3ETRA

Crystal structure of xanthine oxidase in complex with lumazine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 42
structure length 164
sequence length 164
chains with identical sequence L
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3etrA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3etrA01
1SIJA 3HRDD 1AWDA 1OFFA 2WQYB 3P4SB 4N6EB 5H92C 3DWGC 1NENB 1YQ4B 1E10A 4P6VF 2B76B 1NEKB 1FRRA 1ZXIA 1E7PB 4JWUC 3AV8A 1L6VA 2EKIA 1KF6B 2WS3B 1OQRA 2BT6A 2CJOA 3L4PA 3KWLA 3NVWA 4HRSA 5C2TB 1VJKA 3AB5A 3AEEB 4N58A 1FO4A 1N63A 2Y5CA 1ZUD2 1B9RA 3AEAB 2MH7A 1FMAD 1V97A 3AEBB 3DWMA 1N61A 3FAHA 1OQQA 2H89B 4A9AA 3PO0A 4FXCA 1FFVA 1J7AA 2AX5A 3VR8B 1WRIA 4WWMA 1F0ZA 1WXQA 3AE1B 2WU2B 2L83A 2WDVB 4IDIA 5EE9A 3AE4B 3AECB 4YSYB 4US8A 1FXIA 1XLPA 4WQMA 1J7BA 1WWTA 1SB3C 5MPOA 1YJJA 2K5PA 2KAJA 1L0VB 2W3SA 3W5VB 3ABVB 3AMZA 2MJDA 3AE5B 2W3RA 3W9CB 2CU3A 2PKOA 2DWQA 1PDXA 5C3JB 2W55A 4LTUA 1FXAA 4YTPB 1RYJA 2WU5B 4YSZB 2G1EA 1QF6A 1NVID 2N0SB 3W5UB 1TYGB 3HVZA 3EUB2 1SF0A 3P4QB 1IUEA 4YXDB 4YT0B 1GAQB 1R7SA 3B2FA 1VLBA 1XO3A 2M56B 2JQRB 1JROA 3AEFB 2DBYA 3P63A 5H8YE 1T3QA 3P4RB 1FM0D 1QT9A 1WGKA 1PFDA 1YQ3B 2E3TA 2H88B 3CIRB 3LXFA 1QOBA 1E9MA 3NVYA 1JW9D 3AN1A 2ACZB 4ITKA 5GXGB 4ZHOA 1N5XA 1CJEA 2MJ3A 1JALA 1DGJA 1EWYC 2JX5A 3P4PB 1XLQA 2WP9B 1NYRA 3AEDB 5EE1A 3AE8B 2LEKA 5AUIA 1L5PA 1KFYB 4USAA 4US9A 1AYFA 1FFUA 3AE3B 3NRZA 4YTMB 1JWAD 1DOYA 5G5GA 2W54A 3SFDB 1DOXA 2WDRB 1JRPA 1J7CA 1E6EB 1JQ4A 1XLOA 1PUTA 4JX1C 1CZPA 3AM9A 2FBWB 3NVVA 1FRDA 2K22A 3B2GA 4C80A 1QOGA 3FC4A 1TKGA 3AEGB 1TKYA 2PIAA 3CWIA 3VRAB 1ZP0B 1FIQA 1YJIA 2PVGC 1QLBB 1GPXA 1L6UA 1XLNA 1ZOYB 3VR9B 5AUKA 5G5HA 2WDQB 3RPFC 2BS3B 4KX6B 1QOFA 1DOIA 1TKEA 3NVZA 3ZYYX 3ETRA 3VRBB 2Q5WD 4YSXB 3AE7B 1N60A 1JWBD 3HUIA 4N59A 2L52A 2BS2B 3WCQA 1VDVA 3B9JA 2KMMA 3AH7A 4ZHPA 3BIID 4YTNB 4HROA 4ZOHC 2CJNA 2K9XA 1RM6C 1WYGA 1ROEA 3P1MA 1I7HA 1E0ZA 3AE9B 1RFKA 2WLBA 3SFEB 1A70A 1QOAA 2PVOD 1KRHA 3SR6A 2M19A 1V8CA 2QJLA 4C7YA 1N5WA 1N62A 2BS4B 2MJEA 2HTME 2OHFA 5EE0A 3AE6B 3AE2B 3LB8C 5EE3A 1NI3A 1RWSA 4C7ZA 1NYQA 3NS1A 1TJEA 2QIEB 1UWMA 4JWSC
chains in the Genus database with same CATH superfamily
3HKZF 1QH9A 2MSNA 1AWDA 3QU5A 2M0AA 3TADC 2CU1A 4N6EB 1NENB 2NV3A 1I4RA 4KSKC 1X6JA 4IL6U 1T8EA 4OD0A 3MFHA 4BDPA 4KGSA 4W9JA 3WKDA 4CGZA 2P6RA 4HRSA 1X1MA 2LVPA 1QZEA 3AEEB 2IMWP 5ALIA 1SZPA 2IY1B 3OAWA 1UPHA 3Q8PB 2H89B 4O3RA 3PV8A 1KFDA 3OJ3A 1C4CA 2LVQA 9ICFA 3BVZA 4NZLB 4W9FA 2FCNA 4YMMA 2AQ1B 3AE1B 2L0FA 1ESFA 4NM1A 5KT4A 2EZYA 3W2DA 1EWCA 3ZRFA 4FZLA 5AKXA 5KFDA 3UMBA 3TIXA 3BQ7A 3T5LA 1S10A 4XDCA 5HI1A 3DV9A 4NLNA 2LGXA 4US8A 1UQVA 1J7BA 2KKCA 4HJKA 1EF5A 4RQ8A 5E6JA 3W5VB 2ISOA 4RPXA 4I28A 2V3PA 5ALOA 3ECIA 4JE3B 4FZNA 4B9MA 2WU5B 3A4SC 3MR3A 1ZQOA 3QX1A 1RYRA 2ZJAA 4I2FA 3EUB2 1RLFA 8ICBA 4RGNA 3LWMA 1T0RC 3HM3A 4GC7A 3VC8A 1M6YA 2MU2A 2NO4A 1WMHA 5J2EA 1SXDA 4NM2A 4RQNA 2XGPA 5CWRA 4J9QA 3P4RB 3PV1A 5D3DA 2CHXA 2IOHA 4DSKA 4E0DA 4DWFA 2NRXA 3QUCA 4F8RA 4OZAA 8ICMA 2RDJA 1ZQXA 3PX0A 1WM2A 4DQIA 4KKIA 3E9SA 3DBRI 5CEHA 4J9PA 4YL8A 3UM9A 2W9NA 3RJHA 5AUIA 1P7FA 2FIFA 2LEKA 3AE3B 3UGBB 4CRXA 1PGAA 1FFUA 5JTIA 3CSTA 1SKSA 4NJ6A 3U7DA 4MM3B 4B9TA 5G5GA 3ML8A 3VAWA 4YTMB 3D32A 1JRPA 3MGVA 4M8NA 4TUUA 3TKAA 2DF4B 2XY7A 1F52A 1C7YA 2UVWA 3H1UA 9ICAA 2VZKD 2K22A 4DSEA 4J3OD 3DBHB 1WJ4A 2KFZA 3MR2A 1ZP0B 4KMUA 2KJRA 4FADA 2QILA 2PXIA 4B9LA 4KIKB 5J0OA 2BPSA 2DLBA 2LRWA 2C7HA 3NVZA 4NXZA 2Y3AA 4NL9C 3SAHA 4ED3A 3HUIA 2BS2B 5HHHA 5AKHA 3UXNA 1R4NB 1WYGA 3K1ZA 3M63B 4M6WB 1Q0WB 4RPYA 4ARCA 1IBXB 4RT2A 2J0KA 2KEYA 4OJOA 3QAQA 4HKQA 2JXXA 2L1AA 4C7YA 9ICLA 4ICAA 2YTUA 3QYPA 5KT3A 2A1AA 3RJIA 1PQSA 2HTME 2I1KA 1RWSA 4ECZA 4RQMA 1NYQA 1SE2A 1FXTB 1UUPA 2DAJA 2LXAA 3DVNV 1JWMD 4YD2A 2LHDA 5AI4A 4QWDA 4KV2A 1T94A 4F8CB 4JK1A 2L8JA 4ECRA 2IHMA 3WA0A 3I63C 2YY6A 1GNUA 4PS3A 2VKQA 2BW2A 2QMTA 2R2QA 5IIIA 4N58A 2Y1JA 1RQLA 1WI0A 1WJNA 4EKUA 4JV0A 2Y5CA 1NK4A 4I2EA 2FMPA 1IM4A 3MFIA 3MC9A 3TEXA 2J0JA 4M0WA 3RB0A 3UIOB 3GIJA 3LWLA 3VTWA 4MGZE 1TFRA 3Q14C 1BXTA 4DLEA 4ZRPA 3U30A 2BDPA 2NBVB 3ORYA 1L4DB 1FEHA 4JWNA 4Q2JA 3TEYA 2G07A 1PUZA 4UB8U 3T3FA 2E8MA 1MHXA 1SB3C 1RYSA 3PSFA 2FPKA 2W03A 2MJDA 3UQ0A 1ZE3D 2AQ4A 9ICQA 5IKCM 4AUQC 1WYWB 4CCHA 3RJKA 3P4QB 4EBDA 1Y88A 2KSOA 5AI5A 4KLQA 4YT0B 2YMMA 2REXA 9ICXA 1T7PA 3PSPA 3FILA 1GO3F 3Q8CA 1JROA 2OWOA 4HXDA 3AEFB 2QB0A 4DL5A 4MH0E 2ICIA 4DS5A 4MSMB 2W9BA 2H88B 4PZOA 1WZ0A 1QOBA 4RH6A 4K3CA 1K1QA 1ZQJA 2E1EA 3AQFA 4RQ7A 4M02A 3AN1A 3UXPA 1X9MA 2ACZB 3M7DA 3BK2A 2WF6A 1PGBA 2YX8A 3ZD9A 2XI9A 1LB2B 2I6XA 1LM8B 1TS5A 4USAA 9ICNA 2EAOA 3CP8A 4Z6DA 4II2B 4M9NA 2D8CA 4F5OA 3AI5A 3WK7A 2N1WA 4Y2QA 2FBWB 3PR5B 2KMDA 3QEBZ 3PHWB 4IRDA 4JV1A 1KH0A 3AEGB 1NJWA 1V5OA 2ZCCA 3RAQA 1QLBB 2VA3A 3QXGA 1ZOYB 1IP9A 4A6QA 2G0AA 3EW9A 1DOIA 2D3GA 4XZ4A 3TFRA 1V38A 2KFKA 1N60A 1JWBD 3Q69A 5G55A 4OCZA 3MR5A 3GZNB 2BTEA 2O6KA 3AH7A 1D4BA 4IC9A 5L1MA 4NY8A 4G0NB 1I7HA 2ASQA 1UHUA 1I4PA 3R8BA 4YR3A 3GZFA 2INNE 1KLNA 4DL2A 4UQGA 5GTIU 5J8YA 5ALEA 3BY4B 2EAPA 4KLDA 2OHFA 5IIJA 9ICKA 4KLJA 1FNVA 2KWCA 3LB8C 2CPRA 4KZCA 4C7ZA 5IN7A 2H3ZA 1UT5A 3MBYA 4A55A 3BK1A 2WQYB 3U7ZA 2AGOA 4UARA 5DG8A 3GU3A 3SI8A 2HDOA 1NEKB 2I1JA 2DKZA 2ODGA 1BPBA 3NJTA 5J8YC 2W04A 4KLTA 2DUYA 4IQWA 1J97A 3AL0B 3KWLA 1TAMA 3UQAA 2LHTA 3W1SC 3RR8A 1ZQKA 2UWQA 4KLOA 2X38A 3ZW3A 3IHQB 1ZQMA 3V3XA 3GV8B 1X40A 5J0TA 5KFWA 3ZDDA 3PMNA 1UA0A 2WU2B 2KO3A 1ECWA 4ED0A 9ICGA 4GXBA 4DL7A 4XWTA 4ZRQA 2ZXIA 2JEFA 2GBKA 2H3IA 1KOTA 4DSLA 4IDIA 3BZCA 4P0QA 2XC9A 4ED6A 1QSSA 1XLPA 1HE8A 1ZJMA 2LZ6A 8ICUA 3L08A 1SSNA 1L0VB 3MTNB 4TQ0A 1URJA 4ED7A 5C3JB 1KTQA 9ICEA 2KYWA 4YSZB 5EOZA 5IIOA 3SV3A 2GH1A 5J0QA 5J29A 4RQ4A 1HA5A 4UB3A 4O3QA 1B1ZA 1JI7A 3QEAZ 1MVKA 1SIFA 2XY6A 4OZBA 4IM2A 2ZVOA 1KL9A 1EO6A 2R8JA 4ARIA 4I6PA 2KTRB 2ZJ5A 1EU4A 4PGXA 3A33B 3LXFA 3APCA 2IO3B 2LI5A 2HI0A 4MJSA 5BOLA 3GILA 4KN4A 3OLMD 1F5SA 2LMRA 8ICFA 3A9KB 4KLIA 2IBIB 3AULA 4GN1A 3U8ZA 2PTLA 3UMCA 1XO1A 3KTQA 3V6KA 3ZDBA 2JX5A 2R2OA 5EE1A 2WF9A 2GOWA 2J6SA 4KLHA 4Y2XA 3PTFC 3M8SA 4KGTA 3ZKJC 2FPLA 4UB2A 4HCPB 3NRZA 5KFYA 2D3CA 5E79U 5DBAA 4OVZA 2ZIXB 5EDSA 1J7CA 4ZH4A 1K51A 2FCQA 3BWUD 3H4BA 2CR5A 3B2GA 2GBRA 4NLZA 3B0AA 4BKSA 4DF8A 1DYQA 2Y9UA 3R9KA 3DBSA 5HR7A 1L4ZB 1V1PB 3U26A 7ICTA 4U6PA 2MBOA 4OJLA 3P42A 1RXWA 1V49A 3ISCA 3WCQA 3Q8SB 1TS4A 5DG7A 1XD3B 1N48A 4ECUA 4DS4A 1ROEA 8ICNA 5KL8B 4Y2JA 1ZD2P 2H3VA 5KFJA 1T0YA 1V80A 5JHAA 1A70A 1L0XB 4QZEA 4YR0A 5KFAA 1NZPA 1N56A 3RJJA 3TANA 1YOVB 2JPHA 5EE3A 4ICVA 3RH6A 4GDLB 1N2XA 1CK1A 5AZGA 2W7PA 8ICHA 5AK4A 4JV2A 2KTFA 2C2EA 2ZPYA 3BYYB 1E7PB 3GB1A 2OYYA 4PS8A 4HDQA 4RNAA 2R8KA 3BS5A 5IILA 1WH3A 3NHEB 2LGSA 2RMMA 2RP5A 1WXMA 4JL9A 2HTHA 3ZQ4A 4HYKA 5F9LA 2L32A 5JUMA 2BBCA 1IXRA 3BDPA 2DL0A 2CN1A 9ICRA 3VUXA 2HJ8A 5KFLA 3C0RB 2BQQA 2N4FA 3SD7A 4QWCA 2AL6A 4JWMA 1ZDVA 1MN8A 3IM1A 4RQ5A 5BMIA 5J2KA 3RF9A 4WWMA 4C4VB 5ALRA 1NK9A 2E8NA 3RZFA 4C0ZA 1F1HA 4P1BC 3PZPA 2LYAA 4IR9A 4RF0A 1K5OA 5EE9A 2AGPA 4OZCA 4QZIA 5DQHA 3QCAA 2YEPB 3OSPA 1RG6A 9ICUA 3DHHC 3KZIU 4I29A 3KHRA 2EKEC 5J2HA 1QQ7A 4TURA 3ISDA 4RCOA 2QARA 3IT4B 4IQVA 2NMQA 1IV8A 2E8PA 3MP9A 3PSEB 4QZ8A 4W9KA 1TE2A 2RRDA 1WSPA 3L54A 5L1KA 3UF8A 2NTTA 3DVGX 1IG6A 1GAQB 2BKEA 4IW0A 1BNPA 2BB5A 3I5JC 1TT5B 3LYYA 4F2SA 2HHVA 4KSLC 1L3VA 2BWFA 4LNFA 4RQ2A 1FM0D 3N7SC 1QT9A 2LWPA 2MP2B 4S0RA 3LJ3A 5J2AA 2ZTCA 5KG1A 4DL6A 2BR0A 2KDBA 2D3AA 1WCLA 5BMGA 1SKRA 4LLGM 1QF6A 5H2FU 3P4PB 5AI8A 1VZ7A 3A4RA 1UNSA 3TQ1A 5KL1B 2C22A 1KFYB 3HK0A 5J2BA 4HJGE 1XS9D 2XCAA 5F9NA 2K8CA 4YMOA 1SV4A 1SGGA 1UWXA 1L7MA 2BPFA 9ICSA 1XSNA 3H0LB 2QB0B 1T5XD 1PZNA 3JPSA 5AM3A 1B22A 1Q46A 5KG6A 1NI2A 2GBMA 2KN5A 3OJUA 2WXGA 4AJWA 2LI6A 1JRUA 2K4EA 2J6TA 1E0ZA 1JX4A 2A4ZA 4Y2PA 2DPIA 1QOFA 1YN4A 2JWUA 2G3QB 3B0XA 3L17A 3ZYYX 1G6JA 3AE7B 1QSYA 2VZKB 4TMAB 4QJFB 3RI7C 2FLNA 1LKYB 2H3FA 2K1FA 1I4GA 2KX3A 1HUOA 4EYHB 2AXTU 4DHJD 3WKCA 3SAFA 1P9DU 2DNFA 3OWEB 3T5JA 7ICKA 3QK0A 2FLPA 2KWVB 1CMXB 3DVNU 1WM3A 3SEIA 1A0PA 1ZQDA 3K9PB 1HEKA 4EBEA 5DPWA 4LJXA 3A0BU 4Q8EA 4P6VF 2INPE 2K39A 4HAIA 2HW3A 2O6VA 2Z59B 2ZW1A 4P4MA 4HKZE 2GLSA 2EQYA 2B6GA 1L7PA 3V7JA 1KLVA 5JU5A 2WF5A 3OHAA 3DWMA 3IHPC 4DHZE 1RQNA 1NK6A 1X66A 4QNLA 1D8YA 4KTQA 5AI0A 2KZRA 3ZDEA 7ICFA 5DKWA 2ZJDA 2HBLA 5C0YA 4RGMA 1TBEA 4M0WB 4PHDA 3PY8A 2K8CB 4B9KA 5KG5A 4TQSA 3KOOA 3GDXA 4URKA 3AE4B 2W82A 1V1PA 1ET6A 3ZJVA 3MGHA 1XNSA 5AZHA 2K5PA 3FKYA 1YN3A 2FUHB 1UELA 2TSSA 4LNOA 1BNOA 4M01A 3ALRA 3W9CB 2W9CA 1WFYA 2PKOA 1GC6A 4UATA 3F2CA 1V2YA 3JPOA 4KX5A 2NO5A 2QKQA 2ZIVA 4C8MA 2XEWA 2F8LA 2WWZA 2VA2A 2VRRB 5AKEA 4O3MA 3H7PB 9ICOA 1LKYA 4B9NA 1GC7A 4R8UB 2KG5A 4GXJA 5CRXA 1H38A 1KLGD 3SU8X 5DB9A 3DVGY 1WGKA 3RB3A 1ZQQA 1RYUA 5HMLA 2IGHA 3U52E 1LO5D 2HBJA 3ZTCA 9ICPA 3JVZX 4EUTA 1J19A 3L3FX 1UBIA 4EELA 2G06A 1DGJA 2DZMA 4ZYNA 5BMHA 1TTNA 4A90A 2L05A 1ACCA 1ZPSA 1KSPA 2Y5BB 1AYFA 4PL1A 2FMSA 3QE9Y 4UB6U 2XO7A 2VANA 1YD8U 5AKLA 2DPJA 8ICCA 2KTRA 3N7PD 2M4NA 4R63A 5KG0A 3OHBA 2YN4A 