5JPMB 2YB7A 3KV9A 1H1AA 3CMAV 1F5JA 1FPN3 5FZFA 1N0NA 2IU3A 4WZFA 3CZJA 1SZXA 2VW2A 5GW7A 3IB3A 4D69A 5GM0A 5A1AA 3P6BA 5ACA2 4HNAB 4P9YA 4DUWA 4KHPO 3JAKB 5DZGA 4BXFA 5A6XA 4KG0A 4A3ZA 2WT2A 4HG6B 2XWBB 4YG0A 1MEC3 2RMU2 4TLFA 3OY8A 5IK7A 1VBA3 5EBLC 3E8GA 3VQXA 3SYQA 4N53C 4XCBA 2WSUA 2W1WA 2W46A 2GC1A 2AHZA 2ZEXA 2AZ5A 3D0JA 4PDMA 2DOSA 4IGPA 1Z2GA 3HQUA 4U36A 5JDBA 3URFA 4UB8Z 1IVSA 5JMCA 3ZYIB 5C3OA 4YPJA 2QE7G 1S3JA 2VZVA 3AZYA 4DXTA 2LW8A 4EEQA 4B8EA 2W91A 4MTFA 5SV5A 5LMNB 1STMA 4HNAA 4IUGA 5LZ6A 4OGQB 4O2BB 2GN7A 4U2AA 3GZAA 1JH5A 4CDXB 1AR63 1DLLA 2NN4A 5CA0A 3CXCU 2MNGA 4YGEA 3H1JH 3VB9A 4DO0A 2WYFA 3LEIA 4QQPA 4CDQA 3X2QC 5IY5B 4FVVA 4DQAA 1W8NA 1C1FA 4ZKIA 1BK1A 1M56B 3JAMN 5BNPA 3WB2A 4LHNA 2QR4A 4NIIA 3MFAA 5CKMA 1SBEA 4ET7A 4HK8A 4XJ9A 1RUD2 2GU9A 2R70A 2D44A 1M9NA 1ZRIA 2Z2SB 4P5HA 5I0UA 1UY4A 1HB2A 4JZRA 5CISA 3SCGA 1B35C 2AZ2A 4YY3B 1VBC3 4RHV2 3KHCA 2ADEA 3K58A 2W47A 3M3CA 3ZHRA 3PUSA 3LEGA 3ZRVA 3RJ2X 3NW4A 5FZOB 4FPKA 3M70A 5JJJB 3C8XA 2ZMLA 4HSJA 5I0DA 1S4CA 5C7GA 5A7PA 4FPOB 3V65A 3L73H 1RVF3 1WBFA 1N1SA 3ACLA 1U12A 5D5QA 2W95A 2FBEA 5JXGA 2J1EA 1O4TA 4RS5C 4YYOA 2VCAA 4LBNA 2DU0A 4MYEA 2VE1A 1UZ0A 1YLLA 3VZNA 5L9RA 4K21A 1WW6A 4UXAA 1VQMV 4PDVA 5GTHZ 4DNYA 1MS5A 3O0XA 1HQLA 1TME2 1XU2A 2HJIA 2CTWA 1M56C 1P7BA 3ZFGC 1SLBA 1SLCA 1XXNA 4JDNA 3OPTA 1PM7A 3WP5A 4DV1B 3ITQA 3AB0A 4YXWG 3M8AA 3NO8A 3WF2A 2H8PC 5LYJA 3LFIA 4D3WA 3I3MA 1VBD3 3ZRXA 1KQSU 5K0UC 4LH7A 5IE9A 2JEMA 3OF1A 2F23A 1BJQA 3TAYA 2P90A 1F4HA 3ZFEB 4QMAA 3HPLC 3ORJA 1SPPA 1MEC1 4DO2A 5EXOA 4SLIA 5BPXA 5LHIA 1JHNA 1WLDA 3N9QA 1E79G 1UZYA 1NKGA 3TN92 4TSFG 4Y22A 5L36A 2W1QA 5C9AC 2WS91 1G9CA 1RHI3 2Y33A 3IMNA 3VGIA 2GV9A 4JI0O 3JAWA 1IS3A 3HBZA 3PMSA 1TNFA 1SKVA 3T4DA 1V9U1 3SCHA 2YC0A 2Y6KA 3THTA 4RFRB 4PA7A 3BI3A 1LUVA 4COUA 2XUEA 2ZAHA 2BCCH 3X2QB 1XQ8A 3VBOC 4CU6A 3ML0A 4UW4A 3Q9OA 1OCZB 1NA1A 3SNMA 2VXJA 4YW4A 5L3GA 2VU9A 3LDKA 3LA2A 1DGWA 3VKOA 1R6KA 3RZMA 5C3SA 1UXZA 1COV3 1QJU2 3ZHSA 1KP3A 2OQ7A 1SMVA 4I02A 3ZFFB 3PUAA 4YZ5A 1WWYA 1XL6A 2QQUA 1WA4A 5L19A 3GB7C 1S0JA 5CA1B 3MHSC 3AKRA 1GLHA 1WJZA 2ZM6O 3JD0A 1GANA 4UVCA 2HBUA 2WL1A 5I0RA 3NNGA 5DM6V 3MW3A 2ZBJA 3RI9A 1EV13 1D5NA 3HBKA 3MV01 2N74A 4Q4V2 4ASUG 2VNRA 3ZXFA 4LA2A 3JCIA 2VMCA 1UOJA 1H1IA 1VAKA 1AJOA 1UKGA 2CTRA 5JI7A 3UESA 2GTSA 4LO5B 3O9OA 3LWCA 4XW3A 4LP8A 1BVVA 1VAMA 2GSMB 1G6NA 2WRAA 4Q5OA 5LBEA 3DPRA 3H1LH 3NV3A 1VB2A 4JI3B 2FL4A 1NAEA 1HV1A 1WB7A 3VBBA 1FFXA 2PUSA 3E6DA 1HRV3 1AR72 3VBHA 3ES4A 4JI4B 1R73A 1RSOA 4QQLA 5DUXA 4DR2O 1BEV3 4CDWC 4IV3B 5A9GA 1SG3A 3ASNC 2AREA 2PLV1 2F4PA 2PYJA 1W8HA 1N4CA 5BR8B 5FZ7A 3ASNB 3L74H 4XABA 1X9TA 4IXLA 1R3JC 4DW1A 4LFAB 2UXDO 2E76B 2PELA 1NU1H 2CTPA 2EIKB 4XFGA 4R50A 1DZTA 4EWDA 4M01A 1XREA 4Y33A 4JC1A 1FPN1 4HVRA 1SACA 3C7HA 1VR3A 2DVBA 3EYPA 2Q8OA 2BTVC 1E5IA 1SFPA 3A7QA 5H6QA 2BFUL 4FIPC 1JMUB 4WBNB 3DKWA 4EKWA 1UIKA 4LNUB 2B46X 5T5OA 2VW1A 1GH6A 1NX9A 2JIJA 4CUAA 4KWJA 2UUAO 2DVFA 3ALQA 4AFAA 3ZHQA 3H8UA 5JXIA 4LTAA 2Y38A 2P3JA 2ZTNA 1G1XB 1ZRRA 1NXD1 3LDEA 3H9AA 1NY71 2WO7A 2VZUA 2YXLA 3RQ0A 5ACA1 4QGPA 1AI7A 2PMWB 2JICA 4BQWA 1URXA 5LMUO 1JUIA 2JGDA 5C4WA 5DXDA 2Z42A 1C8M3 4PDWC 4Q4Y1 3S57A 3SPGA 1RUG1 4CE8A 3N27A 4LF8B 5E79Z 5C33A 3C7FA 5FYMA 3USUA 3WF0A 5ABJA 4O4HB 4J1XA 3HNBM 1XBLA 1PZ8A 5C8CC 3FYIB 5GALA 1XBFA 3IPVB 2EIEA 2YI8A 1K4DC 3K5OA 2HBTA 2MHFA 4ZS2A 4GKJO 5KBFA 4AVBA 4BYYA 1AVBA 4XMIA 4I7ZB 2XT9A 1R3LC 1RINA 4BAYA 1NH2B 2RS33 4QE7A 2ZR2A 4QQ2A 2B4KA 3CF6E 5FPAA 5I8SA 2ZZJA 1GMGA 1HXS1 4OHZA 5KXBA 2W5FA 2E5LB 4BDVB 3E8HA 1CAVB 1NLQA 3CZUA 1FI2A 2AH2A 2UWBA 3H1WA 2MEV3 4CDWA 2OWOA 1FXKB 2PA7A 3W5NA 3AG4C 2VY0A 5GZDA 1QCEA 2PHTA 1VBC1 4Q0VA 4XCAA 4OMCA 2XAQA 4HKLA 1W3XA 3BGAA 1MS0A 4GWIA 5A70A 3NV2A 4O4IA 2VMFA 2KM2A 