3ETRA

Crystal structure of xanthine oxidase in complex with lumazine
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 42
structure length 164
sequence length 164
chains with identical sequence L
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
A PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3etrA02
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3etrA01
1ZXIA 2CJOA 5EE1A 1XLPA 1VJKA 3AMZA 1QOAA 3AEAB 4HRSA 3W9CB 4KX6B 4WWMA 2W3RA 3CIRB 1F0ZA 1J7AA 3SFDB 3AE7B 1R7SA 2W55A 3VR8B 2CU3A 1ROEA 3AN1A 2DWQA 1FXIA 3AE6B 3AEEB 1WXQA 5EE0A 2HTME 1I7HA 2CJNA 1FO4A 3DWMA 4N6EB 3NS1A 2L52A 2LEKA 1QLBB 1XLNA 3VR9B 1DOYA 3ETRA 5AUIA 4N58A 5G5HA 4IDIA 4WQMA 2DBYA 2WDQB 4YSZB 3AE4B 1E9MA 3SFEB 1WYGA 2K9XA 2WU5B 2Y5CA 3HVZA 3P63A 3SR6A 2PVGC 4N59A 1SIJA 3FC4A 1FMAD 3AH7A 4YTPB 1N60A 4US8A 1ZP0B 2BS2B 1L5PA 2M56B 2WP9B 1AWDA 2JX5A 2FBWB 2PIAA 1IUEA 2PKOA 3AEFB 3CWIA 1RWSA 3VRAB 1QOGA 3B9JA 3NVZA 4HROA 2EKIA 3EUB2 1E0ZA 2JQRB 5H92C 2MJDA 1T3QA 3HRDD 1DOIA 3B2GA 5H8YE 1DGJA 1NEKB 3DWGC 3AE2B 3W5UB 1N63A 5C3JB 1EWYC 1VLBA 1XO3A 1YJIA 4ZHPA 3NVWA 3FAHA 1VDVA 4FXCA 1NVID 4YTNB 2MJEA 3NVYA 1NI3A 1FFVA 1B9RA 1XLQA 1PUTA 5AUKA 1YQ3B 1FM0D 1TKYA 4ITKA 4ZOHC 3AE3B 1N62A 5EE3A 3KWLA 1JWAD 1KRHA 3AE1B 4USAA 1JRPA 1E7PB 1XLOA 3AE5B 3AE9B 2K5PA 1ZUD2 2BS4B 3P4RB 2QIEB 1NYRA 2W3SA 4YSYB 1JROA 1V8CA 1ZOYB 3LXFA 4YSXB 4ZHOA 1FIQA 1JALA 3P4SB 3AEDB 1UWMA 1PFDA 4YXDB 4C7YA 2WQYB 4JWUC 2W54A 1DOXA 3AEGB 4C80A 1GAQB 1WWTA 1L6VA 1FFUA 1L0VB 2B76B 1A70A 3PO0A 3W5VB 1QF6A 2G1EA 1TKEA 3AB5A 1RYJA 4YTMB 4A9AA 1J7BA 2H88B 3WCQA 4US9A 2BT6A 1QOBA 1KF6B 4P6VF 1JWBD 3AV8A 1TYGB 1SF0A 2WDRB 3P4QB 3L4PA 2PVOD 1N5WA 2MJ3A 3HUIA 3ZYYX 1CJEA 1JQ4A 3NVVA 1FRRA 2MH7A 3NRZA 1N61A 2WS3B 1OFFA 4YT0B 3AECB 2WU2B 3AE8B 1GPXA 3BIID 1WRIA 5EE9A 4LTUA 1YQ4B 1JW9D 2K22A 3P4PB 4JX1C 