3ETRA

Crystal structure of xanthine oxidase in complex with lumazine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 42
structure length 164
sequence length 164
chains with identical sequence L
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3etrA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3etrA01
1SIJA 4JWUC 1FXIA 1KFYB 3NS1A 4C80A 2PIAA 5EE1A 2AX5A 2G1EA 1DGJA 4YSYB 1FM0D 3VR9B 1N63A 1FXAA 1XLOA 1OQRA 1XO3A 3SR6A 2LEKA 2DBYA 1VDVA 1SF0A 1OQQA 1YQ4B 5C3JB 4YXDB 1RM6C 4HROA 1FFUA 2QIEB 1DOXA 3KWLA 1J7CA 4ZHOA 1WGKA 1GPXA 1J7BA 1NVID 1XLQA 1JWBD 1JRPA 1E10A 1FFVA 4WWMA 1ROEA 2K22A 3AV8A 5H92C 1E0ZA 1FO4A 1T3QA 1YJJA 3WCQA 2ACZB 3NRZA 1GAQB 2M19A 5AUIA 3AEDB 2JQRB 3VRBB 2CJOA 1AYFA 1NI3A 3P4QB 2BS2B 2KAJA 4YTMB 4ZHPA 1WWTA 1TKEA 3AE4B 1WYGA 1QF6A 1ZXIA 2JX5A 2WLBA 1VLBA 2Y5CA 4N58A 2OHFA 4C7YA 4USAA 3AE2B 1IUEA 1QLBB 1R7SA 4LTUA 1FRRA 4JX1C 3P4SB 1JW9D 5G5GA 2MH7A 2FBWB 4HRSA 1KF6B 1L6UA 5MPOA 3NVVA 1J7AA 1V8CA 3ABVB 1QOFA 3P4PB 1JWAD 4FXCA 1NEKB 1N62A 2PVOD 2H89B 1ZOYB 5C2TB 1WXQA 2EKIA 1RYJA 2W54A 1FRDA 1UWMA 1ZP0B 3CIRB 1XLNA 3NVYA 3LXFA 3SFDB 2B76B 5AUKA 4US9A 1CZPA 1L6VA 3DWGC 1SB3C 2K9XA 5H8YE 3VRAB 1QOGA 2BS4B 1QT9A 2WDQB 1NYQA 2L52A 3CWIA 1B9RA 3AM9A 1JQ4A 3AEBB 3AEAB 4C7ZA 2CJNA 1TYGB 3HUIA 4YTPB 2CU3A 2M56B 3AE9B 4N6EB 4ZOHC 2W55A 3W5UB 4A9AA 2MJEA 2PKOA 3AE1B 2MJ3A 1E6EB 1A70A 1KRHA 3AB5A 1N5WA 2H88B 3LB8C 1JALA 1TKYA 2W3SA 2BS3B 1WRIA 2L83A 2WP9B 3AEEB 4P6VF 2MJDA 1I7HA 1YJIA 2WDRB 3FAHA 2WU2B 3NVZA 2HTME 2DWQA 1TKGA 4YTNB 5EE9A 3W9CB 3AE6B 2E3TA 5G5HA 2Q5WD 3HVZA 2QJLA 3SFEB 1E7PB 3ZYYX 3AEGB 3ETRA 1PUTA 3AMZA 1FMAD 2WU5B 2K5PA 3AE5B 5EE3A 1EWYC 1L0VB 2W3RA 3W5VB 1OFFA 2PVGC 4IDIA 1RWSA 1F0ZA 5GXGB 3B2GA 1RFKA 4YT0B 3DWMA 3RPFC 4N59A 1N60A 1DOIA 1NYRA 3AN1A 3BIID 3L4PA 1NENB 1QOAA 4JWSC 4KX6B 4US8A 1AWDA 4YSZB 4YSXB 3NVWA 2BT6A 3FC4A 2WQYB 3AE8B 3AE7B 3B2FA 1DOYA 3B9JA 1N5XA 3AE3B 1ZUD2 1TJEA 1YQ3B 1N61A 1JROA 1L5PA 1QOBA 4WQMA 4ITKA 1PDXA 2WDVB 3EUB2 3HRDD 2KMMA 1V97A 1PFDA 3AEFB 3P4RB 1E9MA 1XLPA 1VJKA 2N0SB 3AH7A 3P1MA 1CJEA 1FIQA 3P63A 5EE0A 2WS3B 3PO0A 3AECB 3VR8B
chains in the Genus database with same CATH superfamily
4RFBA 2LRWA 8ICPA 3HK0A 2ZUBA 4BXOA 4RQ8A 3PSPA 1E7UA 5TSSA 3SZ2A 2FLNA 2H3IA 2ZCBA 2LGXA 1KTKA 5EOZA 3JPNA 1Q10A 2EKEC 4M01A 3AQFA 2Y5BB 1C9FA 4EBDA 3DBHB 2L8JA 3ZVVA 1P1AA 1F52A 5J2JA 1VR9A 2KFJA 2HMXA 1C77A 5IOIA 4J9OA 4KLFA 4BOZB 5JXVA 2KQ4X 4QJFB 3B0YA 1E90A 1GAQB 4KLEA 3A1QA 4KX3A 3ZDTA 2MX2A 5T8IA 4ZRJA 4UW9A 4OZCA 9ICWA 2RSUA 3R2IA 4ECTA 3SENA 3R3MA 2L7RA 2PKEA 5HMMA 4H2AA 3AE2B 1QLBB 1EWCA 5DG8A 1JXLA 1R4MB 1Z19A 4HYKA 2C60A 3FILA 1ZQOA 3VDZA 3PRPB 3ABVB 5FR6A 2RDIA 8ICMA 1STEA 2IBIB 1X2IA 1BNPA 2E5SA 4DL3A 1ZOYB 3N1ZC 3PSEB 1U4BA 4M04A 5TISU 1ZQVA 2W54A 4BBNC 2F8KA 5D49A 2VA8A 3NVYA 1YT3A 3GIKA 3GIJA 2W9CA 2ZVNA 4W9IA 4OJLA 2C7NB 1PQSA 3V6EB 2KX3A 3ENEA 2PE6B 3AU5A 2G0AA 1TTNA 3BJYA 3AU6A 2FCNA 2K6DB 3JW0X 2K4EA 2KMDA 2BYEA 3DBSA 2JT4B 3H8WA 5IO9A 2M56B 2FI1A 1WX9A 3H7PA 3PW5A 4A9AA 3RFAA 2MUTA 3IXSA 2ZJAA 1E6EB 1A70A 4RF1A 4KSLC 2WP9B 2W3SA 2KWCA 1MSWD 1HTOA 2ICIA 3HHMA 3L17A 5ALGA 3Q3FA 7ICOA 2B21A 1RXVA 2LGIA 4RT2A 4M47A 1BT0A 3ZQ4A 3W9CB 4NL9A 3OSNA 2Q5WD 3TMPB 1X9WA 4A20A 2LWPA 2HBLA 3QZ7A 2KZ3A 3N9YC 4BDPA 5GTIU 1URJA 1S9FA 1OUQA 2ZZPB 2XY5A 1NK8A 5J2EA 2LD9A 4KLTA 2JV3A 2RR9A 1M94A 4GC6A 5FKAC 4F4KA 3IAM1 2FCQA 3WA0A 2WXRA 1NENB 3RRHA 3ZD9A 4DXGA 3JPTA 4FHJA 4HJGE 5AKGA 3ZDEA 2INDC 4NLBA 4ARCA 3RAXA 2LGSA 4ITKA 1MJDA 4TQSA 3KUCB 4AWJA 3OJ4B 4HEA1 1ESFA 2F1HA 2LBOA 2BR0A 2LFIA 3VR8B 4JWNA 2O2VB 3L16A 4DFPA 2DZJA 4C80A 4Y2PA 4RQ5A 4B9NA 2L3ZA 4NXZA 4DQSA 4F5QA 1GNUA 3RJGA 4KLUA 3Q8KA 1KL9A 5IIIA 4OJOA 3QU2A 2KZRA 2ZNVC 3KWLA 3QU5A 4Y2SA 9ICTA 3UMCA 2BYVE 4EELA 2DL0A 1LGRA 4DL6A 3R66C 3ZXRA 2L1AA 2MA9B 4R8UB 3I1YA 2EDUA 1TY0A 5CTRC 2BTEA 3EWAA 4NQKE 4NL9C 2P66A 4YMMA 3RYTA 2GBKA 3Q8CA 1D6EC 3AEDB 1GG3A 4J9SA 2KTFA 3TQ1A 4L2YA 5JHAA 1TBEA 1NBFC 3HT3A 4RGMA 4GOCA 1BPBA 2Y0SF 5DGBA 3SQIA 9ICBA 2HD5B 3MJ5A 3PV1A 1H4RA 3ZDBA 1XSLA 1NK0A 2CXYA 3HPOA 3MC9A 3DVNU 3GILA 5J0RA 9ICIA 2JH7A 8ICWA 3ZDAA 2MH7A 1JCKB 4QZDA 1WY8A 4BWJA 1NDDA 1KLNA 2JMGA 5F9LA 1V8CA 3C28A 2GLSA 2KKCA 3VXWA 1QOFA 2ASQA 2M17A 1BPZA 2KQSA 1HUOA 1JWAD 7ICMA 1TIFA 2J6SA 4I29A 1ZQPA 3CIRB 5KG5A 3HP6A 1LFDA 4LZDA 3SFDB 3QC8B 2JGAA 1AROP 2GOWA 4KITB 5ALDA 1COKA 1U45A 4G3XB 4Y2TA 2BS4B 2BBCA 4RNOA 3QAQA 4QZHA 5DBCA 4ECQA 4IM2A 5KHQA 1T0RC 4J9PA 4C7ZA 4QZ9A 2MP2B 4W9CA 3AE9B 3TJPA 4P2HA 2W55A 4B95A 3W5UB 3TADC 2PKOA 2XCPA 5EWEA 4W9EA 1ZRNA 4RZRA 3QUCA 4HPPA 2BS3B 1SKRA 3MJWA 2F3NA 4O3SA 3U2SC 1GB1A 3DCGA 5KFXA 3N7PD 2G06A 3QIJA 3PZPA 4I2FA 3C29A 4EE2A 4ED7A 3GOEA 3M62B 3N32A 3ETRA 1PUTA 1Z1VA 4I6NB 4UASA 1YX5B 3GDXA 1IP9A 2I38A 4Y2UA 1X40A 2W8LA 1F0ZA 4ZDVA 2D3CA 3I57A 2D3AA 3IT6B 3VAWA 3GV5B 2FPLA 4J9QA 2FPKA 1J2NA 1S8OA 2GBRA 2JY6A 2IPKD 2HOQA 5ALSA 2D07B 2JVCA 2PMZC 4AOFA 3AE3B 1TJEA 3AU2A 1QOBA 2NO4A 1V1PB 4F7ZA 1VJKA 2F2AB 1DK2A 4KLQA 8ICSA 1KLVA 1XCTL 3AECB 3A9KB 1NJXA 2YMQA 3OTQA 4F50A 1WCNA 4IRCA 4EZKA 2HJ8A 4HCNB 4MT5A 1ZKHA 5KL1B 5ALVA 3GZNI 4MGIE 4YQWA 4ECZA 2ZIWA 5CRXA 4C4SA 2ASLA 3U52E 2HHSA 4Q8FA 2KXJA 4RM9A 4DLEA 1ZQYA 2J42A 3O65B 4MEYA 2FE9A 1UPHA 5AK3A 1CRXA 2OM6A 3Q2AC 3H0RB 3VH3B 1KDHA 1SSNA 1TGZB 1ZQKA 1ZQRA 4C8OA 1ET6A 4LDTB 3P4QB 4K7SA 4ACOA 2B3AA 2IZVB 2HHQA 4OHJA 3CYMA 2JX5A 4NQLB 3IAS1 2XN9C 3J9CA 4MH8A 1YX6B 1KM7A 1I42A 3PPAA 2DLBA 3PW4A 2MA1A 4P0PB 1AN8A 1HTQA 1L6UA 1FNVA 4YD2A 4HPMB 1WGHA 1UH6A 4M2YA 3HILA 2MRPA 3F5EA 4JUZA 1KQQA 3VCBA 1JX4A 5BMHA 5C2TB 5BPCA 1RYJA 5ALUA 1L0YB 3DVGY 2KJHB 4IWPA 1UF0A 3D32A 2W43A 7ICKA 2BQUA 2LJ5A 4X57B 4TUQA 3DPDA 1S97A 4KVGB 4A8XC 4RQ0A 3PR4A 1SV4A 2PMVA 2YN4A 1I35A 2F8LA 2Y1IA 4M0AA 4J9LA 4AYBC 4PGQA 2KDFB 1NK9A 1XQQA 4RNNA 2ZTCA 1U49A 1S0VA 1N48A 3QK0A 5GTHU 1D3ZA 7ICQA 4KMUA 3H0LB 1D8BA 3M6KA 1TKGA 4YTNB 3EPGA 3RB0A 1X6JA 1SZPA 3T5JA 2QJLA 4G0NB 2O2VA 4HPLB 3AMZA 3F5AA 3Q69A 3VTUA 3Q8SB 2BCRA 2UWQA 2C7HA 5KFVA 1WH3A 5J2FA 3HW8A 1YD8U 3TANA 3W5VB 3ZKJC 2XEWA 2C22A 3UMBA 3ALBA 1VZ7A 3OJSA 4I2BA 2Y3AA 4YCXA 1I4GA 4BKGA 1GC7A 1ZQQA 3PHXB 4EBEA 2FMSA 4MELA 5HKHA 2WFAA 2WQYB 1QQ5A 3L3FX 1U47A 3B9JA 2UU7A 4R8UA 5KT6A 2I1JA 1TK0A 2YEPB 3IG8A 1I4XA 5AK4A 2G07A 1PGAA 3F53A 2N9XA 2HDOA 2XGPA 1WG8A 3R8BA 1SL2A 1Q0WB 1YQBA 4XA5A 5CWRA 4NAMA 3OJ3A 1I4HA 3KHLA 2XGQA 3PRZA 3JPPA 3SAGA 4YXDB 1RM6C 2FE8A 2IGGA 2LJIA 3Q8RB 1L2NA 2LZ6A 5DDYA 3A0HU 4FA6A 2UVWA 4BKSD 1E10A 2O6VD 4ZYSA 1EO6A 4E74A 4NM2A 1QSLA 3RT3B 3QXGA 4OVVA 1JMSA 4IQWA 2KICA 4RNAA 1LM8B 1YZ6A 1C4PA 3RB6A 1U48A 2Y1JA 4GB9A 2BS2B 4ZHPA 2W04A 5DLGA 2KJ9A 2RHFA 4YG2A 3ZNHB 3ZJVA 4YVZA 4C4RA 4PHPA 4M9LA 2OHFA 3R2TA 3KZIU 2PEAA 2REXA 3ZXVA 1KBUA 1R7SA 2NRVA 3N20C 2EAMA 2UVRA 2ZIUB 2R61A 2ZJ5A 1JW9D 2MP2A 3ZTCA 4KIKB 4OCZA 4F3OA 5AZGA 3VTVA 4R3DA 4AJWA 4WURA 2ZPYA 1VZ6A 2N9EB 2EZYA 5J29A 2KG5A 2BQ3A 4FXCA 4GU2A 3AQEA 3N4MB 1SXEA 2VJ4A 3ZD8A 2JEFA 4FBUA 2B0CA 5BOLA 1ZP0B 4MH0E 1WF9A 3ECIA 1ZQMA 2K4IA 1DGSA 2N1RA 3GIMA 4GMVA 4W9KA 3FDSA 2BWES 4FBJB 4DSKA 2NR2A 4HJKA 5AKIA 3Q8AA 5KFYA 3QU4A 1EUVB 3QX7A 1ED1A 4I2EA 1L7YA 1SEBD 2JXXA 1JQ4A 5AKHA 5J8YA 1WGRA 4B9MA 3KWVA 2NTSA 1PUZA 1JWSD 2QMTA 4DQPA 2MU2A 5AM4A 2WXHA 4UB3A 4ARIA 2QLTA 5ALTA 3WKAA 4PH5A 2CHWA 3FKYA 2PFOA 1V1PA 3PRMB 4WAAA 1IYFA 1WWVA 4IL6U 5ALEA 4XRHA 4C8KA 3WAMA 2E3TA 4M0WB 3RNFC 5BYRA 3H7IA 3AEGB 4CHKA 3A9KA 8ICOA 2VJ5A 3MC1A 1MG8A 2K5PA 2WWZA 1TZOA 2DZKA 1C79A 4JIOU 3UIPB 1XO0A 1TT5B 3MTNB 3NUHB 3V6JA 1IXRA 3TFSA 3DWMA 3VHTC 2C7MB 1ZXHA 3ETLA 3C5FA 2OYYA 1QOAA 1UZXB 3BDPA 3FC4A 2HTHA 1K50A 2KYWA 2W82A 4PHEA 4ZRQA 1ZPSA 3AL0B 3NASA 1SE4A 4A3OA 4LNNA 3ONSA 2KFNA 3SAHA 5ALMA 8ICIA 2LHDA 1MFWA 3DQVA 4EYIB 1PVPA 2N0SB 4KKJA 4GDKB 2AYOB 1SV0A 2IO3B 9ICCA 2JHDA 3PX4A 2FUHB 2XBBC 4HK2A 4JB3A 3Q8LA 2G1EA 4YSYB 3WK7A 1COOA 2BF8B 2EZXA 2LXCA 4ED3A 3IT4B 3H7SA 4P0PA 3ZLZA 1ZQFA 3MFGA 4I6PA 3K9PB 5CB1A 3AV8A 4RGNA 1ZD3A 4DCCA 1GOZA 1MI0A 4RQNA 1FO4A 2ACZB 2DKXA 1C7YA 2FNJB 5LXIB 5AKKA 1FEZA 3KW5B 3Q3OC 3VRBB 1XWLA 2A4ZA 2KIWA 5DB9A 9ICNA 2G4DB 4QZCA 3EECA 2KMAA 4RCOA 2OJRA 2ZJDA 3UQ2A 1WM3A 1F44A 1X1MA 1ET9A 2JZZA 1TE2A 2YB4A 4BAXA 2NRTA 4FZNA 4G50A 4JX1C 2A3VA 1JWMD 1D5XC 2JZPA 3JVZX 4RUCA 5KG1A 5D6JB 2Z8LA 4UB4A 4W9HA 4MF8A 4R63A 1F2RI 3KHGA 5AI6A 4CQNA 3ML8A 3DBHI 2KVSA 1A0PA 1H8CA 1XLNA 2BQQA 3GB1A 4FS2A 4O1NA 4UBBA 1DRGA 5AUKA 1XD3B 1BPEA 4NY0A 1L6VA 2E6XA 2NS5A 2K4PA 2R8JA 1JXEA 3AEBB 4WAFA 4FHKA 1T0QC 3H4BA 4YTPB 4OJPA 1SWVA 1NK5A 4DSEA 2KMCA 3QWZB 3SEBA 1ZETA 3RZWC 1WRIA 5J2BA 4EBCA 4E3CA 3NVZA 2HW3A 3WK9A 5EE9A 2LMRA 5KG4A 4PS8A 1R4MI 1KN5A 1L8LA 4EUTA 1FD6A 5G5HA 9ICKA 3HVZA 1L8OA 4CF4A 3UI3A 1AARA 1TK8A 4XZ4A 4ED8A 4K3BA 2BPFA 2HCFA 2E8OA 4Q45A 3K9OB 1S1QB 4JL9A 3H4DA 1JI7A 2M9NA 1PZNA 5IIMA 3V3XA 4KN4A 8ICYA 3PT2B 3BQ0A 4JWSC 2P6UA 5BOMA 2KO3A 4KTQA 2H3VA 1ZDXA 1QCKA 4Q43A 3S2AA 5DBAA 1RLFA 3ZO5B 4REZA 3HRDD 1WZ0A 2IHMA 5DDMA 3V7LA 4RU9A 3N97B 1T3NA 3RJJA 3VTWA 3K75D 1AW7A 2WS3B 1MPEA 