1MOFA 4JYCA 4BLIA 1EV11 3TXQA 1IZ3A 4XFAA 4DV7O 4GKKO 1GBGA 1AR92 4YRDA 5T3NA 3ZSMA 4TV9B 2VMDA 3HKDA 1UIJA 1ZZ7A 1HDJA 2IBZH 4B3MB 3CB2A 4EJRA 2OIEA 3RYFB 2B9ZA 5EZYA 2D7FA 4NHMA 1WW4A 3AG1B 4DUXA 1XRUA 3SYCA 3LSSA 4OZOA 3RI8A 1CPNA 4QPGA 5CEHA 1M57B 4FPEA 1N36O 4QX5A 1ZBE2 4GT1A 1CD3G 3CLPA 1UOGA 2WLNA 4R6ZA 3OG2A 3RBZA 1JW6A 5FP8A 2OIGA 3INAA 2QTSA 4WFFA 4H3WA 1D5AA 1REFA 2A6ZA 1GP4A 1OURA 4OX9B 1REDA 2ENRA 3IJ4A 3BPZA 3C7EA 4EB6B 4V2WA 1FFXB 3NJYA 4UAPA 3ABTA 3E8FA 5C9AA 5FPBA 3WW3A 2VS0A 1UF2C 3QO7A 4CP2A 4HVQA 1K73W 1NXMA 1Y4MA 1RP3B 4IIJB 2GNMA 1E1QG 1ZREA 5FY4A 1FNYA 2YBSA 1JYCA 1S5HC 4NR1A 2EALA 3HD8B 1FXHA 5L3CA 3M4FA 5A6ZA 3NRUA 3DECA 2WLLB 1F4MA 4BW9A 3RYCB 1K5SA 1OH3A 1S2BA 2VMIA 3B7MA 3ETEA 1GZWA 1X9PA 5DDJ2 4UFLA 4ZZ5A 3R0RA 1IPSA 2ZMKA 1NG0A 1P84F 1W6QA 1V00A 1FXZA 4HANA 2PZSA 1I7FA 4OFGA 3WV6A 4FLYA 1N33B 1GQGA 4N8MA 3WG3A 5CIRA 1EBOA 3RVYA 3H1KH 2PXJA 1K33A 4L9BA 4CZSA 1Y66A 3I5DA 1YI2V 2D3RA 4UFZA 4LH6A 2UXBO 1OA4A 2FKXA 4GMP0 2RQ6A 1NVPD 4DRXA 5LWBA 1OVPA 4XF4A 2XG3A 5LY2A 4JGSA 2VL4A 2PHRA 5F39A 3D0SA 1MZEA 1AJPA 2F4VB 2Q68A 2VQFB 3E89A 3O0WA 4PIXA 3GZUC 4Q4X2 4BCUA 4LO6B 3UV9A 5FZ3A 3OEEG 2ZGSA 4XAAA 3MDSA 2EINC 3IDCB 4XDLA 4AHYA 3JD73 2JS5A 1AYM2 2PGGA 3PDQA 4FOVA 2VQ0A 1VQPV 1BKZA 4CCNA 2BNMA 3T30A 1THZA 1FYJA 4KWUA 4NN0A 1SF9A 3LIGA 1O5UA 2IJKA 2XJVA 1U97A 1QNMA 3GWOA 2W9XA 3AKSA 2G4IA 1F4NA 1ZYBA 3J4UH 3IDBB 3CRAA 2WWJA 4KBBA 5ITZB 3I3DA 3TJTA 5GZFA 3TGUH 5FO9B 2JG8C 5IAVA 3W7TA 5IWAB 2VZTA 5FDBA 1AILA 4FTSA 3ZXGA 2QA4V 5CFCB 4X1IA 2JENA 4LF6B 5EC1C 2AUYA 1YCIA 3IN9A 2IFWA 2ZX1A 4N53B 1IDSA 1QQP3 4I4TB 3PURA 4A3XA 3VZKA 2P37A 1CX4A 2WINB 5CMUA 4MXVA 4TYSA 1PKXA 1Q8QA 2CU5A 1SA0A 4B3RB 2A71A 2VWJA 2EF6A 4NTWA 4DV2B 1Z7S1 5FYIA 3AFGA 2BGPA 3JD71 1AR81 1RUF3 3GCWA 2Q7HA 2QQWA 4P9GA 3LEKA 2IWGB 4X66B 1Q56A 4BIFA 1Y6XA 3N2KB 5CFCA 5FZBA 2GP5A 2D98A 2PQQA 5K9YA 4N7UA 3OUJA 4JVAA 1GNYA 4LKEA 4KHPB 3VBSC 3SH5A 3DYOA 3KT4A 2QWQB 4H13B 1HNXB 4XUQA 3SJBC 2XVKA 1L7LA 5AVPA 2P6HA 3HKBA 3VDDB 2GP3A 1VIBA 2VECA 4YIPA 2HWC3 2NLRA 3O1SA 3CDZB 5JOYA 2WS93 4BQ1A 1ZTEA 1XU1A 3O0VA 4PDRA 2NP0A 1TMF2 2ITDC 4KH9A 5CFCC 4IE7A 2YBPA 4IHJB 1BXHA 1OCRC 2HJDA 2JE9A 3AMQA 2JG8B 4TWKA 2E33A 2ZINA 1IPKA 4Q4W3 2VW0A 4UUJC 5CNAA 1UX7A 1N3PA 1TUBB 5T52A 5HFLA 1P49A 1MSWD 4TTGA 3RYHB 1M4UA 2VOWA 1Q3EA 3VBUC 3ZFEA 1E5SA 1PO13 4FP2A 4OUEA 4A2UA 4OULA 2FCTA 1Z7S2 3JALA 2QQVA 4ISRA 3VKFC 1VAVA 3ETPA 4J11A 1LESA 2LO1A 2HWB1 3QO8A 4PLMA 1JU3A 4DV4O 4GMP1 5CBFA 3N9LA 5GKAC 5J98B 2VPVA 1VBE3 2Y48A 1JJ2U 2NLJC 3DC5A 5J09A 4LHSA 1FKAO 4OQ9A 4PDLA 2ORZA 3MF9A 3RZKA 4NRMA 3ZSLA 3BVCA 3VHRA 4Q2FA 4XBFA 4W65A 3N7LA 4QPGC 5FKCA 4GKJB 1W3VA 4CH6A 2OZ6A 4ONUA 2KSDA 1IKPA 2G9ZA 2WFF2 2XHNA 2J1RA 2WLPA 4JX0A 1GAXA 1BQ0A 1LKNA 4I50A 2E7QA 1W0KG 1N34B 1W2AX 2ZR3A 5BY5A 2BTOA 1YFUA 2D3PA 5C8YB 3J9SA 2AC1A 1BL8A 1XNTA 2QKDA 3AXEA 4QU2A 1NY72 1KU9A 2YXYA 2IJHA 3AP7A 2E31A 1YJKA 1W8ZA 3OYWB 5GZCA 1Y3TA 4J42A 2UUBB 5IJ0B 1PMHX 2SBAA 5EJ3A 4PI0A 2IXJA 3J7MA 3OT7A 4EWEA 4JTDB 3P5BA 2ZHMA 1W8UA 4L2NA 1FNZA 2WLQA 1H30A 1QJX2 3ABMC 1GZ9A 4DW0A 2JDAA 3CCUV 4CCMA 3FYEB 3MIEA 4MS2A 2Y60A 1RUD3 1OOPA 1QJY1 5B1AC 2B1GA 1ROPA 3MO4A 4A6SA 2QQPA 2GHYA 3AMNA 2FMDA 1RIRA 4BXSV 2DCKA 3ZXDA 4XQWA 3QH6A 4B29A 5GJ6A 2B7YA 2P5OA 4NXNO 2WR9A 2FCUA 5JSOA 4Z82A 4DR2B 1ULEA 5J7MA 1XMQB 2JDUA 4Q0QA 4AQYB 1NCQA 3BY6A 4WFBV 1UMZA 5CBLA 3VDBA 3QTCA 2V72A 1CIWA 5LXTA 1JCHA 4Q27A 2P34A 1OCOC 1XE8A 2XONA 4A42A 4LBLA 1MQTC 3VOUA 1QXPA 5AC91 1ALYA 1XJAA 4HLTA 2JIZG 4RGAA 4FOQA 2X5IB 1PVC3 4UCVA 3A0HZ 2VOKA 1Q6IA 3EB7A 1PNGA 5LGNA 5EIYB 1N32O 4QX7A 3MLLA 3VL9A 1TVGA 1UMIA 1VP7A 3I97A 3WDUA 3LA7A 1OLMA 2CH7B 2ES3A 1RUI3 1G9FA 4ICGA 1UU5A 4YJ2B 5DN2A 3M3OA 2ZOEB 3ZN0A 1K3IA 1WGPA 1IS5A 5FBZA 4CU9A 2WABA 