3ETRA

Crystal structure of xanthine oxidase in complex with lumazine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence L
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3etrA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3etrA01
1FO4A 1WRIA 1NYRA 1PFDA 2PVGC 4YSXB 5EE0A 5EE3A 5H92C 1N63A 1XLNA 3AEEB 2W54A 1NENB 2H88B 3VRBB 1SF0A 1QF6A 4JWUC 2BS4B 5AUIA 1KFYB 4LTUA 4HROA 3B2GA 3AMZA 4US8A 1FXIA 1L0VB 4WWMA 2K22A 5GXGB 1SIJA 2EKIA 1RYJA 1WWTA 3AEDB 3CWIA 1R7SA 1YQ4B 1XLPA 3HRDD 1NYQA 3VR8B 1VLBA 3VRAB 1WYGA 1TJEA 2BT6A 3LXFA 1XO3A 1PUTA 3RPFC 1KF6B 1N62A 3P4RB 1AWDA 3B2FA 2MH7A 1E7PB 4ZHPA 4P6VF 1JALA 3ETRA 2WQYB 4KX6B 1JQ4A 2WP9B 1FRRA 4ZOHC 2L83A 4YSYB 3W5VB 1ZP0B 2HTME 3AE4B 3AEGB 2KAJA 4N59A 1B9RA 1OQQA 1L6UA 2WDRB 2WU5B 1XLQA 2CU3A 3AE8B 3AEBB 3DWGC 2W55A 4ITKA 2M19A 3SFEB 1KRHA 4YTNB 1T3QA 3ZYYX 5EE1A 5G5GA 3NS1A 1FRDA 1E9MA 1QOAA 1VJKA 3LB8C 4ZHOA 4US9A 3NRZA 1I7HA 2PVOD 1N5WA 2ACZB 2KMMA 2Y5CA 3AE2B 3EUB2 1QLBB 3CIRB 3DWMA 4YTPB 1J7AA 4JX1C 1NVID 2OHFA 1ZUD2 1JW9D 1ZOYB 3SR6A 1SB3C 1VDVA 1JROA 3ABVB 1FIQA 4USAA 5C3JB 3AECB 1OFFA 1TKEA 1DGJA 3P63A 1JWAD 2BS3B 2K5PA 2H89B 1QOFA 3SFDB 2W3SA 1EWYC 2WDVB 1CJEA 2JQRB 3AE6B 3P4SB 1N60A 1GPXA 3NVYA 1CZPA 4HRSA 1FFUA 1RM6C 2WU2B 2M56B 2B76B 5C2TB 2N0SB 5AUKA 1TKGA 3WCQA 5EE9A 2WLBA 4A9AA 3B9JA 4YT0B 1ROEA 2MJEA 3AE7B 4C7ZA 1FM0D 4FXCA 1DOXA 3AB5A 3AE1B 3W9CB 1E0ZA 4C7YA 2JX5A 2MJDA 3AM9A 3AEAB 4N58A 1DOIA 2Q5WD 1RWSA 2FBWB 2G1EA 4IDIA 4YTMB 5MPOA 1AYFA 1QOBA 4YSZB 1A70A 3AE9B 2CJNA 2LEKA 4WQMA 1J7BA 3W5UB 1FFVA 3HVZA 2DBYA 1RFKA 3NVZA 3NVVA 3L4PA 3HUIA 1J7CA 1WGKA 1IUEA 2QIEB 1OQRA 4N6EB 2WDQB 2QJLA 1F0ZA 1FXAA 1GAQB 2BS2B 1V8CA 1YQ3B 3AH7A 4YXDB 1N5XA 1V97A 5G5HA 1UWMA 1YJIA 2L52A 1TKYA 4C80A 1TYGB 1QT9A 2MJ3A 1E6EB 1L6VA 2DWQA 2PKOA 3AE3B 3KWLA 1E10A 1NI3A 1PDXA 3P4PB 3BIID 1N61A 3FC4A 2WS3B 2AX5A 1QOGA 1FMAD 2K9XA 4JWSC 3VR9B 1NEKB 1ZXIA 1L5PA 3AV8A 3AN1A 3AEFB 2E3TA 3PO0A 2PIAA 2CJOA 3FAHA 3P1MA 5H8YE 1JWBD 3NVWA 3AE5B 1YJJA 1WXQA 1JRPA 1XLOA 3P4QB 1DOYA 2W3RA
chains in the Genus database with same CATH superfamily
2BQUA 5B5EU 3IVFA 5J17A 2F2AB 1JRUA 2BW2A 2EANA 4TURA 2GRIA 2NV3A 4XWTA 1SL1A 2KMAA 1ZQKA 3VQIA 2V0GA 2HHQA 3B2GA 1QQRA 3D2SA 3DBHB 4NZLB 4DFDA 2KLGA 4Q8EA 3PZ8A 4NNJB 4ZH4A 3VR8B 1MFWA 4TSSA 4B9VA 3VRAB 1SEBD 9ICGA 5AM1A 4RH6A 1Q0WB 4ASWC 5E6PA 2ON8A 8ICFA 2REXA 3RAQA 5CP2A 4TQ0A 2M0XA 4ELTA 3HKZF 3KTQA 4B9MA 3WA0A 2HBMA 1D5MC 3LYSA 3UPQA 3QZ7A 2K8AA 1QILA 3GV8B 3Q8AA 1WR6E 4A8XC 1OQQA 1JWUD 3I76A 1XLQA 3HPOA 2CU3A 1X9MA 5ALOA 2WX0A 2FAZA 5BYRA 2BPCA 4KLMA 2ZXIA 1VJ5A 1GC6A 2NTTA 3I63C 3RTVA 2W7OA 2WF5A 4B9LA 3SD5A 1FEHA 1RFAA 4RGMA 2L00B 1GUAB 4TMAB 3H0LB 5D4BA 4NJ7A 1SXEA 1S9FA 2KMMA 3ETLA 1HTOA 2JZPA 1OEYJ 3FILB 4KVGB 1B4FA 2CHXA 2R8JA 2XGQA 4G3XB 4QW9A 1KKXA 1XCTL 2ZJDA 4DL4A 9ICVA 2O6VB 1FIQA 3D2QA 3D2NA 2KFJA 2XBBC 4O0IA 4P4MA 2D3CA 3UMBA 2IO3B 2NR2A 1P3QU 3PT2B 2JGAA 2J0JA 3C28A 1N60A 1NK0A 1S77D 3PV1A 5IA7A 3KUDB 4IM3A 5DPRA 4CHKA 5J2FA 2LVQA 2WGSA 3TQ1A 4MHVA 5IO9A 2MUTB 3M3JA 4EYHB 1I4XA 4UW9A 3AU6A 5KHQA 7ICJA 1VCBA 2KJ9A 2KKVA 3N1YC 1JUDA 3QUCA 1K8RB 2I1KA 2JWUA 4A8EA 3BZCA 2X8XX 3OHBA 2PKEA 4O3PA 2RLTA 1E7UA 1DK2A 1SE3A 4EEYA 5KG3A 1WY8A 3L4PA 3U2SC 2KFKB 2DKXA 7ICMA 4YN4A 1HE8A 1TY2A 3KYCD 4NY8A 1HZ5A 3A4RA 1C76A 2HDEA 4M8NA 4HJKA 1X42A 1E10A 1ZOLA 4DS4A 3JYUA 3WK8A 4P0PA 1A5RA 4ANWA 1K53A 1UBIA 3BWUD 1I4PA 4CRXA 2LRWA 1E7VA 2K25A 4JWSC 1ZXIA 3FAHA 7ICSA 1FNVA 3J9CA 4NXZA 3MGIA 3V6CB 1XLOA 3H1UA 3AUOA 3RF9A 4XDDA 2HDOA 5KHOA 3EHVA 3QK0A 3RFAA 4RQ3A 1P7EA 4RCOA 3TACB 2NTSA 2H3QA 1WXMA 4NQLB 4GIVA 4TUQA 1TS2A 2M0NA 8ICPA 1TS5A 1KL9A 1WE7A 2KXJA 2M17A 4QZIA 4UAVA 2AQ2B 2DUYA 2D10A 1R4NI 4HKQA 3ECIA 1ZQIA 1YQ4B 2QC8A 1Z4NA 2ZTDA 4FFDA 4RQNA 3N9YC 5AM4A 2KWUB 1L6NA 8ICZA 5ALTA 3MFHA 2J0MA 2MH7A 3B0AA 2EZYA 4BXOA 3F2DA 4YR2A 3VC8A 4DFJA 1KM7A 4NAWA 3W1SA 3JVZX 1QQ5A 5KG5A 1B9RA 4N59A 4MH8A 2NRVA 2K8BB 3TUOA 1UGMA 5ALHA 4UB2A 2OJWA 4CYEA 4DL6A 2HHXA 2AGPA 3D32A 4BGDA 3SV4A 4O3NA 5AKKA 3HW8A 2J4XA 2YEPB 2Y0SC 1URJA 1KDHA 3MC1A 2ZNVC 4YTPB 2UVWA 4Y2SA 4JX1C 3H4DA 3UXPA 1PK3A 1XF5L 5ALSA 1L0YB 2WXIA 2WYQA 4O3RA 2Q0ZX 2NRXA 1OUQA 5AICA 1U4AA 3ABVB 2IZVB 3QCAA 5AEKB 5KT6A 1JWAD 4O5CA 2BTEA 2H89B 4DQQA 3Q8KA 2HD5B 1H8CA 3I28A 1KRPA 1BGXT 4IRKA 2KTRA 5H2FU 3WK6A 1BXTA 4IWOA 4DSFA 3RJFA 4RQ6A 2WXOA 4NQKE 3U30A 2LUMA 9ICLA 4NLKA 2EELA 1KBUA 3ZDCA 2AQ3B 2V9HA 4RQ0A 3H7SA 4A20A 3OLMD 1QCKA 2RQ5A 4MFAA 3DHGC 4KLTA 5AK3A 2MHJA 1ZD5A 5KG1A 4N58A 4CF4A 1YN3A 4IDIA 1TZOA 5MPOA 1A70A 2UVRA 2CJNA 4PGQA 4WQMA 2JZZA 4DEZA 1IPGA 2GLSA 4RGNA 2QARB 4F71A 4IWPA 5KFKA 3N7PD 4E74A 3PVXA 3B08A 2RD0A 2OM6A 1NK5A 2DNFA 3WK9A 4J9PA 1BUIC 4HK2A 1YQ3B 4YR3A 4NY0A 3UIPB 1EF5A 1XSLA 2JEGA 3RH4A 1TYGB 2KN4A 3DBLI 4EFOA 2MSNA 3VCBA 2QILA 2Q4TA 1KEJA 3MGVA 2I1JA 3GP7A 3T8MA 2BYTA 1RG6A 1UGJA 3FC4A 1GO3F 1X9SA 3KFUF 4EENA 5JTIA 3HT3A 3IV6A 4J9LA 5JHBA 2YB4A 3ZJTA 5HHHA 2E3TA 3JPRA 3Q3MC 2Y1JA 4HPMB 4QZGA 5JU5A 2XK5A 3IN5A 4HEA1 1UA0A 1WRIA 2K39A 2V4LA 4YSXB 1HZ6A 5J0UA 3RULA 3SV3A 3TAQA 2O6KA 1K5OA 4TUPA 2JF5A 3ONNA 1RPLA 5JUMA 3QEBZ 3T3NA 1KFYB 1SL2A 3DVGY 4Y2XA 1I4RA 4JGHB 4Y2TA 3GS2A 4GIBA 1EO6A 5AKGA 1NK7A 1V9PA 3OPXA 4NLZA 1SIJA 3AI5A 3PRPB 4MFCA 5KL8B 2ZCCA 3C19A 1R7SA 4ANUA 5ALRA 2BYVE 1VLBA 5D2MB 1KH0A 2BT6A 3EPGA 1QH9A 2LPEA 3ONSA 4Y2JA 2Y0SF 3F53A 1A77A 2FDRA 5DQGA 5KT4A 2KNBA 3E2EA 4DHJB 2DYOA 4MGIE 4PYUA 2DPJA 5FR3A 3MC8A 2C2EA 4GSWA 2VZKD 5DCNA 1TK0A 4UAWA 1YT3A 4I2AA 4I2DA 9ICBA 5J29A 2JRHA 1YX5B 2RSUA 5AK4A 1L6UA 1RQNA 5J18A 4DFMA 4IRCA 8ICRA 2JT4B 2PMVA 4ITKA 4I2HA 1RRBA 5IILA 3RNBC 3JPPA 1FRDA 1J8CA 2JMGA 2IO2B 4BKTA 1QQ6A 4UARA 5ALDA 2E8MA 1D9FA 1LGRA 5KFVA 2KSOB 3U8ZA 7ICTA 4R8UA 3ZUNA 3H4BA 3Q6BA 4C8NA 3RZFA 4TV3A 1K50A 3EWAA 3ZJVA 1AN8A 4I6NB 3S2AA 5DG7A 5KFOA 3OAWA 3PLUA 3T5HA 2N7DA 1NK9A 3N3KB 2KJ8A 2FPMA 3V60A 1GPXA 2R18A 2ZIVA 4UAZA 1N48A 4QZBA 1C7YA 2K8HA 1C77A 3RBEA 1XS9D 2UU7A 3SDLC 3QU4A 4F5RA 4R64A 2ZG6A 1P7FA 4OZAA 4EKUA 4MM3A 1ROEA 3AE7B 5ALUA 2GMIC 5AM3A 2MWSB 1Z1BA 2BDUA 5DPWA 4K81A 3KHGA 1GB1A 8ICIA 5CR0A 3APCA 4EEWA 2NRZA 2ZPNA 4WWOA 2INPE 3NUHB 3L54A 3BZDB 4PS3A 2G3QB 5ALNA 3NVZA 4ZYNA 2CHZA 3EFUA 2KD1A 2EMSA 4KIKA 5J2IA 4JQWC 1L3SA 2QJLA 3ZGZA 2G08A 3ED5A 4DXFA 5K4LA 1CUKA 1BPDA 4ECYA 1LV5A 2KDEB 1F5SA 3H9DA 3KWLA 2XNAC 3NOBA 5DBBA 1L7YA 1N61A 1Y88A 3RRHA 4I2GA 3KZIU 1X1MA 3DBRI 2AX5A 2K9XA 4KV2A 4MDKE 1YN5A 2VH2A 2DLBA 3AV8A 3RJKA 2CU1A 4KLSA 1TBEA 3QARA 3RAXA 3ZVVA 5IKCM 2KTQA 5J2KA 1X40A 4QAYA 1NI2A 5J0OA 2V3PA 2I5HA 1KLNA 4A3OA 1TGZB 4LJPB 1BNPA 2INCC 4F5NA 4IW0A 1KSPA 3NGDA 2ASLA 3PVLA 4JIOU 4ARCA 4M0AA 2JXXA 2JZBB 2N9EB 1NOMA 4YMOA 1BPEA 3IG3A 5ALGA 1I35A 2W8LA 2RPQA 2LKYA 3QUBA 3H8JA 4LCDE 2ZPYA 3T5KA 3I3TB 1P98A 2KJHB 4YL8A 2PE6B 2PJHA 1JMSA 3WAPA 2EMTA 2D2QA 2UVVA 5D46A 2M4NA 1ZQOA 4K7SA 4P6VF 4J03A 3HIZA 3WK7A 1JIHA 4J9QA 3G6YA 1NDDA 1T0QC 3RZWC 1WM3A 4DHZB 4WH4A 4TQRA 5LXHA 1XO0A 1KFDA 1RZTA 3DBLB 2AXTU 2KDMA 4DOAA 3FILA 1LB2B 4RNAA 4IWQA 5ALMA 4RQ4A 2BGFA 5CRXA 2GI9A 1I7HA 2O6VA 2RPVA 2Y5CA 2GBMA 4C4SA 2BZFA 3GIJA 2NBVB 5LLIA 1WCNA 2B21A 2JYEA 5AIAA 4LZGA 2ES6A 1D5ZC 2ZVOA 3SAFA 4HAIA 4DF8A 4B0EA 5AI9A 4GU2A 2E8PA 1ECWA 4EZJA 3SAHA 1TZ1A 1D8BA 3C8YA 4RPZA 2MUTA 4OJ6A 2IGHA 3R8BA 4QZAA 4UB5A 2JR5A 3TJPA 2ISPA 3QUTA 2BVCA 1TKGA 5J0RA 5AKIA 2ZW1A 3O13A 2P6RA 3B9JA 2MJEA 1YJ1A 7ICFA 4EOYA 1K1QA 1SKWA 2EZZA 2C22A 3M9MB 2KFNA 5KFQA 3EFCA 1TE2A 4YTMB 1WX7A 4A6QA 4ED6A 8ICCA 3KWVA 3AU4A 3UXOA 2KFKA 3MDAA 5DQHA 1KOTA 3LDZE 4GN1A 2OYYA 2W7PA 1RFKA 2MP2B 2VA3A 2JZ3B 2PEAA 2OXOA 1N6ZA 4IQVA 3TARA 4II2B 2WXFA 4DQIA 3BS7A 3SEBA 1MQ3A 1FXAA 3U26A 5ALLA 7ICEA 1TAMA 2HHTA 3AE3B 4OW0A 1MHHE 4FZMA 2L0TA 3U4EG 2MQJA 3FKYA 3BYTB 1D4BA 4IQWA 5HI1A 1WH3A 1WXQA 1ZQLA 4QZEA 4GXJA 2AHOB 4WWMA 4G50A 4AUQC 1X6JA 5EE3A 2YVCA 3V61A 2N9XA 2W54A 4ICAA 4F91B 1QF6A 1COOA 3EECA 2IGDA 1CRXA 2BCQA 4G0NB 4ECZA 3VVWB 4C56C 1J19A 1V38A 2CXYA 5LNK1 1ZQCA 4KDLB 1RYJA 4I2BA 2ISOA 2D07B 3PS6A 2LUEA 8ICJA 5J0TA 1PUTA 4F4KA 1WYWB 1UH6A 2K8BA 5DGAA 2PI4A 2HJ1A 4GFJA 5CX3A 5FP0A 3ETRA 2KX0A 3HVDA 3V62A 4KX6B 3VAWA 1TIFA 4E0DA 4GLXA 4GXKA 1GG3A 4BKSA 1TK5A 5AI0A 3R7RA 2HCFA 2W55A 3HHMA 4C4TA 5C5JA 4UB6U 4J6IA 4ED3A 4M8MA 4PYZA 1E9MA 3KQ4A 1ZYQA 3B0XA 2FCMA 5DLFA 3K9PB 5IAAC 1Q8KA 5J2CA 2KVCA 2LXAA 1L3UA 2HOFA 1G6JA 3TKAA 5DB6A 2A4ZA 3WAMA 2KACA 7ICOA 3ZIMA 1DXSA 4FBTA 4M0WB 2K5PA 2K6DB 3GU3A 1EWYC 1FCCC 1CJEA 5C2TB 3QYPA 2B76B 2M56B 5AKXA 4ED7A 1KQQA 3IT4B 5HFYA 3QX7A 5DB8A 7ICNA 3KD3A 1D8YA 4Q45A 3Q8FA 2AH5A 5EWFA 1A6SA 1DOXA 2C2DA 4IOIE 4PS8A 2NPTB 4ECQA 3C23A 3RH6A 3BQ0A 4ZRIA 8ICHA 4W9KA 2QARA 1AYFA 1QOBA 2CR5A 2EH9A 3BVZA 3AE9B 2NBWB 4RQ7A 1MC8A 1WGDA 1Z4OA 4PHDA 2EAMA 4F5PA 4CO7A 2WDQB 4NM1A 1EU4A 4PHPA 1P7DA 2P6UA 2GLEA 3KHRA 4GXBA 2EAPA 3M1YA 4M9LA 3SAGA 1YJIA 3LVWA 3W1YA 4NL9A 1E6EB 5L1IA 3G6XA 1BPXA 1MG8A 3PHWB 1HJPA 1HUZA 4ZDVA 3QU9A 1PVPA 2ZCBA 3GE8C 3EGRA 2BCSA 1NEKB 9ICXA 1KLGD 4KLEA 9ICNA 2G09A 2FMSA 