4MHVA 4FADA 1HEZE 4RH6A 1RDFA 1WX8A 9ICAA 4OD0A 4O3NA 2WF7A 1BUIC 2FMPA 1XO3A 1SF0A 1SXTA 3MR3A 4B0MA 2BQRA 3NTUA 2ZIUA 4BJQA 4IRKA 5KT2A 1DOXA 5KFEA 1WYWB 4KIKA 5HHIA 3V6KA 3T3NA 2V9HA 1Q46A 4R66A 2KDBA 4F2RA 4UATA 5D2MB 1C76A 2ZVOA 3V61A 1ROEA 5IA7A 3GU3A 1WXSA 5E6NA 3SHQA 4A6QA 3NRZA 1RXWA 4MFCA 3Q3MC 5AUIA 4DWFA 1LXDA 4PPXA 1L3VA 1NKEA 4K3CA 3DDHA 2D10A 2WXOA 3HX0A 1WWTA 2N9PC 1WYGA 2VA3A 2C5LC 2YMLA 3Q8FA 5CA7A 5IIOA 3EZ5A 2Y5CA 1KLUD 1I4QA 5IIJA 1WJNA 3OLMD 1J8CA 2LM4A 1TV9A 3LDZE 4FLHA 3JSVB 4EZ6A 1NZPA 3HIZA 2QB1A 2Y9TA 1Y56A 1J7AA 4TSSA 3B08A 4F93B 2QILA 3KHHA 4KZCA 4PL2A 1UQVA 2OH2A 1TS3A 2KJ6A 4IW0A 3TAPA 2N9LA 4QIWF 1ZQAA 3BS5B 1TVAA 5AK6A 3QZ8A 4M0WA 2AGQA 2W03A 4US9A 1E8ZA 1SE9A 5AKYA 3OGUA 2KHQA 2KOBA 3GP7A 5KL8B 3VUXA 2WDQB 4LNOA 2YEPF 9ICFA 2DAJA 3GS2A 2KKPA 1UHUA 3LK9A 2WAQF 3C21A 2NRWA 5CP2A 3BK2A 4PS3A 4LNKA 3O13A 1XO1A 4AUQC 1PGXA 1CQVA 3H8JA 4RMAA 2MJ3A 3VC8A 1N5WA 2G9HD 2PLPA 1UCVA 3GFKB 3EPIA 2XY7A 2PW9A 2BPCA 3APDA 3DBLB 3SMVA 2WU2B 5EWGA 2JEGA 3QHTA 5CHFA 3KUZA 2YTUA 3L10B 1YZ7A 2L05A 2I1QA 4WJPA 2R18A 2WF6A 2DYOA 2R2OA 1L3UA 4GDKA 1E7PB 3W2DA 4S0RA 1T7PA 1WI0A 3QEAZ 4IM0A 2WU5B 3LDAA 5KFBA 2GB1A 4ICVA 3AE5B 4TV3A 3UXOA 5DG7A 1UWXA 4B6JA 4G3IA 8ICFA 1B0XA 4QW9A 3UGBB 4FE3A 4F92B 4G11A 4P4MA 1DOIA 2BB6A 2PE9A 2V0GA 4A8EA 4GFJA 2A5UA 1QQRA 4D2KA 1P9DU 2HSZA 1HUZA 5KFNA 1UD7A 4LLGM 4IQUA 1ACCA 1PDXA 4MJSB 5AK5A 5KG2A 1V9JA 1V49A 2KJ5A 2W9NA 4YN4A 4ANXA 4O5KA 1D9DA 3L0WB 1Z00B 2LKYA 5AM0A 1GJZA 5J0TA 4CGZA 9ICOA 2AX5A 3H1UA 3URYA 2V3NA 2L5YA 5FK9C 2ZIXB 9ICEA 2LM1A 4DF8A 1VDVA 2J6UA 4ANUA 1L6NA 1UELA 4NLNA 1C4CA 2KIVA 4XX5A 4BZAA 3G6VA 4UARA 4WJOA 1L5UA 2Y0SC 4RGOS 3BQ7A 2GLEA 5IAAC 4AQ7A 1UGMA 1E0ZA 3MGHA 1DYQA 1T3QA 5ALNA 3FYHA 1Q8KA 2LHTA 3MR6A 3Q3NC 4ICAA 3WALA 2QCZA 3RF9A 3NGDA 2QARA 1WGYA 1NKCA 2XK5B 4YTMB 1AYFA 3VUYA 4ZRKA 4BWMA 4LK0M 1ZQWA 4O3RA 3A9JB 2FIFA 1NKBA 3ML9A 1ZXIA 1EF1A 1KLGD 1VLBA 8ICAA 4R64A 4RQ3A 1UUPA 1XSPA 2L00B 3B0XA 1TK5A 4LJPB 3L13A 4I6LB 1L3TA 2Z59B 3EFUA 5IP4D 3PNCA 2AQ3B 3BZKA 4KGTA 4DFDA 3P4SB 5G5GA 4KLJA 4IR9A 4M02A 4X5VA 3JPRA 4W9GA 2XO7A 4F8CB 2BGFA 3BVZA 2BDUA 1S76D 2WHIA 3IDWA 1BVSA 5HP4A 3QX1A 2ZG6A 1ZQEA 1QILA 1XC9A 2EKIA 3I9V1 2KVRA 5J2HA 1Z1BA 2LHEA 4XUSA 2KDMA 3MGIA 3RZFA 3H0MB 1SB3C 1S0OA 5H8YE 5I4DA 2WX0A 3V6HA 3EYZA 2A1JB 4Q8EA 1UGJA 5KT7A 1VD2A 2MW5A 5HMLA 3WKDA 2CU3A 3BQTA 2AH5A 4GSWA 2GO7A 4JLCA 2F76X 4FFDA 1OEYJ 4J9RA 3AE1B 3UMGA 1J0GA 3AB5A 3V7KA 1JALA 2O6KA 1TKYA 4P6VF 4XQ8A 4IRDA 1S0NA 3QA8A 5B5EU 2WGSA 3UF8A 5AKLA 4EX7A 1UNSA 4GLSC 3ZUNA 4UB5A 3NY5A 3ZYYX 5K4LA 4OW0A 2E1EA 4B0EA 1IBXB 4NJ8A 5GMVA 1RWSA 4JMUA 8ICJA 5GXGB 2WHEA 2KLGA 3RN9C 2WXMA 4EOYA 4PK1A 2ASJA 5ALLA 3PSFA 4M8NA 4B9UA 4M9HA 1S3SG 1Z3EB 1ZQHA 3ALRA 1PVQA 4US8A 3C5GA 2BT6A 3C8YA 3TSSA 4RQ4A 4JWMA 2XCAA 4IOIE 1ZQIA 5KFLA 3GIIA 1RAXA 4EZ9A 1HZ5A 3RNGC 2WDVB 2V4QA 3AEFB 4DXAB 1GUAB 1E9MA 3RNBC 2L76A 2AEHA 3E9SA 1D8YA 1Z4NA 3TL5A 2J6TA 4JWUC 1A6SA 1KSPA 2PIAA 2PFNA 4XGAB 2JPHA 2P6RA 3PHWB 1NJYA 3GV8B 1OQRA 1Y8RC 3H8SA 4Q2JA 4IKGA 5C5JA 3RR7A 4KZ0A 2ZUCA 1MC8A 5ALXA 4B9TA 2BDPA 3JSVA 2W8KA 5J2AA 3QUTA 5KG3A 3NZSA 4TQRA 2LVPA 3WKCA 2QEJC 2LUEA 3RJEA 4UAVA 3QUQA 3RRGA 3T5LA 3RAQA 3CSFA 5DPSA 3WCQA 1YNTE 3APFA 1K1QA 3Q8PB 5ALFA 3CRXA 3BS5A 1CEZA 4CNQA 3N3KB 3ISBA 2ZPNA 2ZXHA 3QU7A 1J97A 4DSIA 2DYBA 3NZ3A 3VQIA 1QKZA 3AE4B 4ZRIA 5ALKA 2LYAA 3NHEB 3SEIA 2IBKA 4C7YA 1ZQBA 3EHVA 4NJ6A 1IUEA 4LTUA 5AIBA 2E1FA 4KLHA 1FRRA 1HQRD 4XDDA 4XC2A 4RM8A 1KF6B 1QTMA 4HAIA 2YVCA 1SKWA 3KYCD 4MSMB 2HHTA 1N62A 4ED1A 5JTIA 2BW2A 3MC0B 5J2KA 9ICJA 2KV2A 2SEBD 1FRDA 1U9LA 3WIMA 3ZNGC 2J53A 4FJVB 3T3FA 1QOGA 1S5LU 4J9MA 8ICHA 5AKJA 1KKXA 3CSTA 3PSIA 1F2RC 4XYCA 4UAYA 3NS8A 1WWUA 5KFFA 2KK8A 3U26A 1RQNA 2FCMA 1WRDB 2LYBA 4KKIA 4MM3B 4FO6A 2LMCA 2AQ2B 9ICQA 3MP9A 3LB8C 2YMMA 1X42A 3DHIC 5DQIA 1XXGA 2MJDA 4F4YA 1I7HA 3H40A 4MJSA 1P7DA 4GDLB 8ICXA 1ZRMA 5AKXA 5J18A 3NG0A 4KSKC 3PSTA 9ICGA 4WQOB 3ZIMA 1Z00A 2JWZA 3RULA 1SKSA 1RYSA 1L0VB 1V9PA 2QC8A 2ZIXA 3VVWB 4PJ0U 4O3MA 4YT0B 2KTQA 2W9MA 2C2DA 1V86A 2GBMA 5IILA 1WMHB 2LVOA 1WCLA 3NVWA 2RDBC 3DBRB 3A0BU 1TZ1A 1ZUD2 1YQ3B 2RPVA 3Q8MA 1JROA 2RLTA 4DL7A 3K1RB 3P42A 2QB0B 2R8KA 7ICTA 9ICRA 1L7MA 2KWDA 1PK1B 2XK5A 2V4IB 2KANA 4E0DA 2DNFA 1ZQUA 2N9KA 3P63A 2KWVB 5KFMA 1KRPA 1WR6E 1KFYB 4K4HA 5AKEA 4P1CC 3A9JA 3NOBA 2C28A 2WTFA 4JV1A 4MGKE 1N63A 4HVBA 4DSLA 4DHZE 1OQQA 2LGDA 4ECXA 3RCZA 1SWWA 1PK3A 1F77A 1F9JA 1FFUA 3RJHA 3IN5A 2O6VB 2DZMA 1J7BA 5DPTA 2W7PA 5J0WA 3F2DA 1XS9D 4F5NA 4I2CA 2W11A 4HDOA 4HDQA 4WWMA 4ASWC 1FCLA 4IG7B 1V80A 2DUYA 2ESEA 4JGHB 4IWQA 3M63B 2N7DA 1CMXB 5FR3A 8ICCA 5J0PA 1ZQ1C 3RH5A 1TAQA 2A1AA 2Q4TA 3IG5A 1N6ZA 1PVRA 1TKEA 5JH5C 2JF5A 4XWWA 4S17A 3H6NA 1XU4A 3V05A 3RBDA 2IY1B 4B9SA 3R7QA 3PV8A 2IGDA 5TR5A 5KFWA 4DDGD 2MAXA 5DQGA 5AI0A 1LKYB 4FJYA 3AEVA 8ICKA 3U30A 2E8MA 2HVIA 2AL3A 4ELVA 3I63C 3RUIB 2M1MA 3ZNID 3ZGZA 1FCCC 1RYRA 2EMTA 4YMNA 4Z6EA 5DG9A 3T8MA 5G2NA 4DQIA 5KFHA 3M9MB 2DPIA 2J0MA 2ZCCA 1DK3A 4PZNA 4WJNA 4F4XA 3T5HA 3VRAB 1TFRA 1SXDA 2MQJA 3BYYB 1IBXA 2X38A 3IG3A 4TKNA 1L7PA 2DZIA 2CJNA 4RQ2A 2L0FA 2IY0B 4M00A 3JPSA 3KVFB 4AP4C 5JZEB 4F4WA 5J0QA 5HHHA 4WJQA 3IBEA 2R8GA 3AEEB 4CYEA 4WH4A 1SJED 5HI1A 2DWQA 2VH1A 1I4PA 2HBMA 2IOHA 3RH6A 4P16A 9ICVA 5E6OA 4YR0A 1LV5A 1FMAD 3UINB 3RNEC 2MCNB 5LNK1 5FP0A 1KW4A 8ICNA 1IGCA 4LVSA 1KH0A 2PVGC 1UA1A 4EX6A 4Y2XA 5T14A 2MWSB 3B2GA 2PFPA 4NAWB 1S10A 2INPE 3RJIA 2AXTU 1LO5D 1RZTA 1TS5A 1WXAA 2G5IB 4F4ZA 2JYTA 4OVUA 2N7EA 2EQYA 1AQ6A 4R65A 1AWDA 4KX6B 2NRZA 4QWCA 2KDEB 3AE7B 4YSXB 2H5XA 5DCNA 5B66U 1L5PA 3HJEA 2HOFA 2F1JA 2AQ4A 3P4RB 4HLEA 2DKZA 3PZ7A 1FIQA 1ZYQA 3T5KA 2IO1B 4DFJA 4QZGA 1IGDA 1YIWA 2LGYA 1F5SA 4KLOA 3AI5A 5CR0A 3OWEB 3OSPA 2XNAC 1ISNA 3M95A 3KOOA 4KLDA 2RDGA 1RPLA 1V81A 4HKQA 3OHBA 7ICLA 1E5WA 1ZJMA 2DBYA 4O5CA 1WJUA 5J0UA 2JRIB 3PZDA 2KQ7A 3AU4A 4UAZA 5D7GA 4QWBA 3WAPA 4ZHOA 1M4VA 3TIXA 2JSVX 4KX5A 2MBEA 3RI7C 3LVVA 1YJJA 2J52A 1KFDA 4KLSA 2ODGA 8ICTA 3CP8A 2FUG1 4IM3A 2DYMA 4MDKE 2SAKA 4F5RA 5LXHA 4XDCA 2FAZA 3BY4B 5BYSA 5HNKA 1KFSA 1LQBA 1WE7A 3IFWB 4N58A 1WE6A 5J8YC 1K51A 4WWPA 4MM3A 4RNMA 4TQ0A 2D3BA 3FILB 4JPSA 2EELA 2WDTB 1WXVA 2JWUA 3H8MA 3APCA 5D46A 4L23A 1VCBA 3GQCA 2PJHA 2KN4A 4W9FA 1WXQA 2VIXA 1UWMA 1BPXA 2QSDA 4FULA 3ZDMC 3C19A 1P98A 3R9KA 3C2KA 2B76B 1I4RA 1SGGA 3KKAA 2ONQA 5J2DA 4BOSC 5BMGA 3PLUA 1NYQA 2IA6A 3ICXA 2J4XA 3EW9A 3KZXA 3MFHA 1H38A 3HVDA 2JH1A 2ZNVB 4BUGA 1ECWA 1ZQXA 1WMHA 2KACA 2MJEA 2FLPA 3TBLD 2CR5A 2H88B 3HKZF 2LUMA 4N9F4 5IN7A 1O03A 4LCDE 5H2FU 2RGFA 3KUDB 2QB0A 4EYHB 1C1YB 5A0LA 1PK1A 1SV0C 1Z4OA 3I76A 3N7SC 2PXIA 1JUDA 2K3UA 3SFEB 1XSNA 1Q3UA 4W9JA 3BK1A 2JUOA 3K4GA 2K8BB 2W9BB 1Q3VA 1EU3A 2K6QA 5L9XA 2MBOA 1OFFA 1XF5L 3N7RC 2XVTA 5KFAA 2V4RA 1WZ3A 2YMPA 2G4SA 4EFOA 2BPSA 2GBNA 2MLBA 1P7EA 4BKSA 3MHSD 1HA5A 3IHPC 3V60A 3ZI4A 4CCHA 3UM9A 2XI9A 3C23A 4WWOA 3RNAC 1A5RA 4B9KA 3UIOB 2DGZA 4Y2JA 1ZW7A 2J7QB 1UA0A 2JEJA 4J6IA 2UVUA 1NJZA 5J2GA 5AHXA 3RH4A 3IRUA 2C2EA 3VUWA 3NUQA 3NS1A 4UB8U 3THVA 7ICRA 8ICUA 4FZMA 2RRDA 2I1KA 3DBLI 2OEHA 4OO1J 3VR9B 4JV2A 1T5XD 2BCUA 4HWIB 2BCVA 3RMKC 1NOMA 3Q3JA 4DQRA 4MEMA 5CHGA 4DSFA 1V5OA 3BQ2A 2WXJA 4DHJD 1LKYA 1ZD4A 5J2CA 2GOLA 4NPNA 1Q5WB 1WJ6A 2F77X 4OJ5A 2OJWA 1YN5A 4XE0A 1NNLA 5L95C 2M8SA 4RPYA 2JQRB 5KHOA 4KN7A 1NI3A 2ALZA 1WGDA 4TMAB 4J9NA 4FJZA 1Y88A 2DFLA 3D2QA 3KBBA 1C4AA 4WJ3B 1ZGUB 2B6GA 2I2YA 5JU5A 2V3SA 5D3IB 1SZHA 3ZDDA 2ISOA 4F1SA 1CUKA 4J03A 4QIWC 3BQ1A 1X9SA 1S0MA 1XEEA 2IO2B 4EKUA 2EAOA 3SYZA 4QZEA 4PHAA 4NZLB 5AI8A 4DEZA 2DQNB 2ZIVB 2KHVA 3GZFA 4U7CA 2R8IA 3KD3A 5DB8A 2XY6A 1NEKB 1R4NB 2H89B 2K8CB 1V5TA 1WR1A 2ES6A 4GLXA 3TCAA 4I2AA 1MN8A 3QNMA 2KSOB 3OAWA 2WAQC 3RJFA 4PGYA 4MGYE 3W1YA 3LWMA 2ZXIA 4W9DA 1ZQLA 5ALHA 2KT7A 2ZEQA 2V3PA 3CWIA 2MBQA 9ICUA 4NAWA 4ZH4A 1ZQNA 2PTLA 3ZRCA 2KTRB 4N6EB 3TACB 1L7NA 2RMMA 7ICVA 4QNLA 7ICNA 2AQ1B 3W1SA 3M3JA 2VANA 3WK8A 4PHDA 1OW5A 2BYTA 1B1ZA 2HTME 3VFKA 2W9AA 4F2SA 4U6PA 2GWSA 2BWFA 1SGHA 1GB4A 4K7UA 5DGAA 2KK0A 3BZCA 4I2DA 5KFUA 3WAOA 1RFKA 5DLFA 1ZQZA 2WB1F 7ICJA 3MR2A 3T79A 7ICSA 3BIID 3TEXA 1SBBB 1BMLC 3RB3A 1HZ6A 2X8XX 3B2FA 1DOYA 8ICLA 4GXKA 2INCC 1OXJA 5DPRA 3U7DA 9ICHA 3PO4A 3U7ZA 2VZKD 4YXMA 3IP4B 2YB1A 1PFDA 2KMMA 4C4VB 1T0SC 4QZAA 1CJEA 3UPQA 3MGVA 1QLNA 2KC1A 2EMSA 5D94A 1Z2MA 4C8MA 4LNIA 2D6FC 5AI9A 2WXLA 3LVWA 3M8SA 4GXIA 4YMOA 2AJQA 2ZIWB 2QKQA 3UXNA 4HROA 4EEYA 3DEEA 4P0QB 4KLIA 4GGQA 2F44A 1T6BX 2PI4A 2GRIA 3PR5B 1YJ1A 3W1SC 1JRPA 1P7FA 4KDIC 2K22A 2Y5PA 4QZ8A 4NJ7A 3NZUA 8ICVA 3IVFA 4UB1A 2HE7A 2NBUA 3TARA 5KFTA 3P2BA 8ICZA 1SIFA 3O0FA 5BYQA 3GE3C 3KQ4A 5BO4B 2BKEA 5CHWA 5C23A 3ZTDA 3S6JA 3PY8A 4A3PA 3BZDB 3L08A 5AM1A 1V1OA 4OZBA 2VH2A 5AKZA 2AL6A 4EEWA 1WUDA 1B22A 4RQ1A 5HR7A 2D5GA 1N2XA 4HRSA 5KFIA 2KKVA 4QZBA 3KYDD 1M6YA 2R8HA 2L32A 1C3TA 1NJWA 2GH1A 5KAFU 4ACFA 2NV3A 2HJ1A 2OWOA 3TEYA 3ISDA 1BPDA 2JRZA 1RQLA 3E58A 1T8EA 3LXFA 2CN1A 4F91B 2LVQA 2MSNA 3MABA 2VRRB 2KFZA 1ZQDA 2K1FA 4QAYA 3D2SA 2PI5A 