1RFKA 3AM9A 1AYFA 1KFYB 1OQQA 2ACZB 2L83A 2OHFA 1N5XA 3ABVB 1QOFA 4JWSC 3RPFC 2H89B 1CZPA 1NENB 1TJEA 2M19A 3B2FA 5GXGB 3LB8C 1RM6C 3VRBB 2KAJA 1E6EB 2N0SB 5C2TB 1E10A 1OQRA 2E3TA 1FXAA 1SB3C 1QT9A 2AX5A 1V97A 1PDXA 2BS3B 2WLBA 1L6UA 1J7CA 2WDVB 3P1MA 4C7ZA 1TKGA 5G5GA 1WGKA 1NYQA 2QJLA 1YJJA 2KMMA 1FRDA 2Q5WD 3AEBB 5MPOA
chains in the Genus database with same CATH superfamily
1TS4A 2GOLA 3UXPA 2JV3A 2KK8A 4TSSA 3RB3A 1ZQIA 4JWMA 1Q5WB 4XE0A 4RQ4A 2ZVOA 3ZW3A 5D4BA 1S9FA 1WR6E 3EZ5A 4M8NA 4ED8A 4NZLB 4DHZB 5AEKB 2W55A 2EZYA 2KC2A 5E79U 3TAPA 4MM3A 7ICMA 3AEEB 5L95C 2W03A 4RQ0A 4QZGA 1UD7A 4NJCA 1FO4A 4F4WA 2F8KA 4TKNA 4Y2VA 2MW5A 1BPEA 1HUOA 5BO4B 1JUDA 2YMQA 1ZQNA 4QWBA 4TQ1A 4M0WB 1BMLC 1QSSA 3PZ8A 1HIWA 2PVGC 1V80A 2BHNA 3MJ5A 5J0TA 4M00A 3M8RA 3WAPA 2F1IA 2DKXA 4FJZA 4ECQA 2KTQA 5CJ7A 2UWQA 8ICAA 7ICGA 4Y2UA 1E7VA 2R8HA 3DWGC 2ZIWA 4RQMA 1BPDA 4F50A 1JRUA 1WX8A 4I28A 3QU2A 1YJIA 3GQCA 3DOWA 3RAQA 5KFTA 2Y9UA 1TKDA 3L16A 3H8HA 3QUQA 1UUPA 3DBSA 8ICRA 4I6LB 1K1SA 2W04A 3UXOA 3GIMA 4DEZA 3RJKA 3EECA 3V3XA 1WH3A 2A1JA 3PO4A 1GO3F 4P0PA 2LM4A 3HT3A 1ET9A 2INDC 4Q2JA 4WJNA 4YSYB 4RNNA 1ZQZA 1X42A 3MR2A 2H3VA 4I2FA 2DHZA 4S17A 1ZQWA 1V8CA 3HM3A 4BKSA 4R64A 3VCBA 1Q3VA 4WWOA 4DDGD 4P1CC 1TBEA 3AEGB 4I2DA 1X9SA 4GGQA 3CMMB 2E8OA 1A70A 4UB8U 1QKZA 2G1EA 1DRGA 4A9AA 1ZQMA 2WXLA 4YCXA 2RDBC 4UB6U 1Z5SB 1JMSA 1EF5A 2KX3A 2Y1IA 4W9GA 4EEWA 5HR6A 4UASA 1D8LA 1TZOA 2KJ6A 4DK5A 2GMIC 5AI4A 4J9SA 3L5KA 4MGYE 3BIID 4FS1A 1JX4A 4GN1A 3P4PB 3GIJA 2NTTA 4N6EB 2L83A 4W9CA 3ABVB 3ZXRA 3AQFA 1KTKA 2QCZA 2WAQF 4I6NB 1RQNA 3RFAA 5AM0A 1TAMA 3DBRI 2BCSA 5J18A 2X38A 3KKAC 5CRXA 3UQBA 5IILA 5J2KA 2HBMA 5T8IA 1SB3C 5ALKA 1QT9A 5KT5A 2M4NA 3ZNZB 3SD7A 4OZAA 1X9XA 3SU8X 1HTQA 1WGKA 5KFMA 1IBXB 1ZJMA 3M9NB 5L1IA 4KIKA 3C1ZA 1IXRA 4YQWA 3H7IA 5FK9C 5C1ZA 3VVWB 2L0TA 2XN9C 