1JWBD 4DF4A 4OJLA 1GOZA 3P4QB 5CWRA 5HR6A 2KOXA 2ZJ5A 4ECSA 1P0RA 4DWIA 1NYRA 2W11A 5AZFA 4G11A 1F9JA 1ZPSA 2BS4B 4LTUA 1BPBA 5AUIA 2WXJA 2XVTA 1FXIA 2ASQA 4UAYA 1YZ6A 4Y2VA 3GDXA 4I6PA 3M9OB 3ZJUA 1GC7A 4XQ8A 3QWZB 3HRDD 5DG8A 5J0XA 1MSWD 2JYTA 5HKHA 2ZTCA 1ZW7A 1LO5D 2KVZA 2MBEA 4LNFA 3LYYA 2VA8A 3KKAA 4QZ8A 1JXEA 5AKYA 1UZXB 4IC7B 2WQYB 5A0LA 5D3DA 2HMXA 2Z7JA 4CF5A 4UB1A 4P4OA 2A5UA 2KZRA 3S6JA 2VIXA 1VZ6A 4F50A 4LJOB 1YD8U 1X9WA 3QU5A 5G5GA 2KHVA 2KSOA 1M6YA 2F1IA 3KH0A 4B0MA 2ZUCA 1Q1OA 1V86A 5IN7A 3TCAA 2I1QA 2OHFA 3RI7C 3NTUA 3H40A 2FMQA 5KFLA 4RT2A 1DGJA 3OGUA 5ALVA 3L0WB 4KZ0A 4RU9A 4PS7A 4S0RA 4QJFB 2N1WA 9ICEA 1U47A 2B6GA 4X57B 2K4HA 4KN7A 5CEHA 2YY6A 5AKHA 5KFGA 4RZRA 4ANXA 2MRLA 4BWJA 2KT7A 4O1NA 5J8YC 2LJIA 2QSDA 1ZQTA 3AB5A 5G55A 1C3TA 4GDLA 4TUSA 3MC9A 1BNOA 5DPTA 3HILA 1RWSA 2FCNA 1KW4A 4R3DA 2Y9TA 4F93B 3M8RA 1HQRD 1UBQA 2G1EA 4ZYSA 1C4AA 4YSZB 2KN7A 1WF9A 3JPOA 3KVFB 5KAFU 2L7RA 3ML8A 1D9DA 1LFDA 3NVVA 1NJZA 1J7CA 4QZFA 1MG4A 3AU5A 3N32A 4L23A 1Z5SB 4UBCA 4KLJA 5IIOA 1ZQNA 4HJGE 2K89A 3A1QB 3N97B 3M95A 2PFPA 3LK9A 3VTVA 4O3SA 5HR7A 3UQ2A 2WXHA 2DWQA 4IQTA 1WXSA 1RYRA 2AQ0A 4GDKB 2ZNVB 4XZ4A 5ALJA 3I1YA 4KLLA 2AQ1B 4B9UA 4DDID 7ICHA 4C8OA 4J9NA 4DO9A 2O6VD 2YMQA 2PPHA 2J53A 1UT5A 2PIAA 3O0FA 2WF8A 2HBKA 4ACOA 4Q44A 3L3FX 5ALKA 1S1QB 3QUQA 3ICXA 3A33B 1K51A 9ICPA 2MBOA 4Z6FA 1YX6B 4CGZA 5BO4B 2PVGC 1TAQA 3TFSA 4IRDA 2JZBA 3VUWA 8ICWA 4RQ1A 5DG9A 3I57A 2KO3A 1J2MA 4W9IA 5AM0A 4DQPA 5IP4D 8ICLA 2D3GA 2PLPA 2K0PA 2ODGA 1NYQA 3V05A 4DFKA 3RJGA 2V3SA 4MEXA 1KF6B 1RAXA 2XY6A 3PX0A 3B2FA 1DOQA 1U9LA 2A3VA 3C2MA 3X0WA 3AE4B 1F1HA 5KFIA 4GXIA 3PREA 1SJHD 5TSSA 4Y2RA 3RJJA 3FM9A 2IA6A 1L7NA 1PK1B 1OQYA 2KWDA 2KJ5A 2XGPA 2KNJA 2HI0A 1QTMA 5EE1A 1CK1A 3NS1A 1WJ4A 3IP4B 4FJZA 3VTUA 1SE9A 3AULA 1Q10A 2QKQA 3HP6A 2N9KA 4F4XA 2ACZB 1NJXA 1ZQJA 4WJPA 2BDPA 2R8KA 4OO1J 2R8IA 4ED2A 2BB5A 4W9EA 2PFNA 1WIAA 4K1RB 1GNUA 3BQ7A 1Q5WB 2KK8A 1OFFA 2BYFA 3ZDMC 3PW7A 2KFZA 4ECXA 4GMVA 3SFDB 4OVUA 3IT6B 2P66A 5KG6A 2FLLA 5KT7A 1ZD4A 3A0BU 2JXTA 1M4VA 4DQSA 4NLCA 1FM0D 3EPIA 1N2XA 3GZNI 3BS5B 2O2VB 3RH5A 2WB1C 5J0PA 1UUPA 1LXDA 2G5IB 3O65B 4R65A 1R4MB 2MP2A 1L5UA 5KFXA 1VD2A 3IDWA 1XEEA 1X6IA 2JXJA 2ALZA 4K3CA 4BX9C 1C20A 2JUOA 4NLNA 5IIKA 3ZDEA 3HVZA 4Z6CA 2H3IA 4WWPA 7ICQA 2RDJA 4KLUA 3PO5A 2CPRA 2LGXA 4FO6A 5DB9A 1OQRA 4WJQA 3WALA 5JH5C 4J9OA 1V8CA 1UQVA 4ECWA 2HE7A 1ZQPA 4HDQA 3A4SC 3ZNGC 3QNMA 2HJ8A 4ZRJA 1CQVA 3SHQA 5AKEA 1TK8A 3A0HU 2MBHA 1PUZA 4I27A 1ZGUB 3RNEC 4ELVA 4YD1A 2RDBC 3PO0A 1C79A 3P1MA 3CP8A 1JWMD 2JH1A 2KN5A 2DFLA 2WXGA 3V6JA 2G06A 1ZQHA 2JH7A 3SENA 2ZJAA 4UBBA 5HHIA 2ASDA 2GBKA 1SIFA 3I5JC 2KD0A 2ZJ8A 2L5YA 4W9JA 2MW5A 5GTHU 3BK1A 1NENB 2I6XA 3IHQB 4C0ZA 5J2BA 3UM9A 4UDUC 3A9JB 2C7NB 3WKEA 3RB0A 1WSPA 1Z3EB 2MA9B 3DQVA 4TQ1A 2NRTA 1MI0A 2YTUA 3C0RB 3RUIB 2BR0A 4J3OD 3TADC 8ICVA 4I29A 1FCLA 1T3NA 1SWWA 3V72A 3RNAC 3APFA 2FNJB 5BPCA 5ALZA 4REZA 1QZEA 4EYIB 3KW5B 1Z00B 2G0AA 3MR2A 3ALBA 3TEWA 3IAS1 4B9TA 7ICGA 2NRWA 4Z6EA 4JLCA 3U7ZA 1ZQRA 2I38A 3V3XA 2A1AA 3BQ1A 1S0MA 1ZE3D 2A19A 2WXNA 4W9GA 4US9A 4ZRQA 5L1JA 4XGAB 5L1LA 2HTHA 3ZD8A 2AQ4A 4KLFA 1TS4A 4M0WA 3PLVA 5ALQA 1WGRA 3TEYA 5FR6A 1VDVA 4A3PA 2WB1F 1X2IA 3AECB 3P63A 1Z2MA 4WJNA 2AL3A 5CHGA 3NZ3A 2VZKB 2KOBA 4FHJA 2XC9A 2NPTA 3Q8BA 4XC2A 5AUKA 3BQTA 4ECTA 1NZBA 4LK0M 4HVBA 1I4HA 2IHMA 3M7DA 1N56A 2ZIXB 5ALWA 4ECVA 4I2FA 4F72A 4RQ2A 5KFBA 5BOMA 2FBWB 2IYDB 1GJZA 1EF1A 1F52A 1MHXA 2GOWA 3ZTDA 3GV7B 2IMWP 1V6EA 3BY4B 4FA6A 4EZKA 3N1XC 4NWIA 1Z1VA 1ZQWA 3ZQ4A 5D7GA 3RN9C 4RT3A 4BVUC 4HYKA 3DHIC 1F0ZA 1WMHB 3C21A 3D6JA 3DV9A 1ZQBA 4YMNA 1TVAA 3H8WA 3U7DA 1DRGA 2LMCA 1QT9A 3PHXB 2W9NA 3WKCA 2BCRA 5LXIB 5J2RA 4QZ9A 1R4NB 2GO7A 4KLQA 3JPTA 2WS3B 2ESEA 4MELA 5HP4A 9ICFA 1B0XA 3C1ZA 3BQ2A 3AU2A 3ZTCA 2ZIWB 2IBIB 2V4RA 1U45A 1SSNA 3NVWA 2JEJA 1SV0C 1FO4A 4ZRKA 1RLFA 4KSLC 2HVIA 1SKRA 1HIWA 3GIMA 2Z0EB 5CHFA 1P1AA 2E1EA 5J0QA 2MSED 1NK4A 4PPXA 1S3SG 3EA6A 4XDCA 3WANA 2DENB 2H3VA 3AMZA 2JY6A 2CKHB 2K22A 2NMQA 4TKNA 3OSNA 2BQQA 3M62B 4Q43A 2EZXA 4KKIA 2C7MB 3UQBA 1V85A 3TAPA 4RQ5A 5ALYA 3DHHC 5AM2A 3K1ZA 3PO4A 3UMCA 4O5EA 3RPFC 2NO5A 1RXWA 3ZDTA 2KQ4X 1PGXA 1BMLC 2AYOB 3PNCA 1TV9A 1OGWA 2BCVA 1UNSA 2CHWA 1YMHE 2HTME 4KKJA 1SWVA 3UINB 1O08A 3QE9Y 2M19A 1ZJMA 4EX7A 3Q3NC 3ALRA 1QOAA 3NRZA 2WXRA 5KFRA 3VTWA 3PV8A 9ICUA 5DBAA 4I2CA 2ZZPB 1WM2A 4P16A 3TSSA 3WU2U 4M02A 2M8SA 1D8LA 1SB3C 9ICOA 5ALFA 5C0YA 4PH5A 3KUZA 3Q8EA 1TKEA 2YLMA 2Y9UA 5AK6A 1YQBA 2BB6A 7ICVA 2KP7A 4J9MA 3L08A 5KT3A 4C00A 4RQMA 3M9NB 3ENEA 3CYMA 3SZ2A 3P4SB 1BT0A 2Z59B 4D2KA 2IJ0A 5JXVA 2FPKA 4PL2A 2RP5A 1ISNA 1WE6A 5KFTA 1L8LA 2PXIA 4WJOA 4BDPA 2WLBA 1ET6A 5TZVA 4YT0B 1F2RI 2PTLA 3MFIA 2LM1A 5KT5A 2N4FA 3CNHA 3KOOA 5AK5A 2FCQA 4ANVA 3DOWA 2M9NA 1NKEA 4P0PB 1XCQL 2YMMA 4KLIA 4O9MA 2C60A 3PSEB 5CA7A 4XWWA 3ZDAA 2VANA 2LEKA 3Q14C 4LDTB 1L0XB 3A1QA 5IIJA 4CNQA 3VH4B 4Z6DA 4M00A 1T0YA 2OH2A 1LKYB 1FXTB 3QC8B 3Q8CA 4JE3B 1SXDA 1L3VA 2WTFA 1ACCA 3JPSA 3R66C 3PSTA 1N5XA 1FNWA 4GDKA 2BBCA 3SI8A 2LVOA 3VDZA 2MJ3A 1C9FA 4RNNA 3H0MB 2PW9A 4KGTA 1NI3A 2CS4A 4FLHA 3RNCC 4KMUA 3PMLA 4HPLB 2MX2A 2MAXA 4KZCA 3Q8PB 5CJ7A 4RF1A 3GOEA 2J6UA 3ML9A 4QWAA 3PW2A 2XCPA 4AOFA 4BFRA 2LBOA 4G3IA 3R9KA 3MFGA 2XIDA 4RPYA 4WJ3B 2BYEA 3EC8A 4RGOS 3RRGA 4QWEA 1F0MA 2PFQA 1JMLA 1AARA 2AU0A 1WWUA 5J2AA 1JWSD 2H88B 2LHDA 4NAWB 2WF9A 3X23A 5KG4A 4AJYB 4EBCA 3GB1A 4KLGA 3IG5A 2YN4A 2V4QA 4OJPA 4HDOA 2DAJA 3WKAA 3LWLA 1E8ZA 5DLGA 8ICNA 2QDFA 1LVHA 2HVHA 2OJRA 1UPHA 5AKJA 2BF8B 3K75D 2IO1B 4LLGM 3QX1A 3MR5A 4BOZB 3ZNHB 1NKCA 4ZHPA 4I6LB 1JCKB 1PK1A 4Y2QA 1TS3A 3LJ3A 4FN2A 2KQSA 3AEGB 2KAJA 3GIIA 2KDBA 3PGEA 3TADA 4MF2A 1MJDA 2KJ6A 3N4MB 2KC2A 4F3OA 1KRHA 3DVNV 1KFSA 3GE3C 3MHSD 2K4EA 3DBHI 3APDA 4MFFA 2JV3A 3SYZA 5L9XA 8ICQA 2ZIUB 5F9NA 2LM4A 5DBCA 3DWMA 3GFKB 4DCCA 4F4YA 2QHOA 2BPSA 2WFAA 3SR6A 4NM2A 5KFMA 2N9LA 2G07A 2KE7A 4F2SA 5C1ZA 2E8NA 1SBBB 4YXMA 1UD7A 5D3IB 2V9WA 4FJYA 4U6PA 2SAKA 2N1RA 3NRWA 3BVMA 3ZD9A 5FK9C 1S5LU 4KGRA 5F9LA 4QZCA 4NJCA 5BMGA 4MT5A 3BS5A 3ISCA 2W9BB 2O2VA 1L4DB 1IM4A 2JRZA 4I28A 2AGOA 3BVGA 2IDYA 2R61A 1ZQZA 4UB4A 4M9GA 4FXCA 4IL6U 1NBFC 1E0ZA 1U49A 2JX5A 3AM9A 1S8OA 2MJDA 1PYWD 4MSMB 5GMVA 1Q3UA 4O3OA 3DBRB 3IXSA 2K8CB 4P0QB 2QB1A 2OWOA 2KYWA 2AL6A 1V5OA 3V6KA 3FDSA 1UT8A 4F5QA 1XSNA 4EZ9A 2LI5A 3ZDDA 2WNMA 4EEKA 3TI0A 1WGKA 2GBJA 2Y5BB 3R7QA 1ZRNA 4FADA 2ZW0A 2B0CA 2EQYA 2BWFA 2YMPA 4YXDB 2FIDA 5G5HA 4URKA 1HTQA 2L52A 2HHWA 4U7CA 2G4SA 4JL9A 3W1SC 1C4PA 3HJEA 4F1SA 4C4VB 2UVUA 4WAFA 2KWVB 4K3BA 2VJ5A 2LGDA 3OJSA 2Y1IA 4QWCA 1ZQUA 1I4GA 3N28A 3JSVB 1CI4A 4MJSB 2XO7A 1QOGA 2XN9C 1TAUA 3C5FA 1T6BX 4XX5A 3VHTC 2J52A 2KANA 5HMMA 2J6TA 2RDGA 2DQNB 2RDIA 3A9JA 4UQGA 4DS5A 5DKWA 3AEEB 1WJUA 4NLBA 1SF0A 2KKCA 3N20C 4JWUC 2GBNA 4G9BA 3M6ZA 4M6WB 1ZQXA 1HEKA 3AL0B 1WGYA 5KG2A 1XLPA 1KFTA 4L1BA 1TJEA 1XO3A 1Z00A 3P4RB 2MA1A 4WAAA 4RQ8A 2W8KA 1JALA 4DSLA 3LVVA 5D49A 2Y5PA 3V6EB 1IBXB 3MTNB 4NAMA 3A9KB 2E5SA 3RB6A 1L2NA 3AEBB 4C8KA 3DWGC 4M04A 3BK2A 1SV4A 5HG2A 4I2JA 1ZQ1C 2ZXHA 2KTFA 3PSFA 9ICMA 1SKSA 3KLSX 1WRDB 3QJZA 1ZXHA 1XWLA 4KDIC 4Y2PA 1JW9D 2WDTB 1JROA 3WKDA 4YVZA 1MPEA 2KX3A 1ZQGA 2VH1A 3CMMB 1WGGA 3T5JA 5BOLA 4LNNA 3NHEB 5KFAA 2UYZB 1B22A 3H7PB 4EZLA 2F77X 3MBYA 4PJ0U 3NS8A 1PGAA 2INNE 4DLGA 4QIWC 1NK6A 1ZQMA 1ENFA 2AGQA 4KGSA 2WU2B 3OHAA 2NCNA 4KIKB 3WCQA 2JEIA 3ZNZB 4XYCA 5EDSA 2KZZA 7ICRA 4OJOA 4P1CC 4FZNA 2WWZA 3RJIA 2JVCA 4QNLA 4B9KA 5CB1A 3K1RB 7ICUA 1A76A 2Q5WD 2N7EA 1WXAA 4X5VA 2N9PC 3F5EA 9ICIA 1S10A 3P42A 2RR9A 2WX1A 4GGQA 4DLEA 2XY7A 1ESFA 3OJ4B 1WMHA 4RPXA 4WQOB 3NASA 3GQCA 4N9F4 3I9V1 2KWCA 2OEHA 4QZHA 1IUEA 3ZRFA 2MCNB 4R66A 2L05A 2F3NA 2BS2B 2C28A 3Q8LA 1TKYA 2PKOA 4HLEA 1L6VA 4MEMA 4JV0A 3L17A 3CSTA 4S17A 3P4PB 2INDC 4ELUA 3T79A 2ZTEA 2C9WB 1F2RC 5E6NA 3PRMB 4DQRA 4JPSA 2ZIWA 5DDMA 3OG5A 2GBRA 4YG2A 3M6KA 1L5PA 4W9CA 3AN1A 2J42A 3MC0B 4RUAA 4DQOC 4IR9A 1KLUD 4PGYA 4W9HA 5D6JB 2N7JA 1DOYA 1VZ8A 2W3RA 4NJ8A 3ISBA 1PGBA 2L76A 4OZCA 1PFDA 2J7QB 1ZRMA 3UXNA 4IR1A 4QWBA 2R8GA 2Z0DB 3Q3FA 2WXLA 5H92C 3K9OB 1D6EC 4WWNA 2HSZA 1YZ7A 2PE9A 2DHZA 2QCZA 1L0VB 3CF6E 1H4RA 5GXGB 9ICHA 5J2HA 4WURA 4JK1A 5ALPA 3JPQA 4M9HA 9ICRA 3QA8A 5E79U 4DSEA 8ICUA 2FJ6A 3BINA 1M94A 4EUTA 3ZDBA 1FNUA 4F92B 1JN3A 2IOFA 5E6OA 2XI9A 1ZQDA 1ZD3A 4DDGD 1RYSA 4QW8A 3VUXA 3H8SA 2GB1A 3RCZA 1FRRA 4ZOHC 1QKZA 4YSYB 2W04A 2WU5B 2F1HA 5ALIA 5L1MA 4DFPA 3AE8B 3Q3JA 5BYSA 4F4ZA 1ZJNA 4MF8A 3ZYYX 1XT9B 8ICEA 4RM9A 2M1MA 4QIWF 4M9JA 1F77A 2D11A 2MU2A 2K1FA 1J97A 2PVOD 1N5WA 3V7LA 3WIMA 2RMMA 3BJYA 2AJQA 1ZDVA 3JW0X 1NVID 2K4PA 5BMHA 4F7ZA 5AKZA 1ZQVA 2F8LA 4USAA 3ISDA 3GV5B 2KKPA 4DL5A 5L95C 4HKZE 2H5XA 3C5GA 5F3XB 4FE3A 3PX4A 5AI6A 2WDVB 3WAOA 5EOZA 2JQRB 3H6NA 5KAIU 2W43A 1NKBA 4KITB 3M63B 3RNFC 5KFFA 4PZNA 4PK1A 4HWIB 1WXVA 3NUQA 5EE9A 4W9LA 4JMUA 1LQBA 4A9AA 2MRPA 4P1BC 5KFHA 3RB3A 1S0NA 1WZ0A 5AKLA 3AEAB 3ZNID 2RDHA 4BJQA 2HW3A 3DCGA 4XE0A 3N7SC 1T7PA 4BWMA 1V81A 5KFZA 2G5HB 1LKYA 1TY0A 