2W9BA 2K8BA 3LWLA 4UB2A 3PLVA 4IUMB 2HHWA 2L52A 4BVUC 1ZOLA 5AM3A 2XICA 4BBNF 1UT8A 2OXOA 1YMHE 2KHWB 2NO5A 1OGWA 4G9BA 1EF5A 2BKFA 1QQ6A 3LJ3A 4P4OA 5L1MA 1TYGB 2K39A 3P1MA 1KOTA 3H9DA 3N28A 4C4TA 3BVGA 2KD1A 4KLGA 2AGOA 3TEWA 1KRHA 5KFJA 3OG5A 4I2GA 2WDRB 1E8WA 1YJIA 2N4FA 4YR3A 3WKEA 1VJ5A 2UYZB 3OHAA 4QWDA 4O3OA 5AZFA 4AP9A 5L1IA 2JRHA 4ANVA 3LYSA 4WIPA 4NV0A 5ALOA 3PVXA 4A55A 4ELUA 2W3RA 4OVZA 1K5OA 3UQAA 1MQ2A 2RQ5A 3RR8A 3BS7A 2KZZA 3TUOA 4KV2A 1N60A 2XC9A 3I28A 1NK4A 4DSJA 2KD0A 4J3OD 3ZNZB 3EFCA 3TEZA 1RYUA 3OPXA 2G5HB 3TADA 5J0XA 2CS4A 2FJ6A 3AE8B 1FXTB 5KG7A 3ZJTA 5JHBA 4EZJA 2IGHA 3CW2C 5ALJA 3E0FA 3Q8QB 1SJHD 1XLPA 5J0OA 3SD7A 1LVHA 3B0AA 2AWTA 3PO0A 1DOQA 4FBTA 2C9WB 4TUUA 2YLMA 4UB6U 4ED6A 4RPZA 5EE1A 5KFGA 5JRTA 3SI8A 3J81j 3RD2A 1T94A 2N1WA 3V62A 2NPTB 3SV3A 2BCQA 1YQ4B 5C3JB 3PMNA 4DOCA 5KFRA 4M8MA 4A90A 4ECRA 4F8RA 1NVID 9ICSA 2TSSA 1XLQA 3WU2U 4DL4A 3D6JA 1F1HA 1SE3A 1D9FA 5KAIU 2DAFA 2ZIVA 4ANWA 3SV4A 1WX7A 5ALPA 2K8CA 2W7OA 1B43A 3PW7A 2MSED 4DF4A 2PPHA 2Z0EB 3C2MA 3Q8BA 5IKCM 4QZFA 4HKZE 2KSOA 3DBRI 3KH0A 1ZQTA 1BGXT 2Q0ZX 4Z6CA 1Q1OA 4ECYA 2P35A 1RRBA 5CJ7A 3RB4A 1MVKA 3QEBZ 5J0SA 3AXCA 4F71A 3K1ZA 5KFPA 2J0KA 5D3DA 1WSPA 2KE7A 5DBBA 2ISPA 5IIKA 2KTRA 4K7WA 3N1YC 3NVVA 1GC6A 4P4PA 3PX0A 4GIBA 2KP7A 2PVOD 1OEYA 4GIVA 4Y2QA 2BGWA 2FIDA 1E7VA 4GN1A 4BKTA 2HHXA 3WANA 4ECSA 7ICGA 1NZBA 4KGRA 1QSYA 4OZAA 1UBIA 4ICUA 4NNJB 4CE6A 3DWGC 2K25A 2MEKA 5KFKA 1ZQGA 5CHVC 3AULA 1BNOA 3PS6A 1RFAA 4IQTA 4JK1A 4DOBA 5E6PA 2AQ0A 5KG6A 3BWUD 4YFKA 4DL2A 5J17A 4QWEA 2IHNA 4ZOHC 1JRUA 4DQQA 3B1LX 2JZ3B 2CPRA 2JZBB 5KFSA 2DHZA 2KEYA 4IS7A 3UXPA 2L83A 5ALYA 2PFQA 5DB6A 4Y2YA 3M8RA 4KLMA 5L1KA 1T0YA 2CHXA 2K89A 4C4VA 3VH4B 2LXAA 4ZYNA 1C20A 2D3DA 2BVCA 2H3ZA 2YQEA 2ASDA 4KGSA 2RD0A 1WIAA 4MF2A 4C00A 4ZRPA 5AI5A 4YR2A 1XT9B 4JQWC 4YXJA 2EH9A 1L4ZB 3SAFA 3C1ZA 3D2NA 3ORYA 4DBGA 4UAUA 2KC2A 4N59A 1NYRA 2AU0A 3L4PA 4P0QA 1OTRB 2CU1A 5G55A 4JV0A 4GXBA 2WXNA 1QQ7A 4IC9A 1ZD2P 4HCPB 2WXIA 2JU6X 5J2RA 2ZTDA 1IG6A 1WGGA 1D5MC 5AI4A 3JYUA 3L54A 9ICMA 3Q8EA 2LI5A 2G09A 4NM1A 2F1IA 3QYPA 2PMZF 4UDUC 3OJUA 1TKDA 4EENA 4ECVA 1WM2A 1TS4A 4LNFA 4JE3B 4RPXA 1XLOA 4TQ1A 2DX5B 3ED5A 2KNBA 3SR6A 2IMWP 1OQYA 4YP3A 5C0YA 5DPWA 3N30A 3QARA 4II3B 4NLZA 2JXTA 4ECWA 2G3QB 2IDYA 3DVNV 3PREA 1J2MA 3PVLA 4BFRA 5KT4A 4NWIA 4QW8A 1ZJNA 1JWBD 2KJRA 5F3XB 1FFVA 5KFDA 2MBHA 1ZQCA 5H92C 2I9GA 2HBJA 2M0NA 4K4IA 4ED0A 3CF6E 4DHZB 2KVCA 1QH9A 3RFZB 4DFKA 2CJOA 4MGZE 2KAJA 2ON8A 4IC7B 2NVUI 4LDTD 1HXYD 2D2QA 2KLCA 4NLGA 4CDGA 4YWGG 1JWUD 2E8PA 1DXSA 1D8LA 4IWOA 2FPMA 4RF0A 1V2YA 3WKBA 2NBWB 8ICEA 3MR5A 4YD1A 3ZW3A 1A77A 2YX8A 1P3QU 1UBQA 2FBWB 4DK5A 2IYDB 5KG0A 2NYVA 3P4PB 3KTQA 3U8ZA 9ICXA 1NI2A 5J0YA 2IO0B 1IM4A 1K8RB 2RDHA 3RBEA 4O3QA 1IPGA 3RNCC 4CO7A 1C78A 2AHOB 4I27A 5HR6A 2CHZA 2LYHA 2K60A 1YN3A 4I28A 1FNWA 5L83A 4YL8A 5DQHA 4DOAA 2FMQA 5E79U 1SL1A 2UVVA 2A1JA 3G6XA 3CNHA 5F9NA 2YY6A 3MFIA 2WF5A 1E8YA 1K53A 1Z5SB 3AEAB 1D4BA 2LRUA 4MSQB 4IR1A 2BZFA 3IV6A 2M4NA 1O08A 2GMIC 2R2QA 2RP5A 2D11A 3M7DA 3MDAA 1J19A 1HIWA 4CF5A 1X9MA 5TZVA 2HBKA 5L1JA 4M9GA 3CMMB 3NRWA 2HI0A 1YN4A 4K4GA 3GZNB 4PT5A 4BX9C 4PS7A 3TAQA 3ZDCA 3AE6B 4AYBF 3I3TB 4PL1A 2ZJ8A 2G45B 1TY2A 5KNIA 2CKHB 3EGRA 3RTVA 4LZGA 1EXNA 3QJZA 2KN7A 2V1YA 4O3PA 3H8HA 5EE3A 3AUOA 1UT5A 2QHOA 2KFKB 2BYFA 4IQVA 4HXDA 5DKWA 3V72A 2EZZA 2NPTA 4DL5A 5KT3A 4Z6FA 1ZQSA 2KZMA 4MEXA 4YSZB 3FM9A 2EAPA 4MFAA 4TUPA 4M6WB 5KFQA 2KDIA 1G6JA 5HG2A 3WK5A 4B9VA 5C1ZA 1N61A 3JPOA 1XNSA 3KHRA 3EA6A 4AS1A 1L4DB 3AH7A 5EE0A 2FDRA 3V7JA 1L3SA 1FXIA 4L1BA 2HVHA 3TI0A 4PZOA 4KMOB 3BYTB 4DS5A 2DENB 1DGJA 1FM0D 1FXAA 2LEKA 1FNUA 3F2BA 3QUBA 2WXKA 4TURA 5AM2A 4M9NA 1CI4A 4UQGA 2QIEB 1FPYA 1J7CA 4DO9A 2NRXA 1ZDVA 1B4FA 3C1YA 1LB2B 3KFUF 3UQ0A 2WX1A 5CEHA 3DOWA 2C2RA 4O0IA 2I5HA 8ICBA 4FN2A 3DHGC 7ICPA 1SL0A 3HWTA 2FLLA 2XIDA 1S77D 2HOIA 7ICEA 4UBCA 3WK4A 1QF6A 4BXOB 5HHDG 4BGDA 2WLBA 3ZRFA 1GO3F 2JXJA 1ZQJA 1HEKA 3T9LA 1SE2A 2GBJA 4NLCA 3PGEA 8ICRA 1HJPA 2E8NA 1CK1A 5ALQA 3A4RA 2ZW1A 4C8LA 3UQBA 4I2IA 2OEDA 3SD5A 5ALIA 2JZBA 1TS2A 4DQOC 3PTFC 3Q6BA 5J2IA 5D4BA 4FZLA 3R7RA 3T3OA 3IM1A 5BMIA 3C2LA 5CX3A 5ALWA 5L1LA 3PW2A 4DWIA 2IJ0A 3A1QB 4RUAA 2MRLA 1N56A 3DV9A 4URKA 3M9NB 4NJCA 8ICGA 4I2JA 2MBBB 1TAMA 1QT9A 3C0RB 3TKAA 1T4GA 3HKZC 3M9OB 5IINA 2LI6A 4C8NA 5EWFA 3SU8X 2CRXA 1JMLA 3JPQA 4NLKA 3M6ZA 1EM7A 2G08A 1TAUA 3IHQB 5KFCA 3DDCB 4CRXA 1VZ8A 7ICFA 1EU4A 1MHXA 1MHHE 3PZ8A 2RDJA 3GV7B 1WFYA 2IOFA 4LJXA 3FAHA 3N1XC 2W9CB 1YOVB 4GDLA 3HM3A 3NJTA 3U4EG 1V6EA 1PYWD 4B9LA 1R4NI 5LLIA 2KN5A 4IDIA 3A33B 2D3GA 4II2B 3HM6X 4RQMA 3RPFC 2D8CA 5DB7A 1K1SA 3AN1A 3H7PB 1NK6A 1MQ3A 3DHHC 4NY8A 2QDFA 2MUTB 5AZHA 3QQ8B 2FCSA 4RGTA 1N5XA 2NTTA 5EDSA 1QSSA 2JR5A 5AIAA 2K0PA 4EEKA 3EUB2 4B6WA 2V4LA 4DDID 4FS1A 3A4SC 1F0MA 2WXQA 4O9MA 1IV8A 1BXTA 9ICLA 1SIJA 7ICIA 3EC8A 3MDCA 1L0XB 2V9WA 1QZEA 1VRAB 3G6YA 1ENFA 2KX0A 4LJOB 3MBYA 4ECUA 4P7IA 4DHJB 3DVGX 1X66A 3SDLC 2H3FA 2OOBB 1WGKA 1GPXA 1ZD5A 4OJ6A 4KLLA 1BPYA 1V85A 2KOXA 2H3QA 2O6VA 4PYZA 4DLGA 3L5KA 8ICQA 1KJTA 3QE9Y 4Y2RA 4MFFA 4Y2VA 2KNJA 2QARB 2K8AA 5AM5A 3PO5A 2M19A 3PW0A 2HHVA 2K8HA 2KVZA 3KKAC 3PMLA 1P0RA 4O5EA 1WXMA 2BCSA 2OCEA 2VA2A 1NK7A 4P1BC 2WNMA 1FEHA 1KTQA 2Z0DB 3Q14C 2ZUDA 3ONNA 5ALRA 4J9KA 2BB5A 4USAA 1JIHA 2N7JA 2LASA 5KTQA 4F72A 2DF4B 2IOFK 4Q44A 2M0AA 4MACA 4WWNA 2K4HA 2VKQA 2WF9A 5MPOA 3BINA 2I6XA 2WXPA 4F5PA 2JEIA 2J0JA 2RPQA 4RQ6A 2WYQA 4RQ7A 2ZW0A 3E56A 1E8XA 2JYEA 3WK6A 1JN3A 2GI9A 4DFMA 1V38A 2WXGA 4RT3A 5KT5A 5HFYA 2N1VA 3ZJUA 4QZIA 2KWUB 1X6IA 3PX6A 5AICA 4C0ZA 3E2EA 4K1RB 3MC8A 3F2CA 2L0TA 1CZPA 3M1YA 2A19A 2K9XA 3QCAA 2NMQA 2LPEA 4C56C 4K81A 2ATLA 2KFKA 2KJ8A 3AM9A 1B9RA 3X0WA 2DPJA 5KFZA 3TFRA 4I2HA 3HUIA 4AJYB 3LYYA 4QWAA 2NBVB 5JUMA 4GXJA 4ED2A 4E71A 2BPGA 4ELTA 4F5OA 4M6WA 4PGXA 2NCNA 4GC7A 1PGBA 3X23A 1ZE3D 3BVMA 4UAWA 1KEJA 1U4AA 4DS4A 5AEKB 1IIPA 4DXFA 3ISCA 5E6JA 3V6CB 3QU9A 2AGPA 4PYUA 2WB1C 9ICPA 2EANA 2WF8A 5ALZA 1EWYC 1L7OA 1HE8A 4KDLB 1D5ZC 1WJ4A 2M0XA 2Z7JA 4EZLA 1K52A 4M9JA 2WXFA 2BKRB 1XCQL 1MA7A 2BHNA 2Y9UA 2ZTEA 2INNE 3KLSX 4XWTA 4CF3A 4W9LA 7ICHA 1KFTA 2VZKB 5KFOA 4WQMA 1X9XA 1A76A 7ICUA 3GE8C 1V97A 2HDEA 1RG6A 3RJKA 4TUSA 4Z6DA 2MHJA 2HHUA 1MG4A 3I5JC 3MHZA
chains in the Genus database with same CATH topology
4RFBA 1KFYB 5EE1A 2G1EA 4YSYB 5TSSA 1N63A 1KTKA 1Q10A 1C9FA 1OQQA 1YQ4B 5C3JB 1F77A 1FFUA 3IT4B 4A90A 1J7BA 1NVID 1VR9A 2TSSA 1XLQA 3MFGA 1FCLA 1C77A 1SE3A 4WWMA 3AV8A 4RGNA 1MI0A 1GOZA 5JXVA 1FO4A 2KQ4X 2ACZB 5FR3A 1GAQB 3VRBB 5T8IA 4HKZE 4OZCA 1TKEA 3R2IA 4RCOA 4XWWA 3V05A 1MVKA 4H2AA 3AE2B 1QLBB 2IGDA 1ET9A 1WSPA 5D3DA 1EWCA 4JX1C 1JWMD 1D5XC 2JZPA 2Z8LA 3FILA 3NVVA 3ABVB 1STEA 2PVOD 1F2RI 1ZOYB 4CQNA 3ZGZA 1FCCC 2W54A 4KGRA 1XLNA 3NVYA 3GB1A 4OZAA 4O1NA 5AUKA 1L6VA 3DWGC 2MEKA 3VRAB 2E6XA 3BYYB 1IBXA 2X38A 3AEBB 3BWUD 4WAFA 2CJNA 4YTPB 2M56B 4ZOHC 4A9AA 3SEBA 3IXSA 1E6EB 1A70A 4RF1A 2WP9B 2W3SA 2L83A 1WRIA 3AEEB 2ICIA 4WH4A 1SJED 3NVZA 5HI1A 2DWQA 2LGIA 1I4PA 5EE9A 3ZQ4A 4P16A 3W9CB 1FD6A 5G5HA 2Q5WD 3HVZA 3UI3A 4KGSA 3N9YC 1FMAD 4ZRPA 5LNK1 1L4ZB 1IGCA 1KH0A 2PVGC 3B2GA 3V3XA 4NAWB 5FKAC 2INPE 3IAM1 1LO5D 1TS5A 4N59A 1NYRA 2JYTA 2WXRA 3L4PA 1NENB 4JWSC 4KX6B 1AWDA 4DXGA 4YSXB 3AE7B 2WXNA 1ZDXA 4HJGE 2WXIA 4REZA 1L5PA 2JU6X 4ARCA 4ITKA 3HRDD 3P4RB 1D5MC 3Q8EA 3PZ7A 1ESFA 4HEA1 1FIQA 2LFIA 1AW7A 2WS3B 3Q8BA 1IGDA 1MPEA 4UDUC 3VR8B 1HEZE 3OWEB 4RH6A 2XNAC 4C80A 1TS4A 1BUIC 2RDGA 4JE3B 4HKQA 1XLOA 4TQ1A 1XO3A 3SR6A 2DBYA 1SF0A 1SXTA 4B0MA 2JXTA 5D7GA 1DOXA 2IDYA 3KWLA 4ZHOA 3T3NA 1M4VA 1JWBD 1FFVA 1C76A 1ROEA 2JSVX 2L1AA 1TY0A 5H92C 2BTEA 1YJJA 2J52A 4A6QA 3NRZA 2FUG1 3Q8CA 1D6EC 3AEDB 5AUIA 3RFZB 2CJOA 2DYMA 4L2YA 2KAJA 2WXOA 4RGMA 1WWTA 2ON8A 2SAKA 4XDCA 3MJ5A 5BYSA 1WYGA 1HXYD 3Q8FA 2Y5CA 4N58A 4YWGG 1JWUD 1KLUD 1I4QA 4RF0A 1K51A 4TQ0A 4JPSA 3FILB 2EELA 2MH7A 1JCKB 2FBWB 1Y56A 2JWUA 1J7AA 1V8CA 4TSSA 4L23A 1QOFA 3P4PB 2QILA 1JWAD 1TS3A 2N9LA 2KN4A 2RDHA 1WXQA 3CIRB 1UWMA 2QSDA 1C78A 3SFDB 4M0WA 2B76B 1I4RA 1YN3A 4US9A 1FNWA 2ONQA 3GP7A 2BS4B 2BBCA 2WDQB 5BMGA 1NYQA 2YEPF 2J4XA 3GS2A 1K53A 1D4BA 3AEAB 4C7ZA 3HVDA 3BK2A 3AE9B 2W55A 3O13A 1PGXA 1CQVA 3W5UB 2KACA 2MJEA 2PKOA 2MJ3A 1N5WA 2G9HD 2H88B 2PLPA 2BS3B 2LUMA 2PW9A 3U2SC 1GB1A 2WU2B 1YN4A 4PT5A 3AE6B 2DYOA 2K3UA 1TY2A 3SFEB 1E7PB 3EGRA 3W2DA 4EE2A 3ETRA 1PUTA 3BK1A 2WU5B 1EU3A 2GB1A 3AE5B 3H8HA 5EE3A 1UWXA 1OFFA 1F0ZA 1XF5L 2I38A 3I57A 3IT6B 1DOIA 2BB6A 2V0GA 2IPKD 1P7EA 4YSZB 1HA5A 1QQRA 4D2KA 5HG2A 3AE3B 1TJEA 4LLGM 1N61A 1QOBA 1ACCA 1PDXA 3EA6A 1V1PB 4AS1A 1L4DB 3AH7A 1VJKA 5EE0A 1XCTL 3AECB 1FXIA 4L1BA 3NS1A 3BYTB 2AX5A 1DGJA 3URYA 2V3NA 1FM0D 3VR9B 1FXAA 2LEKA 5FK9C 1FNUA 4MT5A 1VDVA 1T5XD 2WXKA 2QIEB 1C4CA 1J7CA 2WXJA 3U52E 1ZDVA 2J42A 4RGOS 4AQ7A 1E0ZA 1DYQA 1T3QA 1YN5A 4XE0A 1SSNA 2JQRB 4YTMB 1AYFA 1ET6A 1NI3A 3P4QB 4LK0M 4OHJA 4TMAB 1QF6A 1ZXIA 1KLGD 2JX5A 1VLBA 2WLBA 5HHDG 1UUPA 3IAS1 2XN9C 1SE2A 3J9CA 1C4AA 4MH8A 2I2YA 2AQ3B 5D3IB 4KGTA 