3ETQA

X-ray structure of cysteine-free fragment of mhcn2 c-terminal region from amino acids 443-630 including c508n, c584s, and c601s mutations
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
194
structure length
194
Chain Sequence
DSSRRQYQEKYKQVEQYMSFHKLPADFRQKIHDYYEHRYQGKMFDEDSILGELNGPLREEIVNFNNRKLVASMPLFANADPNFVTAMLTKLKFEVFQPGDYIIREGTIGKKMYFIQHGVVSVLTKGNKEMKLSDGSYFGEISLLTRGRRTASVRADTYSRLYSLSVDNFNEVLEEYPMMRRAFETVAIDRLDRI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Mapping the structure and conformational movements of proteins with transition metal ion FRET.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transport protein
molecule keywords Potassium/sodium hyperpolarization-activated cyclic nucleoti
total genus 65
structure length 194
sequence length 194
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.630 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 3etqA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3etqA02
2ET7A 1O3QA 2XL9A 1J3RA 4I0AA 4BIFA 4GULA 1ZZ9A 4QGNA 5I8YA 1WA4A 1RUNA 2BNOA 3IBMA 3I54A 4AQ2A 4HSLA 2VECA 2H6BA 3LZZA 2GC1A 2QNKA 2XKPA 4O9EA 3BCWA 4UBGA 1LB2A 5KHHA 1LKNA 4LA2A 3NJZA 4XFCA 3LAGA 1RC6A 4PIYA 2MNGA 3E5XA 4MX3A 1YFUA 2XHKA 3HIFA 1VR3A 2WC2A 1EY2A 5CU1A 4LLOA 1U12A 4AVBA 1OI6A 5JCTA 3I7DA 3PVBB 3FHIB 4QGLA 5J7MA 4I0BA 1J3QA 5HI0A 5FLJA 1J3PA 3N4MA 2XGXA 4XFAA 3MDPA 1NYWA 4D7SA 1UPIA 3LA2A 4Z82A 1OD5A 3NVCA 2UYAA 5FPXA 1J59A 4IETA 3SXWA 4QMAA 4HMZA 1CAVB 4I09A 3B02A 5I0SA 1WGPA 1VP6A 2BYVE 3H1WA 4FAHA 5JSRA 2K9ZA 1EYBA 2IXJA 4Q0QA 1UIJA 5EZWA 1O4TA 2PFWA 1ZRRA 3OCPA 4Q0VA 3RYKA 2QDRA 3GBFA 4WVZA 5FQ0A 2HJIA 3MZHA 3D82A 4XFFA 1DGWA 2ZKLA 2PHLA 2PAEA 3RNSA 2PA7A 1V70A 2BEOA 2Z2SB 2PTMA 2B5HA 4AVCA 2BNMA 4XF1A 5EFUA 3DKWA 3UKVA 3ES4A 3H9AA 4N9HA 1J1LA 2CGPA 3CEWA 4WBBA 2GC3A 3KCCA 4XETA 4D7TA 3CL1A 3CLPA 3QACA 4HLTA 4AVAA 4XF3A 3WW2A 1EP0A 3ZDSA 4LUKA 4JTOA 1O3RA 1QXRA 1ZNPA 5BXXA 1YUDA 4J1WA 5FLIA 4AQ6A 5CADA 3VHRA 3LWCA 4F8AA 4YNIA 2QVSB 1ZZCA 3WW4A 1LRHA 3NL1A 2PHDA 3EO6A 3H1YA 1Q5OA 3HT2A 4CYDA 5I0UA 4XFGA 4XFBA 1CX4A 1IPKA 4F7ZA 4P9GA 1O7FA 3LA3A 3OD0A 4I3PA 1VJ2A 5LEJA 2I45A 2VQAA 2UYBA 4DINB 1GQGA 2ZCWA 5K8SA 3DV8A 5CVRA 4B29A 2Q1ZB 5LEKA 3M3IA 3I59A 4QM9A 5I0TA 4XF4A 3IIAA 2IXHA 1HW5A 2PQQA 4O9GA 3ACLA 4LUMA 5C8WA 3EHKA 1YLLA 1I5ZA 1NE4A 4R8HA 3FWEA 2C0ZA 1ZVFA 3E6CC 1ZRFA 1CAUB 3KMHA 2OYZA 4WZCA 3RYRA 4K8FA 5JAXA 1SQ4A 3UKNA 4LTAA 1CAXB 4QGMA 4BYYA 1ZZBA 5AVPA 2ETEA 3S7EA 1ZX5A 4L11A 5E16A 5KHKA 4FT8A 3ETQA 4UBHA 2D93A 5LRSA 4Q29A 3MYXA 4MV2A 3ROUA 3OTFA 4Q0SA 1DZTA 1SFNA 2V09A 3MPBA 3O14A 1FI2A 4JVAA 4OLLA 3U11A 5F1RA 3FE5A 1IPJA 1YFXA 2IC1A 1CAWB 2QJVA 3E5QA 3SHRA 4OFGA 5KHIA 4HN0A 3S7IA 3E6BA 4FAGA 2FQPA 3FX3A 5J3UA 3BB6A 2DCTA 5BV6A 4MUVA 2P17A 2PAMA 3BALA 3H8UA 3UKTA 5I8SA 2GU9A 1RL3A 1X8EA 4ORFA 4XEZA 2GC2A 5KBFA 2KXLA 3ELNA 4META 5KHGA 5I91A 1O3SA 1I6XA 1CAVA 3WW1A 2Y0OA 4MGIE 2F4PA 4BHPA 1G6NA 1L3JA 3ES1A 1PMIA 2XLGA 4LEJA 4X6QB 4EWDA 3E6DA 2D40A 3USSA 1JUHA 1Q43A 1QY4A 3BPZA 4HBNA 3OGJA 2GC0A 4ONUA 4HVQA 4NVPA 4IEPA 4IEYA 1OMIA 2E9QA 3WW3A 3BU7A 3HQXA 3M70A 5I0RA 5KHJA 4LULA 3U0ZA 1FT9A 3CF6E 3R6SA 1XE8A 2B8MA 1QWRA 5C6CA 2OZJA 2O1QA 4BH9A 1DGRA 4MGKE 3H7YA 2ET1A 3PLQA 2BNNA 2H0VA 2GAUA 4IEQA 3OF1A 5JR7B 1ZZ7A 5FQ0B 3KSCA 2QCSB 3D0SA 1H1MA 3CO2A 3G7DA 4J1XA 1PM7A 4IERA 1RGSA 4HN1A 4MGZE 1YHFA 4MH0E 3S0MA 1FXZA 4I01A 5D1IA 3EJKA 3CJXA 4YYOA 1ZREA 2VPVA 3IDBB 1YWKA 4KWJA 3NKTA 4YARA 4X6RB 4QXKA 4QM8A 2Q30A 4Z07A 2ATFA 4IEUA 1ZRDA 4N9IA 4JTNA 5FLHA 4IEXA 3GYDA 3HT1A 5JSOA 4PIZA 2EAAA 3H3ZA 3KGZA 4EWEA 2XL7A 2IXLA 2IXIA 4PIXA 2D5FA 3LA7A 3LOIA 5BPXA 1Y3TA 3QOPA 4KL1A 1TQ5A 4IEZA 3ST7A 2D5HA 4KWKA 2MPFA 2XKOA 4I2OA 4EV0A 2BGCA 4QX5A 3E97A 3FFQA 5FDBA 5BUVA 5FCCA 4E2SA 1SEFA 4MGYE 1EPZA 4LA3A 5BY5A 4HZFA 4PJYA 3SMHA 1CAUA 2PAKA 4HVOA 5JSPA 1RTVA 2EVXA 2H6CA 2PYTA 4ZU5A 2CAVA 1LR5A 2Z69A 1GQHA 1UD1A 4E2GA 1Q3EA 4IEVA 4RD7A 3NW4A 3SCHA 2CV6A 3EBRA 1XRUA 4I02A 1J58A 3IWZA 2GH2A 4HSJA 5J48A 1XE7A 2EA7A 3C3VA 3TNPB 3JZVA 3RZZA 4TLFA 4FBFA 3SCGA 4ZU7A 2MHFA 2Q4SA 4Q0UA 3FJSA 2Q0AA 4XF9A 5T3NA 5LRRA 2HKXA 2K0GA 2UY9A 4JV4A 4XFIA 2OA2A 3E5UA 2OPKA 4EWAA 3KGLA 1NE6A 2N7GA 1UCXA 1O5UA 3I59B 1H1IA 1NZCA 4HVRA 4KU7A 4IEWA 3RPQA 5I93A 1CGPA 4Q0PA 4YRDA 3RYPA 4E2QA 2CAUA 3DL3A 1QXJA 1CAXA 1CAWA 1O5LA 2OZ6A 3H7JA 4MZUA 1YFWA 2B9UA 4XF0A 3IDCB 1NXMA 4IESA 2O8QA 3L2HA 4A2UA 5E1RA 4L2NA 4XFHA 2XLFA 4KU8A 1UIKA 1ZRCA 4EROA 1X8MA 3DN7A 4UXAA 4KWLA 2IXCA 2GZWA 3NSTA 3H50A 4IEOA 5FPZA 1O3TA 1DZRA 1YFYA 4H7LA 3PNAA 1Y9QA 2FMYA 2XLAA 1UW8A 4AXOA 3RDIA 1ZZ6A 3D0JA 4YSFA 1RUOA 5I8TA 3SCFA 1X7NA 1OFNA 2WFPA 3EQEA 3FZ3A 1WLTA 3H3UA 3TNQA 1X82A 2UY8A 4R52A 4ZU4A 3U10A 3H1MA 2IXKA 1ZZ8A
chains in the Genus database with same CATH superfamily