5FY1A 3K06A 2ZACA 4XUOA 2HHHB 1GQHA 2A75A 4ZKTB 5A7SA 4LK7A 1VMGA 3ZPYA 1Q5OA 1KFXL 3OBAA 1V6NA 5F2VO 2PQSA 1DZRA 4EQVA 4W4LA 5LK7B 3CJHB 2QSAA 2UYAA 2G9GA 3FZ3A 4XETA 5JVVA 1AR82 4TLGA 3IAYA 2WO2A 3SGIA 3ZFFA 4JI6B 3RMYA 2QM8A 1HR0O 1H8VA 1MQTA 1RITA 1WLTA 2PAEA 1AR71 3CMEV 1YI9A 3WHTA 1Y76A 4IL6Z 1CESA 3ZXAC 3BA8A 2ZCEA 3V0BB 1DHKB 2VNVA 3ZYPA 3HT2A 3FWEA 4AEDB 4HKWA 1K7DA 4L0PA 3WVJA 5B2GB 2FMLA 2ETEA 1QBZA 2QM7A 4CVUA 3DYMA 4F6EA 2GC0A 3I2FA 3RZGA 4LHLA 1WLWA 2NM1A 2VZQA 3GHMA 1OC1A 3VZJA 3NNLA 4TUYA 3E1F1 1TNRA 1PO22 3I8TA 1XOYA 5J36A 2NMNA 1YDXA 4JTOA 4I3GA 1LHVA 1Q6HA 2PY5A 4NHKA 4ZU4A 4FAGA 1SETA 4GCZA 1G8WA 4FZ0A 3AG1C 1UW8A 3PJYA 4P02B 4LWSA 4DUYB 2B45X 5AFEA 1YQCA 2R073 5FQ0A 2ZGUA 3VBRA 4IQPA 1OQ1A 1D7PM 4MVOA 1EPWA 4MTGA 3NKGA 1SQGA 3BKZA 3ZSJA 5HCFA 2WLHA 3VUOA 2JIGA 3ME2A 5H2FZ 1YRZA 1IS6A 5CVRA 3J7LA 2OZJA 3O1PA 4CA9A 4PD4F 2EIDA 5DN6G 4BWOA 1RPOA 3OEHG 1V9U3 3OGIB 4NMIA 5A33B 1ENRA 2RJ2A 1JJOA 4LJHA 1UY0A 2RS52 5FXXA 4BZ4A 2X6BA 2PI4A 2DQ0A 3ZKYA 2QUOA 4AR2A 4NAOA 3SEEA 2ZDIA 3BB6A 2FDKA 4WF9V 3GXUA 3RMXA 5F8PA 3UYJA 1HQWA 4Y20B 3NNMA 4U3JB 1RUC2 2CGPA 4OZXA 3L71H 1TA8A 2VAUA 2R042 1KDKA 1LGBA 5KAFZ 4YZ1A 4ZOLB 2IVIB 4DFSA 2F4VO 3TETA 2QQMA 4DV2O 1ASJ2 4OUMA 2ZT9B 1CAUA 2QTOA 2EAKA 5JH7A 4PT6A 1GQPA 1BSMA 5ITZA 1SQVH 2TUNA 5HFMA 1HNWO 3MUY1 4LUMA 5DDJ1 1WLCA 1TMF1 4N21A 4FLWA 1FMD2 1V70A 3UJOA 5FZIA 1POV1 1UYPA 2HEVF 1PD3A 1UJWB 2UURA 5DMYA 1F9KA 5FWEA 1HNWB 4AK3A 4ZHNA 4K8FA 1N47A 1SC5B 2D6NA 4XJWA 1Y4WA 1LJ7A 3NJXA 1W6MA 1I3HA 1JOYA 5C5UA 5LASA 5DUWA 4TT3G 2X10A 3OUFA 4ATFA 5EIBD 1K42A 5JCTA 4XHXA 4MGYE 2AW9A 4GXLA 2Q8CA 1RVF1 4XJZA 2VTFA 4LEJA 1JMKC 3FB8C 2JRIA 3U10A 1SBFA 4RGGA 1K8AW 5TSWA 2P4KA 5JR2A 3K57A 2A06H 2V4VA 4D6TH 3TEYA 3HN1A 1Q81W 1COV1 1X33A 3SH3A 2WWWA 2XJRA 1DGLA 2YIBD 4E2GA 3T0AA 3VV1A 2L6LA 3LOBA 2ZMNA 4NXMB 4UXNA 3WW2A 3L2HA 4S2HA 2QWNB 1LOAA 2Y64A 1OXCA 4B4RA 4Y22B 4TN7A 4YM0A 2LP7A 4QQOA 3C7OA 5EWSA 4CH4A 3IIIA 3JAWB 3KT7A 2WZPP 2XQXA 3WP6A 1NE6A 4GJZA 3ABMB 1S55A 1ULGA 4MGKE 2ZZQA 4DR1O 2VZPA 1CX1A 4G2KA 4E8DA 4R9CA 4CEWB 3PNAA 4OHXA 2A7AA 2BRTA 4MADA 5LY1A 1PL4A 3AYCA 2EILB 2R062 2X29A 3WG7C 4R4XA 4UBGA 4RHV3 1PNKA 1AYN1 2ZX0A 1K5QA 1JQ0A 2GDSA 1J3PA 3THOA 1YUDA 1V6LA 3VHOA 4XYXA 2Q8EA 4JV4A 1KBHA 4FT8A 4TXWA 5K0UB 2WNEA 1GYKA 4XJAA 3WLUA 1LR5A 2W1UA 1XNRO 5CFDA 2HVJC 2RS31 1GNZA 4XACA 3EXUA 3WNMA 3UGGA 2AXTZ 4MUVA 1ZRCA 4LC1A 2Z3YA 4JKKA 3H1MA 1Q43A 1XSRA 2C24A 4EV0A 3VD5A 1YHQV 2A6XA 1QOTA 1S0BA 5CBGA 1KP2A 4P9OA 4PBOA 5KMGA 4B4QA 1F4AA 2ZGPA 4F4LA 4P9XA 5FUIA 3CEIA 2XAFA 1LGCA 4X8NA 4DV5B 2PFWA 2X6CA 3CE2A 4GX1A 5H6RA 2CL2A 1JOBA 1FX5A 1BQPA 4XFBA 1QR8A 4JHZA 2RR13 1XMOO 3BTAA 4GX0A 5CB4B 1WMDA 2PYTA 3WP3A 2Q8VA 5A32B 3CRQA 4Y1ZA 4I0AA 3RYCA 4JI0B 1WMEA 5D8AC 5C70A 3PJQA 4MSWC 2CE4A 4J9YB 4PF5A 4P08A 4MX3A 1QNYA 1V6JA 1WCUA 2YIDA 3CWBH 3K4DA 5J9PC 2HWF3 3ETQA 4J7KA 3F5TA 1M06G 5A80A 2EXJA 4N90A 5FREA 1B35B 4LO8A 1VRH3 1QXJA 2V5YA 4P00B 3PN1A 1VPHA 2GC2A 1PGW2 5LK5A 4I3PA 4I01A 1H38A 5L7OB 4LKFA 2X6AA 5IATA 3W20A 4A45A 5BNPB 1OKQA 4QPIC 1XNQB 4DY5A 3RJRA 3E6CC 4LF6O 1D0GA 1XHZA 2C1FA 3VKMA 4M4PA 3A23A 2E32A 2VXRA 1UPSA 2DFBA 2OTJV 5IFTA 4ZZ8A 3RYHA 4J25A 3ACGA 3CJIC 4LF5B 2F17A 1OH4A 1R081 1PGL2 3SYPA 1FV3A 2W2IA 3HQRA 1H8TC 1HNZO 1AR61 4LBKA 4DR6O 4BJ0A 3E6BA 4AFMA 2DUPA 1DBNA 3T2PA 2HH9A 4FFBB 2WNVA 2Q8DA 2UU9O 2ZE5A 4X65O 1JBCA 1AR91 3WF1A 5FJKA 2B39A 5DABA 5LRRA 1OFNA 3O7OA 3UKVA 1D4M2 2E26A 3NJVA 1BCXA 3TWIA 1VQ9V 4LCUC 4P9IA 2IJIA 4HZ3A 2ZM6B 4FBFA 2EXKA 2CH7A 1EZVH 4E2QA 2I74A 4Y20A 3F95A 1G8MA 4C91A 1YIJV 2OYQA 2N04A 1T2XA 4CCEA 1I5YA 1SQFA 5EZYB 2EZPA 1VF6A 5JSRA 2JDKA 1PIV2 1D2DA 1ULDA 1KQRA 3AM2A 3KD4A 3QH7A 2IJJA 3MGUA 2V4AA 3KCCA 2DV9A 5SV8A 3ZCCA 4IEOA 3A22A 5FMOS 3IFXA 