4P4PA 5CR0A 4AQ7A 3APDA 4NV0A 7ICRA 3NZUA 2PMVA 1TAQA 1ZQBA 4OHJA 5AZFA 5IIMA 3M9NB 3VRBB 2MUTA 1NBFC 3SAGA 4EX6A 4FS1A 3KLSX 4EYIB 4X57B 5KTQA 5FK9C 2FDRA 1OEYJ 2IZVB 5HR6A 4E3CA 1KW4A 1K8RB 3IN5A 5ALKA 3BZDB 2F1IA 4J9KA 1N62A 2V3NA 3EA6A 2C9WB 4EENA 2QIEB 1FD6A 4KDLB 2M9NA 2RD0A 4WQOB 5IO9A 4WWNA 4E74A 4FLHA 3MABA 3Q2AC 3RD2A 4WJ3B 2L00B 2VH2A 1FNWA 2BT6A 2CJOA 1S8OA 4Q8FA 4ZRJA 4AP9A 4QW9A 2BWES 4YXJA 2HVIA 1TV9A 3V7LA 1J2NA 2ZIXA 1B9RA 2Y0SF 4OJ6A 5ALSA 2MH7A 5HMMA 3DDCB 2KJ9A 1YIWA 4A9AA 1S9FA 1ZQTA 2JRIB 2LYBA 4C00A 2G09A 5DPSA 4K81A 1WRIA 1UF0A 1WUDA 3K1RB 4IRCA 2D11A 2WYQA 2J7QB 3TL5A 3GIMA 2INCC 1ZQ1C 1YX6B 1ZOLA 1D6EC 4P1CC 2D3DA 3N1YC 5A0LA 3AECB 4EEYA 2MWSB 2JH7A 4I2IA 1RZTA 1WWUA 4XRHA 4MH8A 1PK1B 4C4TA 3BZKA 2KFJA 2KLCA 1ZRNA 2PFOA 4PH5A 3PW2A 1A76A 1PVQA 2SEBD 2LD9A 2W9MA 3Q8EA 1WCNA 5KAIU 5ALJA 4NLKA 2EMTA 3QU4A 2G1EA 4KIKA 3WKAA 3HVZA 3BJYA 1U47A 1I35A 4GXKA 1C4AA 1WGRA 2KMAA 4JB3A 1SE9A 3Q8KA 4GU2A 2KQ7A 3ZNID 5AKZA 3QHTA 2N9EB 2E3TA 2JRZA 2ZJ8A 3H8MA 2RDGA 3H8JA 5KFQA 1KJTA 5AM0A 2KT7A 2KC2A 2XBBC 4NL9A 5DPRA 2ZVNA 5HFYA 5KNIA 1YJ1A 3M9MB 5J2GA 5BYSA 2GRIA 5KFIA 5KFSA 4KLUA 1XLQA 3AEDB 1WR6E 4KLFA 3N32A 1B43A 4AOFA 1DOYA 3C1ZA 3T5KA 3SFDB 4M9HA 3R3MA 1E6EB 1YQBA 3ETLA 1E8WA 1XLOA 3H8SA 3QARA 3KVFB 4QW8A 4C80A 4UBCA 2BQUA 1MSWD 4JUZA 8ICYA 4R64A 3HHMA 2PVGC 5ALWA 1U4BA 1XXGA 4R66A 4KX3A 4BJQA 3BQTA 4JIOU 1S0NA 2WF7A 1OUQA 2ZCBA 4EOYA 3KHLA 4K3BA 1PYWD 1ZQNA 4XYCA 4UB4A 5J2DA 2QLTA 3RYTA 1ISNA 1L6NA 4QWAA 4UB1A 1S3SG 3P1MA 1ZQZA 3SV4A 1TIFA 1ZD4A 4Y2YA 2LVOA 4ELUA 3QU2A 5ALVA 4KLSA 2NBWB 3K75D 5ALZA 2HHXA 2ALZA 2MJEA 2L5YA 2MAXA 3ZNZB 3AEVA 1PK1A 3F53A 2ASJA 1SWVA 2EDUA 1B4FA 1BVSA 2LFIA 1ZQRA 5CB1A 4I2AA 7ICEA 3I28A 2NRTA 1OFFA 1TS3A 3EFUA 4F4ZA 3DWGC 3PHXB 2KFNA 1RDFA 4DHZB 1I4HA 4Q44A 1ZXIA 4YQWA 2D3BA 3HP6A 2UVVA 3GV7B 1MJDA 2MSED 3IG3A 2XK5B 2ONQA 3TEZA 1ZKHA 3SDLC 4GMVA 1D8BA 3CSFA 1SXTA 3BS5B 3PNCA 4P0PA 4LCDE 2IY0B 1COKA 1TS2A 2IDYA 5DBBA 1YZ6A 2QDFA 2BHNA 2AX5A 2BQ3A 2HBKA 1WGYA 2KVRA 3MDAA 2BCRA 2KC1A 4RGTA 2BCUA 3VTUA 4KITB 4PHAA 1Q5WB 3QIJA 4QIWF 2NS5A 4PS7A 1BUIC 3RB6A 2FE9A 3NRWA 3T79A 4C4VA 1L3TA 3GP7A 4Q43A 1SKWA 3SEBA 2NVUI 2K4PA 3RULA 3AE5B 1D5ZC 3QUBA 4CDGA 4HK2A 3TUOA 4BKSD 3D2NA 2LJIA 3H8HA 2DX5B 3JSVB 3L5KA 2GOLA 3TACB 5B5EU 3JSVA 3ZIMA 5BPCA 5L1JA 2O2VA 4NLBA 3Q8BA 3ZDTA 4B0EA 1ZQGA 3VDZA 3BYTB 1BPEA 2V4LA 1HTQA 4J9OA 1KFTA 1UBQA 4MJSB 3QU7A 3ZGZA 4HVBA 3Q8MA 2HCFA 3RNGC 3AE8B 1L5PA 3F2DA 4IM0A 3ZO5B 5C1ZA 3U4EG 3IG8A 2VH1A 4IUMB 4MT5A 4M0AA 3UPQA 2Z0EB 3AM9A 5KFRA 2J42A 2R18A 1FRDA 7ICSA 4F4YA 4TUPA 3A9JB 1VCBA 5D7GA 5IP4D 3CWIA 4O5KA 3A9JA 5J0YA 2MHJA 1U49A 3GOEA 4MFAA 3C28A 2V4RA 2ISPA 2AJQA 3C2KA 2BGFA 4YXMA 5AKYA 2KMCA 2MCNB 3HX0A 3EECA 4MM3A 3AXCA 5E6NA 2C2RA 1PK3A 2VJ4A 3H7SA 3EPIA 4DHJB 4IM3A 4DL4A 4DBGA 4W9IA 1HTOA 2K9XA 3ALBA 2N7DA 5AI6A 2WXRA 3OPXA 4LDTB 2WLBA 4K4HA 2E5SA 3W1SA 3H40A 2LM4A 2KWUB 9ICVA 1TK8A 1RPLA 4FJVB 5EE0A 3EFCA 1RFAA 2Y1IA 4R8UA 1NK7A 2YB4A 1E8YA 5JHBA 2OJRA 3LK9A 3HRDD 4YP3A 1WZ3A 3KKAC 4LNNA 4LZGA 3PR4A 3KHHA 3A1QA 2ON8A 4PGYA 2C2DA 5KFXA 2RR9A 1IBXA 4EZ6A 1K53A 2JEIA 1WR1A 4RQ1A 1L6VA 4I2CA 3F5AA 1ZGUB 1KN5A 1KF6B 4DFDA 4CF4A 1AARA 1UCVA 1EU3A 1JXEA 2LUMA 3E56A 1FCLA 2O6VB 5JXVA 1LXDA 4R3DA 1ZUD2 2D2QA 2DZIA 3N20C 1GJZA 2DYMA 3MFGA 3H0RB 3PVLA 4MGYE 2I9GA 1MPEA 4XUSA 4Y2VA 3RJFA 3VFKA 1Z3EB 1TK0A 4MEXA 5CX3A 8ICXA 3LYSA 4BOSC 4F92B 2D10A 3UIPB 2G5HB 1UT8A 1ENFA 1OGWA 1D8LA 2WDVB 1J2MA 2W11A 2F2AB 2KDMA 4MFCA 1WWTA 3ZXVA 2BYFA 2GO7A 1XSLA 1L3UA 3RRGA 3TMPB 1ZQFA 4ED1A 2RLTA 2BYEA 4O0IA 3N4MB 1VR9A 3PW7A 3IRUA 2GLEA 1UZXB 4FA6A 2J53A 2BQRA 3RUIB 4WJPA 5HHIA 2JZBA 1IUEA 3L0WB 2JXJA 4DXFA 1XO3A 2L3ZA 4J9RA 3T8MA 3ZD8A 3B08A 4CHKA 1U4AA 1V86A 9ICIA 1AN8A 4BFRA 3NVYA 4FN2A 4GDLA 7ICUA 1JN3A 4G3IA 2BCSA 5GXGB 3SD5A 1K52A 1QTMA 3FILB 4IKGA 4K7UA 3PGEA 3VVWB 3RNBC 4US9A 2JYTA 8ICGA 8ICKA 1V85A 3FYHA 5AK5A 2V1YA 3EC8A 4FS2A 2HE7A 2JY6A 2WFAA 2NPTB 3NVVA 3X23A 1TKGA 2WXNA 1COOA 3ONNA 1X9XA 4TSSA 1YJIA 3OJ4B 2YLMA 3VR9B 1LV5A 4O5EA 2UVUA 4Y2RA 2IHNA 4UAYA 3ETRA 3R7RA 1T0QC 1A5RA 1VDVA 3E0FA 4DFMA 2V9HA 4DSFA 1I4QA 5C23A 4PHPA 4RU9A 2W8KA 4F7ZA 2WXQA 2AQ3B 4ECSA 2EMSA 1NNLA 1F0MA 3SFEB 3WAPA 4PHEA 1WXAA 5J2FA 1D9FA 4RQ3A 2KIVA 1F77A 4FBTA 3KZXA 4S17A 3N30A 3NS1A 3ZDAA 4IQTA 4X5VA 3ZXRA 5L83A 4RQ6A 2WB1C 1P3QU 3AU5A 2Q4TA 3E2EA 2D6FC 1BPDA 2MEKA 2WXKA 2B76B 3HVDA 4FJZA 4F4WA 4QZCA 2PI5A 2WHIA 3GE3C 2WGSA 4DWIA 2WS3B 8ICTA 3C5FA 3PX6A 4O9MA 5TSSA 1WGDA 5C2TB 3IBEA 4KMOB 1HEZE 3N9YC 2N9XA 2FE8A 5KFBA 4NJCA 4DQSA 5DPTA 4I2HA 3MR6A 1Q3VA 2ZIWA 4TKNA 2H3QA 2NYVA 7ICMA 9ICWA 2IO0B 2KD0A 3ZUNA 4DDID 4PL2A 2O6VD 4O5CA 3DHIC 4QZAA 3PSTA 1WXQA 3QUQA 3MC0B 1PVPA 2Z7JA 5KFTA 2M0NA 5KFCA 3QA8A 2K3UA 3PS6A 2DQNB 1WG8A 1P1AA 1YJJA 1Q3UA 4BOZB 4NJ7A 3W1YA 1L5UA 2A3VA 4P0PB 4RQ0A 4UAVA 3C1YA 4DFJA 1SE4A 4LTUA 3HW8A 1RYJA 2QSDA 1BGXT 7ICNA 3N1ZC 2WXMA 3W5UB 5CTRC 4EEWA 4K1RB 3ZI4A 1TKDA 3ICXA 3H6NA 3KWVA 3RBDA 2JSVX 2GWSA 3Q3MC 3V60A 4BXOB 2LHEA 2FCSA 5KFNA 3KQ4A 3PW0A 2WXJA 5EWGA 7ICIA 2G45B 1PFDA 3UXOA 3WK6A 5GMVA 2X8XX 5LXHA 2EAMA 1KDHA 3GQCA 2D07B 2NTSA 4NNJB 3RB4A 3ZVVA 2JZ3B 5BYRA 1KLUD 5LNK1 3ZNGC 1D5MC 1V6EA 4CYEA 1JALA 3NS8A 1AQ6A 3NASA 5J0WA 4MEMA 3AUOA 1MC8A 1NK0A 1SWWA 4FHKA 2L7RA 2V9WA 3O13A 5J2IA 3RFZB 4MACA 1DK3A 3LDAA 2FAZA 4DDGD 2FPMA 2R8HA 1CZPA 1VRAB 2JU6X 4ECWA 4D2KA 4AYBC 4XGAB 3A0HU 4BBNC 1Q1OA 3A9KA 1TKYA 1ZD5A 3ZNHB 5EWFA 3RTVA 7ICJA 1KBUA 3IFWB 1GPXA 5AUKA 3H9DA 3AU6A 1E5WA 4K7SA 2LM1A 1XWLA 2J6UA 3ISBA 9ICTA 4RMAA 4RM9A 4YSXB 5L1LA 1S0OA 3CRXA 4N59A 2B21A 4PK1A 3B9JA 2KMMA 4FULA 4B6WA 1O08A 5AKGA 4W9HA 3JPPA 1WRDB 2A1JB 1U45A 9ICMA 1E7UA 4OW0A 3WALA 1RFKA 2DHZA 4M9GA 4M9LA 3NTUA 3SR6A 1SE3A 1V8CA 3M62B 4KDIC 2ZPNA 3NUQA 2PFQA 8ICOA 4IWQA 2DAFA 2ZUCA 3I1YA 3V6CB 5ALPA 3V6HA 2AU0A 5KT2A 4DCCA 1UWMA 1YZ7A 4NWIA 4F5QA 1SIJA 3HPOA 4ED8A 1IPGA 2M8SA 4MFFA 1YQ4B 1UA1A 2KQ4X 2RPVA 2Y5PA 3Q3FA 1X42A 1XSPA 2AYOB 2EKIA 1DOQA 3N28A 2LJ5A 4HCNB 5ALNA 1E90A 1Z2MA 3H7PA 5J0UA 2KIWA 2OEDA 3NVWA 3PRPB 4NLGA 3N7RC 3AB5A 9ICCA 3SHQA 5CHGA 1MQ2A 1WY8A 1UD7A 1ZQLA 4ELVA 5KFGA 4RF1A 1FMAD 4TV3A 4ANUA 1LGRA 1IGCA 1OQQA 3HJEA 4UB5A 4HDOA 1MG8A 1L8OA 2KZZA 2F44A 2LPEA 2OH2A 1T6BX 4MF8A 4M00A 1YMHE 2R61A 1Z4NA 7ICGA 2DKXA 2XVTA 2XIDA 4ZRIA 4MSQB 3C19A 2IBKA 5AIBA 3QU9A 4WQMA 3VXWA 5J0XA 2AWTA 3BS7A 1WXVA 1ZJNA 4C8LA 4IC7B 4YR2A 2W3RA 4JPSA 2PI4A 8ICWA 4GSWA 2Q0ZX 4J9SA 3RCZA 2MUTB 2HHTA 2VIXA 1JIHA 1TYGB 2AL3A 1OW5A 2Y0SC 1NOMA 1R7SA 5J2CA 2JQRB 3H7IA 3HM6X 2N7EA 1QQ6A 2DBYA 2KVZA 3SMVA 8ICZA 4TQRA 3PZDA 1P7DA 5AKKA 1Z00B 2AEHA 3WKEA 2LRUA 2JV3A 7ICPA 2V3SA 3NOBA 1ZQYA 3PO5A 5KG3A 1WF9A 2QHOA 2LBOA 3BQ1A 1ZQIA 1H4RA 1Z1BA 1CJEA 2ZZPB 1EWYC 3QJZA 5KFUA 1ZETA 1VZ6A 1B0XA 2ASDA 2KV2A 4PPXA 4RUAA 4A8XC 3KHGA 4J9NA 1TVAA 2KK8A 3C2MA 2BVCA 2KLGA 2PLPA 4PT5A 2MP2A 2K6DB 5DB8A 4AP4C 1NJYA 3V6JA 1U9LA 1AW7A 3IP4B 2HMXA 3G6YA 3FC4A 3AU2A 1WMHB 2DFLA 4REZA 5BYQA 2HDEA 1L6UA 5KFZA 4UDUC 2WDQB 3KYCD 2EH9A 1LQBA 1TKEA 4GC6A 3SQIA 1RAXA 1U48A 4W9GA 2GBNA 3KFUF 4NAMA 2CKHB 4GGQA 5J17A 4YTNB 3I76A 1WE7A 5D49A 9ICHA 4M47A 3DBRB 5ALTA 2F77X 1S97A 4MHVA 1WX7A 1XCQL 2PVOD 2WXLA 4WURA 4F72A 1ZQAA 1ZQPA 3RRHA 4YN4A 2AGQA 2W7OA 3AE6B 2WTFA 2INDC 4NY0A 1JXLA 8ICQA 2JVCA 4P0QB 4NPNA 2K60A 5KG2A 4GIBA 3VUYA 3P4SB 3PVXA 2KACA 2PMZC 3V7KA 1SEBD 3QX7A 1CRXA 3GIKA 1KTKA 3Q6BA 2MW5A 4YWGG 3BQ2A 2BYVE 4J9LA 4YCXA 1OQRA 2XICA 2PW9A 3DBLB 4DK5A 2GB1A 2A19A 1ZQVA 2RDIA 4ELTA 1TZ1A 4XA5A 4XX5A 4HEA1 4TUQA 4PJ0U 4ECQA 2KE7A 3THVA 3DBHI 3PT2B 4GDKB 2DYBA 3DQVA 1TY2A 2YQEA 2FJ6A 4JQWC 3RJGA 5B66U 2BKRB 2IA6A 2JUOA 5KFVA 3R2IA 3ZLZA 2J52A 4EZJA 4EE2A 4DQRA 2K89A 4LJOB 1JUDA 4RZRA 3PLVA 2WXIA 5L95C 3G6VA 2HSZA 3N3KB 2KAJA 2KOXA 2W3SA 3ABVB 3AMZA 4RNOA 4ECYA 3DCGA 5J2RA 3IT6B 4PZNA 2WAQC 3RT3B 1GB1A 4ANVA 4EZKA 3QZ8A 3V05A 3O0FA 2WDTB 4GB9A 3OGUA 2I1QA 1C76A 2A1JA 1GUAB 3OTQA 5DDYA 3TBLD 2W8LA 5HKHA 1ZW7A 5HHDG 2KKPA 4C4SA 2I2YA 1C77A 4C8NA 1LVHA 3EPGA 3IVFA 4IG7B 5ALYA 1T3QA 1CI4A 2PE6B 4G9BA 4RT3A 3RMKC 2DZJA 2JEJA 1C79A 9ICJA 5AICA 1WJ6A 2KHQA 1KQQA 1XQQA 4WAFA 4BXOA 8ICEA 1ZDXA 5EWEA 4OJPA 4CO7A 1MQ3A 1OQYA 5KFPA 3UMGA 2JRHA 3I3TB 5C5JA 5IINA 5D4BA 4F50A 4C8OA 3G6XA 4EX7A 3N97B 2RGFA 3MDCA 2DENB 1E8ZA 3EYZA 5ALLA 2LUEA 1UGMA 3KUZA 4ZYSA 3D2SA 1MI0A 4KX6B 2HHSA 2JHDA 2D5GA 2RSUA 2BZFA 4A8EA 1R4MB 2K6QA 5HNKA 2WNMA 5JRTA 4BKGA 4O1NA 3SYZA 2KJ8A 1D9DA 4BKTA 2E8OA 4ZHPA 2ZTEA 4ZOHC 4ASWC 3QQ8B 3H8WA 7ICVA 4II3B 3IV6A 3S2AA 3AE9B 2M17A 4LNIA 4WJQA 4FZMA 2M0XA 1DXSA 4ACFA 4P4OA 4I2GA 5L1IA 1GOZA 4ED2A 1RRBA 3CYMA 8ICLA 5HP4A 2GI9A 3AE2B 3EGRA 4DOCA 2KJHB 2N9PC 2RQ5A 4F71A 3RJEA 1ET9A 2K4IA 4LK0M 5E6OA 2KN7A 1NJZA 4K4GA 2GBJA 2V0GA 3BVGA 4HPPA 1Z00A 4EZLA 4KKJA 4GIVA 4BX9C 2RPQA 1XC9A 4WWOA 3RNCC 1KFSA 1SL2A 4DSIA 2ZIVB 4GLXA 1Z19A 1EM7A 1N63A 1OTRB 1TZOA 2DZKA 1BMLC 3IG5A 2BDUA 2L76A 3UQBA 1WGHA 2FIDA 3PO0A 5T8IA 2KNJA 1J8CA 4GOCA 4P16A 1DRGA 1F0ZA 2LGDA 4L1BA 4QZHA 1MA7A 2ZW0A 