2DLBA 3P4SB 1CK1A 5G5GA 1AN8A 1L6UA 1FNVA 1XEEA 2ZW1A 3BVZA 2OEDA 4NZLB 1TS2A 4DQOC 1NEKB 3T3OA 2H89B 5BMIA 5BMHA 1QILA 5C2TB 2EKIA 1RYJA 3I9V1 1L0YB 2IJ0A 2LHEA 2KDMA 4NJCA 1SB3C 4A8XC 5H8YE 5I4DA 1QT9A 1UGJA 2PMVA 2V3PA 3CWIA 2PTLA 2CU3A 4N6EB 1JMLA 2RMMA 1EM7A 3AE1B 3AB5A 1JALA 1TKYA 4P6VF 1VZ8A 1EU4A 1MHXA 1MHHE 2AQ1B 3PZ8A 3W1SA 2BYTA 3FAHA 1B1ZA 2HTME 1TKGA 4YTNB 1UNSA 4GLSC 2QJLA 3ZYYX 3U4EG 1GB4A 4OW0A 3AMZA 3Q69A 1PYWD 4B0EA 1IBXB 3W5VB 4IDIA 1RWSA 5GXGB 1RFKA 2WXMA 1VZ7A 2Y3AA 3RPFC 1I4GA 3AN1A 3BIID 3TEXA 4US8A 1SBBB 2BT6A 1BMLC 2WQYB 3C8YA 3TSSA 3B2FA 1HZ6A 4IOIE 3B9JA 1DOYA 4RGTA 1N5XA 2NTTA 2K0PA 1HZ5A 3U7ZA 2WDVB 3EUB2 2VZKD 2KMMA 3AEFB 1PFDA 2YEPB 1E9MA 1I4XA 3E9SA 1CJEA 1PGAA 2WXQA 1BXTA 1SIJA 4JWUC 3R8BA 1L0XB 2PIAA 4NAMA 1VRAB 1ENFA 1I4HA 2WXLA 1OQRA 4Q2JA 4IKGA 4YXDB 1RM6C 2FE8A 4HROA 2IGGA 1WGKA 2LJIA 1GPXA 2GRIA 1T6BX 2QEJC 1JRPA 1P7FA 1E10A 4ZYSA 2K22A 2Y5PA 3WCQA 1YNTE 2M19A 4RNAA 1C4PA 5BYQA 2BS2B 4ZHPA 3VQIA 3KQ4A 3NZ3A 1QKZA 3AE4B 3ZJVA 2WNMA 1FEHA 2BB5A 2OHFA 3R2TA 4C7YA 4USAA 3BZDB 1IUEA 1R7SA 4LTUA 1FRRA 1V1OA 2N7JA 4OZBA 2R61A 1HQRD 1JW9D 2M0AA 4MACA 4XDDA 2D5GA 4HRSA 1KF6B 5MPOA 2WXPA 4R3DA 4WURA 1VZ6A 2L32A 2ZW0A 3E56A 2JYEA 2GI9A 4FXCA 1N62A 2WXGA 2BW2A 5HFYA 3MC0B 3TEYA 3ZJUA 2SEBD 1FRDA 1ZP0B 3LXFA 2J53A 1CZPA 2K9XA 2NMQA 1QOGA 3Q8AA 4C56C 2L52A 1F2RC 1B9RA 3AM9A 1SEBD 1JQ4A 1YMHE 3KWVA 4MM3B 4KKIA 2NTSA 1TYGB 3HUIA 1JWSD 2LMCA 3LYYA 2QMTA 2AQ2B 3BVGA 3TEWA 3MP9A 3LB8C 1KRHA 2WXHA 4ARIA 1XXGA 1PGBA 2MJDA 1ZE3D 1I7HA 1YJIA 2WDRB 3BVMA 1V1PA 4GDLB 4DXFA 5E6JA 2E3TA 5BYRA 3AEGB 2K5PA 1TZOA 4WIPA 1C79A 1EWYC 1L0VB 4A55A 4OVZA 2W3RA 3NUHB 1D5ZC 4YT0B 3DWMA 3TUOA 1N60A 1ZXHA 1K52A 4J3OD 1QOAA 2WXFA 3TEZA 1XCQL 2INNE 3NVWA 3FC4A 3AE8B 2W82A 1K50A 3KLSX 4XWTA 3ZJTA 4ZRQA 2VZKB 1ZUD2 1YQ3B 1ZPSA 2RPVA 1JROA 1SE4A 2IGHA 4WQMA 3P42A 2LHDA 1V97A 2HDEA 1SJHD 1XLPA 2KWDA 2N0SB 3P1MA 3P63A 2V4IB 2N9KA 4KKJA 4GDKB 3MHZA 3PO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SIJ A;  4JWU C;  1FXI A;  1KFY B;  3NS1 A;  4C80 A;  2PIA A;  5EE1 A;  2AX5 A;  2G1E A;  1DGJ A;  4YSY B;  1FM0 D;  3VR9 B;  1N63 A;  1FXA A;  1XLO A;  1OQR A;  1XO3 A;  3SR6 A;  2LEK A;  2DBY A;  1VDV A;  1SF0 A;  1OQQ A;  1YQ4 B;  5C3J B;  4YXD B;  1RM6 C;  4HRO A;  1FFU A;  2QIE B;  1DOX A;  3KWL A;  1J7C A;  4ZHO A;  1WGK A;  1GPX A;  1J7B A;  1NVI D;  1XLQ A;  1JWB D;  1JRP A;  1E10 A;  1FFV A;  4WWM A;  1ROE A;  2K22 A;  3AV8 A;  5H92 C;  1E0Z A;  1FO4 A;  1T3Q A;  1YJJ A;  3WCQ A;  2ACZ B;  3NRZ A;  1GAQ B;  2M19 A;  5AUI A;  3AED B;  2JQR B;  3VRB B;  2CJO A;  1AYF A;  1NI3 A;  3P4Q B;  2BS2 B;  2KAJ A;  4YTM B;  4ZHP A;  1WWT A;  1TKE A;  3AE4 B;  1WYG A;  1QF6 A;  1ZXI A;  2JX5 A;  2WLB A;  1VLB A;  2Y5C A;  4N58 A;  2OHF A;  4C7Y A;  4USA A;  3AE2 B;  1IUE A;  1QLB B;  1R7S A;  4LTU A;  1FRR A;  4JX1 C;  3P4S B;  1JW9 D;  5G5G A;  2MH7 A;  2FBW B;  4HRS A;  1KF6 B;  1L6U A;  5MPO A;  3NVV A;  1J7A A;  1V8C A;  3ABV B;  1QOF A;  3P4P B;  1JWA D;  4FXC A;  1NEK B;  1N62 A;  2PVO D;  2H89 B;  1ZOY B;  5C2T B;  1WXQ A;  2EKI A;  1RYJ A;  2W54 A;  1FRD A;  1UWM A;  1ZP0 B;  3CIR B;  1XLN A;  3NVY A;  3LXF A;  3SFD B;  2B76 B;  5AUK A;  4US9 A;  1CZP A;  1L6V A;  3DWG C;  1SB3 C;  2K9X A;  5H8Y E;  3VRA B;  1QOG A;  2BS4 B;  1QT9 A;  2WDQ B;  1NYQ A;  2L52 A;  3CWI A;  1B9R A;  3AM9 A;  1JQ4 A;  3AEB B;  3AEA B;  4C7Z A;  2CJN A;  1TYG B;  3HUI A;  4YTP B;  2CU3 A;  2M56 B;  3AE9 B;  4N6E B;  4ZOH C;  2W55 A;  3W5U B;  4A9A A;  2MJE A;  2PKO A;  3AE1 B;  2MJ3 A;  1E6E B;  1A70 A;  1KRH A;  3AB5 A;  1N5W A;  2H88 B;  3LB8 C;  1JAL A;  1TKY A;  2W3S A;  2BS3 B;  1WRI A;  2L83 A;  2WP9 B;  3AEE B;  4P6V F;  2MJD A;  1I7H A;  1YJI A;  2WDR B;  3FAH A;  2WU2 B;  3NVZ A;  2HTM E;  2DWQ A;  1TKG A;  4YTN B;  5EE9 A;  3W9C B;  3AE6 B;  2E3T A;  5G5H A;  2Q5W D;  3HVZ A;  2QJL A;  3SFE B;  1E7P B;  3ZYY X;  3AEG B;  3ETR A;  1PUT A;  3AMZ A;  1FMA D;  2WU5 B;  2K5P A;  3AE5 B;  5EE3 A;  1EWY C;  1L0V B;  2W3R A;  3W5V B;  1OFF A;  2PVG C;  4IDI A;  1RWS A;  1F0Z A;  5GXG B;  3B2G A;  1RFK A;  4YT0 B;  3DWM A;  3RPF C;  4N59 A;  1N60 A;  1DOI A;  1NYR A;  3AN1 A;  3BII D;  3L4P A;  1NEN B;  1QOA A;  4JWS C;  4KX6 B;  4US8 A;  1AWD A;  4YSZ B;  4YSX B;  3NVW A;  2BT6 A;  3FC4 A;  2WQY B;  3AE8 B;  3AE7 B;  3B2F A;  1DOY A;  3B9J A;  1N5X A;  3AE3 B;  1ZUD 2;  1TJE A;  1YQ3 B;  1N61 A;  1JRO A;  1L5P A;  1QOB A;  4WQM A;  4ITK A;  1PDX A;  2WDV B;  3EUB 2;  3HRD D;  2KMM A;  1V97 A;  1PFD A;  3AEF B;  3P4R B;  1E9M A;  1XLP A;  1VJK A;  2N0S B;  3AH7 A;  3P1M A;  1CJE A;  1FIQ A;  3P63 A;  5EE0 A;  2WS3 B;  3PO0 A;  3AEC B;  3VR8 B; 
#chains in the Genus database with same CATH topology
 4RFB A;  2LRW A;  8ICP A;  3HK0 A;  2ZUB A;  4BXO A;  4RQ8 A;  3PSP A;  1E7U A;  5TSS A;  3SZ2 A;  2FLN A;  2H3I A;  2ZCB A;  2LGX A;  1KTK A;  5EOZ A;  3JPN A;  1Q10 A;  2EKE C;  4M01 A;  3AQF A;  2Y5B B;  1C9F A;  4EBD A;  3DBH B;  2L8J A;  3ZVV A;  1P1A A;  1F52 A;  5J2J A;  1VR9 A;  2KFJ A;  2HMX A;  1C77 A;  5IOI A;  4J9O A;  4KLF A;  4BOZ B;  5JXV A;  2KQ4 X;  4QJF B;  3B0Y A;  1E90 A;  1GAQ B;  4KLE A;  3A1Q A;  4KX3 A;  3ZDT A;  2MX2 A;  5T8I A;  4ZRJ A;  4UW9 A;  4OZC A;  9ICW A;  2RSU A;  3R2I A;  4ECT A;  3SEN A;  3R3M A;  2L7R A;  2PKE A;  5HMM A;  4H2A A;  3AE2 B;  1QLB B;  1EWC A;  5DG8 A;  1JXL A;  1R4M B;  1Z19 A;  4HYK A;  2C60 A;  3FIL A;  1ZQO A;  3VDZ A;  3PRP B;  3ABV B;  5FR6 A;  2RDI A;  8ICM A;  1STE A;  2IBI B;  1X2I A;  1BNP A;  2E5S A;  4DL3 A;  1ZOY B;  3N1Z C;  3PSE B;  1U4B A;  4M04 A;  5TIS U;  1ZQV A;  2W54 A;  4BBN C;  2F8K A;  5D49 A;  2VA8 A;  3NVY A;  1YT3 A;  3GIK A;  3GIJ A;  2W9C A;  2ZVN A;  4W9I A;  4OJL A;  2C7N B;  1PQS A;  3V6E B;  2KX3 A;  3ENE A;  2PE6 B;  3AU5 A;  2G0A A;  1TTN A;  3BJY A;  3AU6 A;  2FCN A;  2K6D B;  3JW0 X;  2K4E A;  2KMD A;  2BYE A;  3DBS A;  2JT4 B;  3H8W A;  5IO9 A;  2M56 B;  2FI1 A;  1WX9 A;  3H7P A;  3PW5 A;  4A9A A;  3RFA A;  2MUT A;  3IXS A;  2ZJA A;  1E6E B;  1A70 A;  4RF1 A;  4KSL C;  2WP9 B;  2W3S A;  2KWC A;  1MSW D;  1HTO A;  2ICI A;  3HHM A;  3L17 A;  5ALG A;  3Q3F A;  7ICO A;  2B21 A;  1RXV A;  2LGI A;  4RT2 A;  4M47 A;  1BT0 A;  3ZQ4 A;  3W9C B;  4NL9 A;  3OSN A;  2Q5W D;  3TMP B;  1X9W A;  4A20 A;  2LWP A;  2HBL A;  3QZ7 A;  2KZ3 A;  3N9Y C;  4BDP A;  5GTI U;  1URJ A;  1S9F A;  1OUQ A;  2ZZP B;  2XY5 A;  1NK8 A;  5J2E A;  2LD9 A;  4KLT A;  2JV3 A;  2RR9 A;  1M94 A;  4GC6 A;  5FKA C;  4F4K A;  3IAM 1;  2FCQ A;  3WA0 A;  2WXR A;  1NEN B;  3RRH A;  3ZD9 A;  4DXG A;  3JPT A;  4FHJ A;  4HJG E;  5AKG A;  3ZDE A;  2IND C;  4NLB A;  4ARC A;  3RAX A;  2LGS A;  4ITK A;  1MJD A;  4TQS A;  3KUC B;  4AWJ A;  3OJ4 B;  4HEA 1;  1ESF A;  2F1H A;  2LBO A;  2BR0 A;  2LFI A;  3VR8 B;  4JWN A;  2O2V B;  3L16 A;  4DFP A;  2DZJ A;  4C80 A;  4Y2P A;  4RQ5 A;  4B9N A;  2L3Z A;  4NXZ A;  4DQS A;  4F5Q A;  1GNU A;  3RJG A;  4KLU A;  3Q8K A;  1KL9 A;  5III A;  4OJO A;  3QU2 A;  2KZR A;  2ZNV C;  3KWL A;  3QU5 A;  4Y2S A;  9ICT A;  3UMC A;  2BYV E;  4EEL A;  2DL0 A;  1LGR A;  4DL6 A;  3R66 C;  3ZXR A;  2L1A A;  2MA9 B;  4R8U B;  3I1Y A;  2EDU A;  1TY0 A;  5CTR C;  2BTE A;  3EWA A;  4NQK E;  4NL9 C;  2P66 A;  4YMM A;  3RYT A;  2GBK A;  3Q8C A;  1D6E C;  3AED B;  1GG3 A;  4J9S A;  2KTF A;  3TQ1 A;  4L2Y A;  5JHA A;  1TBE A;  1NBF C;  3HT3 A;  4RGM A;  4GOC A;  1BPB A;  2Y0S F;  5DGB A;  3SQI A;  9ICB A;  2HD5 B;  3MJ5 A;  3PV1 A;  1H4R A;  3ZDB A;  1XSL A;  1NK0 A;  2CXY A;  3HPO A;  3MC9 A;  3DVN U;  3GIL A;  5J0R A;  9ICI A;  2JH7 A;  8ICW A;  3ZDA A;  2MH7 A;  1JCK B;  4QZD A;  1WY8 A;  4BWJ A;  1NDD A;  1KLN A;  2JMG A;  5F9L A;  1V8C A;  3C28 A;  2GLS A;  2KKC A;  3VXW A;  1QOF A;  2ASQ A;  2M17 A;  1BPZ A;  2KQS A;  1HUO A;  1JWA D;  7ICM A;  1TIF A;  2J6S A;  4I29 A;  1ZQP A;  3CIR B;  5KG5 A;  3HP6 A;  1LFD A;  4LZD A;  3SFD B;  3QC8 B;  2JGA A;  1ARO P;  2GOW A;  4KIT B;  5ALD A;  1COK A;  1U45 A;  4G3X B;  4Y2T A;  2BS4 B;  2BBC A;  4RNO A;  3QAQ A;  4QZH A;  5DBC A;  4ECQ A;  4IM2 A;  5KHQ A;  1T0R C;  4J9P A;  4C7Z A;  4QZ9 A;  2MP2 B;  4W9C A;  3AE9 B;  3TJP A;  4P2H A;  2W55 A;  4B95 A;  3W5U B;  3TAD C;  2PKO A;  2XCP A;  5EWE A;  4W9E A;  1ZRN A;  4RZR A;  3QUC A;  4HPP A;  2BS3 B;  1SKR A;  3MJW A;  2F3N A;  4O3S A;  3U2S C;  1GB1 A;  3DCG A;  5KFX A;  3N7P D;  2G06 A;  3QIJ A;  3PZP A;  4I2F A;  3C29 A;  4EE2 A;  4ED7 A;  3GOE A;  3M62 B;  3N32 A;  3ETR A;  1PUT A;  1Z1V A;  4I6N B;  4UAS A;  1YX5 B;  3GDX A;  1IP9 A;  2I38 A;  4Y2U A;  1X40 A;  2W8L A;  1F0Z A;  4ZDV A;  2D3C A;  3I57 A;  2D3A A;  3IT6 B;  3VAW A;  3GV5 B;  2FPL A;  4J9Q A;  2FPK A;  1J2N A;  1S8O A;  2GBR A;  2JY6 A;  2IPK D;  2HOQ A;  5ALS A;  2D07 B;  2JVC A;  2PMZ C;  4AOF A;  3AE3 B;  1TJE A;  3AU2 A;  1QOB A;  2NO4 A;  1V1P B;  4F7Z A;  1VJK A;  2F2A B;  1DK2 A;  