1NCRA 3T1HO 1NXD1 5LP6B 1BT8A 1HB4A 2BVVA 2W1QA 3BABA 2Y69C 1SBEA 3LCPA 4UFMA 5FP8A 4DR2O 1ZZ9A 2CE4A 5FZ6A 5IW0A 4CCKA 3B01A 2XQXA 4HSLA 3VD9A 3SGIA 2OIEA 4NWVA 4H7MA 1SQGA 1B35C 5LASA 3GHMA 3RS6A 5FYYA 3ZN5A 3K03A 3J8F1 3R05A 2VZVA 3K5MA 1H8EG 3W21A 2XHKA 1WLCA 3GJAA 3QO8A 2CNAA 4K8XA 3FD9A 4D6QA 5LA1A 4FPPA 1FMD3 2UUBO 3CE2A 2NYYA 5KX5A 4ZY9A 4QU1A 3QNEA 4JX0A 1I94B 1VQLV 4AVVA 4Y4YA 5TISZ 4EFEA 2QWRB 1OVPA 3PVOA 2PA7A 5FBJA 1F4HA 2BNMA 3FLPA 5FXZA 1PZ8A 4ABMA 3VBUC 2RS31 4XETA 5FY0A 4A6SA 5KXBA 5FY1A 3OMIB 3VBUB 3K06A 2ID4A 1NZIA 3ZS8C 2KSDA 2WNVA 4P9WA 5BMVA 1HDKA 2D6LX 1N33B 4GXLA 1OLME 2W08A 2A7WA 2DCZA 2BCCH 3C2UA 2P22C 2PHRA 2ZXWC 4E4HA 4A5UB 2LO1A 4FM0A 2ZHMA 3CCJV 3AYDA 1XPWA 5LEKA 1JQ0A 3SC7X 4XF4A 5A1LA 3SPHA 1MVEA 2D3OW 1LAJA 2WZR3 5FUPA 2VAUA 1RSOA 3K79A 4WZCA 1W6QB 1W6MA 1CAXB 4CPBA 4UWDA 3G67A 1NI8A 4NN0A 4O4LB 5LP6A 2ZGLA 4KWUA 4CS3A 3RVZA 4OHXA 5FZOA 2VZPA 1D2DA 2V09A 4AI3A 4MVRA 4JVAA 1F4MA 4IE5A 1C5HA 3AZVA 1CAWB 5FYCA 2UXBB 1QU0A 1WCSA 2RMU2 2O0OA 1PKXA 3JD1A 1MR5A 4CH5A 4TT3G 4PELA 3Q8EA 4CDXA 4N53B 4YW6A 1MOFA 1Y76A 5A1FA 2IJIA 4JQTA 3GM8A 3LFMA 3W7SA 3CC7V 4LBJA 4LIUA 4QE9A 3I3DA 4IGGA 3HMYA 5LZ6A 4QD2A 2ZGUA 2W92A 1UY2A 1PMIA 5CKQA 3UESA 1AYN1 2LW8A 3BI3A 3LDEA 5GLZA 2AEYA 1VALA 4UVAA 4AWDA 3AK1A 5DDJ1 3B93A 2KKWA 2FMLA 2QQUA 2A06H 5FZ8A 1OFSA 5LB6A 3BGAA 3PTYA 4RHV3 5IDJA 4DV0O 5C9AC 3JXSA 3LGRA 1FOD2 4RWUA 1FAFA 3RMXA 1J1TA 3ZYBA 4WFBV 2ZGOA 4QB1A 2HWE1 4R7CA 2DBIA 5A32B 1R73A 2P3YA 4AFAA 1BKZA 5H9RA 4G9SB 1ZREA 2CUGA 1NR1A 1CJDA 4KWJA 1SDWA 2ZGSA 4C90A 3E8HA 1VQNV 4BISA 5L9VA 1RMU3 5FLHA 1A3KA 4QX8A 1FNYA 4Q4Y2 2HWB2 2TBVA 4EWEA 1ENVA 2QE7G 5A3MA 2E75B 1W0PA 2X6AA 1FOD3 5FZDA 3WB0A 1YJ9V 1K5JA 2X5IA 3V56A 4GX5A 2YU1A 1YJNV 3AG7A 4FFBA 1RPOA 1VQKV 1LJ7A 3IC7A 1B04A 5A2QN 1DP0A 4QE7A 2VOTA 4ZU5A 2AZ5A 4E2GA 4Q4X2 3WF2A 5T55A 4ZHQA 1IKQA 2XG3A 2UURA 2WSUA 4NTWA 3THOA 2R6QA 3CMAV 3R0RA 5JI7A 1GOGA 4M3CE 5DABA 4LFBO 2BTVC 2MHFA 2ZE8A 2YICA 2HKXA 3BTYA 2LROA 2XHNA 1AR63 1DLBA 4O4IA 1S0JA 1OLMA 3HKDB 2WN3A 3S3XA 2X0LA 4MZUA 1GK9A 2O8QA 3I2HA 4JI3O 1NVPD 4XIOA 1H2LA 1OPMA 4QQ2A 4CDWA 2IH3C 5B5EZ 1AR92 3TAYA 2GMEA 1Y4MA 1GMGA 4LOSA 3HKEB 4OUEA 4WVWA 3WG4A 4CUBA 5IJ9B 5ERLA 2EIMC 4A3ZA 2IU0A 4XOGA 2Q67A 1VQ5V 1Q90D 2WKKA 3TEWA 2VZOA 3OGVA 3SJQC 1H2MA 3MD0A 4JZRA 2J1UA 1VQ4V 4M4RA 1OCCC 2WR9A 4J9ZB 1BHGA 1DBNA 3RYFB 1DLCA 1SQVH 4IT5A 4LE4A 1ACCA 2XKPA 4OULA 4PCRA 4ISRA 5DDJ3 1COV3 5EPAA 3H01A 1F4AA 4XFCA 5T5JA 2ZE6A 4JTDB 3AP7A 1PGL1 4JHZA 3PHMA 3HJRA 2P6JA 1SLCA 3OUSA 4QGLA 1NUKA 1GLHA 4I7ZB 3HPLC 2I07B 1NYWA 2EX3A 2JIGA 1FFXB 4FPFA 4DR3O 2OIIA 1WBLA 1V54B 1TNRA 2JKBA 4RYDA 3LDKA 2JEMA 2RMKB 2WQZC 3LDRA 4JDNA 3C7HA 1MZEA 4JYYA 5J98B 4IXLA 4NTXA 1VMGA 1NAEA 4Z1MG 3ZLIA 1W8FA 2GUZA 1FX5A 1H9PA 1R092 3ES4A 2JJ6A 1ULGA 2DBNA 3CEWA 2ITDC 3H1JH 5JZGA 4I55A 3K57A 1Q56A 3NV1A 4X8PA 3TXQA 2V4VA 3LE0A 2DVGA 4L8QA 4GJYA 3FAVA 4LNVA 5FZGA 2P06A 2Q5ZA 3DC6A 1YVWA 5JXHA 3A0KA 5KA5A 5BNNA 2PGGA 2PHDA 5FYHA 3IIIA 1KUQA 4Y4RA 2YROA 4FVVA 4FCAA 4P9GA 5K4LA 1NZ6A 1OPOA 1GQGA 2ZCWA 3L70H 3BAAA 1XEQA 2WA4A 3KCYA 4ZKIA 2VBBA 1QQCA 4IV1A 2ADPA 2MEV1 5FJHA 1QDOA 3RYIA 2HWC3 4S2DA 1KXGA 4QKBA 2IXHA 4N43A 5FNVA 4MXVA 4CP9B 3GNEA 4B3MO 1I5ZA 1NE4A 4EZ4A 4NHLA 2A5ZA 2VMIA 1H4GA 2V72A 1Q8PA 1OCRC 5FO8B 2F1MA 1LGNA 3LDCA 3QD6A 1GKBA 3ROUA 4MW3A 2BTQB 3IFXA 2JDUA 3NJXA 4JYCA 5LGTA 1OF4A 5A3OA 1VBE2 1AR82 4XUNA 1IPJA 2IC1A 3ZSEA 2RJ2A 3BU0A 2WLLB 3H8RA 2JG8A 5FOJB 5FK7A 3PJSK 2B45X 3D6EA 2W9XA 1D4VB 4PA6A 4GB33 3JD3A 1NCRB 3DPRA 3W58A 5DN2A 1HIXA 1WAZA 1SCRA 4I0XA 2NLJC 3CRQA 4Q1RA 4GH4A 1VRH2 5H2FZ 1EN6A 1BBT1 3E6DA 1LESA 3NNFA 2J1TA 5AG2A 1K7DA 2VMDA 4ZPIA 2PHUA 2X6CA 4F4LA 5E1AC 3BU7A 3J80N 2RG4A 1HR0B 2WT1A 1US3A 3TJTA 4YW1A 3CF6E 1UY4A 2B8MA 2CWSA 5JVVA 4ZS2A 4AGVA 5KX5B 1V6NA 1S76D 3I49A 3FLTA 1NH2B 4QPIC 3VBRC 4IEQA 4EN6B 5E8AA 1W39A 1W2TA 3LSEA 4I50A 4RHV1 2D98A 3VBSA 4S2HA 1Q8OA 4YG6A 2RR11 3OUHA 1ZBA3 1O6UA 5JWPA 5A9GA 4CDUB 1HXS3 1YHFA 1H4HA 5L3DA 2W1SA 1YO8A 3NNGA 4PDRA 5E79Z 4DV3B 2UUBB 5H6QA 4OPHA 2VQEO 1SG3A 5IY5B 4Z07A 4IEUA 3T2PA 3UT0A 3ZJZA 1AHSA 4N43B 5DG2A 2VQFO 3OBRA 3HPNA 1P7BA 2V4AA 1DYOA 5BPXA 3MUY1 3SPJA 4LXLA 1B35B 2MPFA 1K5MC 5BUVA 1VBB3 2DU0A 4O4JA 5BY5A 1XILA 1JFFA 2ZAHA 3JARA 4TWKA 3D36C 4LF9B 1UF2C 5IYZA 3ZBHA 1IPSA 1I9RA 4JGZC 4EJRA 3RZHA 1GQHA 3EBRA 1XL6A 4O4HB 2LFSA 3KQ4B 1AR1B 3MIEA 5ITZB 3ZXAC 3UETA 1MA1A 4A41A 3JZVA 3SISA 3TN93 5BNOC 1K5QA 2HYXA 2OVUA 2YC4A 1O5UA 1W0KG 2WNUA 4MGSA 4W4KA 3EXAA 2ZDIA 4C1XA 3BCCH 2Y0IA 1CAWA 2BGOA 5KR7A 2OZ6A 4YLZA 3JAKB 3U07A 1SACA 1H0BA 2VWJA 4QPWA 4DW0A 3O9OA 2JG9C 2EJRA 3CC4V 3ABMC 5JZGC 1J95A 1QJU3 5IE9A 2N04A 2WPDG 2IJKA 4LF5B 3SJCC 1ND2C 1N8RW 4YSFA 1CN1A 5IVVA 5L9RA 4AI1A 2EZOA 4YM0A 1KJRA 4RS5C 1Z78A 2UY8A 1VEWA 4ZU4A 3MPPG 1DGSA 2RQ6A 5SV8A 4UFHA 1BBT3 3UYJA 3VOUA 2D43A 4BQWA 5C3RA 4NWWA 5BNNC 4GMP3 2QDOA 1GNZA 3NJZA 4CP2A 1Q81W 3CCRV 5CBLA 2WC2A 1EY2A 5IWAO 3PVBB 1U5IA 1BHAA 2WSSG 3AK0A 4JTCB 3ABLB 2W1UA 4BZ4A 4N7IA 3A0BZ 3LF7A 3ZHQA 1W6NB 2E51A 3T4HB 2RR13 2R042 5B1OA 2A3WA 3UM7A 1OC1A 1R1ZA 5FR3A 3T3YA 3EB7A 1RHI1 4CEYB 1QJX1 4DV7B 4AEDB 1K97A 4TOIA 4XFFA 1SZTA 4BW5A 2AW9A 4JGSA 4DUYO 3WEZA 4CXYA 4Q5OA 5F2WA 4MTXA 1VBD3 4PA9A 4WBBA 4YW4A 1DQ2A 4AI9A 3ZYPA 1DYKA 3IDAA 1UXXX 3K5OA 5FO7B 1YUDA 2NPIA 3VBHB 4YNIA 4LBMA 3JAWB 1KC8W 2BSKB 1I0HA 5I0UA 5T5OA 3RBZA 2I45A 2Q69A 3KV5A 1TME1 3NNMA 4FFBB 1UPGA 3M3IA 3O0XA 5HCBA 3I59A 3SKJE 