4RUCA 3MHZA 2Y9TA 5D6JB 2WXPA 4QAYA 4GFJA 5ALMA 4L23A 1HJPA 4A3PA 2DWQA 4K4IA 2W55A 2WXHA 4YTPB 1L2NA 1QKZA 4DXAB 3H4DA 3DEEA 5F3XB 2FI1A 1HZ6A 1X9WA 1NJXA 3Q3JA 4BWMA 3OG5A 3H0MB 5GTHU 1NK8A 2PJHA 4PYZA 1S0VA 4ACOA 5KAFU 3GV5B 1CUKA 4O3SA 4I2DA 2IGDA 4MEYA 2HHWA 3WIMA 3GE8C 3VCBA 3CNHA 4F5PA 1L7YA 2N1VA 5BOMA 2KVCA 5IA7A 1YNTE 1ZQWA 2KOBA 1JW9D 4IRKA 3AQEA 2K0PA 1P0RA 1VD2A 4QZ9A 4ZHOA 4ZDVA 4WWPA 4MGIE 1IIPA 5TZVA 3CMMB 3ENEA 4K7WA 2RHFA 2RDBC 1C20A 3VH3B 3R2TA 1JWAD 1K50A 3PLUA 5IOIA 3IDWA 2A5UA 1UH6A 4C4RA 5BO4B 3HKZC 4I2BA 3J81j 3WK9A 1PGXA 4WAAA 2K8HA 4RNMA 3UINB 4A3OA 4B6JA 4G50A 1HUZA 4KLLA 3KKAA 2KD1A 3M95A 1S0MA 2MQJA 2NCNA 1FNUA 1WE6A 5AI9A 5KFKA 1SBBB 2L52A 5J0PA 3BIID 4QZBA 2KX0A 1VJ5A 1RM6C 2J0MA 3HILA 2ZIWB 2JF5A 3NY5A 2MA9B 1QOAA 2LGIA 3TARA 2UVRA 1P98A 1DGSA 5TISU 3M9OB 2F76X 1Q8KA 4YG2A 4MF2A 2PE9A 2BCQA 5E6PA 4YVZA 1KKXA 5FP0A 2PKEA 4OO1J 1E10A 2IOFK 4DFPA 3ML9A 1NZBA 4IQUA 2AHOB 3L13A 4B9SA 2WX0A 3PZ7A 1VZ8A 2E1FA 1D5XC 2KK0A 2KWDA 2LMCA 4J9MA 3UQ2A 5CHVC 3C8YA 4Y2SA 3L4PA 1S1QB 2PEAA 1QILA 3PO4A 4BVUC 4OVVA 2MBEA 2VJ5A 3E58A 1FO4A 4W9CA 2K8BB 3ZJTA 4DQPA 4QZGA 5K4LA 4I2JA 5DQGA 2IYDB 3TFSA 2K25A 2EZZA 4C8KA 4KLGA 5I4DA 1KM7A 4IWOA 1STEA 2GMIC 4XC2A 3EZ5A 4IS7A 2MBQA 2HOQA 3DDHA 3A1QB 3L10B 3PMLA 3M8RA 5KT6A 4YSYB 4F4XA 4JLCA 4TUSA 2HJ1A 4Z6FA 4NQKE 3Q8FA 3F2BA 5L9XA 3MHSD 8ICAA 2XY5A 4Q45A 2UU7A 3IAS1 4FE3A 4CF3A 1SL0A 2BB6A 5D2MB 3CF6E 3EHVA 3QNMA 3RAXA 1TY0A 3TI0A 2AQ0A 1ED1A 2WAQF 5AM2A 3SZ2A 4DSJA 2H5XA 4FBUA 1A6SA 5DQIA 1BT0A 4ECVA 3N1XC 2NRVA 3OSNA 2ZUBA 3B2FA 2M56B 3VUWA 3DOWA 4EFOA 5CHFA 4U7CA 3JPTA 3VTVA 5DG9A 1NKCA 2JH1A 3ZDCA 2KZ3A 1YQ3B 2NR2A 2I38A 4UASA 4DOBA 3CIRB 4TQ1A 3GS2A 8ICSA 1V81A 1Z1VA 3TAQA 5DB6A 4UAZA 2QARB 1L0YB 4WJNA 2KDIA 4ITKA 4YMNA 8ICIA 2XNAC 4KGRA 1N5XA 3DHGC 1T3NA 5AKJA 1ZYQA 1R4NI 3WK5A 4F3OA 1T0SC 2QC8A 1CQVA 3T3NA 2XGQA 4I6LB 2V4QA 4AYBF 4P2HA 1E7VA 1DOXA 4W9DA 2XN9C 3QZ7A 4A20A 5DDMA 1QOGA 1C4PA 3CW2C 2PIAA 4QWEA 2KJ5A 4YFKA 4KLEA 2HOIA 3WKBA 3D2QA 3D6JA 2K8BA 2BS3B 3RPFC 3ONSA 4ANWA 4F5NA 2ATLA 2C7MB 2QEJC 2Q5WD 3K4GA 2B0CA 1V9JA 2Z8LA 4IOIE 5KG7A 2JEGA 3PRZA 1QQ5A 8ICVA 1ZQHA 3L16A 2KDEB 5HG2A 3PRMB 5DLFA 1FEZA 2FNJB 5D46A 4LVSA 2KKVA 2W9BB 2P66A 2BS4B 1RXVA 5KHOA 1C1YB 2OCEA 1MG4A 2BKFA 2DYOA 3JYUA 2JWZA 3LVVA 2N9KA 3JW0X 4NAWA 2NRWA 3LDZE 5H92C 2NBUA 4O3NA 2PFPA 4L2YA 2G9HD 4B95A 4FJYA 3AV8A 4LDTD 4DLGA 2KANA 1C9FA 1MHHE 5KFFA 4F5RA 1R4MI 5ALDA 5D94A 3Q8LA 1VJKA 3PX4A 1N6ZA 1IGDA 3RFAA 3FM9A 4DFKA 1OEYA 4XE0A 4NJ8A 9ICBA 3C23A 1N61A 4Y2TA 2YB1A 2N1RA 5AIAA 1LFDA 3M3JA 2WHEA 1P7EA 2ZG6A 4JGHB 4I6NB 3KUDB 2W43A 3JPRA 4MELA 2CHZA 4M2YA 3C5GA 3NGDA 3GIIA 2KNBA 2YEPF 1WWVA 2KDFB 1YT3A 2CU3A 1WX8A 3NZSA 2KHVA 3JPQA 4AS1A 3HIZA 4ECXA 5T14A 1ZQUA 1SF0A 4G11A 1SV0C 3QWZB 5KT5A 3GFKB 1VLBA 2ASLA 7ICOA 2C7NB 2WX1A 1ZQSA 2E6XA 3RR7A 3VHTC 5AM1A 4BAXA 3HT3A 3SENA 2C60A 1C3TA 1L8LA 1PVRA 1HZ5A 2EANA 8ICJA 5AHXA 3C2LA 2OEHA 4KVGB 3RNEC 5IIKA 3WK4A 2KHWB 1SV0A 1JCKB 5KT7A 4KZ0A 2WP9B 1L7OA 2KXJA 2YVCA 1UGJA 4M04A 1HIWA 1BPXA 4QWBA 1ZD3A 4R65A 1XO0A 7ICQA 1QCKA 3KD3A 2JT4B 1QSLA 2ZUDA 4F2RA 3R66C 4HPMB 4JX1C 1NKEA 3T3OA 4UAUA 1V5TA 2MLBA 3X0WA 2KSOB 2QB1A 4PGQA 2FMQA 5KFHA 2NRZA 4MDKE 1XLNA 2FLLA 3RBEA 2JZZA 5LXIB 2P6UA 2ZIUA 1KRPA 4M8MA 3RH5A 2P35A 3TJPA 3DBLI 3ZRCA 5DCNA 2IO1B 1O03A 4C56C 3NG0A 1CEZA 4HROA 2CJNA 4NQLB 5J18A 5ALXA 4EBCA 1OXJA 4GDKA 3M6ZA 3TAPA 4HWIB 2EELA 4O3OA 1KRHA 4DOAA 2QJLA 3BVMA 4DEZA 5JH5C 3NZ3A 2MA1A 4YD1A 1NI3A 1SL1A 3PSIA 1ZQCA 1X2IA 1TJEA 1IYFA 3M1YA 2BPGA 2PFNA 4KLMA 2F3NA 1GB4A 4Z6EA 3V61A 1D3ZA 3U2SC 4JWUC 2IPKD 4HLEA 4BBNF 2ZNVC 2JXTA 7ICHA 1L7NA 5ALQA 1JMLA 4QZFA 3O65B 4WJOA 2KFKB 1JMSA 1F2RC 4RFBA 1Z4OA 1WX9A 1Y8RC 4GLSC 5AK3A 4RGOS 3WANA 4H2AA 5CA7A 3AEAB 4EEKA 5KFMA 1V97A 3AEBB 2M1MA 2OOBB 3V62A 3FAHA 2W9AA 2G08A 1XEEA 3TEWA 4BUGA 1FFVA 1J7AA 3B1LX 4WIPA 1X6IA 3RNFC 5KHQA 1KEJA 2ZNVB 4F1SA 1EUVB 2SAKA 3PREA 4ZRKA 3TSSA 4WH4A 4DQOC 1TAUA 2BCVA 2OJWA 1A77A 3DPDA 1I4XA 2ZXHA 5ALGA 5D3IB 3ZTDA 3P2BA 2G5IB 1ZRMA 4UAWA 3C29A 1FXAA 3FDSA 2FCMA 2XK5A 4G3XB 5FKAC 2AQ2B 1X9SA 2OXOA 4BGDA 4FHJA 1NVID 2ZIUB 4B9VA 3B0YA 2MRLA 2I5HA 4I27A 4E71A 1HQRD 3WK8A 3KYDD 2JMGA 2BPCA 2JYEA 3ED5A 5H8YE 4BZAA 2HHQA 2NPTA 3MJWA 3APFA 2Z0DB 2B3AA 2KZMA 4JMUA 1E9MA 1Z5SB 2F1HA 4DF4A 4HPLB 4FBJB 8ICRA 4CF5A 4CQNA 2PPHA 3V6EB 1AROP 1SXEA 2F8KA 2KQSA 5AK6A 5KFEA 1NYRA 3C21A 1SGHA 2LXCA 2YMPA 4FFDA 5CJ7A 2WF8A 4F4KA 1GG3A 2MBHA 1I42A 2WDRB 4DO9A 3VH4B 3KW5B 5LLIA 1EXNA 2KP7A 5J0SA 3PW4A 1PUTA 5CHWA 2CHWA 1XT9B 2C5LC 3RN9C 2IJ0A 4DXGA 1M94A 2EZXA 1FIQA 5ALHA 4W9EA 2WB1F 2R8GA 3QC8B 4QZDA 2FUG1 1BPYA 2KVSA 2JGAA 3S6JA 3UI3A 1WJUA 2CS4A 3WAMA 3V72A 5TR5A 4MGKE 3M6KA 2IOFA 4ANXA 5KFOA 3EWAA 2MX2A 2KICA 3LVWA 5FR6A 3J9CA 3JPNA 2M19A 8ICPA 1N5WA 1ZXHA 3VQIA 4BWJA 1T4GA 3MC8A 5IAAC 2DGZA 4PYUA 2ZEQA 2MRPA 5CP2A 1WIAA 3Q8QB 4JWSC 3I57A 5JZEB 2N9LA 3HWTA 4CE6A 2LASA 4RM8A 3T5HA 2KN4A 4B9UA 1ZQEA 1FCCC 2UYZB 1FRRA 3TCAA 3I9V1 4RPZA 2K8AA 3WU2U 1JWSD 2LGYA 2XCPA 5KG4A 1XCTL 1HXYD 1QLNA 4QIWC 2WXFA 2JZBB 4CNQA 1H8CA 2RDHA 1TGZB 3PW5A 3MC1A 1YN5A 3PZ8A 4O3PA 5DGBA 3ZJUA 2PMZF 5AKIA 2N7JA 4GXIA 4NAWB 4J03A 3Q3NC 4FXCA 1MFWA 3VR8B 2AH5A 3RH4A 5J2JA 2V4IB 4XQ8A 3NUHB 2L83A 2MBBB 4OVUA 2HOFA 2YMLA 2R8IA 2G4SA 5AM5A 4P7IA 1TK5A 1SJHD 3IAM1 1FXIA 4AJYB 3BINA 1DK2A 1JWUD 5MPOA 4M6WA 5ALFA 7ICLA 2L0TA 5DB7A 1QQRA 4DL3A 1NKBA 2ES6A 4IWPA 3KBBA 3OJSA 5DLGA 1PDXA 1E8XA 2LKYA 4LJPB 3PPAA 4UW9A 2J4XA 2N0SB 4YXDB 4LZDA 2VA8A 1NK5A 2C28A 2JZPA 1K1SA 1L3SA 4XWWA 2BF8B 5DGAA 3P63A 2QCZA 4EZ9A 1F44A 2WXOA 5DBCA 4XDDA 1YX5B 2G4DB 3RNAC 1F2RI 2ESEA 4NLCA 2CXYA 3RZWC 3URYA 2JR5A 4DQQA 4ICUA 1S5LU 2YMQA 2MJ3A 1Q10A 1SZHA 1EF1A 2IO2B 1F9JA 1S77D 4AWJA 2OM6A 5ALUA 2KTQA 3MGIA 2BGWA 2W54A 1JQ4A 5J0RA 3ZDMC 2LYHA 4F91B 3MJ5A 2W9CB 4OJ5A 2O2VB 4M9JA 1NDDA 3AU4A 4RNNA 3IXSA 5FR3A 3VRAB 2F1JA 4IR1A 1M4VA 1WXSA 2ZTDA 5G5HA 4J6IA 1BPZA 3QUTA 4KN7A 2IGGA 3Q8AA 3T9LA 3WAOA 1J0GA 3Q3OC 4UBBA 4Y2UA 1XF5L 3R7QA 1C78A 4ECTA 5AM4A 5AEKB 1XU4A 3TADA 4LNKA 5G2NA 2HBMA 2CRXA 1S76D 3GZNI 3F5EA 4F93B 3K9OB 3BQ0A 2HD5B 2HVHA 4N9F4 2BYTA 2KJ6A 4FO6A 3Q8RB 1FPYA 4W9LA 2HHUA 1V1OA 1V9PA 4Z6CA 4B0MA 1SJED 3KH0A 1Y56A 1WGGA 2K4HA 3KUCB
chains in the Genus database with same CATH topology
1AWDA 2M0AA 4N6EB 1E10A 3HVDA 1NENB 2WXKA 2MEKA 4P6VF 1I4RA 2B76B 2INPE 3PZ7A 1VZ8A 1D5XC 2WS3B 2ZW1A 4HKZE 4KGSA 2KWDA 2LMCA 5TSSA 3C8YA 3L4PA 4HRSA 5C2TB 1QILA 1HEZE 3N9YC 3AEEB 1FO4A 3ZJTA 2FE8A 4NJCA 3DWMA 2H89B 1C4CA 5I4DA 3BVZA 4NZLB 1STEA 1WXQA 2AQ1B 3AE1B 3MC0B 1ESFA 4RGMA 3W2DA 1EWCA 2K3UA 3AE4B 4XDCA 2W82A 5HI1A 1V1PA 1ET6A 4US8A 4YSYB 3ZJVA 1J7BA 3Q8FA 1YJJA 2K5PA 5E6JA 3W5VB 1YN3A 2TSSA 3IAS1 2BB6A 3W9CB 2V3PA 2PKOA 1SE4A 4LTUA 1TY0A 4JE3B 1RYJA 2WU5B 2QSDA 2WXMA 3W5UB 3EUB2 4RGNA 3B2FA 3KWVA 2JSVX 2M56B 2LHEA 1KLGD 5D3DA 3P4RB 3KQ4A 2WXJA 1WGKA 1PFDA 1YQ3B 3CIRB 2I38A 4TQ1A 3GS2A 2NTSA 2IGHA 4OZAA 3U52E 1LO5D 1L0YB 5BYRA 1KLUD 4KKIA 4ITKA 2XNAC 3E9SA 4KGRA 5LNK1 1N5XA 1D5MC 5BMHA 1JALA 1DGJA 4A90A 5AUIA 1P7FA 1ACCA 2LEKA 1ZPSA 3AE3B 1PGAA 1AYFA 1FFUA 3T3NA 1CQVA 3O13A 4YTMB 4MM3B 3RFZB 5G5GA 4MACA 1DOXA 1JRPA 2XN9C 1CZPA 1VRAB 2JU6X 2VZKD 2K22A 4D2KA 1QOGA 4J3OD 1C4PA 1TKYA 2PIAA 1ZP0B 4AQ7A 1GPXA 2QILA 5AUKA 2DLBA 2BS3B 3RPFC 2PMVA 3NVZA 2Y3AA 2QEJC 4OHJA 4YSXB 3VRBB 2Q5WD 3HUIA 2Z8LA 4IOIE 4N59A 2BS2B 3B9JA 2KMMA 3KLSX 5HG2A 5FK9C 1WYGA 4ARCA 1IBXB 4OW0A 1RFKA 3SR6A 1SE3A 1V8CA 2L1AA 4C7YA 3BZDB 4HKQA 1N62A 2V3NA 2BS4B 3EA6A 2HTME 1RWSA 2DYOA 1NYQA 1SE2A 2QIEB 1UWMA 2N9KA 1UUPA 1FD6A 1SIJA 5H92C 1YQ4B 1JWMD 2KQ4X 4L2YA 2G9HD 2RPVA 2Y5PA 3AV8A 2LHDA 2EKIA 1C9FA 1MHHE 1FNWA 2BT6A 2CJOA 2OEDA 3NVWA 2BW2A 1VJKA 2QMTA 3AB5A 4N58A 1IGDA 2Y5CA 4XE0A 1B9RA 4RF1A 2MH7A 1FMAD 3TEXA 1N61A 4M0WA 1IGCA 1OQQA 4A9AA 1P7EA 1WRIA 1T6BX 1BXTA 1YMHE 4ZRPA 1D6EC 1L4DB 1FEHA 3AECB 4Q2JA 3TEYA 1MHXA 4WQMA 1SB3C 2YEPF 4MH8A 2MJDA 2SEBD 2W3RA 4JPSA 1ZE3D 2CU3A 3Q8EA 2G1EA 4AS1A 1TYGB 3HVZA 1SF0A 3P4QB 4YT0B 1R7SA 1VLBA 2JQRB 3FILA 1C4AA 1JROA 3Q8CA 2E6XA 2DBYA 3AEFB 2ICIA 1HZ5A 2E3TA 2H88B 1QOBA 2RDGA 4RH6A 5HFYA 3AN1A 2ACZB 5BYSA 1CJEA 2GRIA 1EWYC 1JCKB 3BK2A 1PGBA 1VZ6A 1XLQA 2WP9B 3AEDB 4A8XC 1TS5A 4USAA 1UGJA 1DOYA 4PT5A 2PLPA 3SFDB 2R61A 1E6EB 1XLOA 4JX1C 2FBWB 1AW7A 3T3OA 4C80A 3FC4A 3AEGB 1KH0A 4REZA 5BYQA 2PVGC 1XXGA 1QLBB 2HDEA 1L6UA 1XLNA 1ZOYB 4UDUC 2WDQB 4A6QA 1DOIA 1TKEA 1N60A 1JWBD 3Q69A 1PYWD 4NAMA 4C56C 2BTEA 3AH7A 1D4BA 4YTNB 4HROA 2CJNA 3P1MA 1I7HA 1I4PA 3R8BA 1XCQL 2PVOD 2EELA 2WXLA 1KRHA 2INNE 4WURA 2QJLA 3BVMA 3NZ3A 2MJEA 2OHFA 3AE6B 1FNVA 3LB8C 1NI3A 4C7ZA 2LFIA 1TJEA 1TS3A 3BK1A 1OFFA 4A55A 2WQYB 3P4SB 3U7ZA 2KACA 3DWGC 1GB4A 1SEBD 1I4HA 1NEKB 3U2SC 1KTKA 1ZXIA 4JWUC 2IPKD 4YWGG 2JXTA 2ONQA 3TEZA 1JMLA 1OQRA 2PW9A 2GB1A 3KWLA 1F2RC 4RFBA 1SXTA 4GLSC 4RGOS 4H2AA 3AEAB 2X38A 1V97A 3AEBB 4HEA1 3FAHA 4GDKB 2IDYA 1TS2A 1TY2A 1XEEA 3V3XA 3TEWA 1FFVA 1J7AA 2AX5A 4RGTA 4WIPA 2WU2B 1BUIC 2SAKA 3R2IA 