1STEA 1OXJA 1UT8A 1F5SA 4X5VA 3LWMA 2D3CA 2PEAA 2A19A 4ANVA 3SFDB 4MACA 1GUAB 4DBGA 2A1AA 2DWQA 1KTQA 1WXQA 4XA5A 4DWFA 5KG5A 1U45A 3ZDBA 2LEKA 2WDQB 3WIMA 1SKSA 2JYTA 3VQIA 3AE4B 4O1NA 3TSSA 2WF9A 2HHQA 2K9XA 3GZNB 2FCMA 3SR6A 4CE6A 1RAXA 3DCGA 2F2AB 3UINB 2ZUCA 1WE6A 2Z0DB 2DYBA 2FBWB 3IAM1 2DZJA 9ICTA 4K81A 4FE3A 5DB9A 1ESFA 1SGHA 3Q8FA 4OJLA 7ICVA 2PE6B 3MABA 3B2GA 2MSED 4UB1A 3WK7A 1P7FA 5CHWA 1N63A 4G0NB 2WXHA 2KDBA 5C3JB 5KFHA 3BYTB 4UAZA 3HK0A 1T3NA 4A8XC 1B9RA 2K39A 4NL9C 3R7RA 2KJ5A 3R66C 1PUTA 9ICWA 1KLVA 2DLBA 4JV0A 4UAUA 3H0LB 4KGTA 4TUPA 3OJ3A 2ZCCA 2VJ4A 3RCZA 3BWUD 3VFKA 3D2QA 1LQBA 1WJ4A 1MI0A 2R61A 1JRPA 3QZ7A 2PMZF 2JUOA 2D5GA 2BQUA 3AU4A 3MJWA 2PFNA 4FADA 3IAS1 1WF9A 5D3DA 1PFDA 2W54A 4J9LA 2JYEA 1U4BA 4RUAA 1L6VA 4DSJA 4HPMB 3PO0A 1L0VB 4IRDA 3R2IA 4W9LA 2KG5A 1J8CA 5AKJA 1XXGA 2K8AA 2KHWB 3Q3NC 2JZBB 2WF6A 4G50A 4Q43A 4BVUC 4UB2A 5AZGA 9ICIA 3WK8A 3SQIA 2MWSB 1X6JA 1DK2A 4DXFA 2UVWA 1TAQA 4IM2A 5KFCA 3WK9A 2H3IA 2Y0SF 5TZVA 1SE4A 2KOXA 1SL1A 1C77A 3GE8C 3AE8B 2NO4A 1WGRA 2VZKB 3X0WA 2DZMA 3U7DA 2P66A 1ZOLA 1RXWA 3LVVA 3SAFA 3ECIA 3WKDA 1ZDVA 1TK8A 9ICUA 3B2FA 5BYQA 2C9WB 3BS5A 3C1YA 2Y3AA 7ICEA 1K53A 2KHVA 4UAWA 1MQ3A 3NOBA 2I1JA 3L3FX 2Y5PA 3SD5A 2KXJA 2R8IA 1WXVA 5HHIA 1VJKA 3BZDB 2IBKA 2L32A 1L4ZB 1OW5A 1JWMD 5J2AA 3PW7A 2LYBA 2GOWA 3BQ7A 1D3ZA 4Y2SA 3M1YA 4Y2QA 1I4HA 2C5LC 2WXMA 3N97B 2BDUA 1Z3EB 4Y2RA 1HUZA 3AXCA 1NOMA 1OEYJ 2VJ5A 3C0RB 1S0OA 1WM3A 3T5KA 5JUMA 1TIFA 3VR9B 1V2YA 1Y8RC 4HCPB 1IV8A 1EO6A 3M8SA 4C4RA 3RZWC 4FHJA 1S5LU 3K9OB 5J2RA 4C4TA 5AI6A 2LXAA 3RNAC 3ZNGC 3IT6B 1V49A 2GI9A 2ONQA 5J2EA 3Q3MC 2EMTA 4FJYA 3VTUA 2VA2A 4TURA 4AP4C 1SJED 3TFRA 2ZXIA 3JPTA 4EEKA 3QZ8A 5H92C 4PGQA 1NBFC 4XX5A 3HKZC 3ZD8A 1WGYA 4F2RA 4KN4A 3V05A 5ALRA 2BQQA 1WGGA 2RGFA 4GIBA 3QQ8B 3RJGA 2HHVA 1ZRNA 4URKA 3UGBB 1L7PA 1SZHA 