4KLQ A;  8ICS A;  1KLV A;  1XCT L;  3AEC B;  3A9K B;  1NJX A;  2YMQ A;  3OTQ A;  4F50 A;  1WCN A;  4IRC A;  4EZK A;  2HJ8 A;  4HCN B;  4MT5 A;  1ZKH A;  5KL1 B;  5ALV A;  3GZN I;  4MGI E;  4YQW A;  4ECZ A;  2ZIW A;  5CRX A;  4C4S A;  2ASL A;  3U52 E;  2HHS A;  4Q8F A;  2KXJ A;  4RM9 A;  4DLE A;  1ZQY A;  2J42 A;  3O65 B;  4MEY A;  2FE9 A;  1UPH A;  5AK3 A;  1CRX A;  2OM6 A;  3Q2A C;  3H0R B;  3VH3 B;  1KDH A;  1SSN A;  1TGZ B;  1ZQK A;  1ZQR A;  4C8O A;  1ET6 A;  4LDT B;  3P4Q B;  4K7S A;  4ACO A;  2B3A A;  2IZV B;  2HHQ A;  4OHJ A;  3CYM A;  2JX5 A;  4NQL B;  3IAS 1;  2XN9 C;  3J9C A;  4MH8 A;  1YX6 B;  1KM7 A;  1I42 A;  3PPA A;  2DLB A;  3PW4 A;  2MA1 A;  4P0P B;  1AN8 A;  1HTQ A;  1L6U A;  1FNV A;  4YD2 A;  4HPM B;  1WGH A;  1UH6 A;  4M2Y A;  3HIL A;  2MRP A;  3F5E A;  4JUZ A;  1KQQ A;  3VCB A;  1JX4 A;  5BMH A;  5C2T B;  5BPC A;  1RYJ A;  5ALU A;  1L0Y B;  3DVG Y;  2KJH B;  4IWP A;  1UF0 A;  3D32 A;  2W43 A;  7ICK A;  2BQU A;  2LJ5 A;  4X57 B;  4TUQ A;  3DPD A;  1S97 A;  4KVG B;  4A8X C;  4RQ0 A;  3PR4 A;  1SV4 A;  2PMV A;  2YN4 A;  1I35 A;  2F8L A;  2Y1I A;  4M0A A;  4J9L A;  4AYB C;  4PGQ A;  2KDF B;  1NK9 A;  1XQQ A;  4RNN A;  2ZTC A;  1U49 A;  1S0V A;  1N48 A;  3QK0 A;  5GTH U;  1D3Z A;  7ICQ A;  4KMU A;  3H0L B;  1D8B A;  3M6K A;  1TKG A;  4YTN B;  3EPG A;  3RB0 A;  1X6J A;  1SZP A;  3T5J A;  2QJL A;  4G0N B;  2O2V A;  4HPL B;  3AMZ A;  3F5A A;  3Q69 A;  3VTU A;  3Q8S B;  2BCR A;  2UWQ A;  2C7H A;  5KFV A;  1WH3 A;  5J2F A;  3HW8 A;  1YD8 U;  3TAN A;  3W5V B;  3ZKJ C;  2XEW A;  2C22 A;  3UMB A;  3ALB A;  1VZ7 A;  3OJS A;  4I2B A;  2Y3A A;  4YCX A;  1I4G A;  4BKG A;  1GC7 A;  1ZQQ A;  3PHX B;  4EBE A;  2FMS A;  4MEL A;  5HKH A;  2WFA A;  2WQY B;  1QQ5 A;  3L3F X;  1U47 A;  3B9J A;  2UU7 A;  4R8U A;  5KT6 A;  2I1J A;  1TK0 A;  2YEP B;  3IG8 A;  1I4X A;  5AK4 A;  2G07 A;  1PGA A;  3F53 A;  2N9X A;  2HDO A;  2XGP A;  1WG8 A;  3R8B A;  1SL2 A;  1Q0W B;  1YQB A;  4XA5 A;  5CWR A;  4NAM A;  3OJ3 A;  1I4H A;  3KHL A;  2XGQ A;  3PRZ A;  3JPP A;  3SAG A;  4YXD B;  1RM6 C;  2FE8 A;  2IGG A;  2LJI A;  3Q8R B;  1L2N A;  2LZ6 A;  5DDY A;  3A0H U;  4FA6 A;  2UVW A;  4BKS D;  1E10 A;  2O6V D;  4ZYS A;  1EO6 A;  4E74 A;  4NM2 A;  1QSL A;  3RT3 B;  3QXG A;  4OVV A;  1JMS A;  4IQW A;  2KIC A;  4RNA A;  1LM8 B;  1YZ6 A;  1C4P A;  3RB6 A;  1U48 A;  2Y1J A;  4GB9 A;  2BS2 B;  4ZHP A;  2W04 A;  5DLG A;  2KJ9 A;  2RHF A;  4YG2 A;  3ZNH B;  3ZJV A;  4YVZ A;  4C4R A;  4PHP A;  4M9L A;  2OHF A;  3R2T A;  3KZI U;  2PEA A;  2REX A;  3ZXV A;  1KBU A;  1R7S A;  2NRV A;  3N20 C;  2EAM A;  2UVR A;  2ZIU B;  2R61 A;  2ZJ5 A;  1JW9 D;  2MP2 A;  3ZTC A;  4KIK B;  4OCZ A;  4F3O A;  5AZG A;  3VTV A;  4R3D A;  4AJW A;  4WUR A;  2ZPY A;  1VZ6 A;  2N9E B;  2EZY A;  5J29 A;  2KG5 A;  2BQ3 A;  4FXC A;  4GU2 A;  3AQE A;  3N4M B;  1SXE A;  2VJ4 A;  3ZD8 A;  2JEF A;  4FBU A;  2B0C A;  5BOL A;  1ZP0 B;  4MH0 E;  1WF9 A;  3ECI A;  1ZQM A;  2K4I A;  1DGS A;  2N1R A;  3GIM A;  4GMV A;  4W9K A;  3FDS A;  2BWE S;  4FBJ B;  4DSK A;  2NR2 A;  4HJK A;  5AKI A;  3Q8A A;  5KFY A;  3QU4 A;  1EUV B;  3QX7 A;  1ED1 A;  4I2E A;  1L7Y A;  1SEB D;  2JXX A;  1JQ4 A;  5AKH A;  5J8Y A;  1WGR A;  4B9M A;  3KWV A;  2NTS A;  1PUZ A;  1JWS D;  2QMT A;  4DQP A;  2MU2 A;  5AM4 A;  2WXH A;  4UB3 A;  4ARI A;  2QLT A;  5ALT A;  3WKA A;  4PH5 A;  2CHW A;  3FKY A;  2PFO A;  1V1P A;  3PRM B;  4WAA A;  1IYF A;  1WWV A;  4IL6 U;  5ALE A;  4XRH A;  4C8K A;  3WAM A;  2E3T A;  4M0W B;  3RNF C;  5BYR A;  3H7I A;  3AEG B;  4CHK A;  3A9K A;  8ICO A;  2VJ5 A;  3MC1 A;  1MG8 A;  2K5P A;  2WWZ A;  1TZO A;  2DZK A;  1C79 A;  4JIO U;  3UIP B;  1XO0 A;  1TT5 B;  3MTN B;  3NUH B;  3V6J A;  1IXR A;  3TFS A;  3DWM A;  3VHT C;  2C7M B;  1ZXH A;  3ETL A;  3C5F A;  2OYY A;  1QOA A;  1UZX B;  3BDP A;  3FC4 A;  2HTH A;  1K50 A;  2KYW A;  2W82 A;  4PHE A;  4ZRQ A;  1ZPS A;  3AL0 B;  3NAS A;  1SE4 A;  4A3O A;  4LNN A;  3ONS A;  2KFN A;  3SAH A;  5ALM A;  8ICI A;  2LHD A;  1MFW A;  3DQV A;  4EYI B;  1PVP A;  2N0S B;  4KKJ A;  4GDK B;  2AYO B;  1SV0 A;  2IO3 B;  9ICC A;  2JHD A;  3PX4 A;  2FUH B;  2XBB C;  4HK2 A;  4JB3 A;  3Q8L A;  2G1E A;  4YSY B;  3WK7 A;  1COO A;  2BF8 B;  2EZX A;  2LXC A;  4ED3 A;  3IT4 B;  3H7S A;  4P0P A;  3ZLZ A;  1ZQF A;  3MFG A;  4I6P A;  3K9P B;  5CB1 A;  3AV8 A;  4RGN A;  1ZD3 A;  4DCC A;  1GOZ A;  1MI0 A;  4RQN A;  1FO4 A;  2ACZ B;  2DKX A;  1C7Y A;  2FNJ B;  5LXI B;  5AKK A;  1FEZ A;  3KW5 B;  3Q3O C;  3VRB B;  1XWL A;  2A4Z A;  2KIW A;  5DB9 A;  9ICN A;  2G4D B;  4QZC A;  3EEC A;  2KMA A;  4RCO A;  2OJR A;  2ZJD A;  3UQ2 A;  1WM3 A;  1F44 A;  1X1M A;  1ET9 A;  2JZZ A;  1TE2 A;  2YB4 A;  4BAX A;  2NRT A;  4FZN A;  4G50 A;  4JX1 C;  2A3V A;  1JWM D;  1D5X C;  2JZP A;  3JVZ X;  4RUC A;  5KG1 A;  5D6J B;  2Z8L A;  4UB4 A;  4W9H A;  4MF8 A;  4R63 A;  1F2R I;  3KHG A;  5AI6 A;  4CQN A;  3ML8 A;  3DBH I;  2KVS A;  1A0P A;  1H8C A;  1XLN A;  2BQQ A;  3GB1 A;  4FS2 A;  4O1N A;  4UBB A;  1DRG A;  5AUK A;  1XD3 B;  1BPE A;  4NY0 A;  1L6V A;  2E6X A;  2NS5 A;  2K4P A;  2R8J A;  1JXE A;  3AEB B;  4WAF A;  4FHK A;  1T0Q C;  3H4B A;  4YTP B;  4OJP A;  1SWV A;  1NK5 A;  4DSE A;  2KMC A;  3QWZ B;  3SEB A;  1ZET A;  3RZW C;  1WRI A;  5J2B A;  4EBC A;  4E3C A;  3NVZ A;  2HW3 A;  3WK9 A;  5EE9 A;  2LMR A;  5KG4 A;  4PS8 A;  1R4M I;  1KN5 A;  1L8L A;  4EUT A;  1FD6 A;  5G5H A;  9ICK A;  3HVZ A;  1L8O A;  4CF4 A;  3UI3 A;  1AAR A;  1TK8 A;  4XZ4 A;  4ED8 A;  4K3B A;  2BPF A;  2HCF A;  2E8O A;  4Q45 A;  3K9O B;  1S1Q B;  4JL9 A;  3H4D A;  1JI7 A;  2M9N A;  1PZN A;  5IIM A;  3V3X A;  4KN4 A;  8ICY A;  3PT2 B;  3BQ0 A;  4JWS C;  2P6U A;  5BOM A;  2KO3 A;  4KTQ A;  2H3V A;  1ZDX A;  1QCK A;  4Q43 A;  3S2A A;  5DBA A;  1RLF A;  3ZO5 B;  4REZ A;  3HRD D;  1WZ0 A;  2IHM A;  5DDM A;  3V7L A;  4RU9 A;  3N97 B;  1T3N A;  3RJJ A;  3VTW A;  3K75 D;  1AW7 A;  2WS3 B;  1MPE A;  4MHV A;  4FAD A;  1HEZ E;  4RH6 A;  1RDF A;  1WX8 A;  9ICA A;  4OD0 A;  4O3N A;  2WF7 A;  1BUI C;  2FMP A;  1XO3 A;  1SF0 A;  1SXT A;  3MR3 A;  4B0M A;  2BQR A;  3NTU A;  2ZIU A;  4BJQ A;  4IRK A;  5KT2 A;  1DOX A;  5KFE A;  1WYW B;  4KIK A;  5HHI A;  3V6K A;  3T3N A;  2V9H A;  1Q46 A;  4R66 A;  2KDB A;  4F2R A;  4UAT A;  5D2M B;  1C76 A;  2ZVO A;  3V61 A;  1ROE A;  5IA7 A;  3GU3 A;  1WXS A;  5E6N A;  3SHQ A;  4A6Q A;  3NRZ A;  1RXW A;  4MFC A;  3Q3M C;  5AUI A;  4DWF A;  1LXD A;  4PPX A;  1L3V A;  1NKE A;  4K3C A;  3DDH A;  2D10 A;  2WXO A;  3HX0 A;  1WWT A;  2N9P C;  1WYG A;  2VA3 A;  2C5L C;  2YML A;  3Q8F A;  5CA7 A;  5IIO A;  3EZ5 A;  2Y5C A;  1KLU D;  1I4Q A;  5IIJ A;  1WJN A;  3OLM D;  1J8C A;  2LM4 A;  1TV9 A;  3LDZ E;  4FLH A;  3JSV B;  4EZ6 A;  1NZP A;  3HIZ A;  2QB1 A;  2Y9T A;  1Y56 A;  1J7A A;  4TSS A;  3B08 A;  4F93 B;  2QIL A;  3KHH A;  4KZC A;  4PL2 A;  1UQV A;  2OH2 A;  1TS3 A;  2KJ6 A;  4IW0 A;  3TAP A;  2N9L A;  4QIW F;  1ZQA A;  3BS5 B;  1TVA A;  5AK6 A;  3QZ8 A;  4M0W A;  2AGQ A;  2W03 A;  4US9 A;  1E8Z A;  1SE9 A;  5AKY A;  3OGU A;  2KHQ A;  2KOB A;  3GP7 A;  5KL8 B;  3VUX A;  2WDQ B;  4LNO A;  2YEP F;  9ICF A;  2DAJ A;  3GS2 A;  2KKP A;  1UHU A;  3LK9 A;  2WAQ F;  3C21 A;  2NRW A;  5CP2 A;  3BK2 A;  4PS3 A;  4LNK A;  3O13 A;  1XO1 A;  4AUQ C;  1PGX A;  1CQV A;  3H8J A;  4RMA A;  2MJ3 A;  3VC8 A;  1N5W A;  2G9H D;  2PLP A;  1UCV A;  3GFK B;  3EPI A;  2XY7 A;  2PW9 A;  2BPC A;  3APD A;  3DBL B;  3SMV A;  2WU2 B;  5EWG A;  2JEG A;  3QHT A;  5CHF A;  3KUZ A;  2YTU A;  3L10 B;  1YZ7 A;  2L05 A;  2I1Q A;  4WJP A;  2R18 A;  2WF6 A;  2DYO A;  2R2O A;  1L3U A;  4GDK A;  1E7P B;  3W2D A;  4S0R A;  1T7P A;  1WI0 A;  3QEA Z;  4IM0 A;  2WU5 B;  3LDA A;  5KFB A;  2GB1 A;  4ICV A;  3AE5 B;  4TV3 A;  3UXO A;  5DG7 A;  1UWX A;  4B6J A;  4G3I A;  8ICF A;  1B0X A;  4QW9 A;  3UGB B;  4FE3 A;  4F92 B;  4G11 A;  4P4M A;  1DOI A;  2BB6 A;  2PE9 A;  2V0G A;  4A8E A;  4GFJ A;  2A5U A;  1QQR A;  4D2K A;  1P9D U;  2HSZ A;  1HUZ A;  5KFN A;  1UD7 A;  4LLG M;  4IQU A;  1ACC A;  1PDX A;  4MJS B;  5AK5 A;  5KG2 A;  1V9J A;  1V49 A;  2KJ5 A;  2W9N A;  4YN4 A;  4ANX A;  4O5K A;  1D9D A;  3L0W B;  1Z00 B;  2LKY A;  5AM0 A;  1GJZ A;  5J0T A;  4CGZ A;  9ICO A;  2AX5 A;  3H1U A;  3URY A;  2V3N A;  2L5Y A;  5FK9 C;  2ZIX B;  9ICE A;  2LM1 A;  4DF8 A;  1VDV A;  2J6U A;  4ANU A;  1L6N A;  1UEL A;  4NLN A;  1C4C A;  2KIV A;  4XX5 A;  4BZA A;  3G6V A;  4UAR A;  4WJO A;  1L5U A;  2Y0S C;  4RGO S;  3BQ7 A;  2GLE A;  5IAA C;  4AQ7 A;  1UGM A;  1E0Z A;  3MGH A;  1DYQ A;  1T3Q A;  5ALN A;  3FYH A;  1Q8K A;  2LHT A;  3MR6 A;  3Q3N C;  4ICA A;  3WAL A;  2QCZ A;  3RF9 A;  3NGD A;  2QAR A;  1WGY A;  1NKC A;  2XK5 B;  4YTM B;  1AYF A;  3VUY A;  4ZRK A;  4BWM A;  4LK0 M;  1ZQW A;  4O3R A;  3A9J B;  2FIF A;  1NKB A;  3ML9 A;  1ZXI A;  1EF1 A;  1KLG D;  1VLB A;  8ICA A;  4R64 A;  4RQ3 A;  1UUP A;  1XSP A;  2L00 B;  3B0X A;  1TK5 