2UUAB 1NCRA 1XNKA 5DAPA 2UUCB 3TNQA 2Y34A 5FOJB 4LBJA 2E6VA 2EIJC 3WR0A 5C71A 4DV0O 4JI7B 2WLIB 3CP1A 4META 2V1DA 1P4RA 1FOD1 1X7NA 4DPNA 1SZTA 4QKBA 3DCQA 4RD7A 2G9FA 5IWFA 4H7MA 4DXRA 5B1NA 4QHZA 1RUC1 2VC9A 2QE3A 1IKQA 3H01A 1CONA 4JI8B 3D3AA 5B66Z 1L0NH 3PUHA 2WLLA 2VJXA 4PA6A 5LMNO 4N7IA 4D6QA 2LQTA 3WDXA 3E22B 1W9YA 1EFRG 2VM9A 5EV7A 4LWSB 2PI5A 3O1OA 4FPPA 1ZWIC 2ZGNA 3NWKA 4N43B 3ENRA 3OGSA 3VKNA 4QPGB 3M7AA 3GNEA 4K6BA 4OI2A 4B1LA 3L2YA 4LKDA 1AUYA 2VQEB 1VQKV 2QJ1A 4QHBA 4XUPA 2DYCA 2ZPXA 3CL1A 2HEPA 3UGHA 3MAQA 1O3QA 3VZLA 2O8QA 3SJCC 1ONAA 3KQRA 2BEOA 3R6SA 3FHQA 4HAMA 4YGCA 4URTA 3SLIA 1AF9A 4R8HA 4DV6O 4UCSA 2D6PA 4Q0UA 2JD4A 5A7QA 3ZYBA 4Z92B 2B8MA 3C3TA 2R061 1XYOA 1MZ6A 2EXIA 4AI9A 1A34A 1C8M2 3PU3A 2WZ8A 3G6JB 4NPLA 5LBBA 2Q1FA 2ZX3A 3VZMA 2IH3C 4UCUA 1W90A 2WZEA 2EJRA 3EFFK 2QQIA 3ILNA 4IYIA 5T50A 1N3OA 1XOUA 3LA3A 1OKOA 3F2ZA 4CEYB 1LULA 1UZZA 3K03A 2XUMA 1YF2A 3EVKA 2YPDA 2VUJA 3GHNA 2FD8A 2QKSA 2XDVA 2XLFA 3MZHA 4XFCA 4QGLA 2YICA 5KR7A 2B5HA 3Q8EA 3KHBA 2IVJA 4Q4Y3 1WCSA 4BR6A 4H33A 5FBJA 2WSSG 1OZ0A 3MIHA 1NQDA 2RCVA 4AI3A 1QOOA 4KMQA 1K12A 3A0NA 1SPPB 4CSWA 4CXXA 1KB9F 1JZ5A 1H2GA 5FV3A 1OOPB 2GNDA 3SDLA 2HWE3 4IE6A 4UFMA 4HXCA 3LQCA 4BQ4A 5KXCA 3T1HB 5LYJB 4O4JB 1NTZH 5HCAA 4E4ZA 1RUF1 1KD1W 3U0ZA 2FDGA 3ZR6A 1JU4A 2ARHA 2X8KA 1JHJA 3B09A 5A3NA 1ZBA3 1QJY3 4QX3A 4FSJA 1W6NA 4R9DA 3J81N 4EN7B 1QH7A 1EYBA 3AP4A 2WZR3 3WF3A 3HVDA 4AHZA 1KEXA 1YQ5A 2P1BA 2XAGA 4COVA 4EROA 2GMMA 5EYXA 4GIQA 1FYUA 2M6YA 4K8ZA 2WC2A 5JIAA 5B1BB 1AROP 3FLTA 1O9HA 3FBYA 3KF5A 2TNFA 1SFYA 3NVCA 1KC8W 4U7OA 1PX3A 3AP9A 1RM1B 4LF9O 2W3JA 5J37A 4NHLA 2ADDA 2QQOA 3KKYA 1YO8A 3B5LB 3AJZA 1X59A 1UWWA 3UT5A 3NAPC 4UFIA 3THDA 1HRI3 1WB8A 4IV3A 4XC9A 2CGOA 1VQLV 2Q5TA 4NKGB 3BFRA 2RS51 5IVVA 1CR7A 3HR9A 2E63A 1RFYA 2XTAA 1JFFB 4ZS3A 4GWMA 3MYXA 1MSDA 4OX9O 1G86A 5LBFA 3VHNA 4NIHA 1N1YA 4NROA 1SERA 1QVFU 3HKDB 4B08A 2BERA 2B5UA 4LIVA 5FYTA 4PQ9A 3VBRB 1DF5A 1D4VB 5DAWA 1US6A 1PM9A 3OR7C 1XNQO 4U7NA 5IYYA 2BJSA 1LOEA 5J48A 1PGSA 1DQ2A 2EICA 3VQYA 4QKFA 1JTZX 2AZ0A 1YI7A 3QACA 3WQ7A 4Y5Z0 2QEXV 3PTRB 2MW2B 2BE3A 5BNNB 2ZD9A 1A8MA 3RGBA 1FFTB 4FM1A 3AYEA 5KHKA 1LHUA 4GWNA 4Z2AA 4B3SB 1C8NA 2PTMA 3ES1A 5IHRA 4FMTA 2X0LA 1F35A 2VTXJ 4Q4X1 3Q4HA 3FN9A 2K2SA 2O1QA 2B42B 1QLNA 4Q1RA 4RHV1 2VRZA 5BV6A 1BBT1 5DUVA 5A3PA 1J1LA 1N1VA 5LRSA 3JARA 3TYJA 2WAOA 3JXSA 2WNVC 3BALA 4UB6Z 1N1TA 2W52A 3ZX6A 2VTXA 1FXKA 4K40A 5E88A 3I2DA 4KU7A 5LA6B 2QCSB 3H3LA 2WAAA 3HN3A 1VBB2 5AVAA 3JBG3 1VBD1 4LR3A 3BTYA 4DR3O 3U37A 3JUUA 4A41A 1SQPH 2DWDC 3PMEA 5JOWA 5FPOA 3OUSA 2Q1ZB 1YC61 5IYDO 2F66C 2R071 1CAXA 1VARA 4AE2A 1LHNA 1GN6A 3AG3C 4BA6A 5C9AB 2VUAA 3GBFA 3BODA 1OD5A 4M3CB 2JEUA 2CNAA 1WAZA 2D3OW 3JASA 4QPJA 1LGNA 1NQJA 1QQP2 2A7WA 1MMMA 4PJ0Z 1PO23 2WWUA 1RJ7A 3ZIXA 3N2GA 5CZKA 5JZGB 3HNYM 3POSA 5LGUA 2K9ZA 1IS4A 2EZOA 5JJEB 5KX5B 4YM2A 2Q9LA 2HYKA 1DQ1A 2VUDA 3A4UA 1PK6B 4QWNA 4WVVA 1GO3F 4RGKA 1VQ5V 2W39A 4FJCC 5FYYA 1DGWX 1J59A 1DLBA 5F6LB 1I6XA 3A0BZ 1TE1B 1A32A 2ZGLA 3WP4A 5GLUA 3FJSA 2BOCC 2DJVA 1ZX3A 4Q0PA 4URAA 1MS4A 4I0BA 2DFCA 4GX2A 4MOAA 1R1BA 2HWC2 1GSLA 2P5BA 1PVXA 2BNNA 4JDOA 1UYYA 3CRCA 3WU2Z 3EQEA 2LFSA 2VQEO 4LNVA 4WVZA 1TMF3 1EN6A 4EYUA 2EVXA 1PV0A 3K2OA 3S5AA 2CAZC 2B9UA 3B02A 4FPYA 3W58A 4QXBA 2R043 3ICXA 3OCPA 4UI9L 3WDYA 2JDPA 4MLOA 2K0GA 1VJ2A 2RDQA 4LBMA 3GVMA 4B4PA 4OUSA 4IEVA 2A3WA 4MVQA 5J3UA 3ZFEC 5A3TA 2V73A 1Y9QA 1M90W 2RR11 4RA0A 4CXWA 1O3SA 4B3MO 5B1AB 1GOHA 1RSOB 1YXWA 3PLQA 3T2OA 5FOBB 4BK5A 3GF6A 3L9JT 4IGQA 4IGGA 1HJGA 3PL0A 5JQGB 2P06A 1ZZBA 4OYUA 2YMZA 1WCQA 3KGLA 5ABJC 4RSUA 1OF4A 4BHPA 1B6QA 4CEYA 4JAAA 2QQJA 3FX3A 4JI2B 3ZLIA 2JS3A 2WNUB 1AX1A 4GKYA 2YGMA 2CWMA 1O3RA 4LA3A 2ZX2A 3CKHA 4LFCO 2JJ1G 2OIIA 4YFZA 4GKKB 3M3QA 5DECA 