3TADC 2NRWA 2WF5A 4YXJA 2BGWA 4M9NA 3N4MB 1KFDA 2JWUA 4GDLA 4MF2A 2HVIA 1KKXA 2OWOA 1WM2A 2XGQA 4BZAA 1FXTB 2A1JB 2C2RA 1XD3B 4RGMA 5KG6A 2XCAA 3AE1B 4HJKA 5AZFA 4KV2A 1UELA 2EDUA 2KSOB 2LGYA 2V4LA 5KG0A 1U47A 2YN4A 1JROA 2ATLA 1UGMA 1FD6A 4FN2A 4PYZA 1CRXA 2HBLA 5ALLA 2ON8A 4R3DA 3APDA 3JYUA 2KTFA 4F4YA 2DQNB 4GXBA 2KKPA 4DQIA 1LXDA 1Z19A 4HPPA 3ZGZA 3U2SC 4YFKA 2MHJA 4JV1A 3GS2A 3RYTA 4KLEA 4RNAA 8ICZA 3ENEA 2L1AA 1Z1VA 3NRZA 5FP0A 1YIWA 1T4GA 4PL1A 4I2JA 1ZQBA 1L3UA 3OTQA 2JF5A 4A6QA 4JX1C 2MA9B 3RPFC 4B9MA 2KFKA 3Q8LA 2MLBA 1XWLA 3I57A 1E10A 1E6EB 3PREA 3BQ2A 1NI2A 1BGXT 4ED7A 2KN4A 4Z6FA 2G45B 4K7UA 4EEYA 1QSLA 4NV0A 4F5QA 1S10A 3DDHA 5ALEA 5J0YA 1JI7A 5G5GA 4GSWA 1CI4A 2JY6A 4DXAB 1VZ8A 3F53A 8ICGA 1ZXIA 4IRCA 3V6KA 2JH1A 4YXMA 2IGHA 3P2BA 2KACA 4BDPA 3ZJVA 4UW9A 1R4MB 1WJUA 2M8SA 2CU1A 1RRBA 1KH0A 2QILA 3Q69A 4LNFA 3T8MA 2RDGA 4ED3A 4DQPA 2KZZA 2FIDA 4U7CA 1ACCA 1WR1A 2E6XA 3UPQA 1T0QC 4UQGA 2KLGA 1DOYA 1PUZA 3MFGA 5LNK1 2MSNA 1WIAA 2BPGA 5DBBA 4DSKA 3MDAA 3SFEB 2IO3B 3IVFA 5KT2A 5J0UA 1FCCC 2N9XA 3P63A 1TY2A 3Q8RB 3WKBA 1L5PA 4HYKA 1WCLA 2LXCA 3KHRA 4NM1A 4CYEA 2KJHB 4NLGA 8ICIA 1E8XA 2D3AA 4XUSA 3E58A 3PHXB 4HDOA 5AM2A 2KP7A 3NUQA 2IOFA 2QMTA 5L1KA 4QW9A 4DFKA 5AM3A 3NVWA 4RQ8A 4YTNB 2IJ0A 2X8XX 1EU3A 2D11A 4J9RA 3MR5A 2W11A 4MEXA 3RR7A 2ASQA 2J52A 2KWDA 5AUKA 3X23A 1YX6B 8ICVA 4WIPA 5DCNA 4F2SA 3SV3A 4IQVA 4RNMA 5E6OA 3RBDA 2I2YA 4K4IA 4P0QA 2WXGA 3AULA 3RI7C 4XQ8A 2K6QA 4KTQA 4UDUC 4EYIB 2N1VA 3ZJTA 4YSXB 1O08A 2L76A 3SEBA 1DOXA 5AI5A 2OEDA 1T94A 5F3XB 1ZQUA 2B76B 2PXIA 1YZ7A 2KDMA 3C2KA 4BFRA 2GLSA 4PT5A 2V4RA 2HBJA 4DLGA 2OYYA 4GOCA 3F5AA 1GC6A 1CUKA 1NNLA 2KTRA 1KJTA 3J9CA 3T5HA 3ED5A 4I6PA 3RR8A 4DFDA 1CJEA 4ZRQA 1ZGUB 2GO7A 5D49A 5ALJA 1OFFA 1QLNA 4KLTA 5AHXA 5KFRA 4RM9A 5C5JA 5ALYA 5EOZA 4WJPA 1I35A 5CP2A 7ICNA 3RNBC 1D5MC 