1J7BA 1KTKA 1FFVA 4LJXA 3RYTA 3SU8X 8ICOA 1FPYA 2KVRA 3HM6X 2ZUBA 2P35A 3NY5A 2KK0A 4LZDA 2W9CB 1C4CA 5AI4A 1ZQSA 4RF0A 5KFYA 5EE0A 2LYHA 5JRTA 4YD2A 3DBSA 3UI3A 3RFZB 2BKFA 3QHTA 2H3FA 1J0GA 1X9XA 2CRXA 3M8SA 1OXJA 4O3QA 4EX6A 4B95A 3R2TA 3T9LA 3LDAA 1LM8B 2YMLA 3PRZA 1WWVA 1WJNA 5BMIA 1U48A 1S97A 1IV8A 5DB7A 4EZ6A 1UCVA 1ZQFA 3C1YA 1YJJA 3AE5B 3ZLZA 4F5OA 4DK5A 1KLVA 5AZGA 4RNMA 1B1ZA 3PPAA 2KZ3A 2ZEQA 4IKGA 4C8LA 1AQ6A 2HHSA 3IFWB 4RMAA 4F8CB 5TR5A 4UB3A 2LXCA 3RJEA 3PY8A 1L7PA 1JX4A 8ICMA 2LHTA 4BKSD 3H7IA 2WXMA 4JV1A 3IM1A 2EKIA 4R63A 3TEZA 2LRUA 4I2EA 1U4BA 4C4RA 1XD3B 3LXFA 4ICVA 1Q46A 1T0RC 1VRAB 4IM2A 2DF4B 1XSPA 2XEWA 2FI1A 1AROP 4K4IA 4ZRPA 1V1PB 3HM3A 2RRDA 5KG0A 2V3NA 2WF6A 3KZXA 1EM7A 2L83A 4FBJB 3QU2A 1S76D 3OJ3A 2HOQA 3P2BA 1PQSA 2QLTA 1D5XC 2CN1A 2ZIUA 5EWGA 8ICTA 2E6XA 9ICTA 2VA2A 1S0VA 2QB0B 1V5TA 2D3DA 3EUB2 1QLBB 4TQSA 1CMXB 2K3UA 2X38A 1AW7A 4CE6A 5KG7A 2D6FC 4J9SA 3NZSA 3Q69A 4OVVA 1NJWA 2YQEA 2LMRA 2HBJA 5KNIA 1T8EA 1FEZA 2W9BA 3PZPA 1T0SC 2W3SA 2ATLA 3Q8QB 2R2QA 1DK3A 2W82A 3ZO5B 4EE2A 4NPNA 4F2RA 4YP3A 2FUG1 4MGZE 3EZ5A 3T3FA 1STEA 1HEZE 2K8CA 4P0QA 4ECRA 1Z19A 3QAQA 3H8HA 4II3B 4W9DA 3VUYA 4NJ6A 4YFKA 4F8RA 2LWPA 3PW0A 4C7YA 3AE1B 2JEFA 4IM0A 2F8KA 1IGDA 1DOIA 3MR3A 9ICWA 1KJTA 1MN8A 2EAOA 2A1JB 3JPNA 1TT5B 8ICSA 5J2EA 5G2NA 1IXRA 1A0PA 4XA5A 4K4HA 1ZKHA 1XNSA 4KN4A 5BYQA 4C8MA 5CTRC 1HA5A 4O3MA 3ZRCA 4CQNA 5I4DA 2DYMA 2I2YA 5DPSA 2AEHA 3T3OA 2FE9A 5HMLA 4KLOA 1YN4A 4C4VA 1ED1A 3OSPA 1V97A 8ICYA 2LGYA 1L8OA 2V1YA 5KFEA 3C2LA 3OTQA 1J2NA 1JI7A 2LASA 3JSVA 4MJSA 2NYVA 3Q8SB 1PDXA 3KUCB 4OCZA 2C5LC 4FHKA 3KHHA 1NJYA 1D3ZA 1SXTA 2M0AA 2KJRA 3VR9B 1DGSA 3VFKA 1WG8A 3Q8MA 3LWMA 1SJED 4BKGA 2YB1A 3SD7A 4UAUA 4B6WA 4DHJD 1JRPA 3TFRA 4H2AA 3PW4A 1TKDA 3MHZA 4ED1A 4LVSA 3MJWA 3VXWA 1KN5A 3ZXRA 3MDCA 4M6WA 5AIBA 2ASJA 2JWZA 5J8YA 2PI5A 4P4PA 4M01A 1IP9A 4DL2A 3SMVA 2DX5B 4DL7A 3HK0A 1Y8RC 4HROA 3U52E 5AHXA 1OEYA 1QLNA 4JB3A 2VKQA 2AWTA 1EU3A 4MACA 2FLNA 1WWTA 3AEDB 3IBEA 3RT3B 2WAQC 4Y2YA 3HWTA 1I42A 5C23A 2KZMA 1IBXA 2EDUA 5KT2A 1ZQQA 1E7PB 3A9KA 3L10B 3GIKA 8ICGA 4ECUA 3ORYA 2L3ZA 2KDFB 2XICA 2NVUI 2YX8A 1QSSA 2WDRB 3L5KA 5DQIA 4RFBA 3WKBA 4ED8A 2K60A 3C29A 4CCHA 1WUDA 4J9KA 2DZKA 5KFPA 2ICIA 5B66U 2E1FA 1T3QA 1QSYA 9ICSA 3PZDA 2W9AA 5HHDG 3TL5A 1L7OA 4P7IA 4ZHOA 2GWSA 4I2IA 1VJKA 3GZNB 3AXCA 1FD6A 2RHFA 3N7RC 2DZMA 4IC9A 5EWEA 2FMPA 1T5XD 4GB9A 4NL9C 4GDLB 3UQAA 4PGXA 1WX9A 1ZOYB 4JWMA 3L16A 2JHDA 3H7PA 4RM8A 4ED0A 3UIOB 1E8WA 7ICIA 3QEAZ 4HXDA 3J81j 5L83A 4EELA 3KYDD 2FPLA 1TFRA 1UELA 1E5WA 2VRRB 3AE6B 4ARIA 4HRSA 1CZPA 4ICUA 4AP9A 1YOVB 1RM6C 3KBBA 1TTNA 2RGFA 1DYQA 4MGKE 4DXGA 4EBEA 2QMTA 1YIWA 1C78A 3BYYB 2J0KA 3UGBB 1ZDXA 4BBNC 1V1OA 3QU7A 1IGCA 1H38A 2FIFA 4PHEA 4IG7B 4TUUA 5AI5A 1L4ZB 1K1SA 2PFOA 3SQIA 3VH3B 2BCUA 1JXLA 2BQRA 2IY1B 2YEPF 3ZI4A 2DBYA 1SE2A 5AM5A 3V7JA 4BOSC 2MBQA 3V6HA 2QIEB 2EKEC 3RB4A 3AH7A 2KMDA 4M47A 3KKAC 2FUHB 1L3TA 3ZXVA 1RYUA 8ICAA 1NNLA 3B0YA 1B43A 3SEIA 2TSSA 3NJTA 1E8YA 5ALXA 3URYA 4PZOA 5IIIA 1FMAD 5KTQA 5CHVC 3H8MA 3QXGA 5H8YE 4AWJA 2KV2A 2CJOA 2K6QA 3DDCB 4DXAB 4PHAA 2WAQF 2G9HD 1BVSA 3Q8RB 2HHUA 2BPFA 4GLSC 1IIPA 3NZUA 1OTRB 3HX0A 3PX6A 2B3AA 2BWES 4K4GA 1XLNA 4AJWA 1VR9A 4JWNA 1XQQA 2BHNA 1WR1A 4OVZA 2HOIA 2G4DB 2WXKA 2L32A 4OJ5A 3PSIA 2SEBD 1SZHA 4NLGA 3OWEB 2LHEA 1V49A 5GTIU 1ZQEA 2WXPA 4B6JA 4HCPB 5JZEB 4AQ7A 3BZKA 1S0OA 2MEKA 2C2RA 1WYGA 4KMOB 1T94A 3C2KA 2D5GA 5JHAA 4LDTD 1Q3VA 2E8OA 3TBLD 2D3BA 1V2YA 1JQ4A 3UMGA 3TANA 2WP9B 4B9NA 3Q2AC 4LNIA 1ZP0B 1YNTE 4MH0E 4JUZA 2FE8A 4BXOB 2BKRB 3BDPA 2KIVA 3SFEB 2MBBB 4KLHA 3PTFC 2BPGA 2WHIA 4YTNB 2WHEA 5J0WA 2K4IA 3WK4A 4DSKA 4RNOA 4Q2JA 2IPKD 3AE2B 2F44A 4JV2A 1CEZA 3IG8A 1QQ7A 2F1JA 2ZVNA 9ICAA 2UWQA 2GOLA 2LVPA 2BQ3A 5T8IA 3E0FA 1OW5A 4BBNF 5ALEA 2KG5A 2L0FA 1X66A 4OD0A 5DDYA 4KX3A 1K52A 1WZ3A 1QOFA 1XO1A 2BS3B 1PVQA 9ICJA 2LYBA 1QSLA 1XC9A 3H0RB 4MEYA 2D8CA 1WCLA 2Y3AA 5HNKA 2HHVA 3V7KA 2MLBA 3F2CA 4FULA 2DZIA 2GH1A 2KTRB 3MABA 4C7ZA 3CRXA 4DOBA 5IINA 3MR6A 3TEXA 1WI0A 2KHQA 3RD2A 4UB8U 5J2DA 1WGHA 4OZBA 1SL0A 2OEDA 2BGWA 1EUVB 5IOIA 4UATA 3PR4A 2LD9A 1NZPA 3AQFA 4K7WA 1V9JA 2W9CA 4XRHA 2KHWB 4KLDA 3B1LX 1MVKA 2H3ZA 1P9DU 2W9MA 4N6EB 2R8HA 4B9SA 4GOCA 3WK5A 4GC7A 3CSFA 4LNOA 1UWMA 1XXGA 3R2IA 4C80A 3W9CB 2IGGA 2OCEA 3THVA 5J2GA 2PMZC 1BPZA 1T4GA 2R2OA 3RBDA 2IBKA 1MQ2A 4DOCA 2IHNA 2IY0B 3TMPB 4BZAA 4FBUA 2DZJA 1KTQA 1XU4A 2IOHA 2XY5A 2JPHA 3DVGX 3E58A 4IS7A 2XCAA 2KDIA 2QEJC 4K7UA 2IO0B 3EYZA 4F4WA 4UASA 3L13A 4YQWA 4E3CA 3QIJA 2ONQA 3DDHA 4DBGA 4MSQB 2J6SA 4EBDA 2FLPA 5T14A 4QZDA 4AYBC 3R3MA 5KFCA 1L7MA 2XK5B 3MJ5A 1N63A 5KFDA 3VRBB 4GC6A 4O5KA 1GB4A 2JU6X 3Q3OC 5KFUA 3GILA 1V80A 2JSVX 1ZQAA 8ICXA 4AS1A 4BUGA 2I9GA 4US8A 8ICBA 1O03A 3GZFA 2LZ6A 3CWIA 3K4GA 7ICKA 1WJ6A 1EXNA 4YWGG 4E71A 5AI8A 2V4IB 1V1PA 1ZD2P 2JRIB 2BKEA 3F5AA 4MGYE 4M2YA 2LYAA 1RQLA 4NV0A 3DPDA 1N62A 2KICA 3QQ8B 5E6JA 1AWDA 3DVNU 4YXJA 5DGBA 3PW5A 3E9SA 2FCSA 3PMNA 1F44A 4DSJA 4DL3A 3W5VB 1PZNA 3E56A 4CDGA 3UF8A 2NS5A 3W2DA 1E90A 1I4QA 1MA7A 4BAXA 2HBLA 2QB0A 5J0SA 2NBUA 5J2JA 3RR8A 5KL1B 2NO4A 2KC1A 3ZKJC 1Y56A 2OOBB 2DGZA 3KHLA 2WXQA 4OHJA 3LB8C 3RMKC 2L8JA 2KVSA 3CIRB 4FJVB 2DKZA 3HKZC 1IG6A 1J7AA 1SV0A 1C1YB 1ZUD2 1ZETA 8ICKA 2LFIA 4KSKC 2KLCA 4QWDA 9ICQA 4HCNB 1COKA 2D3AA 3EW9A 3QZ8A 5C3JB 1RXVA 1ET9A 5FKAC 7ICPA 3NG0A 4A90A 4J9RA 3RR7A 3AEVA 1UWXA 4PL1A 4R8UB 3CW2C 3MP9A 1SGHA 1HUOA 3NVYA 5TISU 3PZ7A 1FFUA 3TIXA 3PR5B 1E8XA 4DWFA 5KFSA 2WF7A 9ICCA 3N1ZC 5J0YA 2N0SB 4LNKA 5L1KA 2F76X 2A1JA 1UF0A 4KTQA 4YR0A 2ZIVB 1UA1A 5KFJA 4FZLA 5CHWA 3RNGC 4DHZE 3T5LA 4WIPA 5KFWA 3IRUA 3UQ0A 4MM3B 3DEEA 2PMZF 1RDFA 5IIMA 3MGHA 4RGTA 1NK8A 2IOFK 2DPIA 4M9NA 1EWCA 3IHPC 2KMCA 3W5UB 1BPYA 2DAFA 4A55A 4DSIA 4ACFA 4IQUA 5AZHA 4YCXA 3OJUA 3N30A 3IAM1 4Y2UA 5KFNA 3HUIA 1VZ7A 2L1AA 2LGSA 3PSPA 1SZPA 4RUCA 4KX5A 1GAQB 2KEYA 4YMMA 4CF3A 2KQ7A 4FS2A 1WFYA 9ICKA 2LGIA 2DL0A 2ZIXA 4L2YA 3ZW3A 4PT5A 2DYBA 4AYBF 2KIWA 1SGGA 4Q8FA 4AP4C 2N1VA 3BIID 3FYHA 2VJ4A 2W03A 1UHUA 2LI6A 4IUMB 4W9FA 1HXYD 3RJHA 4HPPA 1IYFA 1R4MI 1WX8A 2LJ5A 4XUSA 1SE4A 3F2BA 4FS1A 3AEFB 3G6VA 5D94A 3AQEA 7ICLA 2C7HA 1ZQYA 1PVRA 4P2HA 2G45B 2ZUDA 2Z8LA
chains in the Genus database with same CATH topology
1FO4A 1B1ZA 4IKGA 5EE3A 2BW2A 1QF6A 2W54A 2GRIA 2IGDA 4XWTA 3EA6A 4XDCA 3VQIA 2V0GA 4C56C 3B2GA 3AMZA 1QQRA 5LNK1 2K22A 2NMQA 2WXMA 4NZLB 2EKIA 1RYJA 3TEZA 3PZ8A 4KKIA 3VR8B 4TSSA 3VRAB 1SEBD 3LXFA 4RH6A 1PUTA 1VRAB 3RPFC 2ON8A 2KQ4X 1PGXA 4TQ0A 1BMLC 4ZRPA 1V1PB 3ETRA 3HVDA 1UNSA 2V3NA 1D5MC 4KX6B 1EM7A 2L83A 1QILA 3Q8AA 1YMHE 2HTME 4A8XC 4KKJA 1OQQA 1JWUD 1XLQA 2CU3A 2W55A 1D5XC 2M19A 5BYRA 2E6XA 2NTTA 1FEHA 4RGMA 1E9MA 1QOAA 3NRZA 4TMAB 2WXRA 3KQ4A 2KMMA 3EUB2 1QLBB 2JZPA 3FILB 4P16A 2K3UA 3TSSA 2X38A 1AW7A 1XCTL 1SB3C 1FIQA 3Q69A 3Q8EA 2KACA 1TKEA 2K5PA 2BB6A 2W3SA 1EWYC 1FCCC 1CJEA 3P4SB 4D2KA 1N60A 2W82A 4EE2A 2IJ0A 5JXVA 5C2TB 2M56B 2B76B 2FUG1 2WLBA 3IT4B 1STEA 5HFYA 1HEZE 1ET6A 4YT0B 1F2RI 1I4XA 3H8HA 2PTLA 3Q8FA 1DOXA 3AE1B 4C7YA 4IOIE 1IGDA 1DOIA 1XCQL 1AYFA 1QOBA 2JWUA 4XWWA 3BVZA 3AE9B 2LEKA 5BYQA 1HA5A 1L0XB 1SE3A 4CQNA 5I4DA 3L4PA 3U2SC 2DYMA 2I2YA 3T3OA 2WDQB 3Q8CA 1EU4A 1TY2A 1YN4A 4JE3B 1HZ5A 1ACCA 1N5XA 1V97A 1FNWA 2BBCA 1YJIA 1C76A 2HDEA 1C9FA 2MJ3A 1E6EB 1E10A 2PW9A 4KGTA 1NI3A 1PDXA 1K53A 3BWUD 1I4PA 1SXTA 2M0AA 3EGRA 3VR9B 4JWSC 1NEKB 1KLGD 1ZXIA 4RF1A 1SJED 3FAHA 1JWBD 1FNVA 3J9CA 1JRPA 3MFGA 1XLOA 1GOZA 3P4QB 4H2AA 4RGOS 3MHZA 4XDDA 1NYRA 1P7EA 4RCOA 1JMLA 2NTSA 1JWSD 2H88B 2LHDA 4NAWB 1ZPSA 2BS4B 4LTUA 5AUIA 3GB1A 1TS2A 4HROA 1TS5A 2WXJA 3U52E 1FXIA 2AQ2B 1EU3A 4MACA 1WWTA 3AEDB 4HKQA 1YQ4B 3ZJUA 3N9YC 3HRDD 2JYTA 1LO5D 4LLGM 1IBXA 3LYYA 2MH7A 1E7PB 4ZHPA 1JCKB 1TS3A 2WQYB 3W1SA 5D3DA 1B9RA 3AEGB 2KAJA 4MH8A 4N59A 2WDRB 4RFBA 1VZ6A 2ICIA 1KRHA 1T3QA 5HHDG 5G5GA 4B0MA 4ZHOA 1VJKA 2J4XA 2YEPB 1FD6A 3DWMA 1T5XD 4YTPB 4JX1C 1XF5L 2OHFA 4GDLB 1L0YB 3SR6A 1ZOYB 2WXIA 3ABVB 2N9LA 1SBBB 1DGJA 5D3IB 1JWAD 2BTEA 2H89B 2SAKA 3BVMA 4ARIA 3AE6B 5FK9C 1BXTA 4HRSA 1CZPA 4KGRA 2WXOA 5BMGA 1RM6C 2LUMA 4MT5A 4NJCA 2EELA 2AQ3B 1L4DB 1DYQA 4DXGA 2QMTA 3BVGA 2IDYA 2R61A 1C78A 3BYYB 4FXCA 4O1NA 1ZDXA 2LJIA 2QSDA 3AB5A 1E0ZA 1V1OA 1IGCA 2JX5A 2MJDA 3AM9A 4N58A 1PYWD 3IXSA 1RWSA 4R3DA 1YN3A 1L4ZB 2G1EA 1HQRD 1TZOA 4IDIA 5MPOA 4ZYSA 1C4AA 4YSZB 1A70A 2CJNA 4WQMA 2YEPF 1SE2A 2DBYA 4RGNA 2WNMA 3NVVA 1J7CA 1WGKA 2QIEB 4L23A 2ZW0A 1BUIC 3AH7A 1YQ3B 4HJGE 4YXDB 5G5HA 2L52A 1TYGB 2KN4A 2WXHA 1C4PA 2DWQA 2QILA 4WAFA 3GP7A 2BYTA 4GDKB 1UGJA 3FC4A 2TSSA 1I4GA 2AQ1B 1QOGA 1FMAD 2XN9C 3URYA 3ZJTA 2J53A 2E3TA 5H8YE 1T6BX 2CJOA 2PIAA 4HEA1 2J52A 1K51A 1WRIA 2G9HD 2PVGC 2RDGA 1HZ6A 4YSXB 4GLSC 1XLNA 3AEEB 1SF0A 3I57A 1VR9A 4JWUC 3T3NA 1KFYB 4OVZA 1I4RA 2WXKA 2L32A 2SEBD 3GS2A 3OWEB 2LHEA 1SIJA 2PLPA 2K0PA 2WXPA 1R7SA 4AQ7A 1XLPA 4L1BA 1NYQA 3V05A 1VLBA 2MEKA 1WYGA 1KH0A 1TJEA 2BT6A 1XO3A 2D5GA 1KF6B 3P4RB 3B2FA 2DYOA 1JALA 5FR3A 2Y5PA 2VZKD 1JQ4A 2WP9B 1ZP0B 