5FRAA 1W04A 2DTYA 5M0TA 3SJAC 1W6PA 2PQQA 2PN5A 4LUMA 4XDOA 2HWC1 3K3WA 2PXJA 1CVNA 3MV01 4QX2A 2VCBA 3LEIA 1ZRFA 4QPYA 1PX3A 3KMHA 3I4IA 3ZMUA 4K8FA 5JAXA 4JASA 2Y4TA 4PLMA 3N7JA 3S7EA 1AL23 3VBRA 3ZIWA 2JGUA 1QNWA 1V6OA 2HR3A 1M9NA 2X5IC 4AK3A 2A3XA 2ARXA 3CJIC 1FI2A 5ABJC 1SLTA 1CP9A 4COZA 1GAXA 2KB1A 2BOIA 5BV6A 3R4DB 1B09A 1RVF1 1GN2A 5FYTA 1U5ZA 1OOPB 4R4XA 1HB1A 2HFEC 2D44A 1O8SA 2AZ2A 2Q8OA 5KBFA 2Y6LA 3BIEA 2K46A 2WJSA 4X6QB 1V9U2 4BAYA 4CEYA 5K0UA 3USSA 4K8RB 1TE1B 3BA9A 2RS11 2FDGA 4IEYA 5F5AA 3NWKA 2AH2A 2ATKC 2VQ0A 3KT1A 2E6VA 1QQP1 3ABTA 3WNXA 5CN0A 2DUQA 4V2WA 4LF5O 4CCLA 2C4XA 2YIAA 2AHZA 2D6PA 3ETDA 3USUA 4MGKE 3SYAA 3VKNA 1QHDA 1Y43B 4BIZA 5K9YA 1XBFA 4OUSA 4V2VA 3JD73 1FJGB 4EN7B 1Y9GA 3VKMA 2WFF1 3G80A 4JAUA 3K4AA 4N21A 2ENRA 2E26A 4YYOA 2RHPA 1IG3A 3EFFK 4I55B 4B4PA 3OBAA 4DRRA 1KKDA 3OY8B 4Y5Z0 2W3JA 2A75A 1V6MA 4JI7B 5J96B 1TUBB 1VE0A 2LGWA 4CH4A 2JECA 3GYDA 3L2YA 2EAAA 4M00A 2RVAA 4PIXA 2R071 3LA7A 2V73A 2PHXA 3D4KA 1Y3TA 1S4CA 1R093 3J4UH 3SDLA 3E97A 1XMOB 5HFMA 2QWNB 3THPA 3I2JA 4U7OA 3H42B 5H6RA 2FYUH 3VHPA 1NT2B 3HR0A 1TME3 1WW6A 3MDSA 3WQBA 5GW7A 5HCAA 4CDXC 2FBEA 3UL2A 4RD7A 4NHMA 1BQPA 3E22A 4HNAA 2GBOA 5EZYA 4NRPA 3ZR5A 5ACA3 3VDDA 2JDNA 3TNPB 1SRYA 2Q9LA 4Q4W3 4Y20A 1JHJA 2EIEA 4ZONA 3FJSA 4JGYA 4MVUA 4RQPA 4XFIA 1UZYA 2A71A 2OPKA 3WF3A 5A33A 2JS3A 2YXSA 4IGPA 3RYPA 2XWBB 4AEKA 4FLVA 4GIQA 2B9UA 1XOYA 3T2MA 4DPNA 2GNDA 5EYPA 2XLFA 1UIKA 3I3BA 1L0NH 4MS2A 3RI9A 1L8DA 1RINA 1PNKA 2ZHNA 3A0NA 4W4ZA 5L7OC 1JYXA 1KQSU 4UOJA 2PELA 3ZXGA 1O8PA 1DZRA 1L1FA 3K5NA 1K8AW 2XQRA 3RW0A 3F95A 5ACA2 1ASJ2 4XXAA 1ROPA 2UXCO 2R16A 2WFPA 1QNMA 2DCYA 1Z7S2 5FMCA 3DUIA 4CU9A 1HP8A 4JKMA 4J7JA 3V0BA 2ADEA 4AHCA 1UYPA 3O1OA 2VO5A 3T1YB 3OYWA 5IYYA 1BEV1 3CXCU 2P5BA 4FQZA 5J36A 5KHHA 3K0GA 4IYHA 1U0AA 4WBNB 5JLVA 5FP9A 5APAA 4WFHA 4Y1YA 5FYBA 3AKQA 5KXCA 4LHKA 4PV1B 4K35A 2ZMNA 1Y7BA 4JI5B 4I0BA 5IHRA 3CCEV 4R9DA 3ZYRA 3BVOA 4EB6B 1SQPH 4TN7A 1UPIA 1OD5A 3SH3A 4JZ2A 4EKWA 4MOAA 1AJNA 2IJHA 4P5HA 4ZXKA 5C33A 3O0VA 2B39A 3TRSB 4KHPO 1UOFA 2XUEA 2XJUA 3PU8A 4XJ8A 1M06G 3ZXDA 3N9OA 2PAEA 1BL8A 1IZ3A 2VCMA 4YIPA 2IJJA 2OWOA 5F5IA 4E4DX 1C8M1 3OBZA 1XYNA 3H9AA 3SJBC 3RN4A 2YY1A 2A7AA 2VZSA 4D7TA 5HFLA 1IBLO 2Z79A 1RUJ2 3NNLA 2OCCC 2CY6A 1IBLB 2XDVA 4CXWA 2EJ7A 3GDBA 3CP1A 2DU1A 3NL1A 4KUMA 3HNYM 3APOA 2XOKG 3H1YA 4CYDA 5IYZB 2CDPA 1XU1A 5L9BA 4I3PA 2YB7A 3GCXA 4BQ1A 2BDRA 4DINB 2P3JA 4JKLA 4KBBA 1W3VA 3KLSA 3WR0A 2F4VB 5ITZA 4MXWA 5EQUA 1YIJV 3IMMA 3HQUA 1DF4A 2DUOA 4K0KO 4CEWA 2HWB1 5IJRA 4YZ2A 5C8WA 3LPGA 1W8ZA 3TOJA 5A7NA 1AL0G 1A8DA 2C0ZA 3AKTA 4C7UA 5GJ6A 4XCBA 5KMGB 1OZ0A 2Q1MA 1UKRA 5KHKA 2ZGMA 4TZDA 4B7EA 1ULPA 3JBG2 5DZFA 2D3PA 3V0BB 5D5PA 3O7OA 3T2QA 4XAAA 3LSUA 3OTOB 2A6VA 4PJ0Z 4YGDA 2VL4A 3SHRA 2WNEA 3I97A 2EXHA 4UAPA 3G4SV 4QKFA 5J3UA 1W8WA 4CUCA 1NR7A 2CH7A 2P17A 4X65O 3JD2A 3ZX7A 1GQPA 1GR3A 3CX5F 3JB4C 2IFWA 1C3HA 1NT0A 4DV4O 3ELNA 5KHGA 3C7GA 5A6XA 3WDYA 1O3SA 1GNHA 2YUAA 2R041 5JXIA 2F4LA 3D3IA 1WMEA 4L92A 5FZBA 4X66B 3ES1A 1BMV2 4IV3C 1PM9A 4CC6A 4LT5A 3BPZA 3IJ4A 2R9AA 1US6A 4B8EA 1GP4A 5K7PA 3OEAA 5I0RA 2FDFA 5FREA 2ADDA 4AHYA 1ND3A 2ZKNA 1IBMO 3OPTA 4AL9A 2VZTA 3WDUA 3MIDA 1QWRA 1ZYBA 3OGCC 1SLIA 1W99A 3CRCA 1DGRA 3KV9A 2BQPA 4LF9O 1PL0A 2P2KA 1PMHX 1M56C 4L97A 3O1TA 2LUWA 2QQMA 3WFVA 5A3LA 2RJKA 1UN1A 4TQFA 2VE1A 1IX9A 3RGBA 5LMNO 1LENA 4UT5A 3VBFC 2YHJA 2JDZA 3I5DA 5HV0A 1ZRDA 1HNZO 1RUG1 2AYHA 1VBA3 1NVPB 3IKWA 4PIZA 2ITCC 1NLQA 3O1RA 1ND3C 4HOOA 4XILA 5EHDA 2ZE5A 1HDJA 2XJRA 3J7LA 4ZZ5A 2D5HA 1K3IA 4KNCA 2Y33A 3AMQA 4E2SA 2X09A 3HN1A 4D94A 2F93B 4PJYA 1V6KA 1VP7A 3JAWA 1HRI1 1CAUA 5FZFA 2ZX4A 1PV0A 1W6QA 1RTVA 4X1KA 2ZBJA 2CAVA 4MTGA 3ZSMA 5LGUA 4J9YB 4QPGC 3DEMA 4UYBA 3T0BA 2CHHA 3K75B 1QXPA 4MSWC 3N7KA 2VTXA 1MEC1 3OG2A 1XE7A 1WA6X 1W6PB 3ZPYA 2Y38A 2K1EA 2XJVA 3QO7A 5A6QA 1V9U3 3UKMA 4D69A 2OX0A 2QWQB 4AAPA 1XNQB 3U14A 3L9DA 5A3TA 3WX5A 1G6UA 3B7MA 2YFZA 4XF0A 4QWNA 1JS9A 2ZX0A 4JI2B 5E1RA 3VB9A 2RN9A 3ASIA 1AZDA 1NLSA 1JR9A 1Z5WA 3TN92 3ZCCA 3MV11 4UF0A 2W87A 4M3CF 3RZGA 1H8TB 1MQTA 4MHUA 4EEQA 3K2OA 2WQ8A 3VZJA 1TGOA 1ZZ8A 3DXRA 4URAA 2ET7A 1P7GA 5E88A 1AR61 1J3RA 5D21A 2OCHA 3IBMA 4MYEA 1AJOA 4LA2A 1DQ5A 3E5XA 4H0LB 5LA2A 5A7PA 1JZ2A 5JCTA 1JZ6A 4LBQA 1HRI2 2AUYA 3AK2A 5LHIA 4Q4W2 4A4AA 4QQPA 4HMZA 4JI6O 3SH5A 1WCKA 2TUNA 4FPYA 5B1AC 1DGWX 1VP6A 1PGW1 1MNGA 5EZWA 3K5LA 4K6BA 4QX3A 2VS0A 2UWCA 2HVKC 2PHLA 4LE3A 1HLCA 1D5AA 1V70A 3WB1A 1G9AA 1BJQA 5L3CA 4NPRA 1NTZH 3OR6C 1DCSA 1S2KA 1IBMB 2QQWA 4ISQA 4HLTA 1Q6UA 4XF3A 1XMQO 3ZR6A 5BXXA 2BWAA 3M2MA 4J1WA 3NKGA 2R062 5EYXA 4EE2A 1LRHA 1WNSA 4QHZA 5FY8A 3HT2A 5CA6A 1GNYA 2RR12 1GM9A 3NV2A 1RUD2 3LA3A 2VOXA 2Y34A 1WB8A 3N9MA 3CU7A 5FZ9A 2VVFA 2BWCA 1PP9H 3ZSKA 3WU2Z 3GF6A 4AI0A 1WA8B 1I3HA 3FHAA 2OQ6A 3JBG1 3ZRSA 1OLRA 4C8DA 1GTOA 5FYSA 3BRCA 1ZVFA 3ORJA 1IBKO 2JVDA 1WKYA 2W6JG 4JI4O 1BZWA 1ZZBA 3LOBA 4OX9O 3WXPA 5EYPB 5CB4B 3FHQA 3POJA 4OQ9A 4JYBA 1BXHA 2XMLA 3HB3B 1ST8A 2QKCA 4UCVA 4EYUA 4HN0A 3S7IA 2BOCC 3N35A 3JASB 1OQEA 4DO2A 4WZFA 2FMDA 1VBC3 4NROA 1LNSA 4XABA 3ZM8A 3ZMNA 4JDMA 2VUDA 2QQKA 3CEIA 4PBOA 