4EOYA 3CNHA 1RM6C 2MBBB 4IW0A 4QWEA 1C20A 4WJQA 5KFYA 3QYPA 3TADA 3VH3B 2GH1A 1GNUA 1FXAA 2AX5A 1J7CA 2WDVB 4K7WA 2ASJA 1L0XB 4G3XB 2JZ3B 5AKYA 2VH2A 5ALMA 1UZXB 1P9DU 4B9UA 5HI1A 1PVPA 1TS3A 1YN5A 4W9HA 1ZQDA 1WI0A 2MBEA 2KO3A 4PGXA 1L8LA 4XZ4A 3DHHC 3O13A 1ZQKA 3M62B 3W1YA 3QIJA 4FJVB 9ICOA 1F1HA 2JZZA 1XLNA 3ETRA 4RZRA 3SENA 9ICHA 2SEBD 3F2BA 3LDAA 2O6VA 5IA7A 4O3RA 2FLLA 3EFUA 5HR7A 2OOBB 1FMAD 1QQRA 1KSPA 4US8A 2LMRA 5EWEA 3H4BA 2BS2B 5IP4D 5J2GA 3MGVA 3I1YA 1PQSA 5T14A 3DQVA 3TQ1A 3CP8A 1EF1A 1FPYA 5KG3A 2K8CA 4BWMA 1LFDA 4J03A 2W9NA 4I2HA 4LK0M 5J17A 5H8YE 2INPE 4RH6A 3GB1A 5AIAA 5ALFA 4M02A 4DL6A 3HWTA 3C8YA 4HCNB 4GXIA 4MEYA 1UBQA 3BVZA 4NJ6A 2HMXA 1WXAA 4KSKC 4BX9C 3RT3B 2KVZA 5IINA 1VCBA 7ICPA 1DXSA 1D9FA 1J19A 1T6BX 3FILA 1SSNA 1XS9D 1NK0A 3Q8SB 4DO9A 2MBQA 5KHOA 4WURA 3TAQA 1XLOA 3AE5B 1WFYA 1S0VA 2E1FA 3T3NA 1ZJNA 2VH1A 4NM2A 1QCKA 4F71A 4ELUA 1YX5B 4MH0E 4I2BA 4DQQA 5ALNA 5DQHA 5HMMA 3KFUF 2WXFA 5ALIA 3OJUA 1V38A 4KSLC 2N9KA 3KLSX 2ZXHA 1GB4A 4PGYA 1ZQSA 4GMVA 3VUWA 4KMOB 5ALVA 4DF8A 2KMAA 3LYYA 4J6IA 1VZ7A 2QARA 2LRUA 3BS7A 2NV3A 2I5HA 4DOBA 4C8MA 3QNMA 3KWVA 2NO5A 1Q1OA 3M9MB 3B1LX 2XGPA 1B1ZA 1V6EA 1YD8U 2LI5A 2LYHA 1C1YB 2HSZA 1V81A 4U6PA 2WU2B 3QARA 2PFQA 1JW9D 2K22A 2LZ6A 1RFKA 4FULA 2ACZB 3IDWA 1QOFA 2D2QA 2D8CA 2IBIB 9ICLA 2AGOA 2FLNA 3VRBB 5DQGA 4DL4A 8ICCA 1E8ZA 2FAZA 3NASA 4K4HA 1C4CA 3MC9A 4NY0A 2NTSA 2I1QA 5KFPA 2WX0A 3PGEA 1ZW7A 2ALZA 2F77X 2V9WA 1RQLA 3RBEA 4ECVA 4GLSC 4HAIA 4IC7B 3M7DA 2G0AA 3V7LA 3FDSA 5EE1A 3OWEB 5D46A 4NL9A 2AQ3B 2IGDA 3E9SA 3ZNHB 4JUZA 2ZPNA 3L17A 1PK1B 3PR5B 5D7GA 5BYSA 1NJWA 3FKYA 2KVSA 3AN1A 2E1EA 2CHWA 3SEIA 1EM7A 3PRPB 3UQ0A 2ICIA 4F4XA 3RRHA 3BQTA 2XY7A 1BNOA 1SWWA 2JRIB 1S97A 2EZXA 3PLUA 3QUBA 1XO0A 3UF8A 1F2RI 3J81j 1XSPA 8ICUA 3DVNV 4M0WA 4WAFA 4N59A 2QARB 3A9JB 2FNJB 2D3BA 5BOMA 4PS3A 