A;  4LJP B;  3L13 A;  4I6L B;  1L3T A;  2Z59 B;  3EFU A;  5IP4 D;  3PNC A;  2AQ3 B;  3BZK A;  4KGT A;  4DFD A;  3P4S B;  5G5G A;  4KLJ A;  4IR9 A;  4M02 A;  4X5V A;  3JPR A;  4W9G A;  2XO7 A;  4F8C B;  2BGF A;  3BVZ A;  2BDU A;  1S76 D;  2WHI A;  3IDW A;  1BVS A;  5HP4 A;  3QX1 A;  2ZG6 A;  1ZQE A;  1QIL A;  1XC9 A;  2EKI A;  3I9V 1;  2KVR A;  5J2H A;  1Z1B A;  2LHE A;  4XUS A;  2KDM A;  3MGI A;  3RZF A;  3H0M B;  1SB3 C;  1S0O A;  5H8Y E;  5I4D A;  2WX0 A;  3V6H A;  3EYZ A;  2A1J B;  4Q8E A;  1UGJ A;  5KT7 A;  1VD2 A;  2MW5 A;  5HML A;  3WKD A;  2CU3 A;  3BQT A;  2AH5 A;  4GSW A;  2GO7 A;  4JLC A;  2F76 X;  4FFD A;  1OEY J;  4J9R A;  3AE1 B;  3UMG A;  1J0G A;  3AB5 A;  3V7K A;  1JAL A;  2O6K A;  1TKY A;  4P6V F;  4XQ8 A;  4IRD A;  1S0N A;  3QA8 A;  5B5E U;  2WGS A;  3UF8 A;  5AKL A;  4EX7 A;  1UNS A;  4GLS C;  3ZUN A;  4UB5 A;  3NY5 A;  3ZYY X;  5K4L A;  4OW0 A;  2E1E A;  4B0E A;  1IBX B;  4NJ8 A;  5GMV A;  1RWS A;  4JMU A;  8ICJ A;  5GXG B;  2WHE A;  2KLG A;  3RN9 C;  2WXM A;  4EOY A;  4PK1 A;  2ASJ A;  5ALL A;  3PSF A;  4M8N A;  4B9U A;  4M9H A;  1S3S G;  1Z3E B;  1ZQH A;  3ALR A;  1PVQ A;  4US8 A;  3C5G A;  2BT6 A;  3C8Y A;  3TSS A;  4RQ4 A;  4JWM A;  2XCA A;  4IOI E;  1ZQI A;  5KFL A;  3GII A;  1RAX A;  4EZ9 A;  1HZ5 A;  3RNG C;  2WDV B;  2V4Q A;  3AEF B;  4DXA B;  1GUA B;  1E9M A;  3RNB C;  2L76 A;  2AEH A;  3E9S A;  1D8Y A;  1Z4N A;  3TL5 A;  2J6T A;  4JWU C;  1A6S A;  1KSP A;  2PIA A;  2PFN A;  4XGA B;  2JPH A;  2P6R A;  3PHW B;  1NJY A;  3GV8 B;  1OQR A;  1Y8R C;  3H8S A;  4Q2J A;  4IKG A;  5C5J A;  3RR7 A;  4KZ0 A;  2ZUC A;  1MC8 A;  5ALX A;  4B9T A;  2BDP A;  3JSV A;  2W8K A;  5J2A A;  3QUT A;  5KG3 A;  3NZS A;  4TQR A;  2LVP A;  3WKC A;  2QEJ C;  2LUE A;  3RJE A;  4UAV A;  3QUQ A;  3RRG A;  3T5L A;  3RAQ A;  3CSF A;  5DPS A;  3WCQ A;  1YNT E;  3APF A;  1K1Q A;  3Q8P B;  5ALF A;  3CRX A;  3BS5 A;  1CEZ A;  4CNQ A;  3N3K B;  3ISB A;  2ZPN A;  2ZXH A;  3QU7 A;  1J97 A;  4DSI A;  2DYB A;  3NZ3 A;  3VQI A;  1QKZ A;  3AE4 B;  4ZRI A;  5ALK A;  2LYA A;  3NHE B;  3SEI A;  2IBK A;  4C7Y A;  1ZQB A;  3EHV A;  4NJ6 A;  1IUE A;  4LTU A;  5AIB A;  2E1F A;  4KLH A;  1FRR A;  1HQR D;  4XDD A;  4XC2 A;  4RM8 A;  1KF6 B;  1QTM A;  4HAI A;  2YVC A;  1SKW A;  3KYC D;  4MSM B;  2HHT A;  1N62 A;  4ED1 A;  5JTI A;  2BW2 A;  3MC0 B;  5J2K A;  9ICJ A;  2KV2 A;  2SEB D;  1FRD A;  1U9L A;  3WIM A;  3ZNG C;  2J53 A;  4FJV B;  3T3F A;  1QOG A;  1S5L U;  4J9M A;  8ICH A;  5AKJ A;  1KKX A;  3CST A;  3PSI A;  1F2R C;  4XYC A;  4UAY A;  3NS8 A;  1WWU A;  5KFF A;  2KK8 A;  3U26 A;  1RQN A;  2FCM A;  1WRD B;  2LYB A;  4KKI A;  4MM3 B;  4FO6 A;  2LMC A;  2AQ2 B;  9ICQ A;  3MP9 A;  3LB8 C;  2YMM A;  1X42 A;  3DHI C;  5DQI A;  1XXG A;  2MJD A;  4F4Y A;  1I7H A;  3H40 A;  4MJS A;  1P7D A;  4GDL B;  8ICX A;  1ZRM A;  5AKX A;  5J18 A;  3NG0 A;  4KSK C;  3PST A;  9ICG A;  4WQO B;  3ZIM A;  1Z00 A;  2JWZ A;  3RUL A;  1SKS A;  1RYS A;  1L0V B;  1V9P A;  2QC8 A;  2ZIX A;  3VVW B;  4PJ0 U;  4O3M A;  4YT0 B;  2KTQ A;  2W9M A;  2C2D A;  1V86 A;  2GBM A;  5IIL A;  1WMH B;  2LVO A;  1WCL A;  3NVW A;  2RDB C;  3DBR B;  3A0B U;  1TZ1 A;  1ZUD 2;  1YQ3 B;  2RPV A;  3Q8M A;  1JRO A;  2RLT A;  4DL7 A;  3K1R B;  3P42 A;  2QB0 B;  2R8K A;  7ICT A;  9ICR A;  1L7M A;  2KWD A;  1PK1 B;  2XK5 A;  2V4I B;  2KAN A;  4E0D A;  2DNF A;  1ZQU A;  2N9K A;  3P63 A;  2KWV B;  5KFM A;  1KRP A;  1WR6 E;  1KFY B;  4K4H A;  5AKE A;  4P1C C;  3A9J A;  3NOB A;  2C28 A;  2WTF A;  4JV1 A;  4MGK E;  1N63 A;  4HVB A;  4DSL A;  4DHZ E;  1OQQ A;  2LGD A;  4ECX A;  3RCZ A;  1SWW A;  1PK3 A;  1F77 A;  1F9J A;  1FFU A;  3RJH A;  3IN5 A;  2O6V B;  2DZM A;  1J7B A;  5DPT A;  2W7P A;  5J0W A;  3F2D A;  1XS9 D;  4F5N A;  4I2C A;  2W11 A;  4HDO A;  4HDQ A;  4WWM A;  4ASW C;  1FCL A;  4IG7 B;  1V80 A;  2DUY A;  2ESE A;  4JGH B;  4IWQ A;  3M63 B;  2N7D A;  1CMX B;  5FR3 A;  8ICC A;  5J0P A;  1ZQ1 C;  3RH5 A;  1TAQ A;  2A1A A;  2Q4T A;  3IG5 A;  1N6Z A;  1PVR A;  1TKE A;  5JH5 C;  2JF5 A;  4XWW A;  4S17 A;  3H6N A;  1XU4 A;  3V05 A;  3RBD A;  2IY1 B;  4B9S A;  3R7Q A;  3PV8 A;  2IGD A;  5TR5 A;  5KFW A;  4DDG D;  2MAX A;  5DQG A;  5AI0 A;  1LKY B;  4FJY A;  3AEV A;  8ICK A;  3U30 A;  2E8M A;  2HVI A;  2AL3 A;  4ELV A;  3I63 C;  3RUI B;  2M1M A;  3ZNI D;  3ZGZ A;  1FCC C;  1RYR A;  2EMT A;  4YMN A;  4Z6E A;  5DG9 A;  3T8M A;  5G2N A;  4DQI A;  5KFH A;  3M9M B;  2DPI A;  2J0M A;  2ZCC A;  1DK3 A;  4PZN A;  4WJN A;  4F4X A;  3T5H A;  3VRA B;  1TFR A;  1SXD A;  2MQJ A;  3BYY B;  1IBX A;  2X38 A;  3IG3 A;  4TKN A;  1L7P A;  2DZI A;  2CJN A;  4RQ2 A;  2L0F A;  2IY0 B;  4M00 A;  3JPS A;  3KVF B;  4AP4 C;  5JZE B;  4F4W A;  5J0Q A;  5HHH A;  4WJQ A;  3IBE A;  2R8G A;  3AEE B;  4CYE A;  4WH4 A;  1SJE D;  5HI1 A;  2DWQ A;  2VH1 A;  1I4P A;  2HBM A;  2IOH A;  3RH6 A;  4P16 A;  9ICV A;  5E6O A;  4YR0 A;  1LV5 A;  1FMA D;  3UIN B;  3RNE C;  2MCN B;  5LNK 1;  5FP0 A;  1KW4 A;  8ICN A;  1IGC A;  4LVS A;  1KH0 A;  2PVG C;  1UA1 A;  4EX6 A;  4Y2X A;  5T14 A;  2MWS B;  3B2G A;  2PFP A;  4NAW B;  1S10 A;  2INP E;  3RJI A;  2AXT U;  1LO5 D;  1RZT A;  1TS5 A;  1WXA A;  2G5I B;  4F4Z A;  2JYT A;  4OVU A;  2N7E A;  2EQY A;  1AQ6 A;  4R65 A;  1AWD A;  4KX6 B;  2NRZ A;  4QWC A;  2KDE B;  3AE7 B;  4YSX B;  2H5X A;  5DCN A;  5B66 U;  1L5P A;  3HJE A;  2HOF A;  2F1J A;  2AQ4 A;  3P4R B;  4HLE A;  2DKZ A;  3PZ7 A;  1FIQ A;  1ZYQ A;  3T5K A;  2IO1 B;  4DFJ A;  4QZG A;  1IGD A;  1YIW A;  2LGY A;  1F5S A;  4KLO A;  3AI5 A;  5CR0 A;  3OWE B;  3OSP A;  2XNA C;  1ISN A;  3M95 A;  3KOO A;  4KLD A;  2RDG A;  1RPL A;  1V81 A;  4HKQ A;  3OHB A;  7ICL A;  1E5W A;  1ZJM A;  2DBY A;  4O5C A;  1WJU A;  5J0U A;  2JRI B;  3PZD A;  2KQ7 A;  3AU4 A;  4UAZ A;  5D7G A;  4QWB A;  3WAP A;  4ZHO A;  1M4V A;  3TIX A;  2JSV X;  4KX5 A;  2MBE A;  3RI7 C;  3LVV A;  1YJJ A;  2J52 A;  1KFD A;  4KLS A;  2ODG A;  8ICT A;  3CP8 A;  2FUG 1;  4IM3 A;  2DYM A;  4MDK E;  2SAK A;  4F5R A;  5LXH A;  4XDC A;  2FAZ A;  3BY4 B;  5BYS A;  5HNK A;  1KFS A;  1LQB A;  1WE7 A;  3IFW B;  4N58 A;  1WE6 A;  5J8Y C;  1K51 A;  4WWP A;  4MM3 A;  4RNM A;  4TQ0 A;  2D3B A;  3FIL B;  4JPS A;  2EEL A;  2WDT B;  1WXV A;  2JWU A;  3H8M A;  3APC A;  5D46 A;  4L23 A;  1VCB A;  3GQC A;  2PJH A;  2KN4 A;  4W9F A;  1WXQ A;  2VIX A;  1UWM A;  1BPX A;  2QSD A;  4FUL A;  3ZDM C;  3C19 A;  1P98 A;  3R9K A;  3C2K A;  2B76 B;  1I4R A;  1SGG A;  3KKA A;  2ONQ A;  5J2D A;  4BOS C;  5BMG A;  3PLU A;  1NYQ A;  2IA6 A;  3ICX A;  2J4X A;  3EW9 A;  3KZX A;  3MFH A;  1H38 A;  3HVD A;  2JH1 A;  2ZNV B;  4BUG A;  1ECW A;  1ZQX A;  1WMH A;  2KAC A;  2MJE A;  2FLP A;  3TBL D;  2CR5 A;  2H88 B;  3HKZ F;  2LUM A;  4N9F 4;  5IN7 A;  1O03 A;  4LCD E;  5H2F U;  2RGF A;  3KUD B;  2QB0 A;  4EYH B;  1C1Y B;  5A0L A;  1PK1 A;  1SV0 C;  1Z4O A;  3I76 A;  3N7S C;  2PXI A;  1JUD A;  2K3U A;  3SFE B;  1XSN A;  1Q3U A;  4W9J A;  3BK1 A;  2JUO A;  3K4G A;  2K8B B;  2W9B B;  1Q3V A;  1EU3 A;  2K6Q A;  5L9X A;  2MBO A;  1OFF A;  1XF5 L;  3N7R C;  2XVT A;  5KFA A;  2V4R A;  1WZ3 A;  2YMP A;  2G4S A;  4EFO A;  2BPS A;  2GBN A;  2MLB A;  1P7E A;  4BKS A;  3MHS D;  1HA5 A;  3IHP C;  3V60 A;  3ZI4 A;  4CCH A;  3UM9 A;  2XI9 A;  3C23 A;  4WWO A;  3RNA C;  1A5R A;  4B9K A;  3UIO B;  2DGZ A;  4Y2J A;  1ZW7 A;  2J7Q B;  1UA0 A;  2JEJ A;  4J6I A;  2UVU A;  1NJZ A;  5J2G A;  5AHX A;  3RH4 A;  3IRU A;  2C2E A;  3VUW A;  3NUQ A;  3NS1 A;  4UB8 U;  3THV A;  7ICR A;  8ICU A;  4FZM A;  2RRD A;  2I1K A;  3DBL I;  2OEH A;  4OO1 J;  3VR9 B;  4JV2 A;  1T5X D;  2BCU A;  4HWI B;  2BCV A;  3RMK C;  1NOM A;  3Q3J A;  4DQR A;  4MEM A;  5CHG A;  4DSF A;  1V5O A;  3BQ2 A;  2WXJ A;  4DHJ D;  1LKY A;  1ZD4 A;  5J2C A;  2GOL A;  4NPN A;  1Q5W B;  1WJ6 A;  2F77 X;  4OJ5 A;  2OJW A;  1YN5 A;  4XE0 A;  1NNL A;  5L95 C;  2M8S A;  4RPY A;  2JQR B;  5KHO A;  4KN7 A;  1NI3 A;  2ALZ A;  1WGD A;  4TMA B;  4J9N A;  4FJZ A;  1Y88 A;  2DFL A;  3D2Q A;  3KBB A;  1C4A A;  4WJ3 B;  1ZGU B;  2B6G A;  2I2Y A;  5JU5 A;  2V3S A;  5D3I B;  1SZH A;  3ZDD A;  2ISO A;  4F1S A;  1CUK A;  4J03 A;  4QIW C;  3BQ1 A;  1X9S A;  1S0M A;  1XEE A;  2IO2 B;  4EKU A;  2EAO A;  3SYZ A;  4QZE A;  4PHA A;  4NZL B;  5AI8 A;  4DEZ A;  2DQN B;  2ZIV B;  2KHV A;  3GZF A;  4U7C A;  2R8I A;  3KD3 A;  5DB8 A;  2XY6 A;  1NEK B;  1R4N B;  2H89 B;  2K8C B;  1V5T A;  1WR1 A;  2ES6 A;  4GLX A;  3TCA A;  4I2A A;  1MN8 A;  3QNM A;  2KSO B;  3OAW A;  2WAQ C;  3RJF A;  4PGY A;  4MGY E;  3W1Y A;  3LWM A;  2ZXI A;  4W9D A;  1ZQL A;  5ALH A;  2KT7 A;  2ZEQ A;  2V3P A;  3CWI A;  2MBQ A;  9ICU A;  4NAW A;  4ZH4 A;  1ZQN A;  2PTL A;  3ZRC A;  2KTR B;  4N6E B;  3TAC B;  1L7N A;  2RMM A;  7ICV A;  4QNL A;  7ICN A;  2AQ1 B;  3W1S A;  3M3J A;  2VAN A;  3WK8 A;  4PHD A;  1OW5 A;  2BYT A;  1B1Z A;  2HTM E;  3VFK A;  2W9A A;  4F2S A;  4U6P A;  2GWS A;  2BWF A;  1SGH A;  1GB4 