2GU9A 5J2TA 4R9BA 4XMIA 3UGGA 2AHYA 2DN9A 4META 1MS1A 4LNUB 3BA8A 3PU3A 5LBFA 1LEDA 3SNMA 3RG0A 2RS32 1LHWA 4YVSC 4CXXA 2D40A 4PA4A 3WP6A 4KXRA 4YIOA 3MO4A 2VMGA 4HVQA 4NVPA 3B77A 3RWNA 1JZ8A 1V6LA 1O4YA 3VDBA 5CNAA 2P37A 2ZINA 5JMOA 1E79G 5L7OA 1AL22 1WW5A 2CTQA 4AEDC 1AF9A 1KECA 3GWKC 4QIWF 3H7YA 3MFAA 3RJ2X 4O61A 2B9ZA 1W3XA 1CIWA 1VF6C 3O5SA 1BGYH 5FFOC 4BDVB 4EB6A 3K58A 3KSCA 3D0SA 1HKDA 4FFGA 1V0AA 5J37A 4NOTA 1RGSA 1K3EA 3PURA 5JVDA 4FXKB 3EVKA 2ETNA 2F17A 4UVBA 5A1AA 2SBAA 3A23A 3WHUA 1HX6A 4OI4A 5BNNB 5IAVA 1Q6IA 2UXNA 5FUNA 4A45A 4DR1B 3WY6A 4IEXA 3HT1A 5KA6A 3HD8B 4R4ZA 3H3ZA 3KGZA 2BV4A 3N36A 1OVSA 1A6CA 3ABZA 4MVQA 5CG8A 3AK3A 5KXDA 5B4NA 1D7PM 4KWKA 1IQDC 4I2OA 4EV0A 2V5DA 1COV2 2XWJB 3FFQA 3R4SA 1VARA 4NUBA 1RUE3 3VKLA 4MGYE 2Q0OC 4AQTA 4MVTA 3N2KB 1DF0A 4KBZA 4DUWA 4XUQA 3C7FA 3IGAC 2RS51 1XYPA 3OGSA 2YEVB 1CESA 2G9GA 1MABG 1GM8A 5L3FA 5BNQA 4WFFA 2CV6A 1ULEA 4HPKA 4NRQA 4FLWA 2XAGA 1IOAA 3MICA 3MF9A 1I5XA 3WCSA 4CCCA 2Q0AA 3CS5A 1ZBE3 1BVVA 4GAZA 5A6YA 5BY1A 5AVAA 1KFUL 5GLTA 1G9DA 1AJKA 4LF8O 5KMGA 1S0DA 4JI3B 3D5OA 5JI9A 1RHI2 4XTMA 3AG4B 2VQUA 4DIQA 4WVMA 4COWA 2P34A 5LP6C 3ZXJA 1XNDA 4GB32 1ND2A 5IT9N 2E74B 1VBC1 5AFEA 2IXCA 1REDA 1NY72 1MS5A 1O3TA 2H94A 3PNAA 2YDEA 2FMYA 1DG6A 1UW8A 3U4SA 5FIXA 4DK1A 2JJ1G 1VBE3 2VVDA 2ZCEA 3N3HA 1X7NA 2CWMA 1WLTA 3P3NA 3BPSA 4Q4X3 3ZXEA 1O3QA 4AW7A 2WINB 1R1A1 2EINC 2HH9A 4LO4B 3MAQA 3P3PA 3KV6A 3W9AA 5A7QA 5EIBD 5FMBA 1PVC1 1QBZA 2Y48A 1QIQA 3K3OA 1NQJA 1M56B 1LKNA 4OPAA 2RS53 4CCNA 1UZVA 1HN0A 4Y5SA 1RSOB 4LK7A 2HJDA 2CAZC 4QDSA 5FLJA 3PVEA 4CCOA 1CAVB 1PO13 1KP3A 1A34A 1BK1A 4URTA 4K40A 3VBSC 2IXJA 3ZKYA 2C5DA 4XDKA 2PFWA 2Q7EA 1AB3A 5H9SA 3RYKA 1IHMA 4QXBA 2ZKLA 4XUOA 3ZVXA 5IK8A 1AROP 1NCQC 2G9ZA 2DE0X 2RE9A 3C3SA 2ZHLA 1QLEC 2R063 5F37A 2D3SA 1VIBA 4N9HA 4PF1A 3KCCA 4Q8KA 1M57B 3AXEA 1ULFA 4GALA 4CCEA 5CBHA 2P6CA 4JTOA 1ZA7A 3E8BA 3E86A 1YF2A 3FN9A 4F8AA 4PDWA 5A3PA 2WFF2 2HWF3 2WNUB 1Q5OA 4MW8A 4ZHNA 4FLXA 3CJIA 2A3QA 2ZR2A 3B8MA 2A0LA 2WO3A 5F5CA 4XDPA 1CXZB 4AILC 3TETA 2VM9A 2VQAA 1YITV 4BQXA 3WHTA 1R1BA 4LF6O 2Q1ZB 3GGLA 4WV8A 1CZSA 2Y0PA 2WYSA 4LF6B 1K9MW 3MI8A 5FYVA 4CZZA 5FXXA 2IH1C 4DUVA 4X66O 3O1SA 2X29A 2UUAO 3CCVV 1YTFB 1XQNA 4QGMA 4B3RO 2WL1A 1D4M2 3SYQA 2CU5A 4QU2A 4CDQC 1AJPA 4FT8A 4G27B 5F8PA 1K92A 1AYN3 2ZMKA 3VQYA 1UX7A 4PHZA 4NHKA 3A0RA 2P7TC 2WQ4A 2X10A 4BIOA 4FM1A 1ZM1A 3ZSLA 3UCSC 1GO3F 4XJZA 2NNUA 3M4FA 3I2DA 2RDRA 3AFGA 5FYZA 3UV9A 2W2IA 2ORZA 2ZX1A 2ARHA 1RUC2 4DYLA 1XNBA 1GWKA 1K5MB 2WS92 3GALA 2G1MA 1UMIA 4AR2A 2AR6A 2V1DA 1VAKA 4QQOA 2Y0OA 3N2GA 1O91A 2D97A 2J42A 3FBMA 2BBVA 4XDJA 4BB3A 1AL21 3N9QA 2WLIA 2GALA 1OBNA 2VXJA 2WT2A 5KUMA 3MLKA 3PN1A 1ZUQA 4SBVA 3ZYGA 2Q8VA 4HAMA 4AG4A 1S5JA 3JQWA 3B69A 3FUOA 3MHZA 3U37A 2HG5C 4I3GA 5J2UA 2O1QA 4BH9A 2ET1A 3N9LA 2ZKOA 3QG5A 3WB2A 1XI1A 3JATB 4WCEV 5FL7G 1H1MA 1ODNA 5CG9A 1I08A 1PM7A 5C5TA 1KDMA 2WAAA 1OD3A 1FPN1 2GSMB 2ZX3A 2J1EA 3TGUH 1YJKA 4P9JA 4Q27A 5B3SB 5HCFA 4YARA 1VQ7V 3O65A 3O1VA 4M4PA 3SPCA 5DAPA 2ZIOA 4NRMA 1SQBH 4ET7A 4PF5A 1F9KA 2IXIA 2ZTNA 4OI2A 3K46A 1S0CA 4FOYA 2W94A 1SCSA 4IEZA 5D8AA 1VQ8V 2QZ3A 1GH6A 1ZSPA 3P32A 5L3EA 3CMGA 1JJ2U 2XJPA 2MEV2 4HT1T 1N3QA 1Y74A 1EPZA 1Y9MA 1M4UA 2G19A 1S0BA 4FI9A 1Y4WA 4Z2AA 1ZTEA 4BK5A 2WUHA 1UD1A 1N33O 2OKXA 1N0JA 4BMEA 2D7FA 4N90A 1LOGA 1FPOA 4EQVA 3W7WA 4AHWA 1URFA 3RWRD 5J48A 2ARBA 4LORA 5CBFA 4E27A 4OCTA 2JG8C 2PLV1 2C1FA 3OM3B 1UFIA 5F2VO 4IEWA 2QSAA 2DURA 1JHNA 5ANNA 4LPLA 2CAUA 2VOKA 4LBNA 3OE7G 4AEJA 3W20A 1AYM3 1S0VA 1ENQA 4RL7A 1MEC2 4Y24A 4L2NA 1EAH2 5EC1C 4CCDA 4B3SO 3ZFFB 2Y26A 1W2UA 5EYYA 3RYHA 2FZ1A 1SLAA 2RMU3 3V65A 4A7YA 2QQVA 3AXDA 2B1IA 2CTPA 4I0WB 3WOGA 1GANA 5FXVA 3VL8A 1UOGA 3PMSA 1HNXB 4BIFA 3POEA 2VMFA 1VMFA 3FKSG 2WN2A 3I54A 2ADQB 3FC0A 1QJZA 2XJTA 1QJU1 1XNQO 5BR8B 1JVMA 3CCQV 3B5LB 4PBPA 2NP0A 4JC1A 2L35A 3QO5A 1U12A 4AHXA 1AR62 3TXSA 3VGIA 1AI5A 5IWAB 2EINB 4YJ3B 4DEQA 5KUKA 2UYAA 1POQA 4IETA 2VZ1A 3SEPA 2ZIMA 2ZGKA 3B02A 1ENXA 1EV11 4FAHA 1OJHA 2PLV3 3ZFEA 5TSWA 1Y74B 1SLLA 3WQ7A 2D6OX 3GBFA 5JQGA 1RXFA 3CHXA 3IDEA 1X36A 2X05A 1P4RA 3VKOA 1PO21 4P5YA 4BJ0A 1VF7A 2VZQA 3ABKB 2GC3A 4YXWG 3EYPA 3K0DA 5EV7A 1OCCB 1UNBA 4HETA 2L6LA 5IVFA 4UXNA 2QVSB 4DK0A 3N2KA 1UYYA 1TEIA 4DR1O 1BMFG 1G9CA 2VVEA 2JENA 3WDTA 2QWPB 5EZYB 1J5EO 4MO3M 2UU8A 3SLIA 1O7FA 5BNOA 4Y20B 2DWRA 3D36A 2ZZJA 5D5QA 1LODA 2YYOA 1NY71 3LKJA 5T5LA 2FZ2A 1R3IC 2Q4PA 5BXZA 1H6YA 3BODA 1IS6A 1M57C 4S2GA 1RVF3 5FP7A 1TMF2 2FB5A 3I3EA 1KYOF 4S2FA 4CDUA 1BS3A 1S3JA 4RQPC 2QUOA 3TEYA 1M1KW 3SITA 3GVMA 4Q29A 1B6QA 3OTFA 1W9SA 3E1F1 3RQ0A 4CEYC 4M01A 5LBEA 1SFNA 3ZHUA 3APQA 1SHWB 3AP9A 2A6ZA 3E5QA 3AZYA 2RS13 3DKQA 5FTTC 2WLNA 2EAKA 3T4VA 3JAKA 3NR7A 1NA1A 1F2NA 5F3CA 1UKGA 2GUZB 1Q8QA 1JZ3A 3HN3A 1XNKA 4GLXA 3ABMB 2E33A 2VNGA 5JZGB 5ISLA 1IDSA 3TN91 4WBNA 3PUIA 1C8M2 3OPZA 3FAVB 3JD71 1LTEA 5JR2A 3PDQA 1WCQA 5LOVA 2LGQA 5DUWA 3T30A 4DXTA 2RM21 4Q6GA 4WM8A 1RM1B 3THTA 1LU2A 4IE4A 2ZNIA 2ZZQA 4OX9B 5T50A 1JOPA 2ZABA 1F5FA 1CJPA 5JH7B 2HEWF 2DQ0A 4K20A 3E8GA 1UYZA 4TV9B 4LR3A 4YZ3A 2WWSA 4AQYO 1FJGO 1X9PA 3MIGA 5LMUB 3BIWE 