4XWTA 4ZRQA 2J52A 3TSSA 4EE2A 4IDIA 4WH4A 4DQOC 1XLPA 2WXIA 3GP7A 1I4XA 1SSNA 2KAJA 3SEBA 1L0VB 2W3SA 3ABVB 3AMZA 3AE5B 4TQ0A 3IT6B 5D3IB 1D5ZC 5C3JB 1GB1A 3TUOA 1FXAA 2LJIA 3H8HA 5FKAC 3V05A 4YSZB 2AQ2B 1HA5A 1QF6A 1NVID 1C76A 1B1ZA 4OZBA 1MVKA 5HHDG 2I2YA 3Q8BA 1C77A 1HQRD 4B0EA 4ARIA 3BYTB 2JYEA 5H8YE 1T3QA 1EU4A 3LXFA 1E9MA 1C79A 4CQNA 2PTLA 4WAFA 2JX5A 1ZDXA 5EE1A 1NYRA 3AE8B 4KGTA 1L5PA 3NRZA 4OVZA 2WDRB 3U4EG 1J7CA 1K51A 3BWUD 4MT5A 1PUTA 3AM9A 2J42A 1FRDA 3B2GA 5D7GA 1DYQA 2IJ0A 3CWIA 4DXGA 1FIQA 1L4ZB 4ZYSA 1V1PB 1MI0A 4KX6B 2FUG1 2D5GA 3P42A 3UI3A 3WCQA 1TS4A 2WNMA 4O1NA 4ZHPA 4ZOHC 2K9XA 1ROEA 2WXRA 3AE9B 2WLBA 3J9CA 1A70A 3W1SA 1L0XB 2M19A 1N5WA 1ZXHA 1GOZA 3VQIA 5EE0A 2GI9A 3AE2B 3EGRA 5EE3A 4LK0M 1ET9A 4GDLB 1CK1A 4JWSC 3I57A 2V0GA 2N9LA 3HRDD 3BVGA 2KN4A 2ON8A 1IBXA 3BYYB 1FCCC 3GB1A 1FRRA 4RNAA 1E7PB 1K53A 3I9V1 1L6VA 1JWSD 1KF6B 2RMMA 4KKJA 1EU3A 1XCTL 1HXYD 3ZQ4A 2WXFA 2RDHA 2L32A 2BBCA 2LUMA 3E56A 1FCLA 5JXVA 1EM7A 1TZOA 1N63A 4R3DA 1ZUD2 1YN5A 1BMLC 2DYMA 3MFGA 3PZ8A 3ZJUA 2N7JA 3PO0A 4NAWB 1MPEA 1ZDVA 5T8IA 4FXCA 4P16A 5BMIA 3VR8B 1F0ZA 2V4IB 4WWMA 4L1BA 3NUHB 2L83A 2ZW0A 1ENFA 3MHZA 4RF0A 2WDVB 5EE9A 4OZCA 2WXPA 2KDMA 1SJHD 1FXIA 3IAM1 1WWTA 1JWUD 2YEPB 5MPOA 1QQRA 4L23A 4RCOA 2DWQA 1PDXA 3IT4B 2W55A 2WXHA 2NMQA 3MP9A 1VR9A 1QKZA 4YTPB 2J53A 1WSPA 2J4XA 1HZ6A 2N0SB 2NTTA 4YXDB 1IUEA 2JZPA 1GAQB 4DXFA 1XO3A 4XWWA 2BB5A 3P63A 3LYYA 2WXOA 3ZGZA 2IGDA 1FM0D 1QT9A 4XDDA 1F2RI 1AN8A 3URYA 3NVYA 1YNTE 5BMGA 1JW9D 2K0PA 5GXGB 4LLGM 4ZHOA 2MJ3A 1Q10A 1K52A 3P4PB 1VZ7A 3FILB 4IKGA 1UNSA 1KFYB 4US9A 2JYTA 3R2TA 4HJGE 1JWAD 1K50A 2W54A 1UWXA 1JQ4A 1T5XD 1PGXA 3NVVA 2WXGA 3MJ5A 5FR3A 1TKGA 2WXNA 3IXSA 3VRAB 4TSSA 1YJIA 1M4VA 1E0ZA 3VR9B 5G5HA 1QOFA 1YN4A 2JWUA 3ZYYX 2IGGA 3ETRA 3Q8AA 1FNUA 3AE7B 2VZKB 4TMAB 1SBBB 1XF5L 2L52A 1VDVA 1C78A 3BIID 1I4QA 1RM6C 2WXQA 2AQ3B 1I4GA 3SFEB 1QOAA 2LGIA 3OWEB 2BYTA 1F77A 1V1OA 4B0MA 1SJED 3NS1A 1Y56A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIJ A;  3HRD D;  1AWD A;  1OFF A;  2WQY B;  3P4S B;  4N6E B;  5H92 C;  3DWG C;  1NEN B;  1YQ4 B;  1E10 A;  4P6V F;  2B76 B;  1NEK B;  1FRR A;  1ZXI A;  1E7P B;  4JWU C;  3AV8 A;  1L6V A;  2EKI A;  1KF6 B;  2WS3 B;  1OQR A;  2BT6 A;  2CJO A;  3L4P A;  3KWL A;  3NVW A;  4HRS A;  5C2T B;  1VJK A;  3AB5 A;  3AEE B;  4N58 A;  1FO4 A;  1N63 A;  2Y5C A;  1ZUD 2;  1B9R A;  3AEA B;  2MH7 A;  1FMA D;  1V97 A;  3AEB B;  3DWM A;  1N61 A;  3FAH A;  1OQQ A;  2H89 B;  4A9A A;  3PO0 A;  4FXC A;  1FFV A;  1J7A A;  2AX5 A;  3VR8 B;  1WRI A;  4WWM A;  1F0Z A;  1WXQ A;  3AE1 B;  2WU2 B;  2L83 A;  2WDV B;  4IDI A;  5EE9 A;  3AE4 B;  3AEC B;  4YSY B;  4US8 A;  1FXI A;  1XLP A;  4WQM A;  1J7B A;  1WWT A;  1SB3 C;  5MPO A;  1YJJ A;  2K5P A;  2KAJ A;  1L0V B;  2W3S A;  3W5V B;  3ABV B;  3AMZ A;  2MJD A;  3AE5 B;  2W3R A;  3W9C B;  2CU3 A;  2PKO A;  2DWQ A;  1PDX A;  5C3J B;  2W55 A;  4LTU A;  1FXA A;  4YTP B;  1RYJ A;  2WU5 B;  4YSZ B;  2G1E A;  1QF6 A;  1NVI D;  2N0S B;  3W5U B;  1TYG B;  3HVZ A;  3EUB 2;  1SF0 A;  3P4Q B;  1IUE A;  4YXD B;  4YT0 B;  1GAQ B;  1R7S A;  3B2F A;  1VLB A;  1XO3 A;  2M56 B;  2JQR B;  1JRO A;  3AEF B;  2DBY A;  3P63 A;  5H8Y E;  1T3Q A;  3P4R B;  1FM0 D;  1QT9 A;  1WGK A;  1PFD A;  1YQ3 B;  2E3T A;  2H88 B;  3CIR B;  3LXF A;  1QOB A;  1E9M A;  3NVY A;  1JW9 D;  3AN1 A;  2ACZ B;  4ITK A;  5GXG B;  4ZHO A;  1N5X A;  1CJE A;  2MJ3 A;  1JAL A;  1DGJ A;  1EWY C;  2JX5 A;  3P4P B;  1XLQ A;  2WP9 B;  1NYR A;  3AED B;  5EE1 A;  3AE8 B;  2LEK A;  5AUI A;  1L5P A;  1KFY B;  4USA A;  4US9 A;  1AYF A;  1FFU A;  3AE3 B;  3NRZ A;  4YTM B;  1JWA D;  1DOY A;  5G5G A;  2W54 A;  3SFD B;  1DOX A;  2WDR B;  1JRP A;  1J7C A;  1E6E B;  1JQ4 A;  1XLO A;  1PUT A;  4JX1 C;  1CZP A;  3AM9 A;  2FBW B;  3NVV A;  1FRD A;  2K22 A;  3B2G A;  4C80 A;  1QOG A;  3FC4 A;  1TKG A;  3AEG B;  1TKY A;  2PIA A;  3CWI A;  3VRA B;  1ZP0 B;  1FIQ A;  1YJI A;  2PVG C;  1QLB B;  1GPX A;  1L6U A;  1XLN A;  1ZOY B;  3VR9 B;  5AUK A;  5G5H A;  2WDQ B;  3RPF C;  2BS3 B;  4KX6 B;  1QOF A;  1DOI A;  1TKE A;  3NVZ A;  3ZYY X;  3ETR A;  3VRB B;  2Q5W D;  4YSX B;  3AE7 B;  1N60 A;  1JWB D;  3HUI A;  4N59 A;  2L52 A;  2BS2 B;  3WCQ A;  1VDV A;  3B9J A;  2KMM A;  3AH7 A;  4ZHP A;  3BII D;  4YTN B;  4HRO A;  4ZOH C;  2CJN A;  2K9X A;  1RM6 C;  1WYG A;  1ROE A;  3P1M A;  1I7H A;  1E0Z A;  3AE9 B;  1RFK A;  2WLB A;  3SFE B;  1A70 A;  1QOA A;  2PVO D;  1KRH A;  3SR6 A;  2M19 A;  1V8C A;  2QJL A;  4C7Y A;  1N5W A;  1N62 A;  2BS4 B;  2MJE A;  2HTM E;  2OHF A;  5EE0 A;  3AE6 B;  3AE2 B;  3LB8 C;  5EE3 A;  1NI3 A;  1RWS A;  4C7Z A;  1NYQ A;  3NS1 A;  1TJE A;  2QIE B;  1UWM A;  4JWS C; 
#chains in the Genus database with same CATH topology
 3HKZ F;  1QH9 A;  2MSN A;  1AWD A;  3QU5 A;  2M0A A;  3TAD C;  2CU1 A;  4N6E B;  1NEN B;  2NV3 A;  1I4R A;  4KSK C;  1X6J A;  4IL6 U;  1T8E A;  4OD0 A;  3MFH A;  4BDP A;  4KGS A;  4W9J A;  3WKD A;  4CGZ A;  2P6R A;  4HRS A;  1X1M A;  2LVP A;  1QZE A;  3AEE B;  2IMW P;  5ALI A;  1SZP A;  2IY1 B;  3OAW A;  1UPH A;  3Q8P B;  2H89 B;  4O3R A;  3PV8 A;  1KFD A;  3OJ3 A;  1C4C A;  2LVQ A;  9ICF A;  3BVZ A;  4NZL B;  4W9F A;  2FCN A;  4YMM A;  2AQ1 B;  3AE1 B;  2L0F A;  1ESF A;  4NM1 A;  5KT4 A;  2EZY A;  3W2D A;  1EWC A;  3ZRF A;  4FZL A;  5AKX A;  5KFD A;  3UMB A;  3TIX A;  3BQ7 A;  3T5L A;  1S10 A;  4XDC A;  5HI1 A;  3DV9 A;  4NLN A;  2LGX A;  4US8 A;  1UQV A;  1J7B A;  2KKC A;  4HJK A;  1EF5 A;  4RQ8 A;  5E6J A;  3W5V B;  2ISO A;  4RPX A;  4I28 A;  2V3P A;  5ALO A;  3ECI A;  4JE3 B;  4FZN A;  4B9M A;  2WU5 B;  3A4S C;  3MR3 A;  1ZQO A;  3QX1 A;  1RYR A;  2ZJA A;  4I2F A;  3EUB 2;  1RLF A;  8ICB A;  4RGN A;  3LWM A;  1T0R C;  3HM3 A;  4GC7 A;  3VC8 A;  1M6Y A;  2MU2 A;  2NO4 A;  1WMH A;  5J2E A;  1SXD A;  4NM2 A;  4RQN A;  2XGP A;  5CWR A;  4J9Q A;  3P4R B;  3PV1 A;  5D3D A;  2CHX A;  2IOH A;  4DSK A;  4E0D A;  4DWF A;  2NRX A;  3QUC A;  4F8R A;  4OZA A;  8ICM A;  2RDJ A;  1ZQX A;  3PX0 A;  1WM2 A;  4DQI A;  4KKI A;  3E9S A;  3DBR I;  5CEH A;  4J9P A;  4YL8 A;  3UM9 A;  2W9N A;  3RJH A;  5AUI A;  1P7F A;  2FIF A;  2LEK A;  3AE3 B;  3UGB B;  4CRX A;  1PGA A;  1FFU A;  5JTI A;  3CST A;  1SKS A;  4NJ6 A;  3U7D A;  4MM3 B;  4B9T A;  5G5G A;  3ML8 A;  3VAW A;  4YTM B;  3D32 A;  1JRP A;  3MGV A;  4M8N A;  4TUU A;  3TKA A;  2DF4 B;  2XY7 A;  1F52 A;  1C7Y A;  2UVW A;  3H1U A;  9ICA A;  2VZK D;  2K22 A;  4DSE A;  4J3O D;  3DBH B;  1WJ4 A;  2KFZ A;  3MR2 A;  1ZP0 B;  4KMU A;  2KJR A;  4FAD A;  2QIL A;  2PXI A;  4B9L A;  4KIK B;  5J0O A;  2BPS A;  2DLB A;  2LRW A;  2C7H A;  3NVZ A;  4NXZ A;  2Y3A A;  4NL9 C;  3SAH A;  4ED3 A;  3HUI A;  2BS2 B;  5HHH A;  5AKH A;  3UXN A;  1R4N B;  1WYG A;  3K1Z A;  3M63 B;  4M6W B;  1Q0W B;  4RPY A;  4ARC A;  1IBX B;  4RT2 A;  2J0K A;  2KEY A;  4OJO A;  3QAQ A;  4HKQ A;  2JXX A;  2L1A A;  4C7Y A;  9ICL A;  4ICA A;  2YTU A;  3QYP A;  5KT3 A;  2A1A A;  3RJI A;  1PQS A;  2HTM E;  2I1K A;  1RWS A;  4ECZ A;  4RQM A;  1NYQ A;  1SE2 A;  1FXT B;  1UUP A;  2DAJ A;  2LXA A;  3DVN V;  1JWM D;  4YD2 A;  2LHD A;  5AI4 A;  4QWD A;  4KV2 A;  1T94 A;  4F8C B;  4JK1 A;  2L8J A;  4ECR A;  2IHM A;  3WA0 A;  3I63 C;  2YY6 A;  1GNU A;  4PS3 A;  2VKQ A;  2BW2 A;  2QMT A;  2R2Q A;  5III A;  4N58 A;  2Y1J A;  1RQL A;  1WI0 A;  1WJN A;  4EKU A;  4JV0 A;  2Y5C A;  1NK4 A;  4I2E A;  2FMP A;  1IM4 A;  3MFI A;  3MC9 A;  3TEX A;  2J0J A;  4M0W A;  3RB0 A;  3UIO B;  3GIJ A;  3LWL A;  3VTW A;  4MGZ E;  1TFR A;  3Q14 C;  1BXT A;  4DLE A;  4ZRP A;  3U30 A;  2BDP A;  2NBV B;  3ORY A;  1L4D B;  1FEH A;  4JWN A;  4Q2J A;  3TEY A;  2G07 A;  1PUZ A;  4UB8 U;  3T3F A;  2E8M A;  1MHX A;  1SB3 C;  1RYS A;  3PSF A;  2FPK A;  2W03 A;  2MJD A;  3UQ0 A;  1ZE3 D;  2AQ4 A;  9ICQ A;  5IKC M;  4AUQ C;  1WYW B;  4CCH A;  3RJK A;  3P4Q B;  4EBD A;  1Y88 A;  2KSO A;  5AI5 A;  4KLQ A;  4YT0 B;  2YMM A;  2REX A;  9ICX A;  1T7P A;  3PSP A;  3FIL A;  1GO3 F;  3Q8C A;  1JRO A;  2OWO A;  4HXD A;  3AEF B;  2QB0 A;  4DL5 A;  4MH0 E;  2ICI A;  4DS5 A;  4MSM B;  2W9B A;  2H88 B;  4PZO A;  1WZ0 A;  1QOB A;  4RH6 A;  4K3C A;  1K1Q A;  1ZQJ A;  2E1E A;  3AQF A;  4RQ7 A;  4M02 A;  3AN1 A;  3UXP A;  1X9M A;  2ACZ B;  3M7D A;  3BK2 A;  2WF6 A;  1PGB A;  2YX8 A;  3ZD9 A;  2XI9 A;  1LB2 B;  2I6X A;  1LM8 B;  1TS5 A;  4USA A;  9ICN A;  2EAO A;  3CP8 A;  4Z6D A;  4II2 B;  4M9N A;  2D8C A;  4F5O A;  3AI5 A;  3WK7 A;  2N1W A;  4Y2Q A;  2FBW B;  3PR5 B;  2KMD A;  3QEB Z;  3PHW B;  4IRD A;  4JV1 A;  1KH0 A;  3AEG B;  1NJW A;  1V5O A;  2ZCC A;  3RAQ A;  1QLB B;  2VA3 A;  3QXG A;  1ZOY B;  1IP9 A;  4A6Q A;  2G0A A;  3EW9 A;  1DOI A;  2D3G A;  4XZ4 A;  3TFR A;  1V38 A;  2KFK A;  1N60 A;  1JWB D;  3Q69 A;  5G55 A;  4OCZ A;  3MR5 A;  3GZN B;  2BTE A;  2O6K A;  3AH7 A;  1D4B A;  4IC9 A;  5L1M A;  4NY8 A;  4G0N B;  1I7H A;  2ASQ A;  1UHU A;  1I4P A;  3R8B A;  4YR3 A;  