3LAGA 4K1YA 4B3RO 4GQ7A 5JXHA 1PZ9A 1UYZA 5EC2C 5B3SC 2O8OA 3LNMB 1N36B 3QD6A 2FDHA 4E4DX 1ZRFA 1Y74B 4FVMA 5T5PA 2VCMA 3S3WA 3WNOA 4YZ4A 3ZSKA 1JZ3A 1ULOA 1RUG3 4G28B 2ZXWC 1BBT3 4XDJA 3VBFB 1E1RG 1CZVA 2O14A 1YTFD 2TBVA 2JE7A 3KMHA 4JI1B 2WLIA 5HBAA 4YVWB 3BEHA 5DG2A 5JMOA 2LW1A 3WQBA 4NXNB 4RUFA 2CY6A 1B04A 4LF7O 4B3NA 3B8MA 2VBBA 2ITCC 5LXTB 1MVQA 3MBWA 3KV5A 4WFEA 3VD4A 5LA2A 1V54C 3AVRA 3NMBA 1GU3A 1ZRDA 4WCEV 5A33A 5GLVA 4BIOA 1Z0HA 4BE3A 2WN2A 5GONB 3W7SA 1R1A1 4WFAV 5I91A 3O1TA 3K04A 1SCRA 1BHAA 3D36C 1MS9A 4JDMA 1NCRC 3HPNA 4LULA 2VZ1A 3C90A 2BZDA 3RYIA 3POWA 2WFPA 1D2SA 5FXWA 2C0ZA 1W39A 5D5PA 5FMOL 1WPBA 1Z78A 2X53S 4CZZA 2Y26A 1F31A 1R093 2QGNA 2D6MA 5IUQA 3MW4A 1ND2C 1C5HA 3O1UA 3N9OA 4Q29A 1Q6UA 1CAVA 1FAFA 5AG2A 2DBNA 4AG4A 2FZ2A 2E9QA 3LF7A 3M1HA 1NOVA 1RUJ2 4JYBA 2VQFO 1ND3C 4JI4O 5EHDA 4FZ1A 3N9NA 2XVGA 1WW7A 2XVLA 3SPIA 3AG2B 4ARYA 4JI8O 5BMVA 3H7JA 2WLKA 2IM9A 4LOTA 1I5PA 3WUDA 4YW5A 1MNGA 3J80N 5FZOA 3AZXA 2WYSA 4L87A 5LBQA 4QAWA 2D97A 3OPWA 5FZMA 5CG8A 1GUIA 4YVWA 2XASA 1IOAA 1KECA 4N43A 5JJNB 4LO7A 4W4KA 4RS5A 2HVKC 4GH4C 4A4AA 2GH8A 1PK6A 5L7OA 4O4LA 4JGYA 5LEJA 3I2KA 3ZRSA 4IE0A 1LB2A 4RN5A 2VO5A 4R8CA 1K5JA 1X82A 2BUKA 3JYCA 3QOPA 4Q4V1 1RHI1 1IHMA 3GYDA 3CS5A 4QPIA 4DB5A 2Q0AA 3WSOA 2ZE7A 4RQPB 1I1EA 3AG2C 3Q8AA 4LOSA 5EP9A 5FAXA 3OB8A 4LFAO 2UXDB 3ZX7A 1HNZB 1P8JA 1U5XA 2OCCC 1O9GA 3PIGA 4DR6B 2NYYA 1HB4A 1QLEB 3H50A 1CAXB 4JKLA 1OT5A 5CBHA 4WBNA 1IG3A 3V0AB 2WT0A 1CIYA 2A6YA 4HPKA 4IESA 5AC93 4X65B 5JUVA 1CAUB 1UY1A 3AK0A 1NKDA 1NR7A 4RWUA 4MGQA 4YLZA 5C3PA 1LENA 3M2MA 4JV5O 4ZI7A 2AYHA 4JTCB 5GLZA 2Y6JA 2Y69B 4LF9B 1ZL8B 2YYOA 3EMRA 1BT8A 4IERA 3U75A 2A73B 4FM0A 2ZGMA 5JIUA 1H1MA 3DUIA 1ZVFA 2ZEYA 2QZ3A 2DE0X 1NCQB 1E5RA 1JZ6A 3VN4A 1H6XA 3ETGA 3I2HA 2WNUA 5CA6A 2K9PA 1JFFA 3ABLB 1HB3A 2JG9B 4YZ2A 5BXXA 1MEC2 2RMU3 3I7DA 1YFWA 4A7KA 1K3EA 1F8VA 4D6SA 5BYNA 3PIJA 1RMU3 4O4JA 1ND3A 3W7XA 4FP3A 2ZGTA 2RDSA 1JVMA 1BLZA 2ZKLA 5J2UB 4JV5B 1ENXA 3ZYJB 2YIBA 3U1XA 5GONA 3T1YB 3PUQA 4NB5A 5B1OA 4XDKA 3RZJA 1PIV3 4IGOA 5M0TA 5H5NA 3MIFA 1GZCA 2XJQA 4QXHA 1IURA 1EAH2 4OPAA 2MEV1 1AP6A 3ACFA 1QKQA 4J7ZA 1UU4A 2UWCA 3LKJA 3NXSA 2ZEWA 3K9AA 3OSDA 1CAWA 5FZ4A 3DXUA 4RFT0 1QJFA 4LUKA 1TVKB 4IL7A 1KS4A 5KA6A 5IWAO 2WNUC 4RYDA 5C8WA 3J8F1 3P1IA 5E8AA 2GNBA 5CB7A 4GULA 3JATB 2AENA 1EUUA 4GB31 3AJYA 2FDIA 5KHGA 2R9AA 1QR9A 5FPUA 5JPNB 1ZBE1 5F6KA 1OLRA 4UFKA 3WXPA 3IGAC 4M0HA 1M93A 3ATGA 2E53A 4DEVA 5FK7A 4A6OA 2PYLA 1N3QA 5FLJA 2V4DA 3N9MA 4LF7B 3J7HA 4J10A 1HN0A 1CJDA 1CPYA 4BQ5A 4YW2A 2EIBA 1L7QA 4COWA 3MW2A 5EJ1B 1RUE1 3R4SA 5JAXA 4IEXA 4WM8B 1W6MB 5H9PA 3DV8A 4X88A 3LPGA 2BGOA 3NV4A 1RVF2 2XGXA 1HP8A 1AJNA 3RWRD 1J3RA 3I2JA 3T1MA 2VQUA 4BMEA 5JOXA 3WT3A 1MABG 2CDYA 1HX6A 1WCDJ 2J1AA 2X7RB 4NTXA 2PHLA 2DUQA 4Q0SA 5D1IA 4JASA 5FZGA 5J2UA 1CQ9A 3G67A 1Y9MA 5BMVB 2CWSA 1NLRA 4Y4YA 4UWDA 3SKJE 4ZY9A 4JQTA 1XSQA 5FPZA 1X36A 4I2OA 2UU8A 2UUBO 4IE4A 1XILA 3K77A 5FPLA 2J7MA 4A7YA 5C93A 2IXCA 1V9PA 1YXBA 3OGCC 4DOUA 3KLSA 3J8F3 4X20A 4XOGA 3C2UA 4HKOA 3C3SA 3OMIB 5KA5A 2F43G 3VDDA 3L9DA 5KWRA 3RW0A 3WNNA 3T1HO 2LUWA 1BYHA 5BZBA 3K48A 3AG3B 4XDPA 5ABJB 4PA3A 4BM8A 1JYWA 4X6RB 1JZ4A 5LW9A 3BA9A 1Z5WA 1GNHA 5G05L 3TN91 4AHCA 4YJ3A 2ADQB 5H9QA 2GNTA 1N33O 4Q4Y2 4LFBB 5KLVH 3SH4A 4GD4A 1LOBA 1RHI2 3CU7A 1LCLA 1GZTA 1SA0B 3AK3A 1US3A 5H9CA 5I93A 4I55B 3LSDA 5F7UA 4KWLA 4AQSA 4YM3A 1OHFA 1PX4A 2ERFA 1A3KA 1SCSA 1CGPA 4I9WA 1W6OA 4PELA 4CUCA 1WP7A 1QY4A 4CEWC 3VBRC 2A3YA 2ZA9A 2HWE2 1QLEC 3TBDA 3N9PA 4BH9A 1OCCB 4FFHA 3ZN6A 2FDJA 2F93B 2H0VA 4QE9A 5IK5A 3H1IH 2ZKNA 1MVEA 4NAMA 1DQ0A 3ZIWA 3R4DB 2RS12 1QJU3 4D0QA 3KCYA 1XC6A 3ST7A 3E35A 3O5SA 2EIGA 4Z8BA 3TEXA 1U0AA 5FXZA 4Q8KA 2IXLA 4CDXA 1XHXA 5K0UA 3V0BA 1RUJ1 3KF3A 2Y0PA 1QF3A 