5FAXA 2NLRA 2HJFC 1KRIA 2VQTA 3CO2A 3CXHF 4JKKA 3NO8A 1JZ4A 3M3CA 2JDKA 4ZI7B 4MH0E 1OKQA 1FPN2 1AUYA 4I01A 5D1IA 5HCHA 3VD4A 3V0AA 3NKTA 1KD7A 1XQ8A 4LK6A 1TZOA 5BR8O 2P1BA 4BE3A 2Q30A 2GTAA 3DC5A 4LBQB 2WLLA 2WRAA 1Q7YW 4CH6A 4UB6Z 2D5FA 1PIV3 2HWD3 4WM8C 3AP6A 2FL4A 4KL1A 1ULCA 1W2NA 3AG2B 2WFF3 5L19A 3VLBB 4BCUA 2VNOA 1IG0A 2A73B 3GBGA 1EUUA 1OCZB 1W9WA 3KB5A 2YXYA 2GH8A 2CSGA 1CWPA 4QXCA 1FKAO 1LR5A 4AGGA 3P6BA 2JDHA 2V4DA 1OH3A 4Z92B 4J7ZA 4YM2A 2VC9A 4I02A 2PQSA 5GZDA 1J58A 5E6HA 1W6NA 1GZTA 2GH2A 4RGGA 1S72V 1RUC1 3C3VA 4DOUA 2WLPA 5L36A 3SCGA 4X9QA 3NXSA 2JIJA 1SBFA 3K48A 1NTKH 4DV4B 5LRRA 2Y6JA 1V54C 4JV4A 5L7OB 2OA2A 1GN4A 4FPJA 1NZCA 3I2FA 1FS0G 4JGZB 2HWE3 4NB5A 4UB8Z 2ZE7A 4Z2WA 4LWSB 2Y6KA 3GZAA 3DTUB 3ATGA 4JCKA 3ZHVA 2PYJA 2J22A 4IESA 3VBSB 4LC1A 5FZCA 4HKOA 4DV6O 1X8MA 4FVMA 4UXAA 2QA4V 4F3JA 1FV2A 2ZGQA 3F5TA 2XVLA 4QAWA 4U36A 2QBXA 1EUTA 3KKYA 2BSKA 1OFNA 5IY5C 2ZHKA 3P30A 3G6EV 4YJ2A 3N27A 1W8OA 4XW3A 4M0NA 1AR72 4R52A 5H9PA 4CVUA 2YBSA 2EIJB 2EIBA 2GTSA 3I8TA 3DGEA 2HWF1 4UI9L 1WA4A 4LF4B 4N7UA 2R072 2BNOA 3POGA 4AQ2A 5IVEA 1HXS1 1NOVA 2LM3A 3JALA 3J8F3 2O14A 3MEPA 3SKVA 2GN3A 3CNAA 4QGPA 3O0WA 3INAA 5DEDA 5A70A 1L7QA 1LOEA 4COUA 1JXNA 4GWNA 2M7WA 3M3QA 3KT4A 4K8ZA 4XFAA 4XQWA 1OUXA 1J59A 2GP5A 4YPJA 3F7VC 1OQDA 3FMGA 2WO2A 4UW4A 3POWA 2QKAA 4KHPB 4GJZA 1S0GA 2TNFA 3H1WA 4BWOA 1LULA 1EYBA 2Y4UA 4Q0QA 2P90A 3WP5A 3BHPA 1R6KA 3AB0A 4GD4A 1OCOC 4MSVA 4EN9B 5LATA 4B3MB 3PJQA 3UO3A 2ORXA 4XYXA 4JPRA 2UWBA 1UAIA 3ECQA 4AOCA 5GKAC 5CA1A 2HHHB 1DHKB 1E57A 4U3JB 1DTOA 4HK9A 1KB9F 1T2XA 3A2FA 4AVAA 3DSQA 4GZRB 3WG3A 3G6BA 1XE0A 1QJY1 5FZ0A 2A6YA 1QJX2 4LJHA 4YWAA 3VHRA 3LWCA 2YXHA 3WW4A 1AYM2 3RSJA 1KKCA 4QKNA 3ILNA 1HRV1 2VQFB 3E2EA 3SYOA 5F3EA 3B9CA 1PNGA 3PUQA 2JX9A 4LKEA 4CDWB 5C3PA 3HKCB 1VIWB 3POYA 2RV9A 3T0AA 2B42B 2F4VO 2WZR1 4UCRA 2P5OA 4GWJA 4UF0B 1VPHA 2EIKC 2ES3A 2FDIA 2YV8A 3OGRA 1EBOA 1WLEA 4CC5A 1WCDJ 3S5AA 1JA8A 4P30A 1C8NA 3AKPA 3UKNA 1LOAA 1RUJ3 3T4DA 2ETEA 1LOFC 1MACA 4LBQD 3JD4A 1ZX5A 3I2IA 2QTWB 4IHJB 4LHLA 2D93A 2UWAA 3RVYA 2ZMLA 2N05A 1D2QA 4QPKA 4XUPA 1MSDA 3KCXA 3K08A 1D0HA 5B1AB 1BVP1 1JW6A 5IVYA 1QQP3 1VRH1 5D2AA 4FAGA 3VBOC 1GYKA 3NAPA 4WM7C 5FPOA 2PAMA 3BALA 3ZXLA 1SETA 3RYFA 5C9AA 5KAFZ 3CMEV 3DXUA 4I9QA 4YZ4A 1X8EA 3J7MA 1FXKB 2GC2A 1Z2GA 1PM4A 2K2SA 4Q4W1 4BHPA 4MVSA 5CBGA 1R082 5CAZA 1PGW2 1VQPV 4EWDA 1LGBA 3L72H 2G4IA 1JUHA 3CSXA 4HFSA 2GNTA 1CZVA 1JOYA 4FSJA 1GSLA 3OYWB 2GMMA 1W2AX 4I5SA 3GJBA 3ALQA 2B5UA 4FFKA 4LH7A 3K9SA 2BNNA 3OUFA 4NHYA 1G8WA 3CCMV 1GZ9A 1G86A 3RT3C 5B4XA 5C71A 4AVSA 4C0HA 2KD7A 2W6IG 4BPZA 2ZEXA 4N23A 3ZFGB 4FO9A 2VMHA 3CJXA 3B40A 4LQRA 4OQ8A 4PLOA 3BTAA 1LUWA 1PX4A 4X6RB 5FXWA 1WZXA 4DV5B 3E83A 1R1A2 5JSOA 4BLIA 4WFGA 1M5IA 3CKHA 2XASA 3CYOA 2Q8DA 1DGLA 3UT5B 2Y6HA 4F6RB 4W6WA 1N32O 4LO6B 5DECA 4QX5A 2JICA 3RWKX 1ULOA 2WABA 4CP9A 2YI9A 5CB4A 5DUXA 4QPJA 1EFRG 1NJIW 3NRUA 4D8MA 3LNNA 3VBOB 4UCUA 4UFIA 1M93A 4YW5A 1XRUA 4A7KA 1P8JA 2EZPA 5F3GA 4IIJA 4HSJA 2WBKA 2F6BA 4GMP0 2QWOB 4ZU7A 2I2SA 3PUAA 4GKKO 4PQ9A 1ZL8B 1YI9A 4EN0A 3OMNB 4HKLA 1CGPA 4CU7A 2YXLA 1GKFA 1RUF2 2H8PC 1CAXA 3A0HZ 1N1SA 1O5LA 1HRI3 2OCCB 3OUIA 4YW2A 4BXSV 1VRH3 4Q2FA 4F83A 1B06A 2VD7A 2RDCA 4KI5M 3AZWA 3D3QA 2H3OA 2XXZA 3CCLV 4AXOA 1ZZ6A 2VCCA 2Q68A 3KD4A 4JGYC 5C8YB 4ZBMA 1TUBA 4LHNA 1AI7A 3U10A 2JG8B 1UO9A 2JD4A 4G28B 2P4VA 1STMA 1OKOA 5FWEA 4O2AA 2GMPA 1K73W 5I8YA 1QHTA 4AQSA 3A7QA 5JH7A 1LOBA 4FPGA 2CGOA 4D6TH 4YVWB 1TVKA 5GONB 2VTXJ 2ZEWA 3ASOB 4LCUC 3ILFA 5CFDC 1NBMG 4AVBA 1U97A 2GNMA 2LP7A 3ML0A 2XR4A 5EBMC 3OD4A 3ENRA 4D7SA 1Q6HA 1SLBA 2ZAAA 5FPXA 2DFCA 2WWUA 3DCQA 2CDYA 3LQCA 3HNBM 1YHQV 1WGPA 3CRAA 2BYVE 4LFAO 3ZHRA 4IUGA 1XNAA 4MVZA 2J1SA 4E9KA 4UW5A 4XMAA 4YM1A 4RUEA 3VBOA 4Z8BA 4AVCA 4CCJA 4UCSA 1RM1C 5FY5A 4FTSA 3AMMA 4UFLA 3QACA 5J2UB 2DYCA 2L9LA 1JI6A 3BYWA 4JDOA 4HL0A 1IVSA 3AP4A 5LY2A 3OMAB 1QLEB 3OOXA 1H1AA 1ZL8A 2H0BA 5JOYA 1UY0A 4YM3A 4NE9A 4LF7B 1AP6A 1CX4A 5B66Z 1DQ6A 4X62O 1RFYA 1W90A 4ATEA 3ACFA 3MLJA 4B29A 2ZEZA 3SH4A 4CTEA 2AXTZ 1W59A 2BW8A 5DUUA 4ATFA 3IZOA 3HAGA 2ZX2A 2LW7A 4V1PA 4LITA 5IVJA 2W1WA 2YC0A 3OPWA 3O1MA 1N32B 4CDWC 1UMHA 1PPJH 1QJX3 1EN4A 2DMXA 1TA8A 1PVC3 4MV2A 1IS3A 4WFEA 4KGGA 2R72A 2VJXA 3MPBA 4H33A 3O14A 1NQTA 4Y33A 3FE5A 3LEMA 4OFGA 1NCQA 2RDNA 5JQGB 1HB2A 3ZSJA 2WO7A 4YJ2B 3FB5C 1BYHA 4NAMA 2W68A 3Q9OA 1K45A 4DV6B 4GKKB 3ITQA 1HQLA 1UJWB 1CAVA 2EBOA 1H6XA 1G6NA 4OXSA 2XAHA 1OCOB 2ZT9B 4WM7B 3DXRB 1GM7A 4OVEA 2R061 4ARYA 3FBYA 3M70A 5KHJA 3RYHB 4P9OA 3K3NA 2Q8CA 2BE3A 1WLDA 5GLVA 4MVOA 2X53S 1DLLA 1PO12 3THCA 3DECA 4J25A 1JYIA 3KM5A 2ZJCA 4XDLA 2YMZA 2V5YA 4J1XA 2C24A 4FLUA 4XDQA 1H2KA 2AGSA 3WNPA 3OFNG 1CEZA 1VMHA 5FUIA 1RJ8A 3OW2U 3DYPA 2IVIB 4FFFA 4U3JA 4FLYA 3AKRA 3T2OA 1RUH2 4DV1B 2FCVA 1IGOA 1EZJA 1PZ7A 2PI4A 3VBUA 5IATA 1VBC2 4FOVA 4NR1A 1IXBA 2HWB3 2IXLA 3LPFA 4DNYA 1JYWA 4XQDA 3WZ1A 3QOPA 2CK3G 2E31A 5J09A 1W8TA 4P9LA 4X8NA 2DYRB 5FCCA 4LFAB 2E7TA 4LA3A 5KLVH 4D6RA 3AVSA 1W9TA 3SMHA 4N43C 4PI2A 1PK6A 1JU3A 1HQWA 5HXVA 2DJVA 2Z69A 1R6TA 2E7QA 5DG1A 2Q5TA 5JIUA 1VBB2 4OI1A 1I5PA 1ODMA 3VV1A 1W6MB 