3GZF A;  2INN E;  1KLN A;  4DL2 A;  4UQG A;  5GTI U;  5J8Y A;  5ALE A;  3BY4 B;  2EAP A;  4KLD A;  2OHF A;  5IIJ A;  9ICK A;  4KLJ A;  1FNV A;  2KWC A;  3LB8 C;  2CPR A;  4KZC A;  4C7Z A;  5IN7 A;  2H3Z A;  1UT5 A;  3MBY A;  4A55 A;  3BK1 A;  2WQY B;  3U7Z A;  2AGO A;  4UAR A;  5DG8 A;  3GU3 A;  3SI8 A;  2HDO A;  1NEK B;  2I1J A;  2DKZ A;  2ODG A;  1BPB A;  3NJT A;  5J8Y C;  2W04 A;  4KLT A;  2DUY A;  4IQW A;  1J97 A;  3AL0 B;  3KWL A;  1TAM A;  3UQA A;  2LHT A;  3W1S C;  3RR8 A;  1ZQK A;  2UWQ A;  4KLO A;  2X38 A;  3ZW3 A;  3IHQ B;  1ZQM A;  3V3X A;  3GV8 B;  1X40 A;  5J0T A;  5KFW A;  3ZDD A;  3PMN A;  1UA0 A;  2WU2 B;  2KO3 A;  1ECW A;  4ED0 A;  9ICG A;  4GXB A;  4DL7 A;  4XWT A;  4ZRQ A;  2ZXI A;  2JEF A;  2GBK A;  2H3I A;  1KOT A;  4DSL A;  4IDI A;  3BZC A;  4P0Q A;  2XC9 A;  4ED6 A;  1QSS A;  1XLP A;  1HE8 A;  1ZJM A;  2LZ6 A;  8ICU A;  3L08 A;  1SSN A;  1L0V B;  3MTN B;  4TQ0 A;  1URJ A;  4ED7 A;  5C3J B;  1KTQ A;  9ICE A;  2KYW A;  4YSZ B;  5EOZ A;  5IIO A;  3SV3 A;  2GH1 A;  5J0Q A;  5J29 A;  4RQ4 A;  1HA5 A;  4UB3 A;  4O3Q A;  1B1Z A;  1JI7 A;  3QEA Z;  1MVK A;  1SIF A;  2XY6 A;  4OZB A;  4IM2 A;  2ZVO A;  1KL9 A;  1EO6 A;  2R8J A;  4ARI A;  4I6P A;  2KTR B;  2ZJ5 A;  1EU4 A;  4PGX A;  3A33 B;  3LXF A;  3APC A;  2IO3 B;  2LI5 A;  2HI0 A;  4MJS A;  5BOL A;  3GIL A;  4KN4 A;  3OLM D;  1F5S A;  2LMR A;  8ICF A;  3A9K B;  4KLI A;  2IBI B;  3AUL A;  4GN1 A;  3U8Z A;  2PTL A;  3UMC A;  1XO1 A;  3KTQ A;  3V6K A;  3ZDB A;  2JX5 A;  2R2O A;  5EE1 A;  2WF9 A;  2GOW A;  2J6S A;  4KLH A;  4Y2X A;  3PTF C;  3M8S A;  4KGT A;  3ZKJ C;  2FPL A;  4UB2 A;  4HCP B;  3NRZ A;  5KFY A;  2D3C A;  5E79 U;  5DBA A;  4OVZ A;  2ZIX B;  5EDS A;  1J7C A;  4ZH4 A;  1K51 A;  2FCQ A;  3BWU D;  3H4B A;  2CR5 A;  3B2G A;  2GBR A;  4NLZ A;  3B0A A;  4BKS A;  4DF8 A;  1DYQ A;  2Y9U A;  3R9K A;  3DBS A;  5HR7 A;  1L4Z B;  1V1P B;  3U26 A;  7ICT A;  4U6P A;  2MBO A;  4OJL A;  3P42 A;  1RXW A;  1V49 A;  3ISC A;  3WCQ A;  3Q8S B;  1TS4 A;  5DG7 A;  1XD3 B;  1N48 A;  4ECU A;  4DS4 A;  1ROE A;  8ICN A;  5KL8 B;  4Y2J A;  1ZD2 P;  2H3V A;  5KFJ A;  1T0Y A;  1V80 A;  5JHA A;  1A70 A;  1L0X B;  4QZE A;  4YR0 A;  5KFA A;  1NZP A;  1N56 A;  3RJJ A;  3TAN A;  1YOV B;  2JPH A;  5EE3 A;  4ICV A;  3RH6 A;  4GDL B;  1N2X A;  1CK1 A;  5AZG A;  2W7P A;  8ICH A;  5AK4 A;  4JV2 A;  2KTF A;  2C2E A;  2ZPY A;  3BYY B;  1E7P B;  3GB1 A;  2OYY A;  4PS8 A;  4HDQ A;  4RNA A;  2R8K A;  3BS5 A;  5IIL A;  1WH3 A;  3NHE B;  2LGS A;  2RMM A;  2RP5 A;  1WXM A;  4JL9 A;  2HTH A;  3ZQ4 A;  4HYK A;  5F9L A;  2L32 A;  5JUM A;  2BBC A;  1IXR A;  3BDP A;  2DL0 A;  2CN1 A;  9ICR A;  3VUX A;  2HJ8 A;  5KFL A;  3C0R B;  2BQQ A;  2N4F A;  3SD7 A;  4QWC A;  2AL6 A;  4JWM A;  1ZDV A;  1MN8 A;  3IM1 A;  4RQ5 A;  5BMI A;  5J2K A;  3RF9 A;  4WWM A;  4C4V B;  5ALR A;  1NK9 A;  2E8N A;  3RZF A;  4C0Z A;  1F1H A;  4P1B C;  3PZP A;  2LYA A;  4IR9 A;  4RF0 A;  1K5O A;  5EE9 A;  2AGP A;  4OZC A;  4QZI A;  5DQH A;  3QCA A;  2YEP B;  3OSP A;  1RG6 A;  9ICU A;  3DHH C;  3KZI U;  4I29 A;  3KHR A;  2EKE C;  5J2H A;  1QQ7 A;  4TUR A;  3ISD A;  4RCO A;  2QAR A;  3IT4 B;  4IQV A;  2NMQ A;  1IV8 A;  2E8P A;  3MP9 A;  3PSE B;  4QZ8 A;  4W9K A;  1TE2 A;  2RRD A;  1WSP A;  3L54 A;  5L1K A;  3UF8 A;  2NTT A;  3DVG X;  1IG6 A;  1GAQ B;  2BKE A;  4IW0 A;  1BNP A;  2BB5 A;  3I5J C;  1TT5 B;  3LYY A;  4F2S A;  2HHV A;  4KSL C;  1L3V A;  2BWF A;  4LNF A;  4RQ2 A;  1FM0 D;  3N7S C;  1QT9 A;  2LWP A;  2MP2 B;  4S0R A;  3LJ3 A;  5J2A A;  2ZTC A;  5KG1 A;  4DL6 A;  2BR0 A;  2KDB A;  2D3A A;  1WCL A;  5BMG A;  1SKR A;  4LLG M;  1QF6 A;  5H2F U;  3P4P B;  5AI8 A;  1VZ7 A;  3A4R A;  1UNS A;  3TQ1 A;  5KL1 B;  2C22 A;  1KFY B;  3HK0 A;  5J2B A;  4HJG E;  1XS9 D;  2XCA A;  5F9N A;  2K8C A;  4YMO A;  1SV4 A;  1SGG A;  1UWX A;  1L7M A;  2BPF A;  9ICS A;  1XSN A;  3H0L B;  2QB0 B;  1T5X D;  1PZN A;  3JPS A;  5AM3 A;  1B22 A;  1Q46 A;  5KG6 A;  1NI2 A;  2GBM A;  2KN5 A;  3OJU A;  2WXG A;  4AJW A;  2LI6 A;  1JRU A;  2K4E A;  2J6T A;  1E0Z A;  1JX4 A;  2A4Z A;  4Y2P A;  2DPI A;  1QOF A;  1YN4 A;  2JWU A;  2G3Q B;  3B0X A;  3L17 A;  3ZYY X;  1G6J A;  3AE7 B;  1QSY A;  2VZK B;  4TMA B;  4QJF B;  3RI7 C;  2FLN A;  1LKY B;  2H3F A;  2K1F A;  1I4G A;  2KX3 A;  1HUO A;  4EYH B;  2AXT U;  4DHJ D;  3WKC A;  3SAF A;  1P9D U;  2DNF A;  3OWE B;  3T5J A;  7ICK A;  3QK0 A;  2FLP A;  2KWV B;  1CMX B;  3DVN U;  1WM3 A;  3SEI A;  1A0P A;  1ZQD A;  3K9P B;  1HEK A;  4EBE A;  5DPW A;  4LJX A;  3A0B U;  4Q8E A;  4P6V F;  2INP E;  2K39 A;  4HAI A;  2HW3 A;  2O6V A;  2Z59 B;  2ZW1 A;  4P4M A;  4HKZ E;  2GLS A;  2EQY A;  2B6G A;  1L7P A;  3V7J A;  1KLV A;  5JU5 A;  2WF5 A;  3OHA A;  3DWM A;  3IHP C;  4DHZ E;  1RQN A;  1NK6 A;  1X66 A;  4QNL A;  1D8Y A;  4KTQ A;  5AI0 A;  2KZR A;  3ZDE A;  7ICF A;  5DKW A;  2ZJD A;  2HBL A;  5C0Y A;  4RGM A;  1TBE A;  4M0W B;  4PHD A;  3PY8 A;  2K8C B;  4B9K A;  5KG5 A;  4TQS A;  3KOO A;  3GDX A;  4URK A;  3AE4 B;  2W82 A;  1V1P A;  1ET6 A;  3ZJV A;  3MGH A;  1XNS A;  5AZH A;  2K5P A;  3FKY A;  1YN3 A;  2FUH B;  1UEL A;  2TSS A;  4LNO A;  1BNO A;  4M01 A;  3ALR A;  3W9C B;  2W9C A;  1WFY A;  2PKO A;  1GC6 A;  4UAT A;  3F2C A;  1V2Y A;  3JPO A;  4KX5 A;  2NO5 A;  2QKQ A;  2ZIV A;  4C8M A;  2XEW A;  2F8L A;  2WWZ A;  2VA2 A;  2VRR B;  5AKE A;  4O3M A;  3H7P B;  9ICO A;  1LKY A;  4B9N A;  1GC7 A;  4R8U B;  2KG5 A;  4GXJ A;  5CRX A;  1H38 A;  1KLG D;  3SU8 X;  5DB9 A;  3DVG Y;  1WGK A;  3RB3 A;  1ZQQ A;  1RYU A;  5HML A;  2IGH A;  3U52 E;  1LO5 D;  2HBJ A;  3ZTC A;  9ICP A;  3JVZ X;  4EUT A;  1J19 A;  3L3F X;  1UBI A;  4EEL A;  2G06 A;  1DGJ A;  2DZM A;  4ZYN A;  5BMH A;  1TTN A;  4A90 A;  2L05 A;  1ACC A;  1ZPS A;  1KSP A;  2Y5B B;  1AYF A;  4PL1 A;  2FMS A;  3QE9 Y;  4UB6 U;  2XO7 A;  2VAN A;  1YD8 U;  5AKL A;  2DPJ A;  8ICC A;  2KTR A;  3N7P D;  2M4N A;  4R63 A;  5KG0 A;  3OHB A;  2YN4 A;  4P4P A;  5CR0 A;  4AQ7 A;  3APD A;  4NV0 A;  7ICR A;  3NZU A;  2PMV A;  1TAQ A;  1ZQB A;  4OHJ A;  5AZF A;  5IIM A;  3M9N B;  3VRB B;  2MUT A;  1NBF C;  3SAG A;  4EX6 A;  4FS1 A;  3KLS X;  4EYI B;  4X57 B;  5KTQ A;  5FK9 C;  2FDR A;  1OEY J;  2IZV B;  5HR6 A;  4E3C A;  1KW4 A;  1K8R B;  3IN5 A;  5ALK A;  3BZD B;  2F1I A;  4J9K A;  1N62 A;  2V3N A;  3EA6 A;  2C9W B;  4EEN A;  2QIE B;  1FD6 A;  4KDL B;  2M9N A;  2RD0 A;  4WQO B;  5IO9 A;  4WWN A;  4E74 A;  4FLH A;  3MAB A;  3Q2A C;  3RD2 A;  4WJ3 B;  2L00 B;  2VH2 A;  1FNW A;  2BT6 A;  2CJO A;  1S8O A;  4Q8F A;  4ZRJ A;  4AP9 A;  4QW9 A;  2BWE S;  4YXJ A;  2HVI A;  1TV9 A;  3V7L A;  1J2N A;  2ZIX A;  1B9R A;  2Y0S F;  4OJ6 A;  5ALS A;  2MH7 A;  5HMM A;  3DDC B;  2KJ9 A;  1YIW A;  4A9A A;  1S9F A;  1ZQT A;  2JRI B;  2LYB A;  4C00 A;  2G09 A;  5DPS A;  4K81 A;  1WRI A;  1UF0 A;  1WUD A;  3K1R B;  4IRC A;  2D11 A;  2WYQ A;  2J7Q B;  3TL5 A;  3GIM A;  2INC C;  1ZQ1 C;  1YX6 B;  1ZOL A;  1D6E C;  4P1C C;  2D3D A;  3N1Y C;  5A0L A;  3AEC B;  4EEY A;  2MWS B;  2JH7 A;  4I2I A;  1RZT A;  1WWU A;  4XRH A;  4MH8 A;  1PK1 B;  4C4T A;  3BZK A;  2KFJ A;  2KLC A;  1ZRN A;  2PFO A;  4PH5 A;  3PW2 A;  1A76 A;  1PVQ A;  2SEB D;  2LD9 A;  2W9M A;  3Q8E A;  1WCN A;  5KAI U;  5ALJ A;  4NLK A;  2EMT A;  3QU4 A;  2G1E A;  4KIK A;  3WKA A;  3HVZ A;  3BJY A;  1U47 A;  1I35 A;  4GXK A;  1C4A A;  1WGR A;  2KMA A;  4JB3 A;  1SE9 A;  3Q8K A;  4GU2 A;  2KQ7 A;  3ZNI D;  5AKZ A;  3QHT A;  2N9E B;  2E3T A;  2JRZ A;  2ZJ8 A;  3H8M A;  2RDG A;  3H8J A;  5KFQ A;  1KJT A;  5AM0 A;  2KT7 A;  2KC2 A;  2XBB C;  4NL9 A;  5DPR A;  2ZVN A;  5HFY A;  5KNI A;  1YJ1 A;  3M9M B;  5J2G A;  5BYS A;  2GRI A;  5KFI A;  5KFS A;  4KLU A;  1XLQ A;  3AED B;  1WR6 E;  4KLF A;  3N32 A;  1B43 A;  4AOF A;  1DOY A;  3C1Z A;  3T5K A;  3SFD B;  4M9H A;  3R3M A;  1E6E B;  1YQB A;  3ETL A;  1E8W A;  1XLO A;  3H8S A;  3QAR A;  3KVF B;  4QW8 A;  4C80 A;  4UBC A;  2BQU A;  1MSW D;  4JUZ A;  8ICY A;  4R64 A;  3HHM A;  2PVG C;  5ALW A;  1U4B A;  1XXG A;  4R66 A;  4KX3 A;  4BJQ A;  3BQT A;  4JIO U;  1S0N A;  2WF7 A;  1OUQ A;  2ZCB A;  4EOY A;  3KHL A;  4K3B A;  1PYW D;  1ZQN A;  4XYC A;  4UB4 A;  5J2D A;  2QLT A;  3RYT A;  1ISN A;  1L6N A;  4QWA A;  4UB1 A;  1S3S G;  3P1M A;  1ZQZ A;  3SV4 A;  1TIF A;  1ZD4 A;  4Y2Y A;  2LVO A;  4ELU A;  3QU2 A;  5ALV A;  4KLS A;  2NBW B;  3K75 D;  5ALZ A;  2HHX A;  2ALZ A;  2MJE A;  2L5Y A;  2MAX A;  3ZNZ B;  3AEV A;  1PK1 A;  3F53 A;  2ASJ A;  1SWV A;  2EDU A;  1B4F A;  1BVS A;  2LFI A;  1ZQR A;  5CB1 A;  4I2A A;  7ICE A;  3I28 A;  2NRT A;  1OFF A;  1TS3 A;  3EFU A;  4F4Z A;  3DWG C;  3PHX B;  2KFN A;  1RDF A;  4DHZ B;  1I4H A;  4Q44 A;  1ZXI A;  4YQW A;  2D3B A;  3HP6 A;  2UVV A;  3GV7 B;  1MJD A;  2MSE D;  3IG3 A;  2XK5 B;  2ONQ A;  3TEZ A;  1ZKH A;  3SDL C;  4GMV A;  1D8B A;  3CSF A;  1SXT A;  3BS5 B;  3PNC A;  4P0P A;  4LCD E;  2IY0 B;  1COK A;  1TS2 A;  2IDY A;  5DBB A;  