3AE4B 1YNTE 5TSSA 1SJHD 4NAMA 1IBXB 2FE8A 1L6UA 3AEBB 2KWDA 3DWGC 3BK2A 4ITKA 2PMVA 5HG2A 3SFEB 4YTNB 5EE1A 1CK1A 3NS1A 1FRDA 1Q10A 4Q2JA 2IPKD 2N9KA 3AE2B 2ACZB 3KLSX 1ZXHA 2BB5A 1JW9D 5T8IA 1JROA 1MPEA 1K50A 1OFFA 3ZJVA 1AN8A 1K52A 2BS3B 1QOFA 3SFDB 3IT6B 1PGAA 2INNE 1GPXA 1ENFA 3TUOA 2Y3AA 1C77A 4KGSA 2WU2B 3WCQA 2JXTA 1P7FA 4OZAA 1M4VA 1ROEA 3AE7B 4C7ZA 1FM0D 3TEXA 1UUPA 4OZBA 2Q5WD 2OEDA 1GB1A 3P42A 1XEEA 2INPE 1ESFA 3NUHB 3BZDB 3HVZA 3NVZA 1MVKA 3I9V1 1IUEA 4N6EB 1OQRA 2QJLA 3ZGZA 2BS2B 1V8CA 4DXFA 1UWMA 1XXGA 3R2IA 1TKYA 4C80A 2PKOA 3W9CB 1L6VA 2IGGA 3KWLA 2XNAC 3P4PB 1CQVA 1N61A 1F2RC 4JPSA 2AX5A 2K9XA 1YN5A 2DLBA 1L5PA 3AV8A 3AN1A 2J42A 3MC0B 1C79A 3PO0A 2QEJC 4DQOC 3P1MA 1JWMD 1KLUD 2N7JA 2WXGA 2ONQA 1VZ8A 2W3RA 1PGBA 1DOYA 4OZCA 1PFDA 2V3PA 5H92C 3MJ5A 2WXLA 1N63A 3BK1A 3VRBB 1GB4A 1NENB 1D6EC 2JU6X 4UDUC 2JSVX 4TQ1A 1WSPA 4AS1A 4ARCA 4US8A 1L0VB 1MI0A 5GXGB 4WURA 3CWIA 4J3OD 4YWGG 2V4IB 1V1PA 1FCLA 1FNUA 1N62A 5E6JA 1AWDA 4P6VF 3E9SA 2GB1A 4REZA 1FRRA 4ZOHC 1QKZA 4YSYB 3W5VB 3E56A 3TEWA 3W2DA 3IAS1 2WU5B 1I4QA 3AE8B 4WH4A 5BYSA 3U7ZA 2I38A 3ZYYX 3V3XA 2KDMA 3FILA 4RNAA 1Y56A 1F77A 1ZE3D 2WXNA 2WXQA 4OHJA 2GI9A 3LB8C 4US9A 4ZRQA 1I7HA 2PVOD 1N5WA 2RPVA 2Y5CA 3CIRB 2RMMA 1TS4A 1J7AA 1ZDVA 4M0WA 1NVID 2JYEA 1ZUD2 1D5ZC 2LFIA 5BMHA 3TEYA 1VDVA 4B0EA 4USAA 5C3JB 3AECB 4HKZE 1ET9A 3P63A 5FKAC 3C8YA 4A90A 3NZ3A 1UWXA 2VZKB 2WDVB 2IGHA 3MP9A 2JQRB 3R8BA 3NVYA 3PZ7A 1FFUA 2N0SB 3Q8BA 1TKGA 5AUKA 5EE9A 2ZW1A 3O13A 4LK0M 4A9AA 3B9JA 1I4HA 2MJEA 4WIPA 3AEAB 2RDHA 2FBWB 4MM3B 4XE0A 4YTMB 4A6QA 4RGTA 3KWVA 1EWCA 1MHXA 1TY0A 1J7BA 1KTKA 3W5UB 1FFVA 4A55A 1RFKA 3IAM1 3HUIA 1VZ7A 3ZQ4A 2L1AA 2WXFA 5D7GA 3SEBA 1C4CA 1FXAA 1GAQB 1F0ZA 4RF0A 2LGIA 5EE0A 4L2YA 2LMCA 1QT9A 3UI3A 4PT5A 3AE3B 3RFZB 4OW0A 3BIID 1MHHE 2WS3B 1HXYD 3R2TA 3U4EG 1SE4A 5BMIA 3AEFB 3BYTB 1D4BA 1SSNA 3NVWA 3AE5B 1YJJA 1WXQA 5HI1A 2Z8LA 4WWMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FO4 A;  1WRI A;  1NYR A;  1PFD A;  2PVG C;  4YSX B;  5EE0 A;  5EE3 A;  5H92 C;  1N63 A;  1XLN A;  3AEE B;  2W54 A;  1NEN B;  2H88 B;  3VRB B;  1SF0 A;  1QF6 A;  4JWU C;  2BS4 B;  5AUI A;  1KFY B;  4LTU A;  4HRO A;  3B2G A;  3AMZ A;  4US8 A;  1FXI A;  1L0V B;  4WWM A;  2K22 A;  5GXG B;  1SIJ A;  2EKI A;  1RYJ A;  1WWT A;  3AED B;  3CWI A;  1R7S A;  1YQ4 B;  1XLP A;  3HRD D;  1NYQ A;  3VR8 B;  1VLB A;  3VRA B;  1WYG A;  1TJE A;  2BT6 A;  3LXF A;  1XO3 A;  1PUT A;  3RPF C;  1KF6 B;  1N62 A;  3P4R B;  1AWD A;  3B2F A;  2MH7 A;  1E7P B;  4ZHP A;  4P6V F;  1JAL A;  3ETR A;  2WQY B;  4KX6 B;  1JQ4 A;  2WP9 B;  1FRR A;  4ZOH C;  2L83 A;  4YSY B;  3W5V B;  1ZP0 B;  2HTM E;  3AE4 B;  3AEG B;  2KAJ A;  4N59 A;  1B9R A;  1OQQ A;  1L6U A;  2WDR B;  2WU5 B;  1XLQ A;  2CU3 A;  3AE8 B;  3AEB B;  3DWG C;  2W55 A;  4ITK A;  2M19 A;  3SFE B;  1KRH A;  4YTN B;  1T3Q A;  3ZYY X;  5EE1 A;  5G5G A;  3NS1 A;  1FRD A;  1E9M A;  1QOA A;  1VJK A;  3LB8 C;  4ZHO A;  4US9 A;  3NRZ A;  1I7H A;  2PVO D;  1N5W A;  2ACZ B;  2KMM A;  2Y5C A;  3AE2 B;  3EUB 2;  1QLB B;  3CIR B;  3DWM A;  4YTP B;  1J7A A;  4JX1 C;  1NVI D;  2OHF A;  1ZUD 2;  1JW9 D;  1ZOY B;  3SR6 A;  1SB3 C;  1VDV A;  1JRO A;  3ABV B;  1FIQ A;  4USA A;  5C3J B;  3AEC B;  1OFF A;  1TKE A;  1DGJ A;  3P63 A;  1JWA D;  2BS3 B;  2K5P A;  2H89 B;  1QOF A;  3SFD B;  2W3S A;  1EWY C;  2WDV B;  1CJE A;  2JQR B;  3AE6 B;  3P4S B;  1N60 A;  1GPX A;  3NVY A;  1CZP A;  4HRS A;  1FFU A;  1RM6 C;  2WU2 B;  2M56 B;  2B76 B;  5C2T B;  2N0S B;  5AUK A;  1TKG A;  3WCQ A;  5EE9 A;  2WLB A;  4A9A A;  3B9J A;  4YT0 B;  1ROE A;  2MJE A;  3AE7 B;  4C7Z A;  1FM0 D;  4FXC A;  1DOX A;  3AB5 A;  3AE1 B;  3W9C B;  1E0Z A;  4C7Y A;  2JX5 A;  2MJD A;  3AM9 A;  3AEA B;  4N58 A;  1DOI A;  2Q5W D;  1RWS A;  2FBW B;  2G1E A;  4IDI A;  4YTM B;  5MPO A;  1AYF A;  1QOB A;  4YSZ B;  1A70 A;  3AE9 B;  2CJN A;  2LEK A;  4WQM A;  1J7B A;  3W5U B;  1FFV A;  3HVZ A;  2DBY A;  1RFK A;  3NVZ A;  3NVV A;  3L4P A;  3HUI A;  1J7C A;  1WGK A;  1IUE A;  2QIE B;  1OQR A;  4N6E B;  2WDQ B;  2QJL A;  1F0Z A;  1FXA A;  1GAQ B;  2BS2 B;  1V8C A;  1YQ3 B;  3AH7 A;  4YXD B;  1N5X A;  1V97 A;  5G5H A;  1UWM A;  1YJI A;  2L52 A;  1TKY A;  4C80 A;  1TYG B;  1QT9 A;  2MJ3 A;  1E6E B;  1L6V A;  2DWQ A;  2PKO A;  3AE3 B;  3KWL A;  1E10 A;  1NI3 A;  1PDX A;  3P4P B;  3BII D;  1N61 A;  3FC4 A;  2WS3 B;  2AX5 A;  1QOG A;  1FMA D;  2K9X A;  4JWS C;  3VR9 B;  1NEK B;  1ZXI A;  1L5P A;  3AV8 A;  3AN1 A;  3AEF B;  2E3T A;  3PO0 A;  2PIA A;  2CJO A;  3FAH A;  3P1M A;  5H8Y E;  1JWB D;  3NVW A;  3AE5 B;  1YJJ A;  1WXQ A;  1JRP A;  1XLO A;  3P4Q B;  1DOY A;  2W3R A; 
#chains in the Genus database with same CATH topology
 2BQU A;  5B5E U;  3IVF A;  5J17 A;  2F2A B;  1JRU A;  2BW2 A;  2EAN A;  4TUR A;  2GRI A;  2NV3 A;  4XWT A;  1SL1 A;  2KMA A;  1ZQK A;  3VQI A;  2V0G A;  2HHQ A;  3B2G A;  1QQR A;  3D2S A;  3DBH B;  4NZL B;  4DFD A;  2KLG A;  4Q8E A;  3PZ8 A;  4NNJ B;  4ZH4 A;  3VR8 B;  1MFW A;  4TSS A;  4B9V A;  3VRA B;  1SEB D;  9ICG A;  5AM1 A;  4RH6 A;  1Q0W B;  4ASW C;  5E6P A;  2ON8 A;  8ICF A;  2REX A;  3RAQ A;  5CP2 A;  4TQ0 A;  2M0X A;  4ELT A;  3HKZ F;  3KTQ A;  4B9M A;  3WA0 A;  2HBM A;  1D5M C;  3LYS A;  3UPQ A;  3QZ7 A;  2K8A A;  1QIL A;  3GV8 B;  3Q8A A;  1WR6 E;  4A8X C;  1OQQ A;  1JWU D;  3I76 A;  1XLQ A;  3HPO A;  2CU3 A;  1X9M A;  5ALO A;  2WX0 A;  2FAZ A;  5BYR A;  2BPC A;  4KLM A;  2ZXI A;  1VJ5 A;  1GC6 A;  2NTT A;  3I63 C;  3RTV A;  2W7O A;  2WF5 A;  4B9L A;  3SD5 A;  1FEH A;  1RFA A;  4RGM A;  2L00 B;  1GUA B;  4TMA B;  3H0L B;  5D4B A;  4NJ7 A;  1SXE A;  1S9F A;  2KMM A;  3ETL A;  1HTO A;  2JZP A;  1OEY J;  3FIL B;  4KVG B;  1B4F A;  2CHX A;  2R8J A;  2XGQ A;  4G3X B;  4QW9 A;  1KKX A;  1XCT L;  2ZJD A;  4DL4 A;  9ICV A;  2O6V B;  1FIQ A;  3D2Q A;  3D2N A;  2KFJ A;  2XBB C;  4O0I A;  4P4M A;  2D3C A;  3UMB A;  2IO3 B;  2NR2 A;  1P3Q U;  3PT2 B;  2JGA A;  2J0J A;  3C28 A;  1N60 A;  1NK0 A;  1S77 D;  3PV1 A;  5IA7 A;  3KUD B;  4IM3 A;  5DPR A;  4CHK A;  5J2F A;  2LVQ A;  2WGS A;  3TQ1 A;  4MHV A;  5IO9 A;  2MUT B;  3M3J A;  4EYH B;  1I4X A;  4UW9 A;  3AU6 A;  5KHQ A;  7ICJ A;  1VCB A;  2KJ9 A;  2KKV A;  3N1Y C;  1JUD A;  3QUC A;  1K8R B;  2I1K A;  2JWU A;  4A8E A;  3BZC A;  2X8X X;  3OHB A;  2PKE A;  4O3P A;  2RLT A;  1E7U A;  1DK2 A;  1SE3 A;  4EEY A;  5KG3 A;  1WY8 A;  3L4P A;  3U2S C;  2KFK B;  2DKX A;  7ICM A;  4YN4 A;  1HE8 A;  1TY2 A;  3KYC D;  4NY8 A;  1HZ5 A;  3A4R A;  1C76 A;  2HDE A;  4M8N A;  4HJK A;  1X42 A;  1E10 A;  1ZOL A;  4DS4 A;  3JYU A;  3WK8 A;  4P0P A;  1A5R A;  4ANW A;  1K53 A;  1UBI A;  3BWU D;  1I4P A;  4CRX A;  2LRW A;  1E7V A;  2K25 A;  4JWS C;  1ZXI A;  3FAH A;  7ICS A;  1FNV A;  3J9C A;  4NXZ A;  3MGI A;  3V6C B;  1XLO A;  3H1U A;  3AUO A;  3RF9 A;  4XDD A;  2HDO A;  5KHO A;  3EHV A;  3QK0 A;  3RFA A;  4RQ3 A;  1P7E A;  4RCO A;  3TAC B;  2NTS A;  2H3Q A;  1WXM A;  4NQL B;  4GIV A;  4TUQ A;  1TS2 A;  2M0N A;  8ICP A;  1TS5 A;  1KL9 A;  1WE7 A;  2KXJ A;  2M17 A;  4QZI A;  4UAV A;  2AQ2 B;  2DUY A;  2D10 A;  1R4N I;  4HKQ A;  3ECI A;  1ZQI A;  1YQ4 B;  2QC8 A;  1Z4N A;  2ZTD A;  4FFD A;  4RQN A;  3N9Y C;  5AM4 A;  2KWU B;  1L6N A;  8ICZ A;  5ALT A;  3MFH A;  2J0M A;  2MH7 A;  3B0A A;  2EZY A;  4BXO A;  3F2D A;  4YR2 A;  3VC8 A;  4DFJ A;  1KM7 A;  4NAW A;  3W1S A;  3JVZ X;  1QQ5 A;  5KG5 A;  1B9R A;  4N59 A;  4MH8 A;  2NRV A;  2K8B B;  3TUO A;  1UGM A;  5ALH A;  4UB2 A;  2OJW A;  4CYE A;  4DL6 A;  2HHX A;  2AGP A;  3D32 A;  4BGD A;  3SV4 A;  4O3N A;  5AKK A;  3HW8 A;  2J4X A;  2YEP B;  2Y0S C;  1URJ A;  1KDH A;  3MC1 A;  2ZNV C;  4YTP B;  2UVW A;  4Y2S A;  4JX1 C;  3H4D A;  3UXP A;  1PK3 A;  1XF5 L;  5ALS A;  1L0Y B;  2WXI A;  2WYQ A;  4O3R A;  2Q0Z X;  2NRX A;  1OUQ A;  5AIC A;  1U4A A;  3ABV B;  2IZV B;  3QCA A;  5AEK B;  5KT6 A;  1JWA D;  4O5C A;  2BTE A;  2H89 B;  4DQQ A;  3Q8K A;  2HD5 B;  1H8C A;  3I28 A;  1KRP A;  1BGX T;  4IRK A;  2KTR A;  5H2F U;  3WK6 A;  1BXT A;  4IWO A;  4DSF A;  3RJF A;  4RQ6 A;  2WXO A;  4NQK E;  3U30 A;  2LUM A;  9ICL A;  4NLK A;  2EEL A;  1KBU A;  3ZDC A;  2AQ3 B;  2V9H A;  4RQ0 A;  3H7S A;  4A20 A;  3OLM D;  1QCK A;  2RQ5 A;  4MFA A;  3DHG C;  4KLT A;  5AK3 A;  2MHJ A;  1ZD5 A;  5KG1 A;  4N58 A;  4CF4 A;  1YN3 A;  4IDI A;  1TZO A;  5MPO A;  1A70 A;  2UVR A;  2CJN A;  4PGQ A;  4WQM A;  2JZZ A;  4DEZ A;  1IPG A;  2GLS A;  4RGN A;  2QAR B;  4F71 A;  4IWP A;  5KFK A;  3N7P D;  4E74 A;  3PVX A;  3B08 A;  2RD0 A;  2OM6 A;  1NK5 A;  2DNF A;  3WK9 A;  4J9P A;  1BUI C;  4HK2 A;  1YQ3 B;  4YR3 A;  4NY0 A;  3UIP B;  1EF5 A;  1XSL A;  2JEG A;  3RH4 A;  1TYG B;  2KN4 A;  3DBL I;  4EFO A;  2MSN A;  3VCB A;  2QIL A;  2Q4T A;  1KEJ A;  3MGV A;  2I1J A;  3GP7 A;  3T8M A;  2BYT A;  1RG6 A;  1UGJ A;  3FC4 A;  1GO3 F;  1X9S A;  3KFU F;  4EEN A;  5JTI A;  3HT3 A;  3IV6 A;  4J9L A;  5JHB A;  2YB4 A;  