1BHBA 2ZGRA 4D7YA 2XVGA 5FZEA 1N36B 5FNVB 4XQ4A 4BQ3A 2Q73A 2UY9A 1DGRN 1SBDA 5LK7B 2C6SA 4EWAA 1RUD3 2UUCB 4YRDA 4B4RA 3POBA 1SFYA 4Q4X1 1HRV2 1R3KC 4FPOB 4RR3B 2E5LO 1DK1A 2PI5A 5IWFA 1AX0A 4QT6A 1FD9A 4IHJA 3QH6A 1GZCA 2W52A 3Q4HA 2W91A 1POV3 3ZYJB 4EROA 4Y1ZA 3ZMVA 1FXKC 4D6SA 2LRPA 4BM8A 2ZR3A 3H1IH 3CB2A 5K0UB 3RDIA 1LHNA 4YZ5A 4H37A 2OTLV 4ASUG 1FFTB 2JDAA 3FZ3A 4CE8A 2D6MA 4O7XA 1FOD1 1Z7S3 3H1MA 5EXOA 5J2TB 2GSYA 1MS9A 1X59A 4IV1B 1ASJ3 2VULA 3ZFGC 1CPYA 4MADA 4DR7B 1R3JC 4DW1A 4XC9A 1MS3A 4LBOA 3U4XA 4DR7O 3M8AA 1SQXH 2BVBA 5H9CA 3C3TA 4JF3A 2JB4A 4XIKA 1OH4A 5FWJA 4DB5A 1E5IA 1Z5VA 1NA1B 3I7DA 1EN5A 3T09A 2WZEA 5B1NA 4P9PA 1VMJA 5HI0A 3VZMA 2BFUS 2XOMA 4IGOA 1AR4A 5HPOA 1GOHA 4FPEA 5JOWA 4KG8A 3NVCA 4QJFB 3WNNA 1HN1A 4ZOLB 3KVAA 4XBQA 5LBQA 3ABUA 2F95B 1BE3H 4UW3A 4XURA 3M99B 3PL0A 3AVRA 4P00B 1BCXA 1O4TA 1V9PA 5T54A 2CL2A 2YZ4A 4YVSB 4TV8A 2HJIA 1UZZA 3D82A 4O4IB 1DGWA 4QPGA 3D3AA 4LWSA 2Q6AA 4RQFA 3OGIB 3RJRA 1PGSA 3MHSC 1FAYA 3JBG3 1N4CA 3G6JB 3Q8BA 5EFUA 1WLWA 4YFZA 4OYUA 3KS7A 2EIKB 1GP5A 3CL1A 4Y5TA 2YFUA 3SEEA 4F6RA 3VDDC 3HQRA 2RS33 2WT0A 3UJOA 3WVJA 1WW7A 3HKEA 4JV5O 5FLIA 2EULA 1GMMA 2OT5A 2ZOEB 5BNPB 2K9PA 3M8LA 2NN4A 2FCTA 5FPVA 4Q4Y1 3KWVA 5F39A 1TG7A 5A7OA 1QF3A 1BEV3 2CYFA 2AREA 4GKXA 2HLDG 4QX7A 1OA4A 2VW2A 4NAOA 4RQPB 5FY7A 5I0TA 3IIAA 4GKJB 1BCCH 4O9GA 2VOWA 5G04L 1MZFA 1WB7A 2QJ1A 1N34O 2PF4E 3E6CC 3DPRC 3VZNA 3RYRA 5EIYB 4C0BA 3RZKA 1UXZA 1GOFA 3KQRA 4HANA 2VBDA 5C3SA 2VBPA 4Q20A 1HW7A 2B4KA 3PMEA 1YEWA 3C7EA 2MW2B 2E7AA 4DEVA 5JJNB 5GM0A 3TK1A 3FL7A 2KM2A 2UU9B 3AC0A 1W8NA 3LDDA 1VBA2 2WIIB 1XC6A 4CRQA 1AVMA 4DR6B 3H8UA 4ZXEA 3BVCA 1LNQA 4QX1A 3B3QE 3JQXA 3I2OA 1T5EA 3CPWU 3SQOA 5I91A 1XBLA 2KA3A 1G9FA 4LFCB 2YEVA 3ABLC 5LA6B 4LEJA 4I30A 4YVSA 3U1XA 4Y22B 2WLHA 4ONUA 4O2AB 1FPN3 1H8VA 1V55C 1S5LZ 3JCIA 4MTFA 3OAAG 1HR0O 1W28A 1FFXA 4FQ4A 2FD8A 1MPXA 3QCWA 3H1LH 4UFKA 5I0DA 3FX7A 4RA0A 5AC91 1G1XB 3FB7C 1JU4A 4DR5B 1RJ7A 1XSQA 1ZZ7A 1KS5A 4ZIBA 4ZKTB 1VF5B 3Q8CA 5L73A 2B1GA 4YG3A 1YTFD 3JB8A 1R1A3 2HEVF 3GCWA 5F32A 4X1YB 3GBWA 2VPVA 2JDPA 3KF5A 5FY9A 3VD5A 1C57A 4FLTA 1H8TC 4QM8A 1YNAA 4W65A 1WUVA 2DVDA 1W05A 2Z5WA 1KQRA 2WO1A 3M7AA 4GZ9A 4FOWA 2JG9A 1ZA4A 4MXWB 1QJEA 4KP4A 2BERA 2HKOA 4M3CA 5IK4A 3HBZA 1GU3A 3KT7A 1V6JA 4UW6A 4Y1VA 2RS12 4HZFA 3H0OA 4LNUA 1OQ1A 4JI8O 2VR4A 2PYTA 3QBQA 3WCRA 5A3WA 4WFAV 4YZ1A 2AGAA 4AF9A 2P4KA 2DTWA 3IWZA 4JAVA 1PL4A 1S0IA 1GV9A 3UK9A 1YSCA 2YSUB 2WNVC 4L9BA 1RP3B 2PY5A 4RAIA 5LHHA 2TEPA 1QOOA 5BYNA 5FZIA 4C1WA 1F15A 1UCXA 3AMHA 3KZ4C 2HWE2 4E2QA 1QXJA 5C5UA 3RZMA 2Z3YA 1OCZC 1OLQA 1XYOA 1PZ9A 1N47A 3AL5A 1VBD1 2IVJA 3BEHA 4QHBA 2V7QG 3WDVA 2YS8A 3P5BA 3WNMA 2YGLA 3JD72 1MZ6A 4MGQA 1RUJ1 4W6XA 3ZPOA 4Q8LA 3BFRA 3NMBA 1YDXA 1BQZA 1YC61 2HYKA 1SA0B 3IPVA 3URFA 1YQ5A 4Q4V1 3UT5A 3MFCA 3AG1C 2AC1A 1KD1W 5GTIZ 3WV6A 2GC1A 2QNKA 1FXHA 2JEUA 3WF0A 5JOXA 4JYAO 1XMQB 2E76B 2PMWB 1APNA 3BOWA 2DW4A 2VZUA 1ZAUA 5J7MA 5IJ0B 2A6XA 2BZDA 5FO9B 1GN6A 3BN6A 1RYYA 1X9TA 2DVFA 3TYJA 2FCUA 2QE3A 3NJVA 5C4WC 3J7HA 1ZBA1 2WZ8A 2OYQA 1ND3B 1IKPA 1YCIA 1FYJA 2OW4A 1ZRRA 1RUI2 4Q0VA 5JIAA 1DDLA 4W8JA 4WVZA 3MZHA 4A44A 2X7RB 3VZLA 2ZPXA 3RNSA 5FPAA 2EICA 1KFXL 2FHRA 4DUZO 1SQFA 1YXBA 2CGPA 2E53A 1XOUA 3MF6A 1M4WA 1EP0A 3ZDSA 4RR3C 3MIFA 1QXRA 2PHFA 2C9AA 3NV4A 3T08A 4O2BB 4O4JB 3HVDA 3J9SA 2D6NA 4K9SA 3S57A 3RZLA 1YQ2A 4JGZA 2Q1FA 3M7MX 4OHVA 5FYMA 3H8OA 1YJWV 4YHHO 3IC9A 4AFBA 4UCOA 4DV3O 3J8F2 5HXMA 2A3YA 4FPLA 4GMP1 1F8VA 4XCAA 1E5RA 1NTMH 4R8HA 4GA9A 1UMZA 3N7LA 4RR3A 1V6IA 3AYEA 5IUQA 5C93A 1WPXA 1FV3A 3AM2A 1VBD2 3B2EE 4MLOA 3A22A 3ZXKA 1DZTA 3T1YO 2HBUA 2LW1A 1GFF2 3KV4A 3THDA 4DV2B 3JALB 1H8TA 1AI4A 4IE6A 4R50A 1C1FA 2FQPA 5CFCB 1DIWA 1PK6C 4GUNA 3RRDA 4R9AA 1LCLA 5A3NA 4CCMA 3UKTA 2RM22 1LEMA 1FMD2 3VN4A 4NIIA 5GZGA 3WW1A 1KMIZ 4MGIE 2F4PA 4XJUA 1N3PA 2W0FC 5JJEB 2DV9A 2Z0AA 1UOJA 5A7SA 3HKDA 1W9YA 5JPMB 1QLNA 4WVVA 4I9WA 1MS8A 4B7KA 2A6WA 5C8CB 1OMIA 3IN9A 1Q8SA 4JHTA 1YQ8A 3T0DA 1MQTB 3JD0A 4PA3A 3HQXA 4PDMA 4MT8A 2HHHO 4LOTA 2R49A 3R6SA 2Z4FA 4RFT0 3UNPA 1VF6A 3IAYA 2QTSA 2XONA 1C28A 3PLQA 2GAUA 4NYKA 3AMNA 3WG1A 4YG0A 1DYPA 1FATA 1CQ9A 2QQLA 4HONA 4H2AA 2HWD2 2QCSB 3J7NA 2F43G 4HN1A 3UJQA 3ZIXA 1X4TA 4CZSA 1N36O 5DAXA 3L71H 5JPNB 4E8CA 2ZXWB 5JJJB 4P9IA 3AKSA 1LECA 4LF8B 2C9KA 1EZVH 4X62B 2E5LB 5F3IA 4FOQA 1RUC3 4ARXA 2EIGA 2IFRA 2DDUA 4LR4A 1B3QA 5A7WB 3U78A 3LD8A 3NJYA 1K5MA 1S2EA 5FYIA 1ENSA 5FBZA 1DQ0A 5CB7A 2PAKA 4K3AA 5JSPA 2F66C 1W8HA 4DUYB 1JODA 4AZZA 4P14A 4H3WA 3WP3A 3QLQA 2RMU1 3NW4A 5BNOB 4GWIA 5DQ0A 2YU2A 1D4M3 2XBO1 4OHWA 2Y6GA 5ABJA 1JMUB 4TLFA 1JJOA 2GDFA 5GTHZ 4CS4A 5C4WA 4RGKA 1SKVA 2N7GA 3KGLA 3ZN4A 1S5HC 5I93A 2YI8A 3DXTA 3GZTB 5JXJA 4QB2A 1N34B 1NXMA 2QQNA 2UUAB 4QB6A 4KU8A 4E8DA 4XZPA 3IMNA 2KG7B 3CZJA 4B3RB 2JGDA 4L8JA 1SF9A 4D0QA 5FPLA 3B4SA 3POSA 1YFYA 1OOPA 2HWF2 3KG2A 2XUMA 1J84A 5FKBA 1PVXA 1OSGA 1K42A 2UXCB 4K7JA 4L0PA 5I8TA 4KMQA 3EQEA 3TNQA 2IXKA 1RVF2 2ZGNA 1RXGA 3I3QA 1QVFU 3DYOA 1GZWB 4I0AA 4MVMA 4GULA 5D8AB 2VUJA 2W39A 3ZFGA 4K3UA 3BTZA 4FPKA 4O9EA 5LMNB 4AAXA 5LOVB 2BJSA 1GBGA 3EXUA 4P02B 2XJQA 4LBLA 