1EXNA 4DL5A 5C23A 1SWVA 4P4MA 3AEFB 3B0AA 4ZRKA 3VRAB 1QOGA 1K52A 2WXQA 5CWRA 1R4NI 4NAMA 5KT3A 4RF1A 1T3QA 1Q3UA 4EENA 2ASDA 1DOIA 4DQRA 1WXMA 3W5UB 1MA7A 3I3TB 4F93B 5AIBA 2QEJC 1P0RA 3ICXA 5KFFA 2FPMA 3NVYA 9ICVA 2WXKA 1I4QA 3GE3C 3PW4A 4TMAB 1EWCA 3RH6A 4ZOHC 2PTLA 2LKYA 5AKLA 5KFLA 2DF4B 2E8MA 3JPPA 3LVWA 3PLVA 3Q8QB 2KEYA 1KRHA 3JSVB 2ZIUB 1NYRA 1MJDA 4P1BC 2JEFA 3ZQ4A 2MU2A 4DSFA 3V6EB 4FZLA 4UBBA 3TIXA 2AWTA 3RNFC 4I2GA 4UB4A 4YMMA 1M4VA 2NR2A 2WQYB 4XC2A 1URJA 5AI8A 2RP5A 4QWDA 1KBUA 2MUTA 3ZUNA 3B0YA 2AL3A 4DL7A 5IIMA 3MFHA 2NCNA 4IR9A 3W2DA 1Y88A 4UATA 4RGNA 4QZ8A 4H2AA 5CHVC 4PHAA 2IMWP 2KZRA 2MRLA 2C2DA 4O3MA 1YN4A 3H8WA 2MJ3A 2LHDA 1PYWD 2OJRA 4Z6EA 2H5XA 2KE7A 3A4RA 3TKAA 2KWUB 3ALRA 4A8EA 2ZIXB 1N5XA 3TEWA 1DK3A 1EUVB 2NRXA 5JTIA 5F9NA 1MG8A 4MEMA 7ICOA 4ZYSA 5C2TB 2C28A 3JPNA 2JRHA 4LNOA 8ICOA 4XWTA 2ODGA 4NLBA 3U7ZA 2KJRA 3ONNA 4AQ7A 3N28A 3WK4A 2KZMA 1IIPA 2GB1A 4NLZA 2VA8A 2XK5A 4E71A 4YMNA 4PK1A 3DEEA 1NK9A 1Z00A 4EUTA 4OZCA 2BVCA 2LVPA 4RQ7A 3CIRB 3H7SA 2KFJA 4IL6U 3C29A 1WZ3A 1FNVA 2BPSA 2HJ1A 3R8BA 3F5EA 2C60A 2N1WA 2RQ5A 3VR8B 1ZRMA 2W7PA 5DLFA 2DPJA 5J8YA 3AE6B 3GILA 2ZIVA 4DXGA 2HHWA 1YZ6A 4LNIA 4N58A 3TI0A 1X2IA 5ALTA 4ICUA 3BJYA 4W9FA 1L8OA 4F7ZA 4QZFA 3GFKB 1BXTA 3RH4A 1SV4A 1MPEA 2G09A 2DNFA 4RPYA 2HOFA 3QUCA 3ISBA 4C4SA 3KYCD 1RWSA 1YOVB 2R8GA 4AP9A 2D10A 4HROA 4JPSA 2IPKD 1A5RA 4FBTA 1Q0WB 3TMPB 4RNOA 4JGHB 2BYTA 4J3OD 5J2JA 4CCHA 1JN3A 4PL2A 3R3MA 5AI0A 4EZ6A 4N9F4 1UH6A 1NI3A 5JU5A 1LM8B 2G5IB 3HW8A 3KHHA 2BF8B 2P35A 4O5EA 4HWIB 1S0NA 8ICMA 3FILB 3QEAZ 2SAKA 4MDKE 1N62A 1ET6A 1ZD3A 5FR3A 1F77A 4OD0A 2DX5B 3QAQA 1E7PB 2JU6X 3IG3A 2W7OA 2DZKA 2K5PA 3VTWA 4RQ1A 2J42A 3DV9A 4Y2JA 2DUYA 3PSTA 4MGZE 4EELA 4E74A 2OCEA 4KMUA 1FEZA 4IWPA 4JWUC 5HHHA 3HJEA 4CF4A 5KHQA 5KNIA 1Z2MA 3IBEA 2K8HA 3QU9A 3U4EG 2IY1B 4M0AA 