3DN7A 4KP4A 4HPKB 3DXTA 2VVDA 4BQXA 4R4ZA 1RUI1 5IW0A 2XB6C 5A1LA 2F1MA 1J84A 4JI6O 2UU9B 3W5MA 4AL9A 2DURA 4JGZC 1ZAUA 2BP6A 1HQNA 3IC7A 4DS0A 2W94A 5FNVA 1W8WA 2JDYA 3ASOC 4NTYA 1H2KA 2WPDG 1NH2D 2XKPA 2V7QG 1VRH2 4HONA 3IKWA 1ST8A 3CD6V 1F5FA 1HRV2 1FXKC 2VMEA 2XPJA 1R082 1JYXA 3W59A 2GDFA 5H9RA 2AACA 3HOBA 2Q73A 1JR9A 3V64A 3WQ0A 4I55A 2A6VA 5CKQA 3ZDSA 4L11A 2FQPA 3PHMA 4TQDA 1L7RA 3H0OA 4CCLA 4HETA 2XAHA 2AEZA 4X8AA 4AEKA 4LORA 3BU0A 1P7GA 2FTKA 2X5IA 4HVOA 5DEDA 4UW3A 4DRRA 5TISZ 2RS11 4O9EA 3HIFA 2DTYA 3WY6A 1RM1C 4ORFA 1QQCA 4ITCA 4BW5A 3EHKA 5F32A 2DVDA 3WNKA 1HDKA 4JI3O 1XYNA 3CJIB 1F51A 3CC7V 4YW6A 3VBHB 3O14A 1O8SA 1SHWB 1WMXA 4HMZA 3CHXA 2DWEC 1S2EA 2M7WA 3TB0A 3MEPA 2AR6A 5A7OA 3U11A 1IQAA 3AKTA 4A5UB 2WT1A 2BOBC 3AL5A 1ZZ8A 4MH0E 4XBLA 3ASOB 2C4XA 4OHVA 2GAUA 1OFSA 3ZHVA 3N7JA 4NO4A 4NHXA 1XNBA 4X1YB 4CS3A 4TZDA 3DL3A 5FLIA 1SQ4A 1SLIA 4AWDA 4B3TB 1OLME 3J26N 3WF4A 4B7KA 5LOVA 3NSTA 2FCVA 5B4NA 4XF9A 3VBOB 3Q8BA 3WINE 5DZEA 1HXS3 2WQ4A 1VALA 4AILC 5BNNA 4YJ2A 3G4SV 3AK2A 1SESA 2EINB 2ZEZA 5IVFA 5EBWC 3FAVB 1DTOA 3KB5A 1S0GA 1GMMA 2VOVA 3K59A 2FMYA 1PMIA 1IGOA 2RS32 4WBBA 1VBB3 5EYPB 3JBG2 5A7NA 4K3UA 3OUIA 3AG7A 5C3RA 3RZZA 1QDOA 3K0GA 1QEXA 4K20A 4IV1C 2RDCA 1WA8A 4LQRA 5FUNA 1FPN2 1L1FA 2RM23 1G4YB 3T3YA 5T54A 3I3QA 5FP7A 1VF7A 2XJTA 3RZHA 2WSVA 2OXBA 3S0MA 1SS3A 5JVDB 3JCUZ 1YFYA 3NAPB 5ACA3 5K7PA 4XFFA 2UXCB 1W8TA 4OVEA 5LP6C 2D2CB 4ZHQA 3STLC 4K0KO 1R3KC 5A3MA 3BN6A 4ZU5A 1W6PB 4YVSA 1H9WA 3C3VA 5CADA 2WLMA 4Y26A 2KG7A 3ILRA 1D4M1 1HV0A 4WM7A 2A3XA 1SEFA 4GKXA 1K5MC 3KSCA 3LCPA 4QGMA 2AEYA 1CVNA 1JN2P 3RT3C 1AR93 3FHAA 4JYAO 4QX1A 3CRRA 4IEZA 1ACCA 3JQWA 4NIAA 3WZ1A 4N53A 1V55C 5I8YA 3IAQA 1AR62 4FPGA 1YJ9V 1GFF2 1N34O 4MHUA 2QFEA 2N05A 2DQ3A 1XPWA 2CTVA 4NWVA 4P30A 3GBGA 3GGLA 3LUTB 3CCQV 4R52A 5DPNA 4CP9B 5FPXA 4XF1A 4DV6B 4MGTA 3GWKC 1R1ZA 1R64A 4X89A 2K46A 4LO4B 4D8MA 4BQ3A 4KU8A 4C0BA 2OT5A 1IBKO 4N43C 3FFQA 3A0RA 3B77A 1Y76B 4QKDA 5L73A 2Z5UA 3HKCA 4FFGA 4HOOA 4J6GA 5FNVB 2VQAA 5F5AA 4P5YA 5C6CA 2HKXA 2O0OA 2JJ2G 3WD5A 1WA8B 4JAUA 4RAIA 3HJRA 1AYM1 1VBC2 1NJIW 5A3UA 3ZN5A 2V09A 2GTAA 3K0DA 3JARB 2YUAA 2Q4PA 4Y4RA 4DK0A 1QIQA 4XEZA 1WA6X 4QIWF 2ILMA 2BVBA 2OCHA 2PHXA 4G9SB 3ZXJA 4XQ4A 4DR7O 5FP9A 3X29B 4YG6A 2HWD3 2ZHLA 4UFJA 1OBNA 4GZ9A 3IWZA 2QDNA 4AYUA 1K34A 1ND2B 3ETDA 4QX2A 2VCCA 2R9IA 1S0IA 3E97A 4XBNA 2XNDG 3CCSV 3BIEA 2ZS6B 2WBKA 1GV9A 3ZEDA 4ASKA 1X8EA 2BVVA 4PIYA 2E74B 2Q7GA 1LEDA 2WNVB 3NJZA 1ORQC 2G1MA 1O8PA 1XUQA 4HZFA 3OMAB 4YM1A 5ANNA 1JYIA 2W0XA 1ENVA 4DV5O 2P3KA 3BAAA 3HKBB 3UO2A 2HWF1 4QPIB 1PNLA 2DWRA 1G9DA 1QJY2 1H8EG 2EX3A 3WOGA 1QOSA 4AI1A 5LGTA 3ZSEA 2HP8A 2A9HA 4E9KA 1LHOA 3J7NA 4EZ4A 3T08A 5FZ1A 3K5MA 2HR3A 4HT1T 5B4XA 1HR0B 5IJRA 1GN4A 4IHJA 4NRPA 1Q8OA 3KT1A 3UK9A 3DEMA 5FLHA 1SRYA 3JBG1 4E8CA 1CP9A 1BCCH 1IBMB 2KKWA 5A7WA 2AHYA 1U5ZA 4PI2A 3CCRV 1BHBA 4DR4B 2XKOA 3TN93 3CIHA 4CEWA 5T5JA 4ES8A 4DV0B 2C9AA 4NE9A 1WMFA 1K45A 5LATA 1K4CC 1DQ6A 2HYXA 5H9SA 1AYM3 1H2NA 1IQDC 4AZZA 3K3WA 3H3UA 1T5EA 4HN1A 5FRAA 4DUZB 1ULCA 2L35A 2DU1A 3ZMOA 4ASMB 4RL7A 5DDJ3 3LE0A 1R092 2Q30A 1OQDA 1KFUL 3RG0A 4M3CE 3RRDA 2R72A 1LU1A 4CP0A 1RXFA 4OLLA 1BMV1 2WUHA 2WWSA 3SJQC 1XMQO 3VBFC 2OS2A 3KWVA 3DTUB 1TZOA 4UF0A 1COV2 1K9MW 1H2MA 4AI2A 1UQXA 5LA1A 3S30A 1PHMA 2SLIA 2DBIA 1S0FA 2ZHNA 1AL21 4LLOA 2ZIMA 1O6UA 5G04L 1PPJH 4YIOA 4AGVA 4YGBA 4H0LB 3SKVA 4CDXC 4K1ZA 3K9SA 2R49A 4FLXA 3ECQA 1YIPA 4BIUA 5FZ8A 4WM8A 5A1FA 1EV12 1XE7A 3T0DA 5CFDB 4AEDC 1RUF2 2ZX4A 2VZSA 2XAJA 1OCRB 4Y1UA 3CCLV 4FOWA 4Q4X3 4UF0B 1U5YA 1KUQA 3PVOA 3ABLC 2QWRB 1KKDA 5I0SA 5F2SA 3LIHA 5HXVA 2A3QA 4CRQA 5IDJA 4B1MA 1ZA7A 2ZJCA 2HKOA 3A2FA 2F95B 1J83A 1DGRA 2ORXA 4EB6A 1LU2A 1TEIA 1BZWA 1AR73 5IVYA 1NBMG 3BHPA 1R1A2 4DRVA 5JXJA 1H4HA 