A;  4K7U A;  5DGA A;  2KK0 A;  3BZC A;  4I2D A;  5KFU A;  3WAO A;  1RFK A;  5DLF A;  1ZQZ A;  2WB1 F;  7ICJ A;  3MR2 A;  3T79 A;  7ICS A;  3BII D;  3TEX A;  1SBB B;  1BML C;  3RB3 A;  1HZ6 A;  2X8X X;  3B2F A;  1DOY A;  8ICL A;  4GXK A;  2INC C;  1OXJ A;  5DPR A;  3U7D A;  9ICH A;  3PO4 A;  3U7Z A;  2VZK D;  4YXM A;  3IP4 B;  2YB1 A;  1PFD A;  2KMM A;  4C4V B;  1T0S C;  4QZA A;  1CJE A;  3UPQ A;  3MGV A;  1QLN A;  2KC1 A;  2EMS A;  5D94 A;  1Z2M A;  4C8M A;  4LNI A;  2D6F C;  5AI9 A;  2WXL A;  3LVW A;  3M8S A;  4GXI A;  4YMO A;  2AJQ A;  2ZIW B;  2QKQ A;  3UXN A;  4HRO A;  4EEY A;  3DEE A;  4P0Q B;  4KLI A;  4GGQ A;  2F44 A;  1T6B X;  2PI4 A;  2GRI A;  3PR5 B;  1YJ1 A;  3W1S C;  1JRP A;  1P7F A;  4KDI C;  2K22 A;  2Y5P A;  4QZ8 A;  4NJ7 A;  3NZU A;  8ICV A;  3IVF A;  4UB1 A;  2HE7 A;  2NBU A;  3TAR A;  5KFT A;  3P2B A;  8ICZ A;  1SIF A;  3O0F A;  5BYQ A;  3GE3 C;  3KQ4 A;  5BO4 B;  2BKE A;  5CHW A;  5C23 A;  3ZTD A;  3S6J A;  3PY8 A;  4A3P A;  3BZD B;  3L08 A;  5AM1 A;  1V1O A;  4OZB A;  2VH2 A;  5AKZ A;  2AL6 A;  4EEW A;  1WUD A;  1B22 A;  4RQ1 A;  5HR7 A;  2D5G A;  1N2X A;  4HRS A;  5KFI A;  2KKV A;  4QZB A;  3KYD D;  1M6Y A;  2R8H A;  2L32 A;  1C3T A;  1NJW A;  2GH1 A;  5KAF U;  4ACF A;  2NV3 A;  2HJ1 A;  2OWO A;  3TEY A;  3ISD A;  1BPD A;  2JRZ A;  1RQL A;  3E58 A;  1T8E A;  3LXF A;  2CN1 A;  4F91 B;  2LVQ A;  2MSN A;  3MAB A;  2VRR B;  2KFZ A;  1ZQD A;  2K1F A;  4QAY A;  3D2S A;  2PI5 A;  2W9B A;  2K8B A;  3LWL A;  4UB2 A;  3PLV A;  4IUM B;  2HHW A;  2L52 A;  4BVU C;  1ZOL A;  5AM3 A;  2XIC A;  4BBN F;  1UT8 A;  2OXO A;  1YMH E;  2KHW B;  2NO5 A;  1OGW A;  4G9B A;  1EF5 A;  2BKF A;  1QQ6 A;  3LJ3 A;  4P4O A;  5L1M A;  1TYG B;  2K39 A;  3P1M A;  1KOT A;  3H9D A;  3N28 A;  4C4T A;  3BVG A;  2KD1 A;  4KLG A;  2AGO A;  3TEW A;  1KRH A;  5KFJ A;  3OG5 A;  4I2G A;  2WDR B;  1E8W A;  1YJI A;  2N4F A;  4YR3 A;  3WKE A;  1VJ5 A;  2UYZ B;  3OHA A;  4QWD A;  4O3O A;  5AZF A;  4AP9 A;  5L1I A;  2JRH A;  4ANV A;  3LYS A;  4WIP A;  4NV0 A;  5ALO A;  3PVX A;  4A55 A;  4ELU A;  2W3R A;  4OVZ A;  1K5O A;  3UQA A;  1MQ2 A;  2RQ5 A;  3RR8 A;  3BS7 A;  2KZZ A;  3TUO A;  4KV2 A;  1N60 A;  2XC9 A;  3I28 A;  1NK4 A;  4DSJ A;  2KD0 A;  4J3O D;  3ZNZ B;  3EFC A;  3TEZ A;  1RYU A;  3OPX A;  2G5H B;  3TAD A;  5J0X A;  2CS4 A;  2FJ6 A;  3AE8 B;  1FXT B;  5KG7 A;  3ZJT A;  5JHB A;  4EZJ A;  2IGH A;  3CW2 C;  5ALJ A;  3E0F A;  3Q8Q B;  1SJH D;  1XLP A;  5J0O A;  3SD7 A;  1LVH A;  3B0A A;  2AWT A;  3PO0 A;  1DOQ A;  4FBT A;  2C9W B;  4TUU A;  2YLM A;  4UB6 U;  4ED6 A;  4RPZ A;  5EE1 A;  5KFG A;  5JRT A;  3SI8 A;  3J81 j;  3RD2 A;  1T94 A;  2N1W A;  3V62 A;  2NPT B;  3SV3 A;  2BCQ A;  1YQ4 B;  5C3J B;  3PMN A;  4DOC A;  5KFR A;  4M8M A;  4A90 A;  4ECR A;  4F8R A;  1NVI D;  9ICS A;  2TSS A;  1XLQ A;  3WU2 U;  4DL4 A;  3D6J A;  1F1H A;  1SE3 A;  1D9F A;  5KAI U;  2DAF A;  2ZIV A;  4ANW A;  3SV4 A;  1WX7 A;  5ALP A;  2K8C A;  2W7O A;  1B43 A;  3PW7 A;  2MSE D;  4DF4 A;  2PPH A;  2Z0E B;  3C2M A;  3Q8B A;  5IKC M;  4QZF A;  4HKZ E;  2KSO A;  3DBR I;  3KH0 A;  1ZQT A;  1BGX T;  2Q0Z X;  4Z6C A;  1Q1O A;  4ECY A;  2P35 A;  1RRB A;  5CJ7 A;  3RB4 A;  1MVK A;  3QEB Z;  5J0S A;  3AXC A;  4F71 A;  3K1Z A;  5KFP A;  2J0K A;  5D3D A;  1WSP A;  2KE7 A;  5DBB A;  2ISP A;  5IIK A;  2KTR A;  4K7W A;  3N1Y C;  3NVV A;  1GC6 A;  4P4P A;  3PX0 A;  4GIB A;  2KP7 A;  2PVO D;  1OEY A;  4GIV A;  4Y2Q A;  2BGW A;  2FID A;  1E7V A;  4GN1 A;  4BKT A;  2HHX A;  3WAN A;  4ECS A;  7ICG A;  1NZB A;  4KGR A;  1QSY A;  4OZA A;  1UBI A;  4ICU A;  4NNJ B;  4CE6 A;  3DWG C;  2K25 A;  2MEK A;  5KFK A;  1ZQG A;  5CHV C;  3AUL A;  1BNO A;  3PS6 A;  1RFA A;  4IQT A;  4JK1 A;  4DOB A;  5E6P A;  2AQ0 A;  5KG6 A;  3BWU D;  4YFK A;  4DL2 A;  5J17 A;  4QWE A;  2IHN A;  4ZOH C;  1JRU A;  4DQQ A;  3B1L X;  2JZ3 B;  2CPR A;  2JZB B;  5KFS A;  2DHZ A;  2KEY A;  4IS7 A;  3UXP A;  2L83 A;  5ALY A;  2PFQ A;  5DB6 A;  4Y2Y A;  3M8R A;  4KLM A;  5L1K A;  1T0Y A;  2CHX A;  2K89 A;  4C4V A;  3VH4 B;  2LXA A;  4ZYN A;  1C20 A;  2D3D A;  2BVC A;  2H3Z A;  2YQE A;  2ASD A;  4KGS A;  2RD0 A;  1WIA A;  4MF2 A;  4C00 A;  4ZRP A;  5AI5 A;  4YR2 A;  1XT9 B;  4JQW C;  4YXJ A;  2EH9 A;  1L4Z B;  3SAF A;  3C1Z A;  3D2N A;  3ORY A;  4DBG A;  4UAU A;  2KC2 A;  4N59 A;  1NYR A;  2AU0 A;  3L4P A;  4P0Q A;  1OTR B;  2CU1 A;  5G55 A;  4JV0 A;  4GXB A;  2WXN A;  1QQ7 A;  4IC9 A;  1ZD2 P;  4HCP B;  2WXI A;  2JU6 X;  5J2R A;  2ZTD A;  1IG6 A;  1WGG A;  1D5M C;  5AI4 A;  3JYU A;  3L54 A;  9ICM A;  3Q8E A;  2LI5 A;  2G09 A;  4NM1 A;  2F1I A;  3QYP A;  2PMZ F;  4UDU C;  3OJU A;  1TKD A;  4EEN A;  4ECV A;  1WM2 A;  1TS4 A;  4LNF A;  4JE3 B;  4RPX A;  1XLO A;  4TQ1 A;  2DX5 B;  3ED5 A;  2KNB A;  3SR6 A;  2IMW P;  1OQY A;  4YP3 A;  5C0Y A;  5DPW A;  3N30 A;  3QAR A;  4II3 B;  4NLZ A;  2JXT A;  4ECW A;  2G3Q B;  2IDY A;  3DVN V;  3PRE A;  1J2M A;  3PVL A;  4BFR A;  5KT4 A;  4NWI A;  4QW8 A;  1ZJN A;  1JWB D;  2KJR A;  5F3X B;  1FFV A;  5KFD A;  2MBH A;  1ZQC A;  5H92 C;  2I9G A;  2HBJ A;  2M0N A;  4K4I A;  4ED0 A;  3CF6 E;  4DHZ B;  2KVC A;  1QH9 A;  3RFZ B;  4DFK A;  2CJO A;  4MGZ E;  2KAJ A;  2ON8 A;  4IC7 B;  2NVU I;  4LDT D;  1HXY D;  2D2Q A;  2KLC A;  4NLG A;  4CDG A;  4YWG G;  1JWU D;  2E8P A;  1DXS A;  1D8L A;  4IWO A;  2FPM A;  4RF0 A;  1V2Y A;  3WKB A;  2NBW B;  8ICE A;  3MR5 A;  4YD1 A;  3ZW3 A;  1A77 A;  2YX8 A;  1P3Q U;  1UBQ A;  2FBW B;  4DK5 A;  2IYD B;  5KG0 A;  2NYV A;  3P4P B;  3KTQ A;  3U8Z A;  9ICX A;  1NI2 A;  5J0Y A;  2IO0 B;  1IM4 A;  1K8R B;  2RDH A;  3RBE A;  4O3Q A;  1IPG A;  3RNC C;  4CO7 A;  1C78 A;  2AHO B;  4I27 A;  5HR6 A;  2CHZ A;  2LYH A;  2K60 A;  1YN3 A;  4I28 A;  1FNW A;  5L83 A;  4YL8 A;  5DQH A;  4DOA A;  2FMQ A;  5E79 U;  1SL1 A;  2UVV A;  2A1J A;  3G6X A;  3CNH A;  5F9N A;  2YY6 A;  3MFI A;  2WF5 A;  1E8Y A;  1K53 A;  1Z5S B;  3AEA B;  1D4B A;  2LRU A;  4MSQ B;  4IR1 A;  2BZF A;  3IV6 A;  2M4N A;  1O08 A;  2GMI C;  2R2Q A;  2RP5 A;  2D11 A;  3M7D A;  3MDA A;  1J19 A;  1HIW A;  4CF5 A;  1X9M A;  5TZV A;  2HBK A;  5L1J A;  4M9G A;  3CMM B;  3NRW A;  2HI0 A;  1YN4 A;  4K4G A;  3GZN B;  4PT5 A;  4BX9 C;  4PS7 A;  3TAQ A;  3ZDC A;  3AE6 B;  4AYB F;  3I3T B;  4PL1 A;  2ZJ8 A;  2G45 B;  1TY2 A;  5KNI A;  2CKH B;  3EGR A;  3RTV A;  4LZG A;  1EXN A;  3QJZ A;  2KN7 A;  2V1Y A;  4O3P A;  3H8H A;  5EE3 A;  3AUO A;  1UT5 A;  2QHO A;  2KFK B;  2BYF A;  4IQV A;  4HXD A;  5DKW A;  3V72 A;  2EZZ A;  2NPT A;  4DL5 A;  5KT3 A;  4Z6F A;  1ZQS A;  2KZM A;  4MEX A;  4YSZ B;  3FM9 A;  2EAP A;  4MFA A;  4TUP A;  4M6W B;  5KFQ A;  2KDI A;  1G6J A;  5HG2 A;  3WK5 A;  4B9V A;  5C1Z A;  1N61 A;  3JPO A;  1XNS A;  3KHR A;  3EA6 A;  4AS1 A;  1L4D B;  3AH7 A;  5EE0 A;  2FDR A;  3V7J A;  1L3S A;  1FXI A;  4L1B A;  2HVH A;  3TI0 A;  4PZO A;  4KMO B;  3BYT B;  4DS5 A;  2DEN B;  1DGJ A;  1FM0 D;  1FXA A;  2LEK A;  1FNU A;  3F2B A;  3QUB A;  2WXK A;  4TUR A;  5AM2 A;  4M9N A;  1CI4 A;  4UQG A;  2QIE B;  1FPY A;  1J7C A;  4DO9 A;  2NRX A;  1ZDV A;  1B4F A;  3C1Y A;  1LB2 B;  3KFU F;  3UQ0 A;  2WX1 A;  5CEH A;  3DOW A;  2C2R A;  4O0I A;  2I5H A;  8ICB A;  4FN2 A;  3DHG C;  7ICP A;  1SL0 A;  3HWT A;  2FLL A;  2XID A;  1S77 D;  2HOI A;  7ICE A;  4UBC A;  3WK4 A;  1QF6 A;  4BXO B;  5HHD G;  4BGD A;  2WLB A;  3ZRF A;  1GO3 F;  2JXJ A;  1ZQJ A;  1HEK A;  3T9L A;  1SE2 A;  2GBJ A;  4NLC A;  3PGE A;  8ICR A;  1HJP A;  2E8N A;  1CK1 A;  5ALQ A;  3A4R A;  2ZW1 A;  4C8L A;  3UQB A;  4I2I A;  2OED A;  3SD5 A;  5ALI A;  2JZB A;  1TS2 A;  4DQO C;  3PTF C;  3Q6B A;  5J2I A;  5D4B A;  4FZL A;  3R7R A;  3T3O A;  3IM1 A;  5BMI A;  3C2L A;  5CX3 A;  5ALW A;  5L1L A;  3PW2 A;  4DWI A;  2IJ0 A;  3A1Q B;  4RUA A;  2MRL A;  1N56 A;  3DV9 A;  4URK A;  3M9N B;  4NJC A;  8ICG A;  4I2J A;  2MBB B;  1TAM A;  1QT9 A;  3C0R B;  3TKA A;  1T4G A;  3HKZ C;  3M9O B;  5IIN A;  2LI6 A;  4C8N A;  5EWF A;  3SU8 X;  2CRX A;  1JML A;  3JPQ A;  4NLK A;  3M6Z A;  1EM7 A;  2G08 A;  1TAU A;  3IHQ B;  5KFC A;  3DDC B;  4CRX A;  1VZ8 A;  7ICF A;  1EU4 A;  1MHX A;  1MHH E;  3PZ8 A;  2RDJ A;  3GV7 B;  1WFY A;  2IOF A;  4LJX A;  3FAH A;  3N1X C;  2W9C B;  1YOV B;  4GDL A;  3HM3 A;  3NJT A;  3U4E G;  1V6E A;  1PYW D;  4B9L A;  1R4N I;  5LLI A;  2KN5 A;  4IDI A;  3A33 B;  2D3G A;  4II2 B;  3HM6 X;  4RQM A;  3RPF C;  2D8C A;  5DB7 A;  1K1S A;  3AN1 A;  3H7P B;  1NK6 A;  1MQ3 A;  3DHH C;  4NY8 A;  2QDF A;  2MUT B;  5AZH A;  3QQ8 B;  2FCS A;  4RGT A;  1N5X A;  2NTT A;  5EDS A;  1QSS A;  2JR5 A;  5AIA A;  2K0P A;  4EEK A;  3EUB 2;  4B6W A;  2V4L A;  4DDI D;  4FS1 A;  3A4S C;  1F0M A;  2WXQ A;  4O9M A;  1IV8 A;  1BXT A;  9ICL A;  1SIJ A;  7ICI A;  3EC8 A;  3MDC A;  1L0X B;  2V9W A;  1QZE A;  1VRA B;  3G6Y A;  1ENF A;  2KX0 A;  4LJO B;  3MBY A;  4ECU A;  4P7I A;  4DHJ B;  3DVG X;  1X66 A;  3SDL C;  2H3F A;  2OOB B;  1WGK A;  1GPX A;  