2ZACA 4MX3A 4WM8B 1ZWIC 1RIRA 4NHXA 1L7RA 2QR4A 3VHOA 5D8AC 1K33A 3MDPA 5FZ1A 3LA2A 1FNZA 1GUIA 4CA9A 4C91A 1KP2A 3ZDVA 3FUQA 3ACHA 5FKCA 1W8UA 5JSRA 3JSLA 1XB9A 4JGYB 1LGCA 2P3KA 3OY8A 4CSWA 4DR5O 2OPWA 1VB2A 2BEOA 3ZX6A 3FLRA 4EZHA 4I50B 3PIGA 1IS4A 3TCUA 4HPKB 1ULDA 3O1PA 2EIDA 1QJFA 4BOWA 5JVDB 1NA1C 3TBDA 3LSDA 5GALA 4GB31 4AQ6A 5CADA 3PUSA 1ZX3A 4DMIA 1WCUA 3LIHA 3W7UA 5FMOL 3EO6A 4Y1XA 2R7EB 4XFGA 1W0JG 4GCZA 5DM6V 4JI1B 2WS93 4IV1C 1K4CC 3RFRA 4WVMB 4KGQA 5CVRA 2JGDB 1NG0A 1G4YB 5H9QA 3C7OA 3VBBA 5FY4A 4KH9A 3ACLA 1NQDA 4ICGA 1QQP2 2DYSC 2C26A 5FYUA 3I56V 2DQ3A 2HP8A 4IGQA 1GWMA 4AHZA 1RUH1 1O59A 5AVPA 2YUEA 2Q7HA 4YGEA 1QKQA 1AR91 4TTGA 4CDQA 4P2ZA 2WAMA 5LRSA 1S0EA 3K04A 4Q0SA 3M1HA 3MW4A 1NKDA 1KDKA 1PK6B 2QJVA 1DZQA 1T6BX 3OTOO 1QCEA 3E6BA 4GKYA 5IVBA 5ANQA 3FX3A 1VBA1 3KHCA 1BSMA 4M0HA 3OUJA 4BA6A 2NMNA 5SV5A 4ITCA 4EN8B 4XHXA 5I8SA 1FMD1 1I1EA 3IPVB 4XEZA 4YVWA 1HXS2 4GKJO 3EMRA 1ZBA2 2RNBA 4CP0A 5CMUA 4FTBA 4XJ9A 1JCHA 4ZS3A 2WNVB 1L3JA 3IT8A 3OB8A 3E35A 4LO8A 1OHFA 2XLGA 3QVNA 4QKDA 2B7YA 4ZHQB 1WP7A 3ZEDA 1CONA 4NPLA 4LBEC 4IW3A 4IEPA 2WS91 5F6LB 2OUHA 1XXNA 1HNXO 1W2BU 1PIV1 5C6CA 4GWMA 2OZJA 5AC92 5IK7A 4R9CA 5IFPA 4QPIA 1H9WA 4DQAA 2UU9O 5KC5A 2NMOA 1M90W 3LUTB 4X1IB 4AI2A 1YI7A 3MLLA 2AZ0A 3R4UA 1OOPC 4JI0B 4MGZE 3AYAA 4H55A 3S0MA 1FXZA 3ACIA 4HYOA 4Q26A 3EJKA 4IE7A 1UU5A 5B1BB 1AX2A 4JAAA 2VUCA 1YWKA 1QGLA 3GZUC 3ZOIA 4AFMA 4QXKA 2ATFA 5C3QA 2OIGA 2E32A 1H38A 5LHGA 1IS5A 3OEHG 1PNMA 3CC2V 4B3TB 3I2KA 1W03A 4CDUC 5LCWL 2VG9A 3JYCA 4K1YA 3AMPA 1TQ5A 2R073 1RPRA 1NKGA 1WJZA 4L99A 2WSVA 2BGCA 5F7UA 4P9YA 1SEFA 3AEIA 1LUVA 4U7NA 1OV9A 2YC2A 4CEWB 1W9FA 4P9XA 3VBHA 3VBRB 1Q3EA 3LSSA 5K0UC 2QQOA 1ZBE1 2EA7A 5FZAA 1H30A 3RZZA 1YIPA 5EWSA 2Q4SA 3AFKA 4BQ2A 3AX4A 5IAXA 2K0GA 1LOCA 4Q4Y3 3E5UA 4CUGA 3CJHB 1KU9A 3I59B 3VBHC 4FTEA 3DL3A 3S6PA 5C3OA 4BQ5A 5CA0B 4OI0A 3L2HA 2ERFA 4XFHA 3WQ1A 5CFDA 1URXA 3E8FA 2RM23 1ZRCA 4N53A 5EK0A 3DN7A 4X20A 4IEOA 1UL9A 1SESA 1Y9QA 1JYTA 5JOZA 1UYXA 2WLIB 2OT7A 2W5FA 1AILA 4K21A 4MG2A 3SCFA 1D2SA 5L3BA 1AX1A 2CTRA 5T52A 3T1HB 3V64A 1RUNA 4CU8A 2DCJA 1RUF3 5KXEA 3O1UA 3BY6A 4M3CB 1AI6A 3BCWA 2BFUL 4DV1O 4XPVA 5BZBA 2XPJA 2YIBD 4HK8A 4YW7A 1RC6A 5CZKA 3N2GB 2MNGA 4UV8A 4XBFA 2ARAA 5CEHA 5JDBA 4LLOA 4FPCA 1MS0A 3QF7A 4J42A 4UV9A 2LTNA 3LEGA 1J3QA 3J7AU 3T1LA 1J3PA 4MGTA 2A70A 2DF7A 2R0HA 5G05L 1DF5A 4NXMO 2VQEB 1POV0 4JI6B 5CA3A 1UIJA 5LA6A 2VY0A 1KGYA 3OR7C 2ZEYA 3OCPA 1K34A 2QKSA 4LO5B 3K4ZA 2EILB 4Y22A 2DWDC 4H14A 1F4NA 3IAQA 1YI2V 1S1AA 2B5HA 2VW0A 1J1LA 3IM0A 1FXKA 3RYCB 1SFPA 2JIZG 5FMOS 5CKNA 3CRMA 2VMCA 3WW2A 2GNBA 2X5IB 1R64A 1O3RA 4NJ4A 4FFHA 3JCZA 3F2ZA 5IJ9A 4TXWA 4E4EA 1N1VA 3RI8A 1N3OA 1VQ9V 1AR5A 2X8KA 4YVWC 5GZFA 4XFBA 1IPKA 2ZD9A 4NIGA 5LEJA 1MVQA 2JS5A 4X1YA 5FV3A 2Y69B 2UYBA 1BQ0A 1EPWA 3AG3C 1KJLA 4SLIA 4DRVA 5K8SA 5FLXN 3B8NA 4JZGA 1JBCA 4NO4A 4X20B 4BIUA 2G38A 1HW5A 5EC2C 1KEXA 3EHKA 3K4DA 3TEZA 1QOTA 1YLLA 2QM7A 3D8CA 2ZQMA 4NIDA 3KZIZ 2R70A 4TUYA 4K1ZA 4DUXA 4R8CA 1ZRIA 4RUFA 1SQ4A 4BYYA 2HBTA 4IIJB 2QDNA 2XHBA 2E63A 4FZ1A 3BKZA 1E5HA 3ETQA 2VH9A 2ARCA 4AEMA 1MG1A 1JH5A 2FDKA 4X8AA 3KF3A 3OEBA 4QQHA 4DXRA 5F1RA 2JE7A 2DWEC 4TWTA 2Y64A 1KBHA 5BNPC 5LXTB 4XTPA 1YRZA 5LMUO 3E22B 4LP8A 3ZIAG 2A9HA 4IV3B 1UY1A 4BK4A 1PNLA 3VDDB 3VD3A 1GWLA 5EJ1B 4UVCA 3VZKA 5JCOC 4FPHA 3ME2A 1N1TA 1VBE1 3VQVA 5DZEA 1QNYA 4PT6A 4XACA 4YY3O 4BR6A 5FOBB 1RUF1 2EILC 4JI7O 1XNRB 4COVA 4OMCA 3IB3A 3C90A 3A21A 1SDDB 3POFA 3ZMSA 3WDXA 2YIBA 2O57A 2FKXA 1UY3A 3GHNA 1FT9A 1U96A 1THZA 3JCUZ 1HV1A 3N9PA 2VNVA 2FDJA 1MZ5A 1O9HA 3I3MA 4FXGB 5FQ0B 2PLV2 4DXSA 3ETGA 1ALYA 1QR9A 2KR2A 4XZUG 1AXYA 2RJLA 1ND2B 4DR2B 1CPMA 4QX0A 2D6KA 3K59A 2P6HA 2GN7A 2DYRC 1ONAA 4AFDA 3IDBB 3POIA 4FMTA 2WLKA 4E2LA 5LK5A 4ZOLA 2BTQA 2Z42A 4RFRB 3I55V 1REEA 4N9IA 5C8YA 2O8OA 1NS1A 1FXVA 1SC5B 2EIMB 1XU2A 1COWG 5CFCA 2ZNJA 2P67A 4AVTA 1KITA 3ZMOA 4BW9A 4QPGB 4J11A 4UCTA 2IWGB 2XKOA 5FDBA 5B1BC 4LKSA 1QEXA 5CYYA 2IUWA 4FJCC 2WA3A 5CKMA 1RUG2 1TVKB 5GONA 2WNOA 4CBCA 3BUCA 4I0XB 4Y1UA 1OT5A 2LJ2A 2QM8A 2VNRA 4IYIA 1AR81 2H6CA 1H8HG 1G7YA 4B4QA 5DZGA 1RMU1 1H2GA 4O4LA 4W50A 2XAFA 4IV3A 5FZOB 3ZYIB 1Y67A 4JI1O 2IZWA 4AI8A 4XJAA 4CDQB 1MEC3 2QTOA 4NPMA 3CBNA 1AVBA 2UUCO 5DMYA 1K4DC 1TUEB 1H1IA 2HEPA 3BOPA 4Q0PA 2Q8EA 3B00A 4W6YA 1I5YA 4EFBA 2CH7B 4U2AA 1WWYA 2J1VA 1ASJ1 1RUI1 1UPSA 1F23A 5FPUA 4A2UA 1QDCA 2Y60A 5FJKA 3MIBA 3WF1A 4CH3A 5FZMA 2QFEA 4OUMA 4KWLA 3NSTA 2GZWA 3H50A 1FYUA 3WUDA 1VQMV 2BP6A 5EP9A 2QM4A 5FMDA 3WNKA 1JYCA 1H2NA 3B94A 1IQAA 1D0GA 3L74H 3D0JA 2YPJA 2LALA 1RUOA 3IAPA 2VGDA 1REFA 3H3UA 2G9FA 1F51A 1L0LH 5H5NA 2QGNA 3H1HH 3VQXA 4TYSA 1YZBA 3O12A 4QGNA 2QQJA 1NU1H 1POV1 3T1MA 3KHBA 3LZZA 1PD3A 4LIVA 2EALA 1XREA 3LAGA 3SYPA 4PIYA 4XBNA 4LO7A 1VR3A 1OI6A 5IVCA 4ZI7A 3FHIB 1R6NA 2XB6C 3ZFEC 4O4HA 1RITA 3PVNA 1LU1A 3H9VA 2OQ7A 3V0AB 2WNUC 5LW9A 3SXWA 2RDQA 2VW1A 1BEV2 1YQCA 4X64B 3HKBA 4I09A 5C7GA 1RUH3 1JOBA 4F6EA 4X64O 3JAMN 2K9ZA 4YY3B 3CCSV 1PGL2 4TV9A 4K0KB 2QDRA 3QTCA 1ENRA 3SPGA 3FB6C 1JN2P 1PO23 2ZGTA 2SLIA 4A7ZA 4IL7A 5DN6G 5K1XA 2PTMA 5IFTA 5KC6A 2NN8A 4MTOA 4UFZA 