2D5FA 3E2EA 1BEV2 5JR7B 5KHHA 3GM8A 1JUHA 1RC6A 3UL2A 1EY2A 2BQPA 5CB4A 4NPRA 2LJ2A 2JX9A 3PJSK 3VBUB 2A1XA 4CPBA 5KUKA 1UCXA 2R041 4KI5M 1FOD3 4YHHB 3G80A 4V1PA 4IETA 4LPLA 5B1BC 2AGSA 3NNJA 3G6EV 2XOKG 2YUEA 5FYUA 4MGZE 2Y0IA 1JZ8A 3ABKC 1W0PA 4E2LA 2HWD1 5BXZA 2BGCA 1HKDA 3RYFA 2VMHA 2IUWA 5BR8O 3E86A 5EFUA 4TV9A 4CYDA 1LUWA 1R6NA 2P3IA 4V2VA 4MTOA 5DZFA 3OPZA 2VCBA 4Q26A 2JXAA 1WCKA 3R05A 4IEPA 1U96A 1S5LZ 2GALA 5EYPA 5LA6A 3I3EA 3QLQA 3AVSA 1DK1A 5F5IA 3POIA 2BFUS 3WNLA 1VBE2 2NQYA 1NA1B 5D8AB 1VIWB 1VBA1 1MG1A 4F6RA 4KWKA 3WB1A 3A0KA 4NJ4A 2Y6HA 2NMOA 2VGDA 4JCKA 3WW4A 4WVMA 4BLJA 2YC4A 1PO21 1CXZB 3NQHA 5L3EA 3WCSA 4J9ZB 5FIXA 2W6JG 2ZGKA 3ROUA 2EJ7A 4QKNA 1AYN3 1MS8A 4K8RB 1FJGO 1S0CA 1G6UA 1OJHA 5DUUA 3SHRA 4OHYA 2WAMA 2N7GA 2YDEA 1OUXA 2XMLA 4GWJA 3D5OA 3E5UA 1UNBA 1ZBE3 5KX5A 2PLV2 4AI0A 1UPGA 2VD7A 3MPBA 1DLCA 4YHHO 4PLOA 3L75H 3T4ZA 3OYWA 4MO3M 4ZPIA 3O1MA 2ADPA 3PUIA 1GWKA 1ZNPA 4JPRA 4PIZA 4L92A 1SFNA 3QG5A 3H3ZA 4FLUA 2Y8KA 1AX2A 5ISLA 4G27B 2C9KA 2I2SA 4YVSC 2BPA2 1V6OA 5FY0A 1OMIA 2JGDB 2X09A 1XEQA 3MHZA 1Q82W 1PZ7A 2EA7A 3WNXA 3JQXA 1XE0A 4RQPA 5FKBA 2J1VA 4EFBA 3P32A 4AQ2A 1W6QB 5LP6B 5HCHA 1RYYA 5L9BA 4P9LA 5D2AA 2DVAA 2OQ6A 1OPMA 3D82A 5A3WA 1N0JA 2BNOA 5IYZB 2E5LO 2LM3A 4MW8A 4JYAB 3CX5F 3ZBHA 1L0LH 1S0EA 4GB32 2JE8A 2QQKA 4DY3A 4IV1B 1EZJA 3ABZA 2W87A 4O9GA 4X8PA 3O1RA 1FS0G 1LOGA 1RTVA 1SDDB 3HQXA 5GLWA 1DCSA 5EJZB 2FB5A 1ZZ9A 4ZIBA 4FTEA 3AEIA 2OA2A 3AFKA 4UT5A 2NZ9A 5FK8A 4CDWB 3IDEA 1DFQA 3WQ1A 3F5WC 4AOCA 4MZUA 3HKCB 4IE5A 2VR4A 3I56V 5E89A 1NI8A 1TAEA 1BVP1 2EAAA 4D6RA 1SQQH 3AYDA 4CCJA 3O12A 3LZZA 5C4WC 2W0FC 1HW7A 1BMV2 3AYAA 1FMD1 1B3QA 3ABUA 4AHWA 4KFMA 4O4LB 2BYVE 4AVAA 4LFCB 5JOZA 1RUI2 1PMJX 1PP9H 3UKMA 5FYZA 1GM8A 3PTYA 1RXGA 3LOIA 4RUEA 3RN4A 2YSUB 2GZWA 1RUH1 4LR4A 4Z1MG 5IT9N 4QHOA 4X1KB 2X05A 1XNAA 2PHFA 3RSJA 5A3OA 4DV1O 3V0AA 3CYOA 1UZVA 3DXRA 4RR3B 1L8DA 2JDNA 2G19A 2J1SA 1RJ8A 4ZHQB 5KAIZ 5GZEA 4LBQB 4JI5O 5I8TA 3ZJZA 1OHHG 4CCCA 2P4EA 4COZA 4EN9B 1UU6A 1GM9A 1RUE3 3FB6C 4AVVA 1ZL8A 3WG4A 3B4SA 3B9IA 1O4ZA 3RNSA 3ZRWB 3BTZA 3OR6C 2H0BA 2WQ8A 4KGGA 2UY8A 3AZZA 3N2GB 5JZGA 3VBHC 5FLXN 4AFDA 3Q8CA 4WM8C 3H1HH 2ZE8A 1WPXA 1COWG 1NLSA 2JJ6A 4F8AA 4IEQA 3MD0A 1V6KA 1W0NA 4Z07A 3DGEA 1AI6A 2V5DA 2JVDA 1YVWA 2RS13 3K3OA 4JRLA 4H44B 2E75B 5HXMA 1JZ7A 3IPVA 1OA2A 3T1CA 2ZE6A 3BOWA 4QXCA 3USUB 1B06A 3ZFGA 5LHGA 2BV4A 2RV9A 1PK6C 1HIXA 3D6EA 4EN0A 4B3TO 1VMHA 4P9WA 4DINB 4W8JA 1FXVA 5CN0A 2CDOA 5CA3A 1I94B 1H2LA 5FYBA 1GWMA 1M4WA 1F23A 4HN0A 3IT8A 4CP9A 3K08A 2OUHA 1W0OA 2WS92 2EIMC 2JKXA 4QB1A 5APAA 1RUD1 3ZOIA 1QWRA 2ZQMA 5HV4A 2RJZA 2YGLA 4UVBA 1WD3A 1W99A 1SLLA 2Y69C 1UOFA 4XURA 1XI1A 5JVDA 4CEYC 4UVAA 2QQLA 3CJIA 5EBMC 4B7EA 2JB8A 4QU1A 2R32A 2Q67A 3SISA 3SR2C 1VBE1 4CPBD 2VNOA 3HT1A 1WD4A 3AL6A 3MFCA 3IC9A 2KG7B 1O4YA 3ZMSA 5D8AA 1EP0A 3LDDA 2RNBA 4I4TA 2I45A 2YXHA 3JD2A 3ELNA 3WDTA 2JECA 3JZVA 4EN6B 2QKCA 1BHGA 3J7AU 5C8CA 3G71V 3DXRB 3T2MA 4DR5O 3FUOA 4FPCA 3T4HB 5IYZA 1WW5A 1PO11 1VBB1 4AEJA 5EQUA 2WN3A 3M99B 4ZOLA 1HLCA 3ACIA 1YIFA 4DXWA 3CCMV 3GZTB 5BUVA 5E1RA 3ZVXA 1KDMA 3FUQA 4N9HA 3OGJA 1MA1A 3CRMA 2ZGOA 1N8RW 3I2GA 2VG9A 3UCSC 3FAVA 4PV1B 3OFNG 2C6SA 4D7TA 3RS6A 3D8CA 1MPXA 2A70A 1GR3A 2WFF3 3BCWA 5FPVA 1LODA 1UY3A 2CSGA 3KZIZ 4XDQA 4NOTA 3MIBA 3GJAA 4JTAB 1W06A 1SZBA 3AKPA 4RQFA 5KHIA 5LHHA 2JDMA 3UQ8A 1Q8VA 2F6BA 3AP5A 1AB3A 1RB8G 2ZAAA 2R0FA 1ENSA 3A21A 2PN5A 3NR7A 3OD0A 2J22A 1NR1A 2RE9A 4CU8A 2YI9A 4Y1YA 4ZXEA 4D94A 1CAWB 4BQYA 2QDRA 3IZOA 1Y74A 4N23A 2KQXA 5J2TA 4RQPC 1XYPA 4KUMA 4IEWA 5FZDA 4H14A 4DYLA 4LBEC 4AHXA 1Z7S3 4XUNA 1H6YA 1XNCA 5GLTA 3SPHA 1CN1A 1GKFA 4P2ZA 3RWNA 3BRCA 5FTTC 2HFEC 1GOFA 3BIWE 4IEUA 1YFXA 4UCOA 2RM22 3I3BA 1DU3D 2IC1A 4JI2O 2WFF1 4FXKB 3KGZA 1VF6C 