3ZJT A;  5HHH A;  2E3T A;  3JPR A;  3Q3M C;  2Y1J A;  4HPM B;  4QZG A;  5JU5 A;  2XK5 A;  3IN5 A;  4HEA 1;  1UA0 A;  1WRI A;  2K39 A;  2V4L A;  4YSX B;  1HZ6 A;  5J0U A;  3RUL A;  3SV3 A;  3TAQ A;  2O6K A;  1K5O A;  4TUP A;  2JF5 A;  3ONN A;  1RPL A;  5JUM A;  3QEB Z;  3T3N A;  1KFY B;  1SL2 A;  3DVG Y;  4Y2X A;  1I4R A;  4JGH B;  4Y2T A;  3GS2 A;  4GIB A;  1EO6 A;  5AKG A;  1NK7 A;  1V9P A;  3OPX A;  4NLZ A;  1SIJ A;  3AI5 A;  3PRP B;  4MFC A;  5KL8 B;  2ZCC A;  3C19 A;  1R7S A;  4ANU A;  5ALR A;  2BYV E;  1VLB A;  5D2M B;  1KH0 A;  2BT6 A;  3EPG A;  1QH9 A;  2LPE A;  3ONS A;  4Y2J A;  2Y0S F;  3F53 A;  1A77 A;  2FDR A;  5DQG A;  5KT4 A;  2KNB A;  3E2E A;  4DHJ B;  2DYO A;  4MGI E;  4PYU A;  2DPJ A;  5FR3 A;  3MC8 A;  2C2E A;  4GSW A;  2VZK D;  5DCN A;  1TK0 A;  4UAW A;  1YT3 A;  4I2A A;  4I2D A;  9ICB A;  5J29 A;  2JRH A;  1YX5 B;  2RSU A;  5AK4 A;  1L6U A;  1RQN A;  5J18 A;  4DFM A;  4IRC A;  8ICR A;  2JT4 B;  2PMV A;  4ITK A;  4I2H A;  1RRB A;  5IIL A;  3RNB C;  3JPP A;  1FRD A;  1J8C A;  2JMG A;  2IO2 B;  4BKT A;  1QQ6 A;  4UAR A;  5ALD A;  2E8M A;  1D9F A;  1LGR A;  5KFV A;  2KSO B;  3U8Z A;  7ICT A;  4R8U A;  3ZUN A;  3H4B A;  3Q6B A;  4C8N A;  3RZF A;  4TV3 A;  1K50 A;  3EWA A;  3ZJV A;  1AN8 A;  4I6N B;  3S2A A;  5DG7 A;  5KFO A;  3OAW A;  3PLU A;  3T5H A;  2N7D A;  1NK9 A;  3N3K B;  2KJ8 A;  2FPM A;  3V60 A;  1GPX A;  2R18 A;  2ZIV A;  4UAZ A;  1N48 A;  4QZB A;  1C7Y A;  2K8H A;  1C77 A;  3RBE A;  1XS9 D;  2UU7 A;  3SDL C;  3QU4 A;  4F5R A;  4R64 A;  2ZG6 A;  1P7F A;  4OZA A;  4EKU A;  4MM3 A;  1ROE A;  3AE7 B;  5ALU A;  2GMI C;  5AM3 A;  2MWS B;  1Z1B A;  2BDU A;  5DPW A;  4K81 A;  3KHG A;  1GB1 A;  8ICI A;  5CR0 A;  3APC A;  4EEW A;  2NRZ A;  2ZPN A;  4WWO A;  2INP E;  3NUH B;  3L54 A;  3BZD B;  4PS3 A;  2G3Q B;  5ALN A;  3NVZ A;  4ZYN A;  2CHZ A;  3EFU A;  2KD1 A;  2EMS A;  4KIK A;  5J2I A;  4JQW C;  1L3S A;  2QJL A;  3ZGZ A;  2G08 A;  3ED5 A;  4DXF A;  5K4L A;  1CUK A;  1BPD A;  4ECY A;  1LV5 A;  2KDE B;  1F5S A;  3H9D A;  3KWL A;  2XNA C;  3NOB A;  5DBB A;  1L7Y A;  1N61 A;  1Y88 A;  3RRH A;  4I2G A;  3KZI U;  1X1M A;  3DBR I;  2AX5 A;  2K9X A;  4KV2 A;  4MDK E;  1YN5 A;  2VH2 A;  2DLB A;  3AV8 A;  3RJK A;  2CU1 A;  4KLS A;  1TBE A;  3QAR A;  3RAX A;  3ZVV A;  5IKC M;  2KTQ A;  5J2K A;  1X40 A;  4QAY A;  1NI2 A;  5J0O A;  2V3P A;  2I5H A;  1KLN A;  4A3O A;  1TGZ B;  4LJP B;  1BNP A;  2INC C;  4F5N A;  4IW0 A;  1KSP A;  3NGD A;  2ASL A;  3PVL A;  4JIO U;  4ARC A;  4M0A A;  2JXX A;  2JZB B;  2N9E B;  1NOM A;  4YMO A;  1BPE A;  3IG3 A;  5ALG A;  1I35 A;  2W8L A;  2RPQ A;  2LKY A;  3QUB A;  3H8J A;  4LCD E;  2ZPY A;  3T5K A;  3I3T B;  1P98 A;  2KJH B;  4YL8 A;  2PE6 B;  2PJH A;  1JMS A;  3WAP A;  2EMT A;  2D2Q A;  2UVV A;  5D46 A;  2M4N A;  1ZQO A;  4K7S A;  4P6V F;  4J03 A;  3HIZ A;  3WK7 A;  1JIH A;  4J9Q A;  3G6Y A;  1NDD A;  1T0Q C;  3RZW C;  1WM3 A;  4DHZ B;  4WH4 A;  4TQR A;  5LXH A;  1XO0 A;  1KFD A;  1RZT A;  3DBL B;  2AXT U;  2KDM A;  4DOA A;  3FIL A;  1LB2 B;  4RNA A;  4IWQ A;  5ALM A;  4RQ4 A;  2BGF A;  5CRX A;  2GI9 A;  1I7H A;  2O6V A;  2RPV A;  2Y5C A;  2GBM A;  4C4S A;  2BZF A;  3GIJ A;  2NBV B;  5LLI A;  1WCN A;  2B21 A;  2JYE A;  5AIA A;  4LZG A;  2ES6 A;  1D5Z C;  2ZVO A;  3SAF A;  4HAI A;  4DF8 A;  4B0E A;  5AI9 A;  4GU2 A;  2E8P A;  1ECW A;  4EZJ A;  3SAH A;  1TZ1 A;  1D8B A;  3C8Y A;  4RPZ A;  2MUT A;  4OJ6 A;  2IGH A;  3R8B A;  4QZA A;  4UB5 A;  2JR5 A;  3TJP A;  2ISP A;  3QUT A;  2BVC A;  1TKG A;  5J0R A;  5AKI A;  2ZW1 A;  3O13 A;  2P6R A;  3B9J A;  2MJE A;  1YJ1 A;  7ICF A;  4EOY A;  1K1Q A;  1SKW A;  2EZZ A;  2C22 A;  3M9M B;  2KFN A;  5KFQ A;  3EFC A;  1TE2 A;  4YTM B;  1WX7 A;  4A6Q A;  4ED6 A;  8ICC A;  3KWV A;  3AU4 A;  3UXO A;  2KFK A;  3MDA A;  5DQH A;  1KOT A;  3LDZ E;  4GN1 A;  2OYY A;  2W7P A;  1RFK A;  2MP2 B;  2VA3 A;  2JZ3 B;  2PEA A;  2OXO A;  1N6Z A;  4IQV A;  3TAR A;  4II2 B;  2WXF A;  4DQI A;  3BS7 A;  3SEB A;  1MQ3 A;  1FXA A;  3U26 A;  5ALL A;  7ICE A;  1TAM A;  2HHT A;  3AE3 B;  4OW0 A;  1MHH E;  4FZM A;  2L0T A;  3U4E G;  2MQJ A;  3FKY A;  3BYT B;  1D4B A;  4IQW A;  5HI1 A;  1WH3 A;  1WXQ A;  1ZQL A;  4QZE A;  4GXJ A;  2AHO B;  4WWM A;  4G50 A;  4AUQ C;  1X6J A;  5EE3 A;  2YVC A;  3V61 A;  2N9X A;  2W54 A;  4ICA A;  4F91 B;  1QF6 A;  1COO A;  3EEC A;  2IGD A;  1CRX A;  2BCQ A;  4G0N B;  4ECZ A;  3VVW B;  4C56 C;  1J19 A;  1V38 A;  2CXY A;  5LNK 1;  1ZQC A;  4KDL B;  1RYJ A;  4I2B A;  2ISO A;  2D07 B;  3PS6 A;  2LUE A;  8ICJ A;  5J0T A;  1PUT A;  4F4K A;  1WYW B;  1UH6 A;  2K8B A;  5DGA A;  2PI4 A;  2HJ1 A;  4GFJ A;  5CX3 A;  5FP0 A;  3ETR A;  2KX0 A;  3HVD A;  3V62 A;  4KX6 B;  3VAW A;  1TIF A;  4E0D A;  4GLX A;  4GXK A;  1GG3 A;  4BKS A;  1TK5 A;  5AI0 A;  3R7R A;  2HCF A;  2W55 A;  3HHM A;  4C4T A;  5C5J A;  4UB6 U;  4J6I A;  4ED3 A;  4M8M A;  4PYZ A;  1E9M A;  3KQ4 A;  1ZYQ A;  3B0X A;  2FCM A;  5DLF A;  3K9P B;  5IAA C;  1Q8K A;  5J2C A;  2KVC A;  2LXA A;  1L3U A;  2HOF A;  1G6J A;  3TKA A;  5DB6 A;  2A4Z A;  3WAM A;  2KAC A;  7ICO A;  3ZIM A;  1DXS A;  4FBT A;  4M0W B;  2K5P A;  2K6D B;  3GU3 A;  1EWY C;  1FCC C;  1CJE A;  5C2T B;  3QYP A;  2B76 B;  2M56 B;  5AKX A;  4ED7 A;  1KQQ A;  3IT4 B;  5HFY A;  3QX7 A;  5DB8 A;  7ICN A;  3KD3 A;  1D8Y A;  4Q45 A;  3Q8F A;  2AH5 A;  5EWF A;  1A6S A;  1DOX A;  2C2D A;  4IOI E;  4PS8 A;  2NPT B;  4ECQ A;  3C23 A;  3RH6 A;  3BQ0 A;  4ZRI A;  8ICH A;  4W9K A;  2QAR A;  1AYF A;  1QOB A;  2CR5 A;  2EH9 A;  3BVZ A;  3AE9 B;  2NBW B;  4RQ7 A;  1MC8 A;  1WGD A;  1Z4O A;  4PHD A;  2EAM A;  4F5P A;  4CO7 A;  2WDQ B;  4NM1 A;  1EU4 A;  4PHP A;  1P7D A;  2P6U A;  2GLE A;  3KHR A;  4GXB A;  2EAP A;  3M1Y A;  4M9L A;  3SAG A;  1YJI A;  3LVW A;  3W1Y A;  4NL9 A;  1E6E B;  5L1I A;  3G6X A;  1BPX A;  1MG8 A;  3PHW B;  1HJP A;  1HUZ A;  4ZDV A;  3QU9 A;  1PVP A;  2ZCB A;  3GE8 C;  3EGR A;  2BCS A;  1NEK B;  9ICX A;  1KLG D;  4KLE A;  9ICN A;  2G09 A;  2FMS A;  1JWB D;  4DF4 A;  4OJL A;  1GOZ A;  3P4Q B;  5CWR A;  5HR6 A;  2KOX A;  2ZJ5 A;  4ECS A;  1P0R A;  4DWI A;  1NYR A;  2W11 A;  5AZF A;  4G11 A;  1F9J A;  1ZPS A;  2BS4 B;  4LTU A;  1BPB A;  5AUI A;  2WXJ A;  2XVT A;  1FXI A;  2ASQ A;  4UAY A;  1YZ6 A;  4Y2V A;  3GDX A;  4I6P A;  3M9O B;  3ZJU A;  1GC7 A;  4XQ8 A;  3QWZ B;  3HRD D;  5DG8 A;  5J0X A;  1MSW D;  2JYT A;  5HKH A;  2ZTC A;  1ZW7 A;  1LO5 D;  2KVZ A;  2MBE A;  4LNF A;  3LYY A;  2VA8 A;  3KKA A;  4QZ8 A;  1JXE A;  5AKY A;  1UZX B;  4IC7 B;  2WQY B;  5A0L A;  5D3D A;  2HMX A;  2Z7J A;  4CF5 A;  4UB1 A;  4P4O A;  2A5U A;  2KZR A;  3S6J A;  2VIX A;  1VZ6 A;  4F50 A;  4LJO B;  1YD8 U;  1X9W A;  3QU5 A;  5G5G A;  2KHV A;  2KSO A;  1M6Y A;  2F1I A;  3KH0 A;  4B0M A;  2ZUC A;  1Q1O A;  1V86 A;  5IN7 A;  3TCA A;  2I1Q A;  2OHF A;  3RI7 C;  3NTU A;  3H40 A;  2FMQ A;  5KFL A;  4RT2 A;  1DGJ A;  3OGU A;  5ALV A;  3L0W B;  4KZ0 A;  4RU9 A;  4PS7 A;  4S0R A;  4QJF B;  2N1W A;  9ICE A;  1U47 A;  2B6G A;  4X57 B;  2K4H A;  4KN7 A;  5CEH A;  2YY6 A;  5AKH A;  5KFG A;  4RZR A;  4ANX A;  2MRL A;  4BWJ A;  2KT7 A;  4O1N A;  5J8Y C;  2LJI A;  2QSD A;  1ZQT A;  3AB5 A;  5G55 A;  1C3T A;  4GDL A;  4TUS A;  3MC9 A;  1BNO A;  5DPT A;  3HIL A;  1RWS A;  2FCN A;  1KW4 A;  4R3D A;  2Y9T A;  4F93 B;  3M8R A;  1HQR D;  1UBQ A;  2G1E A;  4ZYS A;  1C4A A;  4YSZ B;  2KN7 A;  1WF9 A;  3JPO A;  3KVF B;  5KAF U;  2L7R A;  3ML8 A;  1D9D A;  1LFD A;  3NVV A;  1NJZ A;  1J7C A;  4QZF A;  1MG4 A;  3AU5 A;  3N32 A;  4L23 A;  1Z5S B;  4UBC A;  4KLJ A;  5IIO A;  1ZQN A;  4HJG E;  2K89 A;  3A1Q B;  3N97 B;  3M95 A;  2PFP A;  3LK9 A;  3VTV A;  4O3S A;  5HR7 A;  3UQ2 A;  2WXH A;  2DWQ A;  4IQT A;  1WXS A;  1RYR A;  2AQ0 A;  4GDK B;  2ZNV B;  4XZ4 A;  5ALJ A;  3I1Y A;  4KLL A;  2AQ1 B;  4B9U A;  4DDI D;  7ICH A;  4C8O A;  4J9N A;  4DO9 A;  2O6V D;  2YMQ A;  2PPH A;  2J53 A;  1UT5 A;  2PIA A;  3O0F A;  2WF8 A;  2HBK A;  4ACO A;  4Q44 A;  3L3F X;  5ALK A;  1S1Q B;  3QUQ A;  3ICX A;  3A33 B;  1K51 A;  9ICP A;  2MBO A;  4Z6F A;  1YX6 B;  4CGZ A;  5BO4 B;  2PVG C;  1TAQ A;  3TFS A;  4IRD A;  2JZB A;  3VUW A;  8ICW A;  4RQ1 A;  5DG9 A;  3I57 A;  2KO3 A;  1J2M A;  4W9I A;  5AM0 A;  4DQP A;  5IP4 D;  8ICL A;  2D3G A;  2PLP A;  2K0P A;  2ODG A;  1NYQ A;  3V05 A;  4DFK A;  3RJG A;  2V3S A;  4MEX A;  1KF6 B;  1RAX A;  2XY6 A;  3PX0 A;  3B2F A;  1DOQ A;  1U9L A;  2A3V A;  3C2M A;  3X0W A;  3AE4 B;  1F1H A;  5KFI A;  4GXI A;  3PRE A;  1SJH D;  5TSS A;  4Y2R A;  3RJJ A;  3FM9 A;  2IA6 A;  1L7N A;  1PK1 B;  1OQY A;  2KWD A;  2KJ5 A;  2XGP A;  2KNJ A;  2HI0 A;  1QTM A;  5EE1 A;  1CK1 A;  3NS1 A;  1WJ4 A;  3IP4 B;  4FJZ A;  3VTU A;  1SE9 A;  3AUL A;  1Q10 A;  2QKQ A;  3HP6 A;  2N9K A;  4F4X A;  2ACZ B;  1NJX A;  1ZQJ A;  4WJP A;  2BDP A;  2R8K A;  4OO1 J;  2R8I A;  4ED2 A;  2BB5 A;  4W9E A;  2PFN A;  1WIA A;  4K1R B;  1GNU A;  3BQ7 