1YZ6 A;  2QDF A;  2BHN A;  2AX5 A;  2BQ3 A;  2HBK A;  1WGY A;  2KVR A;  3MDA A;  2BCR A;  2KC1 A;  4RGT A;  2BCU A;  3VTU A;  4KIT B;  4PHA A;  1Q5W B;  3QIJ A;  4QIW F;  2NS5 A;  4PS7 A;  1BUI C;  3RB6 A;  2FE9 A;  3NRW A;  3T79 A;  4C4V A;  1L3T A;  3GP7 A;  4Q43 A;  1SKW A;  3SEB A;  2NVU I;  2K4P A;  3RUL A;  3AE5 B;  1D5Z C;  3QUB A;  4CDG A;  4HK2 A;  3TUO A;  4BKS D;  3D2N A;  2LJI A;  3H8H A;  2DX5 B;  3JSV B;  3L5K A;  2GOL A;  3TAC B;  5B5E U;  3JSV A;  3ZIM A;  5BPC A;  5L1J A;  2O2V A;  4NLB A;  3Q8B A;  3ZDT A;  4B0E A;  1ZQG A;  3VDZ A;  3BYT B;  1BPE A;  2V4L A;  1HTQ A;  4J9O A;  1KFT A;  1UBQ A;  4MJS B;  3QU7 A;  3ZGZ A;  4HVB A;  3Q8M A;  2HCF A;  3RNG C;  3AE8 B;  1L5P A;  3F2D A;  4IM0 A;  3ZO5 B;  5C1Z A;  3U4E G;  3IG8 A;  2VH1 A;  4IUM B;  4MT5 A;  4M0A A;  3UPQ A;  2Z0E B;  3AM9 A;  5KFR A;  2J42 A;  2R18 A;  1FRD A;  7ICS A;  4F4Y A;  4TUP A;  3A9J B;  1VCB A;  5D7G A;  5IP4 D;  3CWI A;  4O5K A;  3A9J A;  5J0Y A;  2MHJ A;  1U49 A;  3GOE A;  4MFA A;  3C28 A;  2V4R A;  2ISP A;  2AJQ A;  3C2K A;  2BGF A;  4YXM A;  5AKY A;  2KMC A;  2MCN B;  3HX0 A;  3EEC A;  4MM3 A;  3AXC A;  5E6N A;  2C2R A;  1PK3 A;  2VJ4 A;  3H7S A;  3EPI A;  4DHJ B;  4IM3 A;  4DL4 A;  4DBG A;  4W9I A;  1HTO A;  2K9X A;  3ALB A;  2N7D A;  5AI6 A;  2WXR A;  3OPX A;  4LDT B;  2WLB A;  4K4H A;  2E5S A;  3W1S A;  3H40 A;  2LM4 A;  2KWU B;  9ICV A;  1TK8 A;  1RPL A;  4FJV B;  5EE0 A;  3EFC A;  1RFA A;  2Y1I A;  4R8U A;  1NK7 A;  2YB4 A;  1E8Y A;  5JHB A;  2OJR A;  3LK9 A;  3HRD D;  4YP3 A;  1WZ3 A;  3KKA C;  4LNN A;  4LZG A;  3PR4 A;  3KHH A;  3A1Q A;  2ON8 A;  4PGY A;  2C2D A;  5KFX A;  2RR9 A;  1IBX A;  4EZ6 A;  1K53 A;  2JEI A;  1WR1 A;  4RQ1 A;  1L6V A;  4I2C A;  3F5A A;  1ZGU B;  1KN5 A;  1KF6 B;  4DFD A;  4CF4 A;  1AAR A;  1UCV A;  1EU3 A;  1JXE A;  2LUM A;  3E56 A;  1FCL A;  2O6V B;  5JXV A;  1LXD A;  4R3D A;  1ZUD 2;  2D2Q A;  2DZI A;  3N20 C;  1GJZ A;  2DYM A;  3MFG A;  3H0R B;  3PVL A;  4MGY E;  2I9G A;  1MPE A;  4XUS A;  4Y2V A;  3RJF A;  3VFK A;  1Z3E B;  1TK0 A;  4MEX A;  5CX3 A;  8ICX A;  3LYS A;  4BOS C;  4F92 B;  2D10 A;  3UIP B;  2G5H B;  1UT8 A;  1ENF A;  1OGW A;  1D8L A;  2WDV B;  1J2M A;  2W11 A;  2F2A B;  2KDM A;  4MFC A;  1WWT A;  3ZXV A;  2BYF A;  2GO7 A;  1XSL A;  1L3U A;  3RRG A;  3TMP B;  1ZQF A;  4ED1 A;  2RLT A;  2BYE A;  4O0I A;  3N4M B;  1VR9 A;  3PW7 A;  3IRU A;  2GLE A;  1UZX B;  4FA6 A;  2J53 A;  2BQR A;  3RUI B;  4WJP A;  5HHI A;  2JZB A;  1IUE A;  3L0W B;  2JXJ A;  4DXF A;  1XO3 A;  2L3Z A;  4J9R A;  3T8M A;  3ZD8 A;  3B08 A;  4CHK A;  1U4A A;  1V86 A;  9ICI A;  1AN8 A;  4BFR A;  3NVY A;  4FN2 A;  4GDL A;  7ICU A;  1JN3 A;  4G3I A;  2BCS A;  5GXG B;  3SD5 A;  1K52 A;  1QTM A;  3FIL B;  4IKG A;  4K7U A;  3PGE A;  3VVW B;  3RNB C;  4US9 A;  2JYT A;  8ICG A;  8ICK A;  1V85 A;  3FYH A;  5AK5 A;  2V1Y A;  3EC8 A;  4FS2 A;  2HE7 A;  2JY6 A;  2WFA A;  2NPT B;  3NVV A;  3X23 A;  1TKG A;  2WXN A;  1COO A;  3ONN A;  1X9X A;  4TSS A;  1YJI A;  3OJ4 B;  2YLM A;  3VR9 B;  1LV5 A;  4O5E A;  2UVU A;  4Y2R A;  2IHN A;  4UAY A;  3ETR A;  3R7R A;  1T0Q C;  1A5R A;  1VDV A;  3E0F A;  4DFM A;  2V9H A;  4DSF A;  1I4Q A;  5C23 A;  4PHP A;  4RU9 A;  2W8K A;  4F7Z A;  2WXQ A;  2AQ3 B;  4ECS A;  2EMS A;  1NNL A;  1F0M A;  3SFE B;  3WAP A;  4PHE A;  1WXA A;  5J2F A;  1D9F A;  4RQ3 A;  2KIV A;  1F77 A;  4FBT A;  3KZX A;  4S17 A;  3N30 A;  3NS1 A;  3ZDA A;  4IQT A;  4X5V A;  3ZXR A;  5L83 A;  4RQ6 A;  2WB1 C;  1P3Q U;  3AU5 A;  2Q4T A;  3E2E A;  2D6F C;  1BPD A;  2MEK A;  2WXK A;  2B76 B;  3HVD A;  4FJZ A;  4F4W A;  4QZC A;  2PI5 A;  2WHI A;  3GE3 C;  2WGS A;  4DWI A;  2WS3 B;  8ICT A;  3C5F A;  3PX6 A;  4O9M A;  5TSS A;  1WGD A;  5C2T B;  3IBE A;  4KMO B;  1HEZ E;  3N9Y C;  2N9X A;  2FE8 A;  5KFB A;  4NJC A;  4DQS A;  5DPT A;  4I2H A;  3MR6 A;  1Q3V A;  2ZIW A;  4TKN A;  2H3Q A;  2NYV A;  7ICM A;  9ICW A;  2IO0 B;  2KD0 A;  3ZUN A;  4DDI D;  4PL2 A;  2O6V D;  4O5C A;  3DHI C;  4QZA A;  3PST A;  1WXQ A;  3QUQ A;  3MC0 B;  1PVP A;  2Z7J A;  5KFT A;  2M0N A;  5KFC A;  3QA8 A;  2K3U A;  3PS6 A;  2DQN B;  1WG8 A;  1P1A A;  1YJJ A;  1Q3U A;  4BOZ B;  4NJ7 A;  3W1Y A;  1L5U A;  2A3V A;  4P0P B;  4RQ0 A;  4UAV A;  3C1Y A;  4DFJ A;  1SE4 A;  4LTU A;  3HW8 A;  1RYJ A;  2QSD A;  1BGX T;  7ICN A;  3N1Z C;  2WXM A;  3W5U B;  5CTR C;  4EEW A;  4K1R B;  3ZI4 A;  1TKD A;  3ICX A;  3H6N A;  3KWV A;  3RBD A;  2JSV X;  2GWS A;  3Q3M C;  3V60 A;  4BXO B;  2LHE A;  2FCS A;  5KFN A;  3KQ4 A;  3PW0 A;  2WXJ A;  5EWG A;  7ICI A;  2G45 B;  1PFD A;  3UXO A;  3WK6 A;  5GMV A;  2X8X X;  5LXH A;  2EAM A;  1KDH A;  3GQC A;  2D07 B;  2NTS A;  4NNJ B;  3RB4 A;  3ZVV A;  2JZ3 B;  5BYR A;  1KLU D;  5LNK 1;  3ZNG C;  1D5M C;  1V6E A;  4CYE A;  1JAL A;  3NS8 A;  1AQ6 A;  3NAS A;  5J0W A;  4MEM A;  3AUO A;  1MC8 A;  1NK0 A;  1SWW A;  4FHK A;  2L7R A;  2V9W A;  3O13 A;  5J2I A;  3RFZ B;  4MAC A;  1DK3 A;  3LDA A;  2FAZ A;  4DDG D;  2FPM A;  2R8H A;  1CZP A;  1VRA B;  2JU6 X;  4ECW A;  4D2K A;  4AYB C;  4XGA B;  3A0H U;  4BBN C;  1Q1O A;  3A9K A;  1TKY A;  1ZD5 A;  3ZNH B;  5EWF A;  3RTV A;  7ICJ A;  1KBU A;  3IFW B;  1GPX A;  5AUK A;  3H9D A;  3AU6 A;  1E5W A;  4K7S A;  2LM1 A;  1XWL A;  2J6U A;  3ISB A;  9ICT A;  4RMA A;  4RM9 A;  4YSX B;  5L1L A;  1S0O A;  3CRX A;  4N59 A;  2B21 A;  4PK1 A;  3B9J A;  2KMM A;  4FUL A;  4B6W A;  1O08 A;  5AKG A;  4W9H A;  3JPP A;  1WRD B;  2A1J B;  1U45 A;  9ICM A;  1E7U A;  4OW0 A;  3WAL A;  1RFK A;  2DHZ A;  4M9G A;  4M9L A;  3NTU A;  3SR6 A;  1SE3 A;  1V8C A;  3M62 B;  4KDI C;  2ZPN A;  3NUQ A;  2PFQ A;  8ICO A;  4IWQ A;  2DAF A;  2ZUC A;  3I1Y A;  3V6C B;  5ALP A;  3V6H A;  2AU0 A;  5KT2 A;  4DCC A;  1UWM A;  1YZ7 A;  4NWI A;  4F5Q A;  1SIJ A;  3HPO A;  4ED8 A;  1IPG A;  2M8S A;  4MFF A;  1YQ4 B;  1UA1 A;  2KQ4 X;  2RPV A;  2Y5P A;  3Q3F A;  1X42 A;  1XSP A;  2AYO B;  2EKI A;  1DOQ A;  3N28 A;  2LJ5 A;  4HCN B;  5ALN A;  1E90 A;  1Z2M A;  3H7P A;  5J0U A;  2KIW A;  2OED A;  3NVW A;  3PRP B;  4NLG A;  3N7R C;  3AB5 A;  9ICC A;  3SHQ A;  5CHG A;  1MQ2 A;  1WY8 A;  1UD7 A;  1ZQL A;  4ELV A;  5KFG A;  4RF1 A;  1FMA D;  4TV3 A;  4ANU A;  1LGR A;  1IGC A;  1OQQ A;  3HJE A;  4UB5 A;  4HDO A;  1MG8 A;  1L8O A;  2KZZ A;  2F44 A;  2LPE A;  2OH2 A;  1T6B X;  4MF8 A;  4M00 A;  1YMH E;  2R61 A;  1Z4N A;  7ICG A;  2DKX A;  2XVT A;  2XID A;  4ZRI A;  4MSQ B;  3C19 A;  2IBK A;  5AIB A;  3QU9 A;  4WQM A;  3VXW A;  5J0X A;  2AWT A;  3BS7 A;  1WXV A;  1ZJN A;  4C8L A;  4IC7 B;  4YR2 A;  2W3R A;  4JPS A;  2PI4 A;  8ICW A;  4GSW A;  2Q0Z X;  4J9S A;  3RCZ A;  2MUT B;  2HHT A;  2VIX A;  1JIH A;  1TYG B;  2AL3 A;  1OW5 A;  2Y0S C;  1NOM A;  1R7S A;  5J2C A;  2JQR B;  3H7I A;  3HM6 X;  2N7E A;  1QQ6 A;  2DBY A;  2KVZ A;  3SMV A;  8ICZ A;  4TQR A;  3PZD A;  1P7D A;  5AKK A;  1Z00 B;  2AEH A;  3WKE A;  2LRU A;  2JV3 A;  7ICP A;  2V3S A;  3NOB A;  1ZQY A;  3PO5 A;  5KG3 A;  1WF9 A;  2QHO A;  2LBO A;  3BQ1 A;  1ZQI A;  1H4R A;  1Z1B A;  1CJE A;  2ZZP B;  1EWY C;  3QJZ A;  5KFU A;  1ZET A;  1VZ6 A;  1B0X A;  2ASD A;  2KV2 A;  4PPX A;  4RUA A;  4A8X C;  3KHG A;  4J9N A;  1TVA A;  2KK8 A;  3C2M A;  2BVC A;  2KLG A;  2PLP A;  4PT5 A;  2MP2 A;  2K6D B;  5DB8 A;  4AP4 C;  1NJY A;  3V6J A;  1U9L A;  1AW7 A;  3IP4 B;  2HMX A;  3G6Y A;  3FC4 A;  3AU2 A;  1WMH B;  2DFL A;  4REZ A;  5BYQ A;  2HDE A;  1L6U A;  5KFZ A;  4UDU C;  2WDQ B;  3KYC D;  2EH9 A;  1LQB A;  1TKE A;  4GC6 A;  3SQI A;  1RAX A;  1U48 A;  4W9G A;  2GBN A;  3KFU F;  4NAM A;  2CKH B;  4GGQ A;  5J17 A;  4YTN B;  3I76 A;  1WE7 A;  5D49 A;  9ICH A;  4M47 A;  3DBR B;  5ALT A;  2F77 X;  1S97 A;  4MHV A;  1WX7 A;  1XCQ L;  2PVO D;  2WXL A;  4WUR A;  4F72 A;  1ZQA A;  1ZQP A;  3RRH A;  4YN4 A;  2AGQ A;  2W7O A;  3AE6 B;  2WTF A;  2IND C;  4NY0 A;  1JXL A;  8ICQ A;  2JVC A;  4P0Q B;  4NPN A;  2K60 A;  5KG2 A;  4GIB A;  3VUY A;  3P4S B;  3PVX A;  2KAC A;  2PMZ C;  3V7K A;  1SEB D;  3QX7 A;  1CRX A;  3GIK A;  1KTK A;  3Q6B A;  2MW5 A;  4YWG G;  3BQ2 A;  2BYV E;  4J9L A;  4YCX A;  1OQR A;  2XIC A;  2PW9 A;  3DBL B;  4DK5 A;  2GB1 A;  2A19 A;  1ZQV A;  2RDI A;  4ELT A;  1TZ1 A;  4XA5 A;  4XX5 A;  4HEA 1;  4TUQ A;  4PJ0 U;  4ECQ A;  2KE7 A;  3THV A;  3DBH I;  3PT2 B;  4GDK B;  2DYB A;  3DQV A;  1TY2 A;  2YQE A;  2FJ6 A;  4JQW C;  3RJG A;  5B66 U;  2BKR B;  2IA6 A;  2JUO A;  5KFV A;  3R2I A;  3ZLZ A;  2J52 A;  4EZJ A;  4EE2 A;  4DQR A;  2K89 A;  4LJO B;  1JUD A;  4RZR A;  3PLV A;  2WXI A;  5L95 C;  3G6V A;  2HSZ A;  3N3K B;  2KAJ A;  2KOX A;  2W3S A;  3ABV B;  3AMZ A;  4RNO A;  4ECY A;  3DCG A;  5J2R A;  3IT6 B;  4PZN A;  2WAQ C;  3RT3 B;  1GB1 A;  4ANV A;  4EZK A;  3QZ8 A;  3V05 A;  3O0F A;  2WDT B;  4GB9 A;  3OGU A;  2I1Q A;  1C76 A;  2A1J A;  1GUA B;  3OTQ A;  5DDY A;  3TBL D;  2W8L A;  5HKH A;  1ZW7 A;  5HHD G;  2KKP A;  4C4S A;  2I2Y A;  1C77 A;  4C8N A;  1LVH