3S7IA 3W21A 2YG0A 4EE2A 4MV2A 1GM7A 1LOFC 1UZWA 1JZ2A 4FLTA 2IXHA 5T55A 1A78A 4JGZA 3KV6A 3BU7A 2RJLA 5JSPA 2IH1C 4DRXB 3U07A 4W50A 4LNUA 2R6QA 5FY5A 4OXSA 1ASJ1 3IM0A 3SPJA 4Q1PA 3H8OA 5L7OC 3NKTA 2KR2A 3P3NA 3CCEV 4P9JA 3UM7A 3GBWA 3NV1A 1QVGU 5FMBA 4C0HA 4YW3A 2VUCA 2P6JA 5KXEA 1XMOB 3I4IA 4L99A 1WP8A 2JGUA 1AR1B 2P3YA 3D3QA 3ZXLA 2D6LX 1V0AA 1H0BA 4M00A 4QPKA 4O7XA 4QPYA 1E57A 1N32B 2XWJB 3LFMA 1Y67A 4DV7B 1R6TA 4KXRA 4TSVA 1CPMA 2BBAA 3W9AA 2RVAA 4LK6A 3M7MX 4Q8LA 5FZ6A 3U4XA 2GN3A 3OOXA 2RR12 2ODMA 5FPRA 2UWAA 4YNIA 3OW2U 2KB1A 3B8NA 3RDIA 3WG2A 3JATA 3LDRA 4AAXA 4LIUA 1YZBA 1MR5A 3OEBA 4J7JA 5DAXA 1HRI1 2YFZA 4K35A 2Q0OC 1NS1A 3ZMZA 1W8FA 4FQ4A 2Q7EA 4XILA 5FJHA 2PF4E 1OF3A 2VULA 3APBA 1NT0A 4OCTA 2HWF2 3T09A 4X62O 1Y9GA 5HI0A 4XTPA 4H55A 3WFVA 3VD9A 3AX4A 2D93A 3G7DA 1IXBA 3ZM8A 4DR4O 4R9AA 1TQ5A 3LB9A 1AXYA 5C5TA 3LPFA 4JZGA 3DF0A 4I30A 2R0HA 4C8DA 3JASB 1ULFA 1HB1A 5A6QA 3POGA 2XLAA 4PA4A 2XBO2 5FQ0B 1J5EO 4P14A 3WDVA 5FO7B 4X64O 2HWD2 1GRJA 5L3FA 4FPHA 1JYNA 3P3PA 5A32A 2GUZA 3H9VA 2LALA 2R9RB 2WZR1 5F3EA 1IBLB 4KNCA 2DF7A 1DGSA 1PVC2 2D3SA 3OUHA 4AVSA 5BNOB 2UY9A 2AGAA 3I54A 4AEMA 2JWPA 2K1EA 4UBHA 2ZDIC 1KXGA 3MIDA 1GP6A 4RQEA 1I9RA 4AI8A 5E1AC 4YJ3B 1FV2A 5CYYA 4FPFA 4O65A 1T6GC 2LGWA 3JSNA 1PGL1 4WVWA 4GALA 4QDQA 4JHTA 5KHJA 4QJFB 4ZU7A 3TEWA 4XZUG 1QU0A 2VWKA 2JB4A 2R072 4AEDA 3D3IA 2YV8A 5A2QN 2J42A 1RGSA 2W92A 4YWAA 2ARBA 2E7TA 1ODNA 3FD9A 4PJYA 2OVUA 1RUNA 4FLVA 1PGW1 4ABMA 1S77D 2DN9A 1LRHA 2UXNA 3MLKA 3H1YA 4ATEA 2XQRA 1NZ6A 2CUGA 1I08A 5K1PA 2ZCWA 4DUZO 2ARCA 1YJLA 2EXHA 4CS2A 3BTXA 4YW7A 3N4MA 4CC6A 4EZHA 4QB6A 4M3CA 4QDSA 1M57C 5EK0A 3RPQA 2FZ1A 4M0NA 1Q8IA 4Z1VA 1BMFG 2GMEA 3SYAA 2VZ3A 3ZDVA 2Z79A 4CDUB 3QVNA 5DAVA 2IW5A 4PQQA 2DYRC 3AKQA 1IPJA 2H3OA 4GMP3 2Q69A 2HWB2 4HYOA 1S72V 1ZSPA 3WUCA 2R30A 1JOPA 5LOVB 5HV0A 1D0HA 1LNSA 2C5DA 2IFRA 3M3EA 4HFSA 1FATA 1C8M1 1FMD3 1W59A 3OBTA 1O3TA 4CS4A 3D36A 3U14A 5LCWL 3MLJA 2Y6LA 1OI6A 2QQNA 4E2SA 2WDBA 1NT2B 4EWAA 5FO8B 4DK1A 2ZGQA 5B5EZ 2PHDA 1VBA2 1MS1A 2CAVA 2YROA 1W0JG 4O4IB 1JYTA 3B00A 2Y6FA 5T5LA 4JI7O 1VMJA 2DYSC 2YHJA 1KKCA 5A6YA 1HNXO 4XAEA 2VVFA 3S5QA 3HNMA 4UCTA 2OTLV 1K5MB 4CH5A 3SMHA 1TVKA 5FR3A 1UO9A 1ZLZA 2R7EB 4JQRA 5FZHA 2QDOA 2OPWA 3HWJA 2RS53 2GBOA 4H37A 2YEVB 3LSQA 1MZFA 2IZWA 2IU0A 5JLVA 3ILFA 4FI9A 1UL9A 3LDCA 1TME1 2YZ4A 2QM4A 4X9QA 4XVHA 1W2OA 2VH9A 4KQ7A 1RUH2 4SBVA 2W1SA 4DMIA 2LTNA 4AVCA 5JI9A 3ACHA 4A44A 3GCXA 1Q90D 3CJXA 1UMHA 1S5JA 1J1TA 1FJGB 4MVRA 2JD9A 4M3CF 4J41A 4AFBA 3ZN4A 1C1LA 4QM8A 2BWAA 2WKKA 1W9FA 3KCXA 2YU2A 4LF4O 4O2AB 1FOD2 3ZRWA 4XDOA 1BEV1 1S76D 4YY3O 3GDBA 3AG4B 3NL1A 2VBPA 4WM7B 4XE9A 1BGYH 4LBQD 1IX9A 4INDA 3K3NA 3VZOA 4JI1O 4NHYA 4ISQA 1YWKA 4C1XA 5KMGB 2XJPA 3VHPA 4UV8A 4IT5A 1BQZA 1KRIA 3L72H 4E4HA 4R9BA 2VVEA 1DQ4A 5BNQA 2Q6AA 4CUBA 2UXCO 5L9VA 5C3QA 2VOXA 1EPZA 3PVBB 2WA4A 3GJBA 1ZUQA 2ARAA 3O65A 4GLXA 1HW5A 3IIAA 2BDRA 1VQNV 4MSVA 4I09A 1K5MA 3MHHC 1X8MA 1XNRB 4MVUA 2YY1A 4WM7C 2XOMA 3FL7A 3HKEA 4QX8A 3WX5A 4GH4A 3B01A 1AL22 2GC3A 3I55V 1XQNA 1VRH1 3KZ4C 4XQDA 1I5XA 2LS6A 3R65A 5FP3A 3MPPG 5FL7G 1BK0A 4F83A 4JGYC 3CNAA 5EPAA 3HMYA 4K3AA 4CUGA 4BQ2A 3G6BA 1OVSA 2ATKC 4XJ8A 2LFRA 2IXIA 3VBSB 4C90A 1S0DA 4LF5O 2WZR2 4OQ8A 4QDRA 4OPHA 1FT9A 1IBLO 4KL1A 3T0BA 5F9TA 4LF4B 3OBRA 1W8OA 1GZWB 3CSXA 1ND2A 2RMU1 5DAQA 3POYA 2DVGA 3APQA 1REEA 3UO3A 2VQTA 3THCA 2WO3A 2OKXA 1VQ7V 5FZ9A 1JYVA 2R063 1V6MA 4GA9A 4U3FH 1XDCA 2EIMB 4L8JA 1AXZA 2DTWA 4S2FA 4MT8A 1DQ5A 5F5CA 1NVPB 1QNWA 2KXLA 4F3JA 3UJQA 2UXXA 3VBUA 1ZM1A 3POFA 3VBOA 4MVSA 4HK9A 2WO1A 1HRI2 4PLNA 1DZQA 3DGTA 3VDDC 1AR5A 1WUVA 2Z0AA 2F4LA 2CK3G 3JAKA 4YG3A 4CDQC 2D43A 4K8XA 1Q86W 1VRBA 3BPSA 1DP0A 4NIGA 4X62B 1ZX5A 2Y4TA 1F7YA 1DG6A 5IT6A 3ZXKA 2ATFA 4OI0A 1LOCA 4LE3A