3MTNB 2XNAC 2YVCA 3L10B 2FJ6A 5D2MB 3B0XA 1J7BA 3A0BU 2B21A 4MM3B 9ICXA 5GMVA 3ZRCA 3QX7A 2HCFA 2N9LA 4LCDE 5KFQA 1Z4OA 2JZPA 7ICLA 3GU3A 4KLGA 2LJIA 4Y2XA 4DQOC 1XF5L 2WXNA 1GJZA 4R63A 3TEXA 2B6GA 1D5XC 4C8KA 1F9JA 3D2SA 1PVRA 2J7QB 3LB8C 2C22A 4QW8A 1OQRA 4B9LA 2AGPA 2MAXA 4M9JA 3C2MA 1HE8A 3I9V1 2K4HA 1PDXA 1U48A 1OEYA 2BB6A 1KEJA 5KFNA 5GTIU 1ZQJA 1LKYA 4NQLB 3AUOA 2XCPA 4NY8A 3RJEA 4JIOU 2LI6A 3KBBA 1CQVA 3QWZB 4IWQA 4BOZB 1S8OA 5ALDA 1DOQA 4BAXA 1RPLA 4HK2A 4RM8A 5HFYA 2NYVA 3HKZF 2VA3A 2I38A 5BYRA 3OHAA 4MJSA 1S0MA 2KQ7A 3RNEC 2CXYA 1GC7A 2HTME 1Q46A 7ICSA 1T0RC 1N6ZA 2K0PA 3ZRFA 9ICGA 2L52A 1F44A 1K51A 3E2EA 2ZVNA 3T79A 3NUHB 5ALZA 4ECRA 4QAYA 5CHGA 1B43A 4KVGB 9ICNA 2KJ9A 4K3CA 5JXVA 5DDYA 2L3ZA 4DFJA 1NKCA 3AH7A 4IKGA 4NLCA 3IHPC 1UWXA 2K6DB 4WWNA 2LHEA 1IUEA 1P3QU 2R2OA 4BKTA 3H8MA 4S0RA 2I6XA 3HRDD 4GIVA 3LK9A 2IOFK 1ZQXA 4EFOA 4EX7A 2UVVA 1MQ2A 4AOFA 2OXOA 1E8WA 2V9HA 5DB8A 2HD5B 2WHEA 3ALBA 4Z6CA 1T8EA 2WF7A 1XT9B 1MSWD 5L1MA 1ZQQA 5J29A 1YQBA 4GLXA 3PZ7A 2JVCA 4Q8FA 2AJQA 4AS1A 1NJXA 4GDKA 5DPSA 1ZQGA 1WJNA 5KFSA 4HEA1 5AM4A 2MX2A 3V6CB 1P7DA 4GFJA 4F72A 5J0WA 2BDPA 2HOIA 4I2CA 3EYZA 2LWPA 3PRZA 5AKGA 3VAWA 2NVUI 4A90A 1BPBA 3OJSA 2FUG1 2H3FA 1ZQRA 2E5SA 3P4RB 2LJ5A 3M9OB 1K5OA 1SL0A 3PTFC 1ZOYB 1I42A 2LUEA 2CPRA 4DCCA 5KFGA 4C80A 5CA7A 1FNUA 1WWTA 4RQNA 3FM9A 4ANUA 2VKQA 3W1SC 3M6ZA 3CW2C 2VZKD 1U4AA 1L7YA 3SAGA 2AH5A 3KHLA 2BB5A 2AQ2B 5IN7A 3OHBA 2QB0B 4ELVA 2WDRB 4DOCA 3H40A 1L6NA 3NVVA 1L0YB 1D6EC 2DENB 2IO1B 4EBDA 5CX3A 4YT0B 5EE9A 1WRIA 4B9KA 2PMZC 5K4LA 1UGJA 3L13A 5TSSA 4KLFA 3H1UA 3AE2B 4BKSD 4ELTA 2FE8A 4PYUA 5AK3A 2YB1A 2TSSA 3CF6E 4ZRJA 1ZXHA 2H89B 1TS5A 2B0CA 4QZDA 1SXTA 1XCQL 1IGCA 2P6UA 3RTVA 3KZXA 4BJQA 1OTRB 1XO1A 5BMHA 3CRXA 4YVZA 3VC8A 3P1MA 3ZDTA 1B0XA 1FNWA 3H8JA 1WWUA 1ZDXA 4XRHA 2MRPA 2YX8A 5J0SA 2Q5WD 