A;  1Q5W B;  2KK8 A;  1OFF A;  2BYF A;  3ZDM C;  3PW7 A;  2KFZ A;  4ECX A;  4GMV A;  3SFD B;  4OVU A;  3IT6 B;  2P66 A;  5KG6 A;  2FLL A;  5KT7 A;  1ZD4 A;  3A0B U;  2JXT A;  1M4V A;  4DQS A;  4NLC A;  1FM0 D;  3EPI A;  1N2X A;  3GZN I;  3BS5 B;  2O2V B;  3RH5 A;  2WB1 C;  5J0P A;  1UUP A;  1LXD A;  2G5I B;  3O65 B;  4R65 A;  1R4M B;  2MP2 A;  1L5U A;  5KFX A;  1VD2 A;  3IDW A;  1XEE A;  1X6I A;  2JXJ A;  2ALZ A;  4K3C A;  4BX9 C;  1C20 A;  2JUO A;  4NLN A;  5IIK A;  3ZDE A;  3HVZ A;  4Z6C A;  2H3I A;  4WWP A;  7ICQ A;  2RDJ A;  4KLU A;  3PO5 A;  2CPR A;  2LGX A;  4FO6 A;  5DB9 A;  1OQR A;  4WJQ A;  3WAL A;  5JH5 C;  4J9O A;  1V8C A;  1UQV A;  4ECW A;  2HE7 A;  1ZQP A;  4HDQ A;  3A4S C;  3ZNG C;  3QNM A;  2HJ8 A;  4ZRJ A;  1CQV A;  3SHQ A;  5AKE A;  1TK8 A;  3A0H U;  2MBH A;  1PUZ A;  4I27 A;  1ZGU B;  3RNE C;  4ELV A;  4YD1 A;  2RDB C;  3PO0 A;  1C79 A;  3P1M A;  3CP8 A;  1JWM D;  2JH1 A;  2KN5 A;  2DFL A;  2WXG A;  3V6J A;  2G06 A;  1ZQH A;  2JH7 A;  3SEN A;  2ZJA A;  4UBB A;  5HHI A;  2ASD A;  2GBK A;  1SIF A;  3I5J C;  2KD0 A;  2ZJ8 A;  2L5Y A;  4W9J A;  2MW5 A;  5GTH U;  3BK1 A;  1NEN B;  2I6X A;  3IHQ B;  4C0Z A;  5J2B A;  3UM9 A;  4UDU C;  3A9J B;  2C7N B;  3WKE A;  3RB0 A;  1WSP A;  1Z3E B;  2MA9 B;  3DQV A;  4TQ1 A;  2NRT A;  1MI0 A;  2YTU A;  3C0R B;  3RUI B;  2BR0 A;  4J3O D;  3TAD C;  8ICV A;  4I29 A;  1FCL A;  1T3N A;  1SWW A;  3V72 A;  3RNA C;  3APF A;  2FNJ B;  5BPC A;  5ALZ A;  4REZ A;  1QZE A;  4EYI B;  3KW5 B;  1Z00 B;  2G0A A;  3MR2 A;  3ALB A;  3TEW A;  3IAS 1;  4B9T A;  7ICG A;  2NRW A;  4Z6E A;  4JLC A;  3U7Z A;  1ZQR A;  2I38 A;  3V3X A;  2A1A A;  3BQ1 A;  1S0M A;  1ZE3 D;  2A19 A;  2WXN A;  4W9G A;  4US9 A;  4ZRQ A;  5L1J A;  4XGA B;  5L1L A;  2HTH A;  3ZD8 A;  2AQ4 A;  4KLF A;  1TS4 A;  4M0W A;  3PLV A;  5ALQ A;  1WGR A;  3TEY A;  5FR6 A;  1VDV A;  4A3P A;  2WB1 F;  1X2I A;  3AEC B;  3P63 A;  1Z2M A;  4WJN A;  2AL3 A;  5CHG A;  3NZ3 A;  2VZK B;  2KOB A;  4FHJ A;  2XC9 A;  2NPT A;  3Q8B A;  4XC2 A;  5AUK A;  3BQT A;  4ECT A;  1NZB A;  4LK0 M;  4HVB A;  1I4H A;  2IHM A;  3M7D A;  1N56 A;  2ZIX B;  5ALW A;  4ECV A;  4I2F A;  4F72 A;  4RQ2 A;  5KFB A;  5BOM A;  2FBW B;  2IYD B;  1GJZ A;  1EF1 A;  1F52 A;  1MHX A;  2GOW A;  3ZTD A;  3GV7 B;  2IMW P;  1V6E A;  3BY4 B;  4FA6 A;  4EZK A;  3N1X C;  4NWI A;  1Z1V A;  1ZQW A;  3ZQ4 A;  5D7G A;  3RN9 C;  4RT3 A;  4BVU C;  4HYK A;  3DHI C;  1F0Z A;  1WMH B;  3C21 A;  3D6J A;  3DV9 A;  1ZQB A;  4YMN A;  1TVA A;  3H8W A;  3U7D A;  1DRG A;  2LMC A;  1QT9 A;  3PHX B;  2W9N A;  3WKC A;  2BCR A;  5LXI B;  5J2R A;  4QZ9 A;  1R4N B;  2GO7 A;  4KLQ A;  3JPT A;  2WS3 B;  2ESE A;  4MEL A;  5HP4 A;  9ICF A;  1B0X A;  3C1Z A;  3BQ2 A;  3AU2 A;  3ZTC A;  2ZIW B;  2IBI B;  2V4R A;  1U45 A;  1SSN A;  3NVW A;  2JEJ A;  1SV0 C;  1FO4 A;  4ZRK A;  1RLF A;  4KSL C;  2HVI A;  1SKR A;  1HIW A;  3GIM A;  2Z0E B;  5CHF A;  1P1A A;  2E1E A;  5J0Q A;  2MSE D;  1NK4 A;  4PPX A;  1S3S G;  3EA6 A;  4XDC A;  3WAN A;  2DEN B;  2H3V A;  3AMZ A;  2JY6 A;  2CKH B;  2K22 A;  2NMQ A;  4TKN A;  3OSN A;  2BQQ A;  3M62 B;  4Q43 A;  2EZX A;  4KKI A;  2C7M B;  3UQB A;  1V85 A;  3TAP A;  4RQ5 A;  5ALY A;  3DHH C;  5AM2 A;  3K1Z A;  3PO4 A;  3UMC A;  4O5E A;  3RPF C;  2NO5 A;  1RXW A;  3ZDT A;  2KQ4 X;  1PGX A;  1BML C;  2AYO B;  3PNC A;  1TV9 A;  1OGW A;  2BCV A;  1UNS A;  2CHW A;  1YMH E;  2HTM E;  4KKJ A;  1SWV A;  3UIN B;  1O08 A;  3QE9 Y;  2M19 A;  1ZJM A;  4EX7 A;  3Q3N C;  3ALR A;  1QOA A;  3NRZ A;  2WXR A;  5KFR A;  3VTW A;  3PV8 A;  9ICU A;  5DBA A;  4I2C A;  2ZZP B;  1WM2 A;  4P16 A;  3TSS A;  3WU2 U;  4M02 A;  2M8S A;  1D8L A;  1SB3 C;  9ICO A;  5ALF A;  5C0Y A;  4PH5 A;  3KUZ A;  3Q8E A;  1TKE A;  2YLM A;  2Y9U A;  5AK6 A;  1YQB A;  2BB6 A;  7ICV A;  2KP7 A;  4J9M A;  3L08 A;  5KT3 A;  4C00 A;  4RQM A;  3M9N B;  3ENE A;  3CYM A;  3SZ2 A;  3P4S B;  1BT0 A;  2Z59 B;  4D2K A;  2IJ0 A;  5JXV A;  2FPK A;  4PL2 A;  2RP5 A;  1ISN A;  1WE6 A;  5KFT A;  1L8L A;  2PXI A;  4WJO A;  4BDP A;  2WLB A;  1ET6 A;  5TZV A;  4YT0 B;  1F2R I;  2PTL A;  3MFI A;  2LM1 A;  5KT5 A;  2N4F A;  3CNH A;  3KOO A;  5AK5 A;  2FCQ A;  4ANV A;  3DOW A;  2M9N A;  1NKE A;  4P0P B;  1XCQ L;  2YMM A;  4KLI A;  4O9M A;  2C60 A;  3PSE B;  5CA7 A;  4XWW A;  3ZDA A;  2VAN A;  2LEK A;  3Q14 C;  4LDT B;  1L0X B;  3A1Q A;  5IIJ A;  4CNQ A;  3VH4 B;  4Z6D A;  4M00 A;  1T0Y A;  2OH2 A;  1LKY B;  1FXT B;  3QC8 B;  3Q8C A;  4JE3 B;  1SXD A;  1L3V A;  2WTF A;  1ACC A;  3JPS A;  3R66 C;  3PST A;  1N5X A;  1FNW A;  4GDK A;  2BBC A;  3SI8 A;  2LVO A;  3VDZ A;  2MJ3 A;  1C9F A;  4RNN A;  3H0M B;  2PW9 A;  4KGT A;  1NI3 A;  2CS4 A;  4FLH A;  3RNC C;  4KMU A;  3PML A;  4HPL B;  2MX2 A;  2MAX A;  4KZC A;  3Q8P B;  5CJ7 A;  4RF1 A;  3GOE A;  2J6U A;  3ML9 A;  4QWA A;  3PW2 A;  2XCP A;  4AOF A;  4BFR A;  2LBO A;  4G3I A;  3R9K A;  3MFG A;  2XID A;  4RPY A;  4WJ3 B;  2BYE A;  3EC8 A;  4RGO S;  3RRG A;  4QWE A;  1F0M A;  2PFQ A;  1JML A;  1AAR A;  2AU0 A;  1WWU A;  5J2A A;  1JWS D;  2H88 B;  2LHD A;  4NAW B;  2WF9 A;  3X23 A;  5KG4 A;  4AJY B;  4EBC A;  3GB1 A;  4KLG A;  3IG5 A;  2YN4 A;  2V4Q A;  4OJP A;  4HDO A;  2DAJ A;  3WKA A;  3LWL A;  1E8Z A;  5DLG A;  8ICN A;  2QDF A;  1LVH A;  2HVH A;  2OJR A;  1UPH A;  5AKJ A;  2BF8 B;  3K75 D;  2IO1 B;  4LLG M;  3QX1 A;  3MR5 A;  4BOZ B;  3ZNH B;  1NKC A;  4ZHP A;  4I6L B;  1JCK B;  1PK1 A;  4Y2Q A;  1TS3 A;  3LJ3 A;  4FN2 A;  2KQS A;  3AEG B;  2KAJ A;  3GII A;  2KDB A;  3PGE A;  3TAD A;  4MF2 A;  1MJD A;  2KJ6 A;  3N4M B;  2KC2 A;  4F3O A;  1KRH A;  3DVN V;  1KFS A;  3GE3 C;  3MHS D;  2K4E A;  3DBH I;  3APD A;  4MFF A;  2JV3 A;  3SYZ A;  5L9X A;  8ICQ A;  2ZIU B;  5F9N A;  2LM4 A;  5DBC A;  3DWM A;  3GFK B;  4DCC A;  4F4Y A;  2QHO A;  2BPS A;  2WFA A;  3SR6 A;  4NM2 A;  5KFM A;  2N9L A;  2G07 A;  2KE7 A;  4F2S A;  5C1Z A;  2E8N A;  1SBB B;  4YXM A;  1UD7 A;  5D3I B;  2V9W A;  4FJY A;  4U6P A;  2SAK A;  2N1R A;  3NRW A;  3BVM A;  3ZD9 A;  5FK9 C;  1S5L U;  4KGR A;  5F9L A;  4QZC A;  4NJC A;  5BMG A;  4MT5 A;  3BS5 A;  3ISC A;  2W9B B;  2O2V A;  1L4D B;  1IM4 A;  2JRZ A;  4I28 A;  2AGO A;  3BVG A;  2IDY A;  2R61 A;  1ZQZ A;  4UB4 A;  4M9G A;  4FXC A;  4IL6 U;  1NBF C;  1E0Z A;  1U49 A;  2JX5 A;  3AM9 A;  1S8O A;  2MJD A;  1PYW D;  4MSM B;  5GMV A;  1Q3U A;  4O3O A;  3DBR B;  3IXS A;  2K8C B;  4P0Q B;  2QB1 A;  2OWO A;  2KYW A;  2AL6 A;  1V5O A;  3V6K A;  3FDS A;  1UT8 A;  4F5Q A;  1XSN A;  4EZ9 A;  2LI5 A;  3ZDD A;  2WNM A;  4EEK A;  3TI0 A;  1WGK A;  2GBJ A;  2Y5B B;  3R7Q A;  1ZRN A;  4FAD A;  2ZW0 A;  2B0C A;  2EQY A;  2BWF A;  2YMP A;  4YXD B;  2FID A;  5G5H A;  4URK A;  1HTQ A;  2L52 A;  2HHW A;  4U7C A;  2G4S A;  4JL9 A;  3W1S C;  1C4P A;  3HJE A;  4F1S A;  4C4V B;  2UVU A;  4WAF A;  2KWV B;  4K3B A;  2VJ5 A;  2LGD A;  3OJS A;  2Y1I A;  4QWC A;  1ZQU A;  1I4G A;  3N28 A;  3JSV B;  1CI4 A;  4MJS B;  2XO7 A;  1QOG A;  2XN9 C;  1TAU A;  3C5F A;  1T6B X;  4XX5 A;  3VHT C;  2J52 A;  2KAN A;  5HMM A;  2J6T A;  2RDG A;  2DQN B;  2RDI A;  3A9J A;  4UQG A;  4DS5 A;  5DKW A;  3AEE B;  1WJU A;  4NLB A;  1SF0 A;  2KKC A;  3N20 C;  4JWU C;  2GBN A;  4G9B A;  3M6Z A;  4M6W B;  1ZQX A;  1HEK A;  3AL0 B;  1WGY A;  5KG2 A;  1XLP A;  1KFT A;  4L1B A;  1TJE A;  1XO3 A;  1Z00 A;  3P4R B;  2MA1 A;  4WAA A;  4RQ8 A;  2W8K A;  1JAL A;  4DSL A;  3LVV A;  5D49 A;  2Y5P A;  3V6E B;  1IBX B;  3MTN B;  4NAM A;  3A9K B;  2E5S A;  3RB6 A;  1L2N A;  3AEB B;  4C8K A;  3DWG C;  4M04 A;  3BK2 A;  1SV4 A;  5HG2 A;  4I2J A;  1ZQ1 C;  2ZXH A;  2KTF A;  3PSF A;  9ICM A;  1SKS A;  3KLS X;  1WRD B;  3QJZ A;  1ZXH A;  1XWL A;  4KDI C;  4Y2P A;  1JW9 D;  2WDT B;  1JRO A;  3WKD A;  4YVZ A;  1MPE A;  2KX3 A;  1ZQG A;  2VH1 A;  3CMM B;  1WGG A;  3T5J A;  5BOL A;  4LNN A;  3NHE B;  5KFA A;  2UYZ B;  1B22 A;  3H7P B;  4EZL A;  2F77 X;  3MBY A;  4PJ0 U;  3NS8 A;  1PGA A;  2INN E;  4DLG A;  4QIW C;  1NK6 A;  1ZQM A;  1ENF A;  2AGQ A;  4KGS A;  2WU2 B;  3OHA A;  2NCN A;  4KIK B;  3WCQ A;  2JEI A;  3ZNZ B;  4XYC A;  5EDS A;  2KZZ A;  7ICR A;  4OJO A;  4P1C C;  4FZN A;  2WWZ A;  3RJI A;  2JVC A;  4QNL A;  4B9K A;  5CB1 A;  3K1R B;  7ICU A;  1A76 A;  2Q5W D;  2N7E A;  1WXA A;  4X5V A;  2N9P C;  3F5E A;  9ICI A;  1S10 A;  3P42 A;  2RR9 A;  2WX1 A;  4GGQ A;  4DLE A;  2XY7 A;  1ESF A;  3OJ4 B;  1WMH A;  4RPX A;  4WQO B;  3NAS A;  3GQC A;  4N9F 4;  3I9V 1;  2KWC A;  2OEH A;  4QZH A;  1IUE A;  3ZRF A;  2MCN B;  4R66 A;  2L05 A;  2F3N A;  2BS2 B;  2C28 A;  3Q8L A;  1TKY A;  2PKO A;  4HLE A;  1L6V A;  4MEM A;  4JV0 A;  3L17 A;  3CST A;  4S17 A;  3P4P B;  2IND C;  4ELU A;  3T79 A;  2ZTE A;  2C9W B;  1F2R C;  5E6N A;  3PRM B;  4DQR A;  4JPS A;  2ZIW A;  5DDM A;  3OG5 A;  2GBR A;  4YG2 A;  3M6K A;  1L5P A;  4W9C A;  3AN1 A;  2J42 A;  3MC0 B;  4RUA A;  4DQO C;  4IR9 A;  1KLU D;  4PGY A;  4W9H A;  5D6J B;  2N7J