A;  3EPG A;  3IVF A;  4IG7 B;  5ALY A;  1T3Q A;  1CI4 A;  2PE6 B;  4G9B A;  4RT3 A;  3RMK C;  2DZJ A;  2JEJ A;  1C79 A;  9ICJ A;  5AIC A;  1WJ6 A;  2KHQ A;  1KQQ A;  1XQQ A;  4WAF A;  4BXO A;  8ICE A;  1ZDX A;  5EWE A;  4OJP A;  4CO7 A;  1MQ3 A;  1OQY A;  5KFP A;  3UMG A;  2JRH A;  3I3T B;  5C5J A;  5IIN A;  5D4B A;  4F50 A;  4C8O A;  3G6X A;  4EX7 A;  3N97 B;  2RGF A;  3MDC A;  2DEN B;  1E8Z A;  3EYZ A;  5ALL A;  2LUE A;  1UGM A;  3KUZ A;  4ZYS A;  3D2S A;  1MI0 A;  4KX6 B;  2HHS A;  2JHD A;  2D5G A;  2RSU A;  2BZF A;  4A8E A;  1R4M B;  2K6Q A;  5HNK A;  2WNM A;  5JRT A;  4BKG A;  4O1N A;  3SYZ A;  2KJ8 A;  1D9D A;  4BKT A;  2E8O A;  4ZHP A;  2ZTE A;  4ZOH C;  4ASW C;  3QQ8 B;  3H8W A;  7ICV A;  4II3 B;  3IV6 A;  3S2A A;  3AE9 B;  2M17 A;  4LNI A;  4WJQ A;  4FZM A;  2M0X A;  1DXS A;  4ACF A;  4P4O A;  4I2G A;  5L1I A;  1GOZ A;  4ED2 A;  1RRB A;  3CYM A;  8ICL A;  5HP4 A;  2GI9 A;  3AE2 B;  3EGR A;  4DOC A;  2KJH B;  2N9P C;  2RQ5 A;  4F71 A;  3RJE A;  1ET9 A;  2K4I A;  4LK0 M;  5E6O A;  2KN7 A;  1NJZ A;  4K4G A;  2GBJ A;  2V0G A;  3BVG A;  4HPP A;  1Z00 A;  4EZL A;  4KKJ A;  4GIV A;  4BX9 C;  2RPQ A;  1XC9 A;  4WWO A;  3RNC C;  1KFS A;  1SL2 A;  4DSI A;  2ZIV B;  4GLX A;  1Z19 A;  1EM7 A;  1N63 A;  1OTR B;  1TZO A;  2DZK A;  1BML C;  3IG5 A;  2BDU A;  2L76 A;  3UQB A;  1WGH A;  2FID A;  3PO0 A;  5T8I A;  2KNJ A;  1J8C A;  4GOC A;  4P16 A;  1DRG A;  1F0Z A;  2LGD A;  4L1B A;  4QZH A;  1MA7 A;  2ZW0 A;  4RUC A;  3MHZ A;  2Y9T A;  5D6J B;  2WXP A;  4QAY A;  4GFJ A;  5ALM A;  4L23 A;  1HJP A;  4A3P A;  2DWQ A;  4K4I A;  2W55 A;  2WXH A;  4YTP B;  1L2N A;  1QKZ A;  4DXA B;  3H4D A;  3DEE A;  5F3X B;  2FI1 A;  1HZ6 A;  1X9W A;  1NJX A;  3Q3J A;  4BWM A;  3OG5 A;  3H0M B;  5GTH U;  1NK8 A;  2PJH A;  4PYZ A;  1S0V A;  4ACO A;  5KAF U;  3GV5 B;  1CUK A;  4O3S A;  4I2D A;  2IGD A;  4MEY A;  2HHW A;  3WIM A;  3GE8 C;  3VCB A;  3CNH A;  4F5P A;  1L7Y A;  2N1V A;  5BOM A;  2KVC A;  5IA7 A;  1YNT E;  1ZQW A;  2KOB A;  1JW9 D;  4IRK A;  3AQE A;  2K0P A;  1P0R A;  1VD2 A;  4QZ9 A;  4ZHO A;  4ZDV A;  4WWP A;  4MGI E;  1IIP A;  5TZV A;  3CMM B;  3ENE A;  4K7W A;  2RHF A;  2RDB C;  1C20 A;  3VH3 B;  3R2T A;  1JWA D;  1K50 A;  3PLU A;  5IOI A;  3IDW A;  2A5U A;  1UH6 A;  4C4R A;  5BO4 B;  3HKZ C;  4I2B A;  3J81 j;  3WK9 A;  1PGX A;  4WAA A;  2K8H A;  4RNM A;  3UIN B;  4A3O A;  4B6J A;  4G50 A;  1HUZ A;  4KLL A;  3KKA A;  2KD1 A;  3M95 A;  1S0M A;  2MQJ A;  2NCN A;  1FNU A;  1WE6 A;  5AI9 A;  5KFK A;  1SBB B;  2L52 A;  5J0P A;  3BII D;  4QZB A;  2KX0 A;  1VJ5 A;  1RM6 C;  2J0M A;  3HIL A;  2ZIW B;  2JF5 A;  3NY5 A;  2MA9 B;  1QOA A;  2LGI A;  3TAR A;  2UVR A;  1P98 A;  1DGS A;  5TIS U;  3M9O B;  2F76 X;  1Q8K A;  4YG2 A;  4MF2 A;  2PE9 A;  2BCQ A;  5E6P A;  4YVZ A;  1KKX A;  5FP0 A;  2PKE A;  4OO1 J;  1E10 A;  2IOF K;  4DFP A;  3ML9 A;  1NZB A;  4IQU A;  2AHO B;  3L13 A;  4B9S A;  2WX0 A;  3PZ7 A;  1VZ8 A;  2E1F A;  1D5X C;  2KK0 A;  2KWD A;  2LMC A;  4J9M A;  3UQ2 A;  5CHV C;  3C8Y A;  4Y2S A;  3L4P A;  1S1Q B;  2PEA A;  1QIL A;  3PO4 A;  4BVU C;  4OVV A;  2MBE A;  2VJ5 A;  3E58 A;  1FO4 A;  4W9C A;  2K8B B;  3ZJT A;  4DQP A;  4QZG A;  5K4L A;  4I2J A;  5DQG A;  2IYD B;  3TFS A;  2K25 A;  2EZZ A;  4C8K A;  4KLG A;  5I4D A;  1KM7 A;  4IWO A;  1STE A;  2GMI C;  4XC2 A;  3EZ5 A;  4IS7 A;  2MBQ A;  2HOQ A;  3DDH A;  3A1Q B;  3L10 B;  3PML A;  3M8R A;  5KT6 A;  4YSY B;  4F4X A;  4JLC A;  4TUS A;  2HJ1 A;  4Z6F A;  4NQK E;  3Q8F A;  3F2B A;  5L9X A;  3MHS D;  8ICA A;  2XY5 A;  4Q45 A;  2UU7 A;  3IAS 1;  4FE3 A;  4CF3 A;  1SL0 A;  2BB6 A;  5D2M B;  3CF6 E;  3EHV A;  3QNM A;  3RAX A;  1TY0 A;  3TI0 A;  2AQ0 A;  1ED1 A;  2WAQ F;  5AM2 A;  3SZ2 A;  4DSJ A;  2H5X A;  4FBU A;  1A6S A;  5DQI A;  1BT0 A;  4ECV A;  3N1X C;  2NRV A;  3OSN A;  2ZUB A;  3B2F A;  2M56 B;  3VUW A;  3DOW A;  4EFO A;  5CHF A;  4U7C A;  3JPT A;  3VTV A;  5DG9 A;  1NKC A;  2JH1 A;  3ZDC A;  2KZ3 A;  1YQ3 B;  2NR2 A;  2I38 A;  4UAS A;  4DOB A;  3CIR B;  4TQ1 A;  3GS2 A;  8ICS A;  1V81 A;  1Z1V A;  3TAQ A;  5DB6 A;  4UAZ A;  2QAR B;  1L0Y B;  4WJN A;  2KDI A;  4ITK A;  4YMN A;  8ICI A;  2XNA C;  4KGR A;  1N5X A;  3DHG C;  1T3N A;  5AKJ A;  1ZYQ A;  1R4N I;  3WK5 A;  4F3O A;  1T0S C;  2QC8 A;  1CQV A;  3T3N A;  2XGQ A;  4I6L B;  2V4Q A;  4AYB F;  4P2H A;  1E7V A;  1DOX A;  4W9D A;  2XN9 C;  3QZ7 A;  4A20 A;  5DDM A;  1QOG A;  1C4P A;  3CW2 C;  2PIA A;  4QWE A;  2KJ5 A;  4YFK A;  4KLE A;  2HOI A;  3WKB A;  3D2Q A;  3D6J A;  2K8B A;  2BS3 B;  3RPF C;  3ONS A;  4ANW A;  4F5N A;  2ATL A;  2C7M B;  2QEJ C;  2Q5W D;  3K4G A;  2B0C A;  1V9J A;  2Z8L A;  4IOI E;  5KG7 A;  2JEG A;  3PRZ A;  1QQ5 A;  8ICV A;  1ZQH A;  3L16 A;  2KDE B;  5HG2 A;  3PRM B;  5DLF A;  1FEZ A;  2FNJ B;  5D46 A;  4LVS A;  2KKV A;  2W9B B;  2P66 A;  2BS4 B;  1RXV A;  5KHO A;  1C1Y B;  2OCE A;  1MG4 A;  2BKF A;  2DYO A;  3JYU A;  2JWZ A;  3LVV A;  2N9K A;  3JW0 X;  4NAW A;  2NRW A;  3LDZ E;  5H92 C;  2NBU A;  4O3N A;  2PFP A;  4L2Y A;  2G9H D;  4B95 A;  4FJY A;  3AV8 A;  4LDT D;  4DLG A;  2KAN A;  1C9F A;  1MHH E;  5KFF A;  4F5R A;  1R4M I;  5ALD A;  5D94 A;  3Q8L A;  1VJK A;  3PX4 A;  1N6Z A;  1IGD A;  3RFA A;  3FM9 A;  4DFK A;  1OEY A;  4XE0 A;  4NJ8 A;  9ICB A;  3C23 A;  1N61 A;  4Y2T A;  2YB1 A;  2N1R A;  5AIA A;  1LFD A;  3M3J A;  2WHE A;  1P7E A;  2ZG6 A;  4JGH B;  4I6N B;  3KUD B;  2W43 A;  3JPR A;  4MEL A;  2CHZ A;  4M2Y A;  3C5G A;  3NGD A;  3GII A;  2KNB A;  2YEP F;  1WWV A;  2KDF B;  1YT3 A;  2CU3 A;  1WX8 A;  3NZS A;  2KHV A;  3JPQ A;  4AS1 A;  3HIZ A;  4ECX A;  5T14 A;  1ZQU A;  1SF0 A;  4G11 A;  1SV0 C;  3QWZ B;  5KT5 A;  3GFK B;  1VLB A;  2ASL A;  7ICO A;  2C7N B;  2WX1 A;  1ZQS A;  2E6X A;  3RR7 A;  3VHT C;  5AM1 A;  4BAX A;  3HT3 A;  3SEN A;  2C60 A;  1C3T A;  1L8L A;  1PVR A;  1HZ5 A;  2EAN A;  8ICJ A;  5AHX A;  3C2L A;  2OEH A;  4KVG B;  3RNE C;  5IIK A;  3WK4 A;  2KHW B;  1SV0 A;  1JCK B;  5KT7 A;  4KZ0 A;  2WP9 B;  1L7O A;  2KXJ A;  2YVC A;  1UGJ A;  4M04 A;  1HIW A;  1BPX A;  4QWB A;  1ZD3 A;  4R65 A;  1XO0 A;  7ICQ A;  1QCK A;  3KD3 A;  2JT4 B;  1QSL A;  2ZUD A;  4F2R A;  3R66 C;  4HPM B;  4JX1 C;  1NKE A;  3T3O A;  4UAU A;  1V5T A;  2MLB A;  3X0W A;  2KSO B;  2QB1 A;  4PGQ A;  2FMQ A;  5KFH A;  2NRZ A;  4MDK E;  1XLN A;  2FLL A;  3RBE A;  2JZZ A;  5LXI B;  2P6U A;  2ZIU A;  1KRP A;  4M8M A;  3RH5 A;  2P35 A;  3TJP A;  3DBL I;  3ZRC A;  5DCN A;  2IO1 B;  1O03 A;  4C56 C;  3NG0 A;  1CEZ A;  4HRO A;  2CJN A;  4NQL B;  5J18 A;  5ALX A;  4EBC A;  1OXJ A;  4GDK A;  3M6Z A;  3TAP A;  4HWI B;  2EEL A;  4O3O A;  1KRH A;  4DOA A;  2QJL A;  3BVM A;  4DEZ A;  5JH5 C;  3NZ3 A;  2MA1 A;  4YD1 A;  1NI3 A;  1SL1 A;  3PSI A;  1ZQC A;  1X2I A;  1TJE A;  1IYF A;  3M1Y A;  2BPG A;  2PFN A;  4KLM A;  2F3N A;  1GB4 A;  4Z6E A;  3V61 A;  1D3Z A;  3U2S C;  4JWU C;  2IPK D;  4HLE A;  4BBN F;  2ZNV C;  2JXT A;  7ICH A;  1L7N A;  5ALQ A;  1JML A;  4QZF A;  3O65 B;  4WJO A;  2KFK B;  1JMS A;  1F2R C;  4RFB A;  1Z4O A;  1WX9 A;  1Y8R C;  4GLS C;  5AK3 A;  4RGO S;  3WAN A;  4H2A A;  5CA7 A;  3AEA B;  4EEK A;  5KFM A;  1V97 A;  3AEB B;  2M1M A;  2OOB B;  3V62 A;  3FAH A;  2W9A A;  2G08 A;  1XEE A;  3TEW A;  4BUG A;  1FFV A;  1J7A A;  3B1L X;  4WIP A;  1X6I A;  3RNF C;  5KHQ A;  1KEJ A;  2ZNV B;  4F1S A;  1EUV B;  2SAK A;  3PRE A;  4ZRK A;  3TSS A;  4WH4 A;  4DQO C;  1TAU A;  2BCV A;  2OJW A;  1A77 A;  3DPD A;  1I4X A;  2ZXH A;  5ALG A;  5D3I B;  3ZTD A;  3P2B A;  2G5I B;  1ZRM A;  4UAW A;  3C29 A;  1FXA A;  3FDS A;  2FCM A;  2XK5 A;  4G3X B;  5FKA C;  2AQ2 B;  1X9S A;  2OXO A;  4BGD A;  4FHJ A;  1NVI D;  2ZIU B;  4B9V A;  3B0Y A;  2MRL A;  2I5H A;  4I27 A;  4E71 A;  1HQR D;  3WK8 A;  3KYD D;  2JMG A;  2BPC A;  2JYE A;  3ED5 A;  5H8Y E;  4BZA A;  2HHQ A;  2NPT A;  3MJW A;  3APF A;  2Z0D B;  2B3A A;  2KZM A;  4JMU A;  1E9M A;  1Z5S B;  2F1H A;  4DF4 A;  4HPL B;  4FBJ B;  8ICR A;  4CF5 A;  4CQN A;  2PPH A;  3V6E B;  1ARO P;  1SXE A;  2F8K A;  2KQS A;  5AK6 A;  5KFE A;  1NYR A;  3C21 A;  1SGH A;  2LXC A;  2YMP A;  4FFD A;  5CJ7 A;  2WF8 A;  4F4K A;  1GG3 A;  2MBH A;  1I42 A;  2WDR B;  4DO9 A;  3VH4 B;  3KW5 B;  5LLI A;  1EXN A;  2KP7 A;  5J0S A;  3PW4 A;  1PUT A;  5CHW A;  2CHW A;  1XT9 B;  2C5L C;  3RN9 C;  2IJ0 A;  4DXG A;  1M94 A;  2EZX A;  1FIQ A;  5ALH A;  4W9E A;  2WB1 F;  2R8G A;  3QC8 B;  4QZD A;  2FUG 1;  1BPY A;  2KVS A;  2JGA A;  3S6J A;  3UI3 A;  1WJU A;  2CS4 A;  3WAM A;  3V72 A;  5TR5 A;  4MGK E;  3M6K A;  2IOF A;  4ANX A;  5KFO A;  3EWA A;  2MX2 A;  2KIC A;  3LVW A;  5FR6 A;  3J9C A;  3JPN A;  2M19 A;  8ICP A;  1N5W A;  1ZXH A;  3VQI A;  4BWJ A;  1T4G A;  3MC8 A;  5IAA C;  2DGZ A;  4PYU A;  2ZEQ A;  2MRP A;  5CP2 A;  1WIA A;  3Q8Q B;  4JWS C;  3I57 A;  5JZE B;  2N9L A;  3HWT A;  4CE6 A;  2LAS A;  4RM8 A;  3T5H A;  2KN4 A;  4B9U A;  1ZQE A;  1FCC C;  2UYZ B;  1FRR A;  