1ZD5 A;  4OJ6 A;  4KLL A;  1BPY A;  1V85 A;  2KOX A;  2H3Q A;  2O6V A;  4PYZ A;  4DLG A;  3L5K A;  8ICQ A;  1KJT A;  3QE9 Y;  4Y2R A;  4MFF A;  4Y2V A;  2KNJ A;  2QAR B;  2K8A A;  5AM5 A;  3PO5 A;  2M19 A;  3PW0 A;  2HHV A;  2K8H A;  2KVZ A;  3KKA C;  3PML A;  1P0R A;  4O5E A;  1WXM A;  2BCS A;  2OCE A;  2VA2 A;  1NK7 A;  4P1B C;  2WNM A;  1FEH A;  1KTQ A;  2Z0D B;  3Q14 C;  2ZUD A;  3ONN A;  5ALR A;  4J9K A;  2BB5 A;  4USA A;  1JIH A;  2N7J A;  2LAS A;  5KTQ A;  4F72 A;  2DF4 B;  2IOF K;  4Q44 A;  2M0A A;  4MAC A;  4WWN A;  2K4H A;  2VKQ A;  2WF9 A;  5MPO A;  3BIN A;  2I6X A;  2WXP A;  4F5P A;  2JEI A;  2J0J A;  2RPQ A;  4RQ6 A;  2WYQ A;  4RQ7 A;  2ZW0 A;  3E56 A;  1E8X A;  2JYE A;  3WK6 A;  1JN3 A;  2GI9 A;  4DFM A;  1V38 A;  2WXG A;  4RT3 A;  5KT5 A;  5HFY A;  2N1V A;  3ZJU A;  4QZI A;  2KWU B;  1X6I A;  3PX6 A;  5AIC A;  4C0Z A;  3E2E A;  4K1R B;  3MC8 A;  3F2C A;  2L0T A;  1CZP A;  3M1Y A;  2A19 A;  2K9X A;  3QCA A;  2NMQ A;  2LPE A;  4C56 C;  4K81 A;  2ATL A;  2KFK A;  2KJ8 A;  3AM9 A;  1B9R A;  3X0W A;  2DPJ A;  5KFZ A;  3TFR A;  4I2H A;  3HUI A;  4AJY B;  3LYY A;  4QWA A;  2NBV B;  5JUM A;  4GXJ A;  4ED2 A;  4E71 A;  2BPG A;  4ELT A;  4F5O A;  4M6W A;  4PGX A;  2NCN A;  4GC7 A;  1PGB A;  3X23 A;  1ZE3 D;  3BVM A;  4UAW A;  1KEJ A;  1U4A A;  4DS4 A;  5AEK B;  1IIP A;  4DXF A;  3ISC A;  5E6J A;  3V6C B;  3QU9 A;  2AGP A;  4PYU A;  2WB1 C;  9ICP A;  2EAN A;  2WF8 A;  5ALZ A;  1EWY C;  1L7O A;  1HE8 A;  4KDL B;  1D5Z C;  1WJ4 A;  2M0X A;  2Z7J A;  4EZL A;  1K52 A;  4M9J A;  2WXF A;  2BKR B;  1XCQ L;  1MA7 A;  2BHN A;  2Y9U A;  2ZTE A;  2INN E;  3KLS X;  4XWT A;  4CF3 A;  4W9L A;  7ICH A;  1KFT A;  2VZK B;  5KFO A;  4WQM A;  1X9X A;  1A76 A;  7ICU A;  3GE8 C;  1V97 A;  2HDE A;  1RG6 A;  3RJK A;  4TUS A;  4Z6D A;  2MHJ A;  2HHU A;  1MG4 A;  3I5J C;  3MHZ A; 
#chains in the Genus database with same CATH homology
 4RFB A;  1KFY B;  5EE1 A;  2G1E A;  4YSY B;  5TSS A;  1N63 A;  1KTK A;  1Q10 A;  1C9F A;  1OQQ A;  1YQ4 B;  5C3J B;  1F77 A;  1FFU A;  3IT4 B;  4A90 A;  1J7B A;  1NVI D;  1VR9 A;  2TSS A;  1XLQ A;  3MFG A;  1FCL A;  1C77 A;  1SE3 A;  4WWM A;  3AV8 A;  4RGN A;  1MI0 A;  1GOZ A;  5JXV A;  1FO4 A;  2KQ4 X;  2ACZ B;  5FR3 A;  1GAQ B;  3VRB B;  5T8I A;  4HKZ E;  4OZC A;  1TKE A;  3R2I A;  4RCO A;  4XWW A;  3V05 A;  1MVK A;  4H2A A;  3AE2 B;  1QLB B;  2IGD A;  1ET9 A;  1WSP A;  5D3D A;  1EWC A;  4JX1 C;  1JWM D;  1D5X C;  2JZP A;  2Z8L A;  3FIL A;  3NVV A;  3ABV B;  1STE A;  2PVO D;  1F2R I;  1ZOY B;  4CQN A;  3ZGZ A;  1FCC C;  2W54 A;  4KGR A;  1XLN A;  3NVY A;  3GB1 A;  4OZA A;  4O1N A;  5AUK A;  1L6V A;  3DWG C;  2MEK A;  3VRA B;  2E6X A;  3BYY B;  1IBX A;  2X38 A;  3AEB B;  3BWU D;  4WAF A;  2CJN A;  4YTP B;  2M56 B;  4ZOH C;  4A9A A;  3SEB A;  3IXS A;  1E6E B;  1A70 A;  4RF1 A;  2WP9 B;  2W3S A;  2L83 A;  1WRI A;  3AEE B;  2ICI A;  4WH4 A;  1SJE D;  3NVZ A;  5HI1 A;  2DWQ A;  2LGI A;  1I4P A;  5EE9 A;  3ZQ4 A;  4P16 A;  3W9C B;  1FD6 A;  5G5H A;  2Q5W D;  3HVZ A;  3UI3 A;  4KGS A;  3N9Y C;  1FMA D;  4ZRP A;  5LNK 1;  1L4Z B;  1IGC A;  1KH0 A;  2PVG C;  3B2G A;  3V3X A;  4NAW B;  5FKA C;  2INP E;  3IAM 1;  1LO5 D;  1TS5 A;  4N59 A;  1NYR A;  2JYT A;  2WXR A;  3L4P A;  1NEN B;  4JWS C;  4KX6 B;  1AWD A;  4DXG A;  4YSX B;  3AE7 B;  2WXN A;  1ZDX A;  4HJG E;  2WXI A;  4REZ A;  1L5P A;  2JU6 X;  4ARC A;  4ITK A;  3HRD D;  3P4R B;  1D5M C;  3Q8E A;  3PZ7 A;  1ESF A;  4HEA 1;  1FIQ A;  2LFI A;  1AW7 A;  2WS3 B;  3Q8B A;  1IGD A;  1MPE A;  4UDU C;  3VR8 B;  1HEZ E;  3OWE B;  4RH6 A;  2XNA C;  4C80 A;  1TS4 A;  1BUI C;  2RDG A;  4JE3 B;  4HKQ A;  1XLO A;  4TQ1 A;  1XO3 A;  3SR6 A;  2DBY A;  1SF0 A;  1SXT A;  4B0M A;  2JXT A;  5D7G A;  1DOX A;  2IDY A;  3KWL A;  4ZHO A;  3T3N A;  1M4V A;  1JWB D;  1FFV A;  1C76 A;  1ROE A;  2JSV X;  2L1A A;  1TY0 A;  5H92 C;  2BTE A;  1YJJ A;  2J52 A;  4A6Q A;  3NRZ A;  2FUG 1;  3Q8C A;  1D6E C;  3AED B;  5AUI A;  3RFZ B;  2CJO A;  2DYM A;  4L2Y A;  2KAJ A;  2WXO A;  4RGM A;  1WWT A;  2ON8 A;  2SAK A;  4XDC A;  3MJ5 A;  5BYS A;  1WYG A;  1HXY D;  3Q8F A;  2Y5C A;  4N58 A;  4YWG G;  1JWU D;  1KLU D;  1I4Q A;  4RF0 A;  1K51 A;  4TQ0 A;  4JPS A;  3FIL B;  2EEL A;  2MH7 A;  1JCK B;  2FBW B;  1Y56 A;  2JWU A;  1J7A A;  1V8C A;  4TSS A;  4L23 A;  1QOF A;  3P4P B;  2QIL A;  1JWA D;  1TS3 A;  2N9L A;  2KN4 A;  2RDH A;  1WXQ A;  3CIR B;  1UWM A;  2QSD A;  1C78 A;  3SFD B;  4M0W A;  2B76 B;  1I4R A;  1YN3 A;  4US9 A;  1FNW A;  2ONQ A;  3GP7 A;  2BS4 B;  2BBC A;  2WDQ B;  5BMG A;  1NYQ A;  2YEP F;  2J4X A;  3GS2 A;  1K53 A;  1D4B A;  3AEA B;  4C7Z A;  3HVD A;  3BK2 A;  3AE9 B;  2W55 A;  3O13 A;  1PGX A;  1CQV A;  3W5U B;  2KAC A;  2MJE A;  2PKO A;  2MJ3 A;  1N5W A;  2G9H D;  2H88 B;  2PLP A;  2BS3 B;  2LUM A;  2PW9 A;  3U2S C;  1GB1 A;  2WU2 B;  1YN4 A;  4PT5 A;  3AE6 B;  2DYO A;  2K3U A;  1TY2 A;  3SFE B;  1E7P B;  3EGR A;  3W2D A;  4EE2 A;  3ETR A;  1PUT A;  3BK1 A;  2WU5 B;  1EU3 A;  2GB1 A;  3AE5 B;  3H8H A;  5EE3 A;  1UWX A;  1OFF A;  1F0Z A;  1XF5 L;  2I38 A;  3I57 A;  3IT6 B;  1DOI A;  2BB6 A;  2V0G A;  2IPK D;  1P7E A;  4YSZ B;  1HA5 A;  1QQR A;  4D2K A;  5HG2 A;  3AE3 B;  1TJE A;  4LLG M;  1N61 A;  1QOB A;  1ACC A;  1PDX A;  3EA6 A;  1V1P B;  4AS1 A;  1L4D B;  3AH7 A;  1VJK A;  5EE0 A;  1XCT L;  3AEC B;  1FXI A;  4L1B A;  3NS1 A;  3BYT B;  2AX5 A;  1DGJ A;  3URY A;  2V3N A;  1FM0 D;  3VR9 B;  1FXA A;  2LEK A;  5FK9 C;  1FNU A;  4MT5 A;  1VDV A;  1T5X D;  2WXK A;  2QIE B;  1C4C A;  1J7C A;  2WXJ A;  3U52 E;  1ZDV A;  2J42 A;  4RGO S;  4AQ7 A;  1E0Z A;  1DYQ A;  1T3Q A;  1YN5 A;  4XE0 A;  1SSN A;  2JQR B;  4YTM B;  1AYF A;  1ET6 A;  1NI3 A;  3P4Q B;  4LK0 M;  4OHJ A;  4TMA B;  1QF6 A;  1ZXI A;  1KLG D;  2JX5 A;  1VLB A;  2WLB A;  5HHD G;  1UUP A;  3IAS 1;  2XN9 C;  1SE2 A;  3J9C A;  1C4A A;  4MH8 A;  2I2Y A;  2AQ3 B;  5D3I B;  4KGT A;  2DLB A;  3P4S B;  1CK1 A;  5G5G A;  1AN8 A;  1L6U A;  1FNV A;  1XEE A;  2ZW1 A;  3BVZ A;  2OED A;  4NZL B;  1TS2 A;  4DQO C;  1NEK B;  3T3O A;  2H89 B;  5BMI A;  5BMH A;  1QIL A;  5C2T B;  2EKI A;  1RYJ A;  3I9V 1;  1L0Y B;  2IJ0 A;  2LHE A;  2KDM A;  4NJC A;  1SB3 C;  4A8X C;  5H8Y E;  5I4D A;  1QT9 A;  1UGJ A;  2PMV A;  2V3P A;  3CWI A;  2PTL A;  2CU3 A;  4N6E B;  1JML A;  2RMM A;  1EM7 A;  3AE1 B;  3AB5 A;  1JAL A;  1TKY A;  4P6V F;  1VZ8 A;  1EU4 A;  1MHX A;  1MHH E;  2AQ1 B;  3PZ8 A;  3W1S A;  2BYT A;  3FAH A;  1B1Z A;  2HTM E;  1TKG A;  4YTN B;  1UNS A;  4GLS C;  2QJL A;  3ZYY X;  3U4E G;  1GB4 A;  4OW0 A;  3AMZ A;  3Q69 A;  1PYW D;  4B0E A;  1IBX B;  3W5V B;  4IDI A;  1RWS A;  5GXG B;  1RFK A;  2WXM A;  1VZ7 A;  2Y3A A;  3RPF C;  1I4G A;  3AN1 A;  3BII D;  3TEX A;  4US8 A;  1SBB B;  2BT6 A;  1BML C;  2WQY B;  3C8Y A;  3TSS A;  3B2F A;  1HZ6 A;  4IOI E;  3B9J A;  1DOY A;  4RGT A;  1N5X A;  2NTT A;  2K0P A;  1HZ5 A;  3U7Z A;  2WDV B;  3EUB 2;  2VZK D;  2KMM A;  3AEF B;  1PFD A;  2YEP B;  1E9M A;  1I4X A;  3E9S A;  1CJE A;  1PGA A;  2WXQ A;  1BXT A;  1SIJ A;  4JWU C;  3R8B A;  1L0X B;  2PIA A;  4NAM A;  1VRA B;  1ENF A;  1I4H A;  2WXL A;  1OQR A;  4Q2J A;  4IKG A;  4YXD B;  1RM6 C;  2FE8 A;  4HRO A;  2IGG A;  1WGK A;  2LJI A;  1GPX A;  2GRI A;  1T6B X;  2QEJ C;  1JRP A;  1P7F A;  1E10 A;  4ZYS A;  2K22 A;  2Y5P A;  3WCQ A;  1YNT E;  2M19 A;  4RNA A;  1C4P A;  5BYQ A;  2BS2 B;  4ZHP A;  3VQI A;  3KQ4 A;  3NZ3 A;  1QKZ A;  3AE4 B;  3ZJV A;  2WNM A;  1FEH A;  2BB5 A;  2OHF A;  3R2T A;  4C7Y A;  4USA A;  3BZD B;  1IUE A;  1R7S A;  4LTU A;  1FRR A;  1V1O A;  2N7J A;  4OZB A;  2R61 A;  1HQR D;  1JW9 D;  2M0A A;  4MAC A;  4XDD A;  2D5G A;  4HRS A;  1KF6 B;  5MPO A;  2WXP A;  4R3D A;  4WUR A;  1VZ6 A;  2L32 A;  2ZW0 A;  3E56 A;  2JYE A;  2GI9 A;  4FXC A;  1N62 A;  2WXG A;  2BW2 A;  5HFY A;  3MC0 B;  3TEY A;  3ZJU A;  2SEB D;  1FRD A;  1ZP0 B;  3LXF A;  2J53 A;  1CZP A;  2K9X A;  2NMQ A;  1QOG A;  3Q8A A;  4C56 C;  2L52 A;  1F2R C;  1B9R A;  3AM9 A;  1SEB D;  1JQ4 A;  1YMH E;  3KWV A;  4MM3 B;  4KKI A;  2NTS A;  1TYG B;  3HUI A;  1JWS D;  2LMC A;  3LYY A;  2QMT A;  2AQ2 B;  3BVG A;  3TEW A;  3MP9 A;  3LB8 C;  1KRH A;  2WXH A;  4ARI A;  1XXG A;  1PGB A;  2MJD A;  1ZE3 D;  1I7H A;  1YJI A;  2WDR B;  3BVM A;  1V1P A;  4GDL B;  4DXF A;  5E6J A;  2E3T A;  5BYR A;  3AEG B;  2K5P A;  1TZO A;  4WIP A;  1C79 A;  1EWY C;  1L0V B;  4A55 A;  4OVZ A;  2W3R A;  3NUH B;  1D5Z C;  4YT0 B;  3DWM A;  3TUO A;  1N60 A;  1ZXH A;  1K52 A;  4J3O D;  1QOA A;  2WXF A;  3TEZ A;  1XCQ L;  2INN E;  3NVW A;  3FC4 A;  3AE8 B;  2W82 A;  1K50 A;  3KLS X;  4XWT A;  3ZJT A;  4ZRQ A;  2VZK B;  1ZUD 2;  1YQ3 B;  1ZPS A;  2RPV A;  1JRO A;  1SE4 A;  2IGH A;  4WQM A;  3P42 A;  2LHD A;  1V97 A;  2HDE A;  1SJH D;  1XLP A;  2KWD A;  2N0S B;  3P1M A;  3P63 A;  2V4I B;  2N9K A;  4KKJ A;  4GDK B;  3MHZ A;  3PO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...