A;  1DOY A;  1VZ8 A;  2W3R A;  4NJ8 A;  3ISB A;  1PGB A;  2L76 A;  4OZC A;  1PFD A;  2J7Q B;  1ZRM A;  3UXN A;  4IR1 A;  4QWB A;  2R8G A;  2Z0D B;  3Q3F A;  2WXL A;  5H92 C;  3K9O B;  1D6E C;  4WWN A;  2HSZ A;  1YZ7 A;  2PE9 A;  2DHZ A;  2QCZ A;  1L0V B;  3CF6 E;  1H4R A;  5GXG B;  9ICH A;  5J2H A;  4WUR A;  4JK1 A;  5ALP A;  3JPQ A;  4M9H A;  9ICR A;  3QA8 A;  5E79 U;  4DSE A;  8ICU A;  2FJ6 A;  3BIN A;  1M94 A;  4EUT A;  3ZDB A;  1FNU A;  4F92 B;  1JN3 A;  2IOF A;  5E6O A;  2XI9 A;  1ZQD A;  1ZD3 A;  4DDG D;  1RYS A;  4QW8 A;  3VUX A;  3H8S A;  2GB1 A;  3RCZ A;  1FRR A;  4ZOH C;  1QKZ A;  4YSY B;  2W04 A;  2WU5 B;  2F1H A;  5ALI A;  5L1M A;  4DFP A;  3AE8 B;  3Q3J A;  5BYS A;  4F4Z A;  1ZJN A;  4MF8 A;  3ZYY X;  1XT9 B;  8ICE A;  4RM9 A;  2M1M A;  4QIW F;  4M9J A;  1F77 A;  2D11 A;  2MU2 A;  2K1F A;  1J97 A;  2PVO D;  1N5W A;  3V7L A;  3WIM A;  2RMM A;  3BJY A;  2AJQ A;  1ZDV A;  3JW0 X;  1NVI D;  2K4P A;  5BMH A;  4F7Z A;  5AKZ A;  1ZQV A;  2F8L A;  4USA A;  3ISD A;  3GV5 B;  2KKP A;  4DL5 A;  5L95 C;  4HKZ E;  2H5X A;  3C5G A;  5F3X B;  4FE3 A;  3PX4 A;  5AI6 A;  2WDV B;  3WAO A;  5EOZ A;  2JQR B;  3H6N A;  5KAI U;  2W43 A;  1NKB A;  4KIT B;  3M63 B;  3RNF C;  5KFF A;  4PZN A;  4PK1 A;  4HWI B;  1WXV A;  3NUQ A;  5EE9 A;  4W9L A;  4JMU A;  1LQB A;  4A9A A;  2MRP A;  4P1B C;  5KFH A;  3RB3 A;  1S0N A;  1WZ0 A;  5AKL A;  3AEA B;  3ZNI D;  2RDH A;  4BJQ A;  2HW3 A;  3DCG A;  4XE0 A;  3N7S C;  1T7P A;  4BWM A;  1V81 A;  5KFZ A;  2G5H B;  1LKY A;  1TY0 A;  1J7B A;  1KTK A;  1FFV A;  4LJX A;  3RYT A;  3SU8 X;  8ICO A;  1FPY A;  2KVR A;  3HM6 X;  2ZUB A;  2P35 A;  3NY5 A;  2KK0 A;  4LZD A;  2W9C B;  1C4C A;  5AI4 A;  1ZQS A;  4RF0 A;  5KFY A;  5EE0 A;  2LYH A;  5JRT A;  4YD2 A;  3DBS A;  3UI3 A;  3RFZ B;  2BKF A;  3QHT A;  2H3F A;  1J0G A;  1X9X A;  2CRX A;  3M8S A;  1OXJ A;  4O3Q A;  4EX6 A;  4B95 A;  3R2T A;  3T9L A;  3LDA A;  1LM8 B;  2YML A;  3PRZ A;  1WWV A;  1WJN A;  5BMI A;  1U48 A;  1S97 A;  1IV8 A;  5DB7 A;  4EZ6 A;  1UCV A;  1ZQF A;  3C1Y A;  1YJJ A;  3AE5 B;  3ZLZ A;  4F5O A;  4DK5 A;  1KLV A;  5AZG A;  4RNM A;  1B1Z A;  3PPA A;  2KZ3 A;  2ZEQ A;  4IKG A;  4C8L A;  1AQ6 A;  2HHS A;  3IFW B;  4RMA A;  4F8C B;  5TR5 A;  4UB3 A;  2LXC A;  3RJE A;  3PY8 A;  1L7P A;  1JX4 A;  8ICM A;  2LHT A;  4BKS D;  3H7I A;  2WXM A;  4JV1 A;  3IM1 A;  2EKI A;  4R63 A;  3TEZ A;  2LRU A;  4I2E A;  1U4B A;  4C4R A;  1XD3 B;  3LXF A;  4ICV A;  1Q46 A;  1T0R C;  1VRA B;  4IM2 A;  2DF4 B;  1XSP A;  2XEW A;  2FI1 A;  1ARO P;  4K4I A;  4ZRP A;  1V1P B;  3HM3 A;  2RRD A;  5KG0 A;  2V3N A;  2WF6 A;  3KZX A;  1EM7 A;  2L83 A;  4FBJ B;  3QU2 A;  1S76 D;  3OJ3 A;  2HOQ A;  3P2B A;  1PQS A;  2QLT A;  1D5X C;  2CN1 A;  2ZIU A;  5EWG A;  8ICT A;  2E6X A;  9ICT A;  2VA2 A;  1S0V A;  2QB0 B;  1V5T A;  2D3D A;  3EUB 2;  1QLB B;  4TQS A;  1CMX B;  2K3U A;  2X38 A;  1AW7 A;  4CE6 A;  5KG7 A;  2D6F C;  4J9S A;  3NZS A;  3Q69 A;  4OVV A;  1NJW A;  2YQE A;  2LMR A;  2HBJ A;  5KNI A;  1T8E A;  1FEZ A;  2W9B A;  3PZP A;  1T0S C;  2W3S A;  2ATL A;  3Q8Q B;  2R2Q A;  1DK3 A;  2W82 A;  3ZO5 B;  4EE2 A;  4NPN A;  4F2R A;  4YP3 A;  2FUG 1;  4MGZ E;  3EZ5 A;  3T3F A;  1STE A;  1HEZ E;  2K8C A;  4P0Q A;  4ECR A;  1Z19 A;  3QAQ A;  3H8H A;  4II3 B;  4W9D A;  3VUY A;  4NJ6 A;  4YFK A;  4F8R A;  2LWP A;  3PW0 A;  4C7Y A;  3AE1 B;  2JEF A;  4IM0 A;  2F8K A;  1IGD A;  1DOI A;  3MR3 A;  9ICW A;  1KJT A;  1MN8 A;  2EAO A;  2A1J B;  3JPN A;  1TT5 B;  8ICS A;  5J2E A;  5G2N A;  1IXR A;  1A0P A;  4XA5 A;  4K4H A;  1ZKH A;  1XNS A;  4KN4 A;  5BYQ A;  4C8M A;  5CTR C;  1HA5 A;  4O3M A;  3ZRC A;  4CQN A;  5I4D A;  2DYM A;  2I2Y A;  5DPS A;  2AEH A;  3T3O A;  2FE9 A;  5HML A;  4KLO A;  1YN4 A;  4C4V A;  1ED1 A;  3OSP A;  1V97 A;  8ICY A;  2LGY A;  1L8O A;  2V1Y A;  5KFE A;  3C2L A;  3OTQ A;  1J2N A;  1JI7 A;  2LAS A;  3JSV A;  4MJS A;  2NYV A;  3Q8S B;  1PDX A;  3KUC B;  4OCZ A;  2C5L C;  4FHK A;  3KHH A;  1NJY A;  1D3Z A;  1SXT A;  2M0A A;  2KJR A;  3VR9 B;  1DGS A;  3VFK A;  1WG8 A;  3Q8M A;  3LWM A;  1SJE D;  4BKG A;  2YB1 A;  3SD7 A;  4UAU A;  4B6W A;  4DHJ D;  1JRP A;  3TFR A;  4H2A A;  3PW4 A;  1TKD A;  3MHZ A;  4ED1 A;  4LVS A;  3MJW A;  3VXW A;  1KN5 A;  3ZXR A;  3MDC A;  4M6W A;  5AIB A;  2ASJ A;  2JWZ A;  5J8Y A;  2PI5 A;  4P4P A;  4M01 A;  1IP9 A;  4DL2 A;  3SMV A;  2DX5 B;  4DL7 A;  3HK0 A;  1Y8R C;  4HRO A;  3U52 E;  5AHX A;  1OEY A;  1QLN A;  4JB3 A;  2VKQ A;  2AWT A;  1EU3 A;  4MAC A;  2FLN A;  1WWT A;  3AED B;  3IBE A;  3RT3 B;  2WAQ C;  4Y2Y A;  3HWT A;  1I42 A;  5C23 A;  2KZM A;  1IBX A;  2EDU A;  5KT2 A;  1ZQQ A;  1E7P B;  3A9K A;  3L10 B;  3GIK A;  8ICG A;  4ECU A;  3ORY A;  2L3Z A;  2KDF B;  2XIC A;  2NVU I;  2YX8 A;  1QSS A;  2WDR B;  3L5K A;  5DQI A;  4RFB A;  3WKB A;  4ED8 A;  2K60 A;  3C29 A;  4CCH A;  1WUD A;  4J9K A;  2DZK A;  5KFP A;  2ICI A;  5B66 U;  2E1F A;  1T3Q A;  1QSY A;  9ICS A;  3PZD A;  2W9A A;  5HHD G;  3TL5 A;  1L7O A;  4P7I A;  4ZHO A;  2GWS A;  4I2I A;  1VJK A;  3GZN B;  3AXC A;  1FD6 A;  2RHF A;  3N7R C;  2DZM A;  4IC9 A;  5EWE A;  2FMP A;  1T5X D;  4GB9 A;  4NL9 C;  4GDL B;  3UQA A;  4PGX A;  1WX9 A;  1ZOY B;  4JWM A;  3L16 A;  2JHD A;  3H7P A;  4RM8 A;  4ED0 A;  3UIO B;  1E8W A;  7ICI A;  3QEA Z;  4HXD A;  3J81 j;  5L83 A;  4EEL A;  3KYD D;  2FPL A;  1TFR A;  1UEL A;  1E5W A;  2VRR B;  3AE6 B;  4ARI A;  4HRS A;  1CZP A;  4ICU A;  4AP9 A;  1YOV B;  1RM6 C;  3KBB A;  1TTN A;  2RGF A;  1DYQ A;  4MGK E;  4DXG A;  4EBE A;  2QMT A;  1YIW A;  1C78 A;  3BYY B;  2J0K A;  3UGB B;  1ZDX A;  4BBN C;  1V1O A;  3QU7 A;  1IGC A;  1H38 A;  2FIF A;  4PHE A;  4IG7 B;  4TUU A;  5AI5 A;  1L4Z B;  1K1S A;  2PFO A;  3SQI A;  3VH3 B;  2BCU A;  1JXL A;  2BQR A;  2IY1 B;  2YEP F;  3ZI4 A;  2DBY A;  1SE2 A;  5AM5 A;  3V7J A;  4BOS C;  2MBQ A;  3V6H A;  2QIE B;  2EKE C;  3RB4 A;  3AH7 A;  2KMD A;  4M47 A;  3KKA C;  2FUH B;  1L3T A;  3ZXV A;  1RYU A;  8ICA A;  1NNL A;  3B0Y A;  1B43 A;  3SEI A;  2TSS A;  3NJT A;  1E8Y A;  5ALX A;  3URY A;  4PZO A;  5III A;  1FMA D;  5KTQ A;  5CHV C;  3H8M A;  3QXG A;  5H8Y E;  4AWJ A;  2KV2 A;  2CJO A;  2K6Q A;  3DDC B;  4DXA B;  4PHA A;  2WAQ F;  2G9H D;  1BVS A;  3Q8R B;  2HHU A;  2BPF A;  4GLS C;  1IIP A;  3NZU A;  1OTR B;  3HX0 A;  3PX6 A;  2B3A A;  2BWE S;  4K4G A;  1XLN A;  4AJW A;  1VR9 A;  4JWN A;  1XQQ A;  2BHN A;  1WR1 A;  4OVZ A;  2HOI A;  2G4D B;  2WXK A;  2L32 A;  4OJ5 A;  3PSI A;  2SEB D;  1SZH A;  4NLG A;  3OWE B;  2LHE A;  1V49 A;  5GTI U;  1ZQE A;  2WXP A;  4B6J A;  4HCP B;  5JZE B;  4AQ7 A;  3BZK A;  1S0O A;  2MEK A;  2C2R A;  1WYG A;  4KMO B;  1T94 A;  3C2K A;  2D5G A;  5JHA A;  4LDT D;  1Q3V A;  2E8O A;  3TBL D;  2D3B A;  1V2Y A;  1JQ4 A;  3UMG A;  3TAN A;  2WP9 B;  4B9N A;  3Q2A C;  4LNI A;  1ZP0 B;  1YNT E;  4MH0 E;  4JUZ A;  2FE8 A;  4BXO B;  2BKR B;  3BDP A;  2KIV A;  3SFE B;  2MBB B;  4KLH A;  3PTF C;  2BPG A;  2WHI A;  4YTN B;  2WHE A;  5J0W A;  2K4I A;  3WK4 A;  4DSK A;  4RNO A;  4Q2J A;  2IPK D;  3AE2 B;  2F44 A;  4JV2 A;  1CEZ A;  3IG8 A;  1QQ7 A;  2F1J A;  2ZVN A;  9ICA A;  2UWQ A;  2GOL A;  2LVP A;  2BQ3 A;  5T8I A;  3E0F A;  1OW5 A;  4BBN F;  5ALE A;  2KG5 A;  2L0F A;  1X66 A;  4OD0 A;  5DDY A;  4KX3 A;  1K52 A;  1WZ3 A;  1QOF A;  1XO1 A;  2BS3 B;  1PVQ A;  9ICJ A;  2LYB A;  1QSL A;  1XC9 A;  3H0R B;  4MEY A;  2D8C A;  1WCL A;  2Y3A A;  5HNK A;  2HHV A;  3V7K A;  2MLB A;  3F2C A;  4FUL A;  2DZI A;  2GH1 A;  2KTR B;  3MAB A;  4C7Z A;  3CRX A;  4DOB A;  5IIN A;  3MR6 A;  3TEX A;  1WI0 A;  2KHQ A;  3RD2 A;  4UB8 U;  5J2D A;  1WGH A;  4OZB A;  1SL0 A;  2OED A;  2BGW A;  1EUV B;  5IOI A;  4UAT A;  3PR4 A;  2LD9 A;  1NZP A;  3AQF A;  4K7W A;  1V9J A;  2W9C A;  4XRH A;  2KHW B;  4KLD A;  3B1L X;  1MVK A;  2H3Z A;  1P9D U;  2W9M A;  4N6E B;  2R8H A;  4B9S A;  4GOC A;  3WK5 A;  4GC7 A;  3CSF A;  4LNO A;  1UWM A;  1XXG A;  3R2I A;  4C80 A;  3W9C B;  2IGG A;  2OCE A;  3THV A;  5J2G A;  2PMZ C;  1BPZ A;  1T4G A;  2R2O A;  3RBD A;  2IBK A;  1MQ2 A;  4DOC A;  2IHN A;  2IY0 B;  3TMP B;  4BZA A;  4FBU A;  2DZJ A;  1KTQ A;  1XU4 A;  2IOH A;  2XY5 A;  2JPH A;  3DVG X;  3E58 A;  4IS7 A;  2XCA A;  2KDI A;  2QEJ C;  4K7U A;  2IO0 B;  3EYZ A;  4F4W A;  4UAS A;  3L13 A;  4YQW A;  4E3C A;  3QIJ A;  2ONQ A;  3DDH A;  4DBG A;  4MSQ B;  2J6S A;  4EBD A;  2FLP A;  5T14 A;  4QZD A;  4AYB C;  3R3M A;  5KFC A;  1L7M A;  2XK5 B;  3MJ5 A;  1N63 A;  5KFD A;  3VRB B;  4GC6 A;  4O5K A;  1GB4 A;  2JU6 X;  3Q3O C;  5KFU A;  3GIL A;  1V80 A;  2JSV X;  1ZQA A;  8ICX A;  4AS1 A;  4BUG A;  2I9G A;  4US8 A;  8ICB A;  1O03 A;  3GZF A;  2LZ6 A;  3CWI A;  3K4G A;  7ICK A;  1WJ6 A;  1EXN A;  4YWG G;  4E71 A;  5AI8 A;  2V4I B;  1V1P A;  1ZD2 P;  2JRI B;  2BKE A;  3F5A A;  4MGY E;  4M2Y A;  2LYA A;  1RQL A;  4NV0 A;  3DPD A;  1N62 A;  2KIC A;  3QQ8 B;  5E6J A;  1AWD A;  3DVN U;  4YXJ A;  