5KAIZ 2JE8A 1P49A 3CWBH 2RCVA 3TEXA 3N7MA 4JV5B 1HWYA 1ZNPA 4XHBA 2ZM6O 1OCRB 3J81N 4NTYA 3T1CA 1HV0A 1RUE1 2ZS6B 2BPA2 1JFFB 4PD4F 3ZYHA 3LNMB 2XJSA 3JARB 4GX0A 1U5YA 2I74A 1F31A 5L3GA 4F7ZA 3SR2C 1CPNA 2WWWA 1TMF1 1VQ6V 3VUOA 2R0FA 2N74A 4XUTA 4FLZA 4RQEA 2JG9B 2Y6FA 2DFBA 4RS5A 4J7KA 3WD5A 5FZ7A 1D5NA 2JJ2G 3FWEA 5FZ3A 1CAUB 2OUJA 2OYZA 3OBTA 4LTAA 3ETEA 2QQIA 1MQTC 5A7WA 3K9AA 5C8CC 4UBHA 4B1MA 2WZR2 1RB8G 1RUI3 1G9BA 4Y26A 1T6GC 1OXCA 1PVC2 1SPPA 1OURA 1UU6A 1PO22 2Q7GA 4JYAB 3GXUA 1HJFA 4AFCA 1EV12 1D4M1 2XBO3 4D3WA 4JQRA 3Q4HB 2UXDO 4BWAA 3BB6A 2QKDA 1VAVA 3OGGA 1LHUA 4MUVA 3C8XA 2PUSA 4JI0O 2B9VA 2NZ9A 3L75H 3FFZA 5CFCC 1PNFA 4GQ7A 1HRV3 2R9IA 1W6OB 1RUD1 4DV5O 3ZKUA 3QH7A 3A4UA 2Y8KA 3ETPA 5GZEA 3ZN1A 1QY4A 4B3TO 3VQWA 3OGJA 2IBZH 2GC0A 3WW3A 1UU4A 1TMF3 5LA9A 1GRJA 3HWJA 3ZRWB 3MIHA 3CQOA 1E1RG 5A33B 1PO11 5JR7B 3T4ZA 3VBFB 1IURA 4AEDA 2JK5C 1XHZA 2FDHA 1AYM1 3P1IA 2GP3A 4IERA 3STZC 4PDVA 2JD9A 4G2KA 5IJ0A 2GHYA 2NQYA 4J80A 2HEYF 1TAEA 1QJU2 5A6ZA 4PI0A 1VQOV 4RS5B 3HKCA 5JXGA 4NXMB 3EHBB 1N1YA 5LL6Y 2RS52 2XL7A 1HNWB 4L87A 3AJYA 2JRIA 3WQ0A 4DR3B 2W47A 1WA8A 4TSVA 1WMDA 1L7LA 1VRBA 1XJAA 4PLNA 1C1LA 2BU9A 3FB8C 4HG6B 3X2QC 2WAOA 4NXNO 4HVOA 1UQXA 5FZHA 2EVXA 1BLZA 4NXNB 1TVGA 3A8TA 3SCHA 4IEVA 2P3IA 1W0NA 1XSRA 1UZWA 1CX1A 3W7TA 5GZCA 1QJY2 3CIHA 1LHOA 1Y76B 2ZA9A 4Q0UA 3ABKC 4XF9A 5LYJA 3NQHA 3S5QA 2YPDA 4LKFA 3F5WC 5IK5A 3W5MA 1HNZB 1R091 1VBB1 4QPIB 3NAPB 2OS2A 1UWWA 3WDWA 3G71V 4B3NA 3CDZB 4LLFA 1YFWA 3IDCB 2ODMA 1ZBE2 1QH6A 3AG2C 4J10A 2J1AA 1MMMA 4H7LA 4B3SB 4OGQB 5BMVB 5EJZB 3AG1B 1F35A 1I94O 3WINE 5ACA1 4BU2A 4RGAA 4A3XA 5FP4A 1SQQH 4LKDA 1TME2 4BXFA 1X82A 4PDLA 4DR4B 2PHWA 5EIBC 3U75A 3UQ8A 2J1RA 5FZKA 4B1LA 3ASNB 2YGMA 2PHTA 1G8MA 4J6GA 2VECA 3AL6A 3OEEG 2WLMA 2AACA 1JZ7A 4H13B 3TB0A 1S55A 1LB2A 3VDAA 1XL4A 1Q8IA 2HVJC 4FM2A 3LEKA 3AJZA 3HIFA 2LQTA 3I2GA 4AGRA 2NM1A 4DR6O 4O65A 4JI2O 3DGTA 4XVHA 1JMKC 2IW5A 4X89A 1VB4A 4PQQA 3N4MA 2XGXA 4Z82A 1K5SA 3TWIA 2JE9A 1HB3A 2PYLA 4X88A 5I0SA 4Q4V3 3E89A 3HEIA 1E5SA 4LFCO 1Y6XA 4QXHA 1Q82W 5FQ0A 2MEV3 4A42A 2YBPA 2YIDA 3CRRA 3B9IA 2WLJA 2IM9A 5FPRA 4DV0B 1AXZA 3HBKA 2XAQA 3N9NA 3DKWA 3STLC 4NKGB 4FIPC 3ZFFA 4LUKA 4QQLA 1K12A 1XNTA 1SERA 2HWD1 1LHVA 4J41A 3OSDA 3CCUV 3UGFA 1R3LC 3NV3A 4LHSA 4G4FA 3GZEA 2W46A 2WDBA 5IT6A 1HQNA 5DXDA 2DCKA 1QH7A 3OD0A 4YHHB 4N53C 3WNOA 3APBA 1AXKA 1J5EB 3AYCA 5FZ4A 2CGNA 3ASNC 3DF0A 3MGUA 5FP3A 5LY1A 3DV8A 4QM9A 2NR5A 1QOSA 4RN5A 1US2A 2DOSA 4DXWA 1XNRO 4DXZA 3R66A 1WD3A 5DAQA 2KG7A 2ZXQA 1LOFA 1B35A 1DQ4A 3ZFFC 3DYMA 1S0FA 2AEZA 3FYIB 3MYXA 3LB9A 2D2CB 2PZSA 5DPNA 1EM1A 5K1PA 1WMFA 4JRLA 1BK0A 1AP5A 4OLLA 3U11A 4JI8B 5EBLC 1YFXA 4YGCA 2LS6A 5C4WB 2JDIG 4LF7O 4GT1A 1TNFA 4TV8B 4I4TA 2BUKA 1COV1 4DRXB 3VL9A 4FZ0A 4CS2A 1GZWA 3LDBA 4UUJC 3WSOA 2BOBC 1C4RA 4PA7A 4ORFA 3L73H 2E3CA 2W0XA 3M3OA 3B09A 2KXLA 4OZXA 5EBWC 4IE0A 2VXRA 4CP1A 4X1KB 4FK5C 2R9RB 2VU9A 5CA0A 1W06A 3ZN6B 2VCAA 1AYN2 3ILRA 1OA3A 2B46X 4HBNA 4JI4B 5CFDB 3H3LA 3S3WA 2JXAA 2JKXA 1JUIA 3NNJA 1V00A 3CD6V 3AG3B 5DDJ2 5LBCA 3SPIA 4LULA 1GP6A 4YJ3A 3U0ZA 3KVBA 1SZXA 4AQYB 4NMIA 3ZYFA 1A78A 2R1BA 2UXBO 1PMJX 3OF1A 4KQ7A 4XAEA 3MHHC 1Q8VA 1WMXA 4TUYB 3PIJA 3GB7C 2DVAA 3UGHA 3AG4C 1PHMA 2R043 2VTFA 1VAMA 3W59A 3RMYA 2IU3A 3K77A 1HJGA 1O4ZA 4Q1PA 2JEXA 1MS4A 1F5JA 3HR9A 4GYCB 4YFWA 4KG0A 2QEXV 2ILMA 2LFRA 3VDCA 2CTWA 5CA1B 4DO0A 4QDQA 1C5IA 3ZMZA 1MSWD 1ZLZA 1JZ5A 3ICXA 3ST7A 1QJY3 2A79B 1XMOO 4CPBD 1A8MA 4ASKA 2C2AA 1JPXA 1BBT2 3WP4A 3K51A 5J1XA 3LFIA 4DV7O 3J26N 2VRZA 3MBWA 1XUQA 5F6KA 2ZM6B 2QZ2A 1IBKB 2QQPA 3ZRXA 4N8MA 4DZGA 5JUVA 4JRAA 5C70A 4DUZB 2WWJA 5JMCA 3LSQA 3RYCA 4QNHB 1I7FA 1A32A 3RZJA 3Q8FA 3HOBA 1O9GA 4ES9A 3ZXFA 3ZHSA 3AP5A 5T3NA 3ZO0B 4AYUA 5AFBA 1V55B 1NE6A 1NCQB 1R083 4BLJA 1Z0HA 5LA0A 2HWC2 4GH4B 4ASLA 3CJIB 2R32A 1YJLA 5F9TA 2EXIA 3NAPC 5LGNA 1AR71 5F2SA 2BGPA 2XNDG 2EXKA 4OZOA 2JWPA 3JU9A 4LH6A 5FPZA 4U3FH 4COYA 1OF3A 3M3EA 4O2BA 4WM7A 4IQPA 2M6YA 3WUCA 1ORQC 2ZGPA 1QMJA 4CUAA 5DUVA 1GN3A 1W6OA 3L9JT 5AC93 1SS3A 4CDXB 4QHOA 2BBAA 4DS0A 4W4LA 1F7YA 2VWKA 1RHI3 4RHV2 2XL9A 2XH6A 1YQ6A 4FFIA 1QVGU 4Q4V2 4LFBB 3ZMTA 5A3UA 4E4ZA 2H6BA 4BMBA 3PTRB 2R30A 4UBGA 3GWOA 4QDRA 3JATA 1XNCA 4XXPA 5LWBA 3MW3A 1QU7A 1YFUA 1WW4A 1UOBA 5C8CA 5CU1A 2JB8A 4OHYA 4Y3OA 5FPBA 1CR7A 5LBBA 2EIJC 4B08A 3OJBA 5KWRA 2UXXA 5HV4A 4HXCA 2WZPP 4QMAA 1DU3D 4ASMB 3ZHTA 1WN7A 2P4EA 2XTAA 5A32A 4JTAB 2VUAA 2XBO2 1QR8A 1EV13 3X2QB 3VBFA 3WNLA 1OUSA 1H2SB 2DYSB 3JASA 1RUE2 1OHHG 4IL6Z 2EF6A 2D3RA 2BTOA 4X1IA 2Z2SB 1P84F 4XF1A 5FK8A 3UKVA 4WF9V 4XBLA 1NCRC 2R1DA 3CLPA 5GLUA 2DVBA 1NX9A 2BOJA 4LMFA 3USUB 3OT7A 5CIRA 5A80A 4H44B 2W95A 1OA2A 1X50A 1Z7S1 3ON7A 1ZZCA 5IYDO 3CJHA 3JSNA 1YXWA 1N0NA 2VMEA 1CZTA 1U5XA 5T5PA 1AR93 2CTVA 2UXDB 4PDWC 4XJWA 1HNWO 2JDMA 1VJ2A 4TSFG 1SA0A 3R65A 3MUZ1 4HZ3A 2GDSA 4INDA 1C8M3 4DY3A 2MK3A 1SZBA 3SYCA 4UFJA 3JUUA 5LYJB 1NLRA 4TQDA 2BRTA 1IXMA 1AJQA 4RO2A 5ABJB 4L11A 5E16A 3WT3A 1DFQA 1AR73 1UX6A 2J7MA 5FZLA 2YG0A 3HKBB 1DQ1A 3LIGA 3HNMA 1JYNA 1W0OA 1SMVA 3ASOC 2A1XA 5KHIA 1Y66A 4LBKA 4P08A 4GX1A 4X65B 4HNAB 3UO2A 2DCTA 4G3YC