3TCA A;  3I9V 1;  4RPZ A;  2K8A A;  3WU2 U;  1JWS D;  2LGY A;  2XCP A;  5KG4 A;  1XCT L;  1HXY D;  1QLN A;  4QIW C;  2WXF A;  2JZB B;  4CNQ A;  1H8C A;  2RDH A;  1TGZ B;  3PW5 A;  3MC1 A;  1YN5 A;  3PZ8 A;  4O3P A;  5DGB A;  3ZJU A;  2PMZ F;  5AKI A;  2N7J A;  4GXI A;  4NAW B;  4J03 A;  3Q3N C;  4FXC A;  1MFW A;  3VR8 B;  2AH5 A;  3RH4 A;  5J2J A;  2V4I B;  4XQ8 A;  3NUH B;  2L83 A;  2MBB B;  4OVU A;  2HOF A;  2YML A;  2R8I A;  2G4S A;  5AM5 A;  4P7I A;  1TK5 A;  1SJH D;  3IAM 1;  1FXI A;  4AJY B;  3BIN A;  1DK2 A;  1JWU D;  5MPO A;  4M6W A;  5ALF A;  7ICL A;  2L0T A;  5DB7 A;  1QQR A;  4DL3 A;  1NKB A;  2ES6 A;  4IWP A;  3KBB A;  3OJS A;  5DLG A;  1PDX A;  1E8X A;  2LKY A;  4LJP B;  3PPA A;  4UW9 A;  2J4X A;  2N0S B;  4YXD B;  4LZD A;  2VA8 A;  1NK5 A;  2C28 A;  2JZP A;  1K1S A;  1L3S A;  4XWW A;  2BF8 B;  5DGA A;  3P63 A;  2QCZ A;  4EZ9 A;  1F44 A;  2WXO A;  5DBC A;  4XDD A;  1YX5 B;  2G4D B;  3RNA C;  1F2R I;  2ESE A;  4NLC A;  2CXY A;  3RZW C;  3URY A;  2JR5 A;  4DQQ A;  4ICU A;  1S5L U;  2YMQ A;  2MJ3 A;  1Q10 A;  1SZH A;  1EF1 A;  2IO2 B;  1F9J A;  1S77 D;  4AWJ A;  2OM6 A;  5ALU A;  2KTQ A;  3MGI A;  2BGW A;  2W54 A;  1JQ4 A;  5J0R A;  3ZDM C;  2LYH A;  4F91 B;  3MJ5 A;  2W9C B;  4OJ5 A;  2O2V B;  4M9J A;  1NDD A;  3AU4 A;  4RNN A;  3IXS A;  5FR3 A;  3VRA B;  2F1J A;  4IR1 A;  1M4V A;  1WXS A;  2ZTD A;  5G5H A;  4J6I A;  1BPZ A;  3QUT A;  4KN7 A;  2IGG A;  3Q8A A;  3T9L A;  3WAO A;  1J0G A;  3Q3O C;  4UBB A;  4Y2U A;  1XF5 L;  3R7Q A;  1C78 A;  4ECT A;  5AM4 A;  5AEK B;  1XU4 A;  3TAD A;  4LNK A;  5G2N A;  2HBM A;  2CRX A;  1S76 D;  3GZN I;  3F5E A;  4F93 B;  3K9O B;  3BQ0 A;  2HD5 B;  2HVH A;  4N9F 4;  2BYT A;  2KJ6 A;  4FO6 A;  3Q8R B;  1FPY A;  4W9L A;  2HHU A;  1V1O A;  1V9P A;  4Z6C A;  4B0M A;  1SJE D;  3KH0 A;  1Y56 A;  1WGG A;  2K4H A;  3KUC B; 
#chains in the Genus database with same CATH homology
 1AWD A;  2M0A A;  4N6E B;  1E10 A;  3HVD A;  1NEN B;  2WXK A;  2MEK A;  4P6V F;  1I4R A;  2B76 B;  2INP E;  3PZ7 A;  1VZ8 A;  1D5X C;  2WS3 B;  2ZW1 A;  4HKZ E;  4KGS A;  2KWD A;  2LMC A;  5TSS A;  3C8Y A;  3L4P A;  4HRS A;  5C2T B;  1QIL A;  1HEZ E;  3N9Y C;  3AEE B;  1FO4 A;  3ZJT A;  2FE8 A;  4NJC A;  3DWM A;  2H89 B;  1C4C A;  5I4D A;  3BVZ A;  4NZL B;  1STE A;  1WXQ A;  2AQ1 B;  3AE1 B;  3MC0 B;  1ESF A;  4RGM A;  3W2D A;  1EWC A;  2K3U A;  3AE4 B;  4XDC A;  2W82 A;  5HI1 A;  1V1P A;  1ET6 A;  4US8 A;  4YSY B;  3ZJV A;  1J7B A;  3Q8F A;  1YJJ A;  2K5P A;  5E6J A;  3W5V B;  1YN3 A;  2TSS A;  3IAS 1;  2BB6 A;  3W9C B;  2V3P A;  2PKO A;  1SE4 A;  4LTU A;  1TY0 A;  4JE3 B;  1RYJ A;  2WU5 B;  2QSD A;  2WXM A;  3W5U B;  3EUB 2;  4RGN A;  3B2F A;  3KWV A;  2JSV X;  2M56 B;  2LHE A;  1KLG D;  5D3D A;  3P4R B;  3KQ4 A;  2WXJ A;  1WGK A;  1PFD A;  1YQ3 B;  3CIR B;  2I38 A;  4TQ1 A;  3GS2 A;  2NTS A;  2IGH A;  4OZA A;  3U52 E;  1LO5 D;  1L0Y B;  5BYR A;  1KLU D;  4KKI A;  4ITK A;  2XNA C;  3E9S A;  4KGR A;  5LNK 1;  1N5X A;  1D5M C;  5BMH A;  1JAL A;  1DGJ A;  4A90 A;  5AUI A;  1P7F A;  1ACC A;  2LEK A;  1ZPS A;  3AE3 B;  1PGA A;  1AYF A;  1FFU A;  3T3N A;  1CQV A;  3O13 A;  4YTM B;  4MM3 B;  3RFZ B;  5G5G A;  4MAC A;  1DOX A;  1JRP A;  2XN9 C;  1CZP A;  1VRA B;  2JU6 X;  2VZK D;  2K22 A;  4D2K A;  1QOG A;  4J3O D;  1C4P A;  1TKY A;  2PIA A;  1ZP0 B;  4AQ7 A;  1GPX A;  2QIL A;  5AUK A;  2DLB A;  2BS3 B;  3RPF C;  2PMV A;  3NVZ A;  2Y3A A;  2QEJ C;  4OHJ A;  4YSX B;  3VRB B;  2Q5W D;  3HUI A;  2Z8L A;  4IOI E;  4N59 A;  2BS2 B;  3B9J A;  2KMM A;  3KLS X;  5HG2 A;  5FK9 C;  1WYG A;  4ARC A;  1IBX B;  4OW0 A;  1RFK A;  3SR6 A;  1SE3 A;  1V8C A;  2L1A A;  4C7Y A;  3BZD B;  4HKQ A;  1N62 A;  2V3N A;  2BS4 B;  3EA6 A;  2HTM E;  1RWS A;  2DYO A;  1NYQ A;  1SE2 A;  2QIE B;  1UWM A;  2N9K A;  1UUP A;  1FD6 A;  1SIJ A;  5H92 C;  1YQ4 B;  1JWM D;  2KQ4 X;  4L2Y A;  2G9H D;  2RPV A;  2Y5P A;  3AV8 A;  2LHD A;  2EKI A;  1C9F A;  1MHH E;  1FNW A;  2BT6 A;  2CJO A;  2OED A;  3NVW A;  2BW2 A;  1VJK A;  2QMT A;  3AB5 A;  4N58 A;  1IGD A;  2Y5C A;  4XE0 A;  1B9R A;  4RF1 A;  2MH7 A;  1FMA D;  3TEX A;  1N61 A;  4M0W A;  1IGC A;  1OQQ A;  4A9A A;  1P7E A;  1WRI A;  1T6B X;  1BXT A;  1YMH E;  4ZRP A;  1D6E C;  1L4D B;  1FEH A;  3AEC B;  4Q2J A;  3TEY A;  1MHX A;  4WQM A;  1SB3 C;  2YEP F;  4MH8 A;  2MJD A;  2SEB D;  2W3R A;  4JPS A;  1ZE3 D;  2CU3 A;  3Q8E A;  2G1E A;  4AS1 A;  1TYG B;  3HVZ A;  1SF0 A;  3P4Q B;  4YT0 B;  1R7S A;  1VLB A;  2JQR B;  3FIL A;  1C4A A;  1JRO A;  3Q8C A;  2E6X A;  2DBY A;  3AEF B;  2ICI A;  1HZ5 A;  2E3T A;  2H88 B;  1QOB A;  2RDG A;  4RH6 A;  5HFY A;  3AN1 A;  2ACZ B;  5BYS A;  1CJE A;  2GRI A;  1EWY C;  1JCK B;  3BK2 A;  1PGB A;  1VZ6 A;  1XLQ A;  2WP9 B;  3AED B;  4A8X C;  1TS5 A;  4USA A;  1UGJ A;  1DOY A;  4PT5 A;  2PLP A;  3SFD B;  2R61 A;  1E6E B;  1XLO A;  4JX1 C;  2FBW B;  1AW7 A;  3T3O A;  4C80 A;  3FC4 A;  3AEG B;  1KH0 A;  4REZ A;  5BYQ A;  2PVG C;  1XXG A;  1QLB B;  2HDE A;  1L6U A;  1XLN A;  1ZOY B;  4UDU C;  2WDQ B;  4A6Q A;  1DOI A;  1TKE A;  1N60 A;  1JWB D;  3Q69 A;  1PYW D;  4NAM A;  4C56 C;  2BTE A;  3AH7 A;  1D4B A;  4YTN B;  4HRO A;  2CJN A;  3P1M A;  1I7H A;  1I4P A;  3R8B A;  1XCQ L;  2PVO D;  2EEL A;  2WXL A;  1KRH A;  2INN E;  4WUR A;  2QJL A;  3BVM A;  3NZ3 A;  2MJE A;  2OHF A;  3AE6 B;  1FNV A;  3LB8 C;  1NI3 A;  4C7Z A;  2LFI A;  1TJE A;  1TS3 A;  3BK1 A;  1OFF A;  4A55 A;  2WQY B;  3P4S B;  3U7Z A;  2KAC A;  3DWG C;  1GB4 A;  1SEB D;  1I4H A;  1NEK B;  3U2S C;  1KTK A;  1ZXI A;  4JWU C;  2IPK D;  4YWG G;  2JXT A;  2ONQ A;  3TEZ A;  1JML A;  1OQR A;  2PW9 A;  2GB1 A;  3KWL A;  1F2R C;  4RFB A;  1SXT A;  4GLS C;  4RGO S;  4H2A A;  3AEA B;  2X38 A;  1V97 A;  3AEB B;  4HEA 1;  3FAH A;  4GDK B;  2IDY A;  1TS2 A;  1TY2 A;  1XEE A;  3V3X A;  3TEW A;  1FFV A;  1J7A A;  2AX5 A;  4RGT A;  4WIP A;  2WU2 B;  1BUI C;  2SAK A;  3R2I A;  4XWT A;  4ZRQ A;  2J52 A;  3TSS A;  4EE2 A;  4IDI A;  4WH4 A;  4DQO C;  1XLP A;  2WXI A;  3GP7 A;  1I4X A;  1SSN A;  2KAJ A;  3SEB A;  1L0V B;  2W3S A;  3ABV B;  3AMZ A;  3AE5 B;  4TQ0 A;  3IT6 B;  5D3I B;  1D5Z C;  5C3J B;  1GB1 A;  3TUO A;  1FXA A;  2LJI A;  3H8H A;  5FKA C;  3V05 A;  4YSZ B;  2AQ2 B;  1HA5 A;  1QF6 A;  1NVI D;  1C76 A;  1B1Z A;  4OZB A;  1MVK A;  5HHD G;  2I2Y A;  3Q8B A;  1C77 A;  1HQR D;  4B0E A;  4ARI A;  3BYT B;  2JYE A;  5H8Y E;  1T3Q A;  1EU4 A;  3LXF A;  1E9M A;  1C79 A;  4CQN A;  2PTL A;  4WAF A;  2JX5 A;  1ZDX A;  5EE1 A;  1NYR A;  3AE8 B;  4KGT A;  1L5P A;  3NRZ A;  4OVZ A;  2WDR B;  3U4E G;  1J7C A;  1K51 A;  3BWU D;  4MT5 A;  1PUT A;  3AM9 A;  2J42 A;  1FRD A;  3B2G A;  5D7G A;  1DYQ A;  2IJ0 A;  3CWI A;  4DXG A;  1FIQ A;  1L4Z B;  4ZYS A;  1V1P B;  1MI0 A;  4KX6 B;  2FUG 1;  2D5G A;  3P42 A;  3UI3 A;  3WCQ A;  1TS4 A;  2WNM A;  4O1N A;  4ZHP A;  4ZOH C;  2K9X A;  1ROE A;  2WXR A;  3AE9 B;  2WLB A;  3J9C A;  1A70 A;  3W1S A;  1L0X B;  2M19 A;  1N5W A;  1ZXH A;  1GOZ A;  3VQI A;  5EE0 A;  2GI9 A;  3AE2 B;  3EGR A;  5EE3 A;  4LK0 M;  1ET9 A;  4GDL B;  1CK1 A;  4JWS C;  3I57 A;  2V0G A;  2N9L A;  3HRD D;  3BVG A;  2KN4 A;  2ON8 A;  1IBX A;  3BYY B;  1FCC C;  3GB1 A;  1FRR A;  4RNA A;  1E7P B;  1K53 A;  3I9V 1;  1L6V A;  1JWS D;  1KF6 B;  2RMM A;  4KKJ A;  1EU3 A;  1XCT L;  1HXY D;  3ZQ4 A;  2WXF A;  2RDH A;  2L32 A;  2BBC A;  2LUM A;  3E56 A;  1FCL A;  5JXV A;  1EM7 A;  1TZO A;  1N63 A;  4R3D A;  1ZUD 2;  1YN5 A;  1BML C;  2DYM A;  3MFG A;  3PZ8 A;  3ZJU A;  2N7J A;  3PO0 A;  4NAW B;  1MPE A;  1ZDV A;  5T8I A;  4FXC A;  4P16 A;  5BMI A;  3VR8 B;  1F0Z A;  2V4I B;  4WWM A;  4L1B A;  3NUH B;  2L83 A;  2ZW0 A;  1ENF A;  3MHZ A;  4RF0 A;  2WDV B;  5EE9 A;  4OZC A;  2WXP A;  2KDM A;  1SJH D;  1FXI A;  3IAM 1;  1WWT A;  1JWU D;  2YEP B;  5MPO A;  1QQR A;  4L23 A;  4RCO A;  2DWQ A;  1PDX A;  3IT4 B;  2W55 A;  2WXH A;  2NMQ A;  3MP9 A;  1VR9 A;  1QKZ A;  4YTP B;  2J53 A;  1WSP A;  2J4X A;  1HZ6 A;  2N0S B;  2NTT A;  4YXD B;  1IUE A;  2JZP A;  1GAQ B;  4DXF A;  1XO3 A;  4XWW A;  2BB5 A;  3P63 A;  3LYY A;  2WXO A;  3ZGZ A;  2IGD A;  1FM0 D;  1QT9 A;  4XDD A;  1F2R I;  1AN8 A;  3URY A;  3NVY A;  1YNT E;  5BMG A;  1JW9 D;  2K0P A;  5GXG B;  4LLG M;  4ZHO A;  2MJ3 A;  1Q10 A;  1K52 A;  3P4P B;  1VZ7 A;  3FIL B;  4IKG A;  1UNS A;  1KFY B;  4US9 A;  2JYT A;  3R2T A;  4HJG E;  1JWA D;  1K50 A;  2W54 A;  1UWX A;  1JQ4 A;  1T5X D;  1PGX A;  3NVV A;  2WXG A;  3MJ5 A;  5FR3 A;  1TKG A;  2WXN A;  3IXS A;  3VRA B;  4TSS A;  1YJI A;  1M4V A;  1E0Z A;  3VR9 B;  5G5H A;  1QOF A;  1YN4 A;  2JWU A;  3ZYY X;  2IGG A;  3ETR A;  3Q8A A;  1FNU A;  3AE7 B;  2VZK B;  4TMA B;  1SBB B;  1XF5 L;  2L52 A;  1VDV A;  1C78 A;  3BII D;  1I4Q A;  1RM6 C;  2WXQ A;  2AQ3 B;  1I4G A;  3SFE B;  1QOA A;  2LGI A;  3OWE B;  2BYT A;  1F77 A;  1V1O A;  4B0M A;  1SJE D;  3NS1 A;  1Y56 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...