5DGB A;  3PW5 A;  3E9S A;  2FCS A;  3PMN A;  1F44 A;  4DSJ A;  4DL3 A;  3W5V B;  1PZN A;  3E56 A;  4CDG A;  3UF8 A;  2NS5 A;  3W2D A;  1E90 A;  1I4Q A;  1MA7 A;  4BAX A;  2HBL A;  2QB0 A;  5J0S A;  2NBU A;  5J2J A;  3RR8 A;  5KL1 B;  2NO4 A;  2KC1 A;  3ZKJ C;  1Y56 A;  2OOB B;  2DGZ A;  3KHL A;  2WXQ A;  4OHJ A;  3LB8 C;  3RMK C;  2L8J A;  2KVS A;  3CIR B;  4FJV B;  2DKZ A;  3HKZ C;  1IG6 A;  1J7A A;  1SV0 A;  1C1Y B;  1ZUD 2;  1ZET A;  8ICK A;  2LFI A;  4KSK C;  2KLC A;  4QWD A;  9ICQ A;  4HCN B;  1COK A;  2D3A A;  3EW9 A;  3QZ8 A;  5C3J B;  1RXV A;  1ET9 A;  5FKA C;  7ICP A;  3NG0 A;  4A90 A;  4J9R A;  3RR7 A;  3AEV A;  1UWX A;  4PL1 A;  4R8U B;  3CW2 C;  3MP9 A;  1SGH A;  1HUO A;  3NVY A;  5TIS U;  3PZ7 A;  1FFU A;  3TIX A;  3PR5 B;  1E8X A;  4DWF A;  5KFS A;  2WF7 A;  9ICC A;  3N1Z C;  5J0Y A;  2N0S B;  4LNK A;  5L1K A;  2F76 X;  2A1J A;  1UF0 A;  4KTQ A;  4YR0 A;  2ZIV B;  1UA1 A;  5KFJ A;  4FZL A;  5CHW A;  3RNG C;  4DHZ E;  3T5L A;  4WIP A;  5KFW A;  3IRU A;  3UQ0 A;  4MM3 B;  3DEE A;  2PMZ F;  1RDF A;  5IIM A;  3MGH A;  4RGT A;  1NK8 A;  2IOF K;  2DPI A;  4M9N A;  1EWC A;  3IHP C;  2KMC A;  3W5U B;  1BPY A;  2DAF A;  4A55 A;  4DSI A;  4ACF A;  4IQU A;  5AZH A;  4YCX A;  3OJU A;  3N30 A;  3IAM 1;  4Y2U A;  5KFN A;  3HUI A;  1VZ7 A;  2L1A A;  2LGS A;  3PSP A;  1SZP A;  4RUC A;  4KX5 A;  1GAQ B;  2KEY A;  4YMM A;  4CF3 A;  2KQ7 A;  4FS2 A;  1WFY A;  9ICK A;  2LGI A;  2DL0 A;  2ZIX A;  4L2Y A;  3ZW3 A;  4PT5 A;  2DYB A;  4AYB F;  2KIW A;  1SGG A;  4Q8F A;  4AP4 C;  2N1V A;  3BII D;  3FYH A;  2VJ4 A;  2W03 A;  1UHU A;  2LI6 A;  4IUM B;  4W9F A;  1HXY D;  3RJH A;  4HPP A;  1IYF A;  1R4M I;  1WX8 A;  2LJ5 A;  4XUS A;  1SE4 A;  3F2B A;  4FS1 A;  3AEF B;  3G6V A;  5D94 A;  3AQE A;  7ICL A;  2C7H A;  1ZQY A;  1PVR A;  4P2H A;  2G45 B;  2ZUD A;  2Z8L A; 
#chains in the Genus database with same CATH homology
 1FO4 A;  1B1Z A;  4IKG A;  5EE3 A;  2BW2 A;  1QF6 A;  2W54 A;  2GRI A;  2IGD A;  4XWT A;  3EA6 A;  4XDC A;  3VQI A;  2V0G A;  4C56 C;  3B2G A;  3AMZ A;  1QQR A;  5LNK 1;  2K22 A;  2NMQ A;  2WXM A;  4NZL B;  2EKI A;  1RYJ A;  3TEZ A;  3PZ8 A;  4KKI A;  3VR8 B;  4TSS A;  3VRA B;  1SEB D;  3LXF A;  4RH6 A;  1PUT A;  1VRA B;  3RPF C;  2ON8 A;  2KQ4 X;  1PGX A;  4TQ0 A;  1BML C;  4ZRP A;  1V1P B;  3ETR A;  3HVD A;  1UNS A;  2V3N A;  1D5M C;  4KX6 B;  1EM7 A;  2L83 A;  1QIL A;  3Q8A A;  1YMH E;  2HTM E;  4A8X C;  4KKJ A;  1OQQ A;  1JWU D;  1XLQ A;  2CU3 A;  2W55 A;  1D5X C;  2M19 A;  5BYR A;  2E6X A;  2NTT A;  1FEH A;  4RGM A;  1E9M A;  1QOA A;  3NRZ A;  4TMA B;  2WXR A;  3KQ4 A;  2KMM A;  3EUB 2;  1QLB B;  2JZP A;  3FIL B;  4P16 A;  2K3U A;  3TSS A;  2X38 A;  1AW7 A;  1XCT L;  1SB3 C;  1FIQ A;  3Q69 A;  3Q8E A;  2KAC A;  1TKE A;  2K5P A;  2BB6 A;  2W3S A;  1EWY C;  1FCC C;  1CJE A;  3P4S B;  4D2K A;  1N60 A;  2W82 A;  4EE2 A;  2IJ0 A;  5JXV A;  5C2T B;  2M56 B;  2B76 B;  2FUG 1;  2WLB A;  3IT4 B;  1STE A;  5HFY A;  1HEZ E;  1ET6 A;  4YT0 B;  1F2R I;  1I4X A;  3H8H A;  2PTL A;  3Q8F A;  1DOX A;  3AE1 B;  4C7Y A;  4IOI E;  1IGD A;  1DOI A;  1XCQ L;  1AYF A;  1QOB A;  2JWU A;  4XWW A;  3BVZ A;  3AE9 B;  2LEK A;  5BYQ A;  1HA5 A;  1L0X B;  1SE3 A;  4CQN A;  5I4D A;  3L4P A;  3U2S C;  2DYM A;  2I2Y A;  3T3O A;  2WDQ B;  3Q8C A;  1EU4 A;  1TY2 A;  1YN4 A;  4JE3 B;  1HZ5 A;  1ACC A;  1N5X A;  1V97 A;  1FNW A;  2BBC A;  1YJI A;  1C76 A;  2HDE A;  1C9F A;  2MJ3 A;  1E6E B;  1E10 A;  2PW9 A;  4KGT A;  1NI3 A;  1PDX A;  1K53 A;  3BWU D;  1I4P A;  1SXT A;  2M0A A;  3EGR A;  3VR9 B;  4JWS C;  1NEK B;  1KLG D;  1ZXI A;  4RF1 A;  1SJE D;  3FAH A;  1JWB D;  1FNV A;  3J9C A;  1JRP A;  3MFG A;  1XLO A;  1GOZ A;  3P4Q B;  4H2A A;  4RGO S;  3MHZ A;  4XDD A;  1NYR A;  1P7E A;  4RCO A;  1JML A;  2NTS A;  1JWS D;  2H88 B;  2LHD A;  4NAW B;  1ZPS A;  2BS4 B;  4LTU A;  5AUI A;  3GB1 A;  1TS2 A;  4HRO A;  1TS5 A;  2WXJ A;  3U52 E;  1FXI A;  2AQ2 B;  1EU3 A;  4MAC A;  1WWT A;  3AED B;  4HKQ A;  1YQ4 B;  3ZJU A;  3N9Y C;  3HRD D;  2JYT A;  1LO5 D;  4LLG M;  1IBX A;  3LYY A;  2MH7 A;  1E7P B;  4ZHP A;  1JCK B;  1TS3 A;  2WQY B;  3W1S A;  5D3D A;  1B9R A;  3AEG B;  2KAJ A;  4MH8 A;  4N59 A;  2WDR B;  4RFB A;  1VZ6 A;  2ICI A;  1KRH A;  1T3Q A;  5HHD G;  5G5G A;  4B0M A;  4ZHO A;  1VJK A;  2J4X A;  2YEP B;  1FD6 A;  3DWM A;  1T5X D;  4YTP B;  4JX1 C;  1XF5 L;  2OHF A;  4GDL B;  1L0Y B;  3SR6 A;  1ZOY B;  2WXI A;  3ABV B;  2N9L A;  1SBB B;  1DGJ A;  5D3I B;  1JWA D;  2BTE A;  2H89 B;  2SAK A;  3BVM A;  4ARI A;  3AE6 B;  5FK9 C;  1BXT A;  4HRS A;  1CZP A;  4KGR A;  2WXO A;  5BMG A;  1RM6 C;  2LUM A;  4MT5 A;  4NJC A;  2EEL A;  2AQ3 B;  1L4D B;  1DYQ A;  4DXG A;  2QMT A;  3BVG A;  2IDY A;  2R61 A;  1C78 A;  3BYY B;  4FXC A;  4O1N A;  1ZDX A;  2LJI A;  2QSD A;  3AB5 A;  1E0Z A;  1V1O A;  1IGC A;  2JX5 A;  2MJD A;  3AM9 A;  4N58 A;  1PYW D;  3IXS A;  1RWS A;  4R3D A;  1YN3 A;  1L4Z B;  2G1E A;  1HQR D;  1TZO A;  4IDI A;  5MPO A;  4ZYS A;  1C4A A;  4YSZ B;  1A70 A;  2CJN A;  4WQM A;  2YEP F;  1SE2 A;  2DBY A;  4RGN A;  2WNM A;  3NVV A;  1J7C A;  1WGK A;  2QIE B;  4L23 A;  2ZW0 A;  1BUI C;  3AH7 A;  1YQ3 B;  4HJG E;  4YXD B;  5G5H A;  2L52 A;  1TYG B;  2KN4 A;  2WXH A;  1C4P A;  2DWQ A;  2QIL A;  4WAF A;  3GP7 A;  2BYT A;  4GDK B;  1UGJ A;  3FC4 A;  2TSS A;  1I4G A;  2AQ1 B;  1QOG A;  1FMA D;  2XN9 C;  3URY A;  3ZJT A;  2J53 A;  2E3T A;  5H8Y E;  1T6B X;  2CJO A;  2PIA A;  4HEA 1;  2J52 A;  1K51 A;  1WRI A;  2G9H D;  2PVG C;  2RDG A;  1HZ6 A;  4YSX B;  4GLS C;  1XLN A;  3AEE B;  1SF0 A;  3I57 A;  1VR9 A;  4JWU C;  3T3N A;  1KFY B;  4OVZ A;  1I4R A;  2WXK A;  2L32 A;  2SEB D;  3GS2 A;  3OWE B;  2LHE A;  1SIJ A;  2PLP A;  2K0P A;  2WXP A;  1R7S A;  4AQ7 A;  1XLP A;  4L1B A;  1NYQ A;  3V05 A;  1VLB A;  2MEK A;  1WYG A;  1KH0 A;  1TJE A;  2BT6 A;  1XO3 A;  2D5G A;  1KF6 B;  3P4R B;  3B2F A;  2DYO A;  1JAL A;  5FR3 A;  2Y5P A;  2VZK D;  1JQ4 A;  2WP9 B;  1ZP0 B;  3AE4 B;  1YNT E;  5TSS A;  1SJH D;  4NAM A;  1IBX B;  2FE8 A;  1L6U A;  3AEB B;  2KWD A;  3DWG C;  3BK2 A;  4ITK A;  2PMV A;  5HG2 A;  3SFE B;  4YTN B;  5EE1 A;  1CK1 A;  3NS1 A;  1FRD A;  1Q10 A;  4Q2J A;  2IPK D;  2N9K A;  3AE2 B;  2ACZ B;  3KLS X;  1ZXH A;  2BB5 A;  1JW9 D;  5T8I A;  1JRO A;  1MPE A;  1K50 A;  1OFF A;  3ZJV A;  1AN8 A;  1K52 A;  2BS3 B;  1QOF A;  3SFD B;  3IT6 B;  1PGA A;  2INN E;  1GPX A;  1ENF A;  3TUO A;  2Y3A A;  1C77 A;  4KGS A;  2WU2 B;  3WCQ A;  2JXT A;  1P7F A;  4OZA A;  1M4V A;  1ROE A;  3AE7 B;  4C7Z A;  1FM0 D;  3TEX A;  1UUP A;  4OZB A;  2Q5W D;  2OED A;  1GB1 A;  3P42 A;  1XEE A;  2INP E;  1ESF A;  3NUH B;  3BZD B;  3HVZ A;  3NVZ A;  1MVK A;  3I9V 1;  1IUE A;  4N6E B;  1OQR A;  2QJL A;  3ZGZ A;  2BS2 B;  1V8C A;  4DXF A;  1UWM A;  1XXG A;  3R2I A;  1TKY A;  4C80 A;  2PKO A;  3W9C B;  1L6V A;  2IGG A;  3KWL A;  2XNA C;  3P4P B;  1CQV A;  1N61 A;  1F2R C;  4JPS A;  2AX5 A;  2K9X A;  1YN5 A;  2DLB A;  1L5P A;  3AV8 A;  3AN1 A;  2J42 A;  3MC0 B;  1C79 A;  3PO0 A;  2QEJ C;  4DQO C;  3P1M A;  1JWM D;  1KLU D;  2N7J A;  2WXG A;  2ONQ A;  1VZ8 A;  2W3R A;  1PGB A;  1DOY A;  4OZC A;  1PFD A;  2V3P A;  5H92 C;  3MJ5 A;  2WXL A;  1N63 A;  3BK1 A;  3VRB B;  1GB4 A;  1NEN B;  1D6E C;  2JU6 X;  4UDU C;  2JSV X;  4TQ1 A;  1WSP A;  4AS1 A;  4ARC A;  4US8 A;  1L0V B;  1MI0 A;  5GXG B;  4WUR A;  3CWI A;  4J3O D;  4YWG G;  2V4I B;  1V1P A;  1FCL A;  1FNU A;  1N62 A;  5E6J A;  1AWD A;  4P6V F;  3E9S A;  2GB1 A;  4REZ A;  1FRR A;  4ZOH C;  1QKZ A;  4YSY B;  3W5V B;  3E56 A;  3TEW A;  3W2D A;  3IAS 1;  2WU5 B;  1I4Q A;  3AE8 B;  4WH4 A;  5BYS A;  3U7Z A;  2I38 A;  3ZYY X;  3V3X A;  2KDM A;  3FIL A;  4RNA A;  1Y56 A;  1F77 A;  1ZE3 D;  2WXN A;  2WXQ A;  4OHJ A;  2GI9 A;  3LB8 C;  4US9 A;  4ZRQ A;  1I7H A;  2PVO D;  1N5W A;  2RPV A;  2Y5C A;  3CIR B;  2RMM A;  1TS4 A;  1J7A A;  1ZDV A;  4M0W A;  1NVI D;  2JYE A;  1ZUD 2;  1D5Z C;  2LFI A;  5BMH A;  3TEY A;  1VDV A;  4B0E A;  4USA A;  5C3J B;  3AEC B;  4HKZ E;  1ET9 A;  3P63 A;  5FKA C;  3C8Y A;  4A90 A;  3NZ3 A;  1UWX A;  2VZK B;  2WDV B;  2IGH A;  3MP9 A;  2JQR B;  3R8B A;  3NVY A;  3PZ7 A;  1FFU A;  2N0S B;  3Q8B A;  1TKG A;  5AUK A;  5EE9 A;  2ZW1 A;  3O13 A;  4LK0 M;  4A9A A;  3B9J A;  1I4H A;  2MJE A;  4WIP A;  3AEA B;  2RDH A;  2FBW B;  4MM3 B;  4XE0 A;  4YTM B;  4A6Q A;  4RGT A;  3KWV A;  1EWC A;  1MHX A;  1TY0 A;  1J7B A;  1KTK A;  3W5U B;  1FFV A;  4A55 A;  1RFK A;  3IAM 1;  3HUI A;  1VZ7 A;  3ZQ4 A;  2L1A A;  2WXF A;  5D7G A;  3SEB A;  1C4C A;  1FXA A;  1GAQ B;  1F0Z A;  4RF0 A;  2LGI A;  5EE0 A;  4L2Y A;  2LMC A;  1QT9 A;  3UI3 A;  4PT5 A;  3AE3 B;  3RFZ B;  4OW0 A;  3BII D;  1MHH E;  2WS3 B;  1HXY D;  3R2T A;  3U4E G;  1SE4 A;  5BMI A;  3AEF B;  3BYT B;  1D4B A;  1SSN A;  3NVW A;  3AE5 B;  1YJJ A;  1WXQ A;  5HI1 A;  2Z8L A;  4WWM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...