4KITB 4BBNF 3PR4A 2KC1A 2LVOA 1OGWA 2JR5A 3D32A 2FMPA 5ALPA 1Z00B 2LM1A 1QH9A 2CS4A 3GDXA 4P0PB 2DAFA 3I5JC 4WWMA 1SE2A 9ICSA 2KQ4X 5LXIB 1KLUD 3AE7B 1R7SA 9ICMA 3SMVA 2I1KA 4NLNA 2G07A 3ZDEA 3F2DA 1KL9A 2VANA 2XY6A 1L3SA 2PI5A 2CU3A 3T3FA 3RB6A 2YEPF 4B9TA 2PJHA 3A1QB 1XEEA 4ECTA 3DWMA 1KFTA 4IS7A 3BK1A 2BWFA 4JV2A 2LMCA 4YMOA 3PW0A 3ZDCA 2REXA 1SL2A 3BVGA 2WP9B 2AHOB 3RJIA 2W9CA 4KLIA 1D8BA 3PHWB 2AQ1B 4K3BA 2MQJA 1TAUA 2J0MA 4JLCA 2EKIA 4JMUA 3URYA 4NJ8A 2L05A 3GIIA 3APCA 3RH5A 4XYCA 4G9BA 2W9CB 4KKJA 4I2EA 4IRKA 4M9GA 3N1ZC 2EH9A 3FAHA 1VDVA 4FS2A 2O2VA 3PSIA 1FFVA 4JK1A 1BPXA 2YMMA 2ZJAA 4C4VA 2ZIUA 1FM0D 2FUHB 3IFWB 3LDZE 1IYFA 4YR3A 4WJOA 5DDMA 4RQ5A 4ECXA 3NG0A 2V3NA 3U8ZA 5TISU 3PX6A 8ICJA 4A20A 4L1BA 1GOZA 2V4QA 5BMIA 2N7JA 2OM6A 2EKEC 1JXEA 4OJ6A 4ED2A 3DHIC 3K9PB 2QIEB 2XEWA 5KFZA 2RDIA 2BCQA 3ZJUA 1QILA 1JALA 1HZ5A 4F92B 8ICQA 4C7YA 3NZSA 1GAQB 2L5YA 3BQ1A 2WFAA 3C21A 3BINA 1KDHA 4YD2A 2XIDA 9ICJA 2KNBA 5CR0A 1QF6A 3K75D 3AB5A 2WXPA 3MC0B 4O3QA 4GXJA 2K8CB 2JRZA 3H7PA 5AKIA 2INNE 3L0WB 3OLMD 1QOBA 4P6VF 1VZ6A 4KX3A 3OPXA 2RDHA 2P6RA 3AV8A 1H4RA 3SI8A 4MT5A 1HQRD 2WHIA 1Z1BA 1FRRA 2BQRA 2QC8A 3GV8B 4LLGM 4B6JA 4K1RB 1QSYA 4ANWA 3BZKA 2M0NA 1UQVA 1MHXA 3C19A 1C7YA 3AM9A 1KFYB 4M47A 2AEHA 2JXXA 5AZHA 1SJHD 4RUCA 2KOBA 3RRGA 1TVAA 1TJEA 3MP9A 1IM4A 4ECUA 4JWNA 4C8LA 4AWJA 7ICIA 3TBLD 5IIJA 3G6XA 2ZW0A 1UBIA 4MSQB 4P4OA 4KLDA 2ZG6A 4NJ7A 2NBVB 1WGHA 1LKYB 2UVUA 4W9IA 2A3VA 3QK0A 4F4KA 4RT3A 2JT4B 3W9CB 1ZD5A 3JSVA 2VRRB 2Y0SC 3DBLI 4DHZE 1COKA 2MEKA 2H3ZA 4GC7A 4G3IA 1F0ZA 1X1MA 3L08A 2Y1JA 2GBNA 2C2EA 4ARIA 4Q45A 4EZ9A 4O9MA 2D07B 2WGSA 4DSEA 4C0ZA 3IN5A 1SZPA 4AYBC 5DBAA 1QLBB 1K50A 1LVHA 2M9NA 4C8OA 4P2HA 4WQOB 4RCOA 5AUIA 2Q0ZX 4XGAB 4M6WA 5J2FA 4B0MA 3OSNA 7ICHA 2IZVB 2YB4A 5ALOA 2ZUDA 2OJWA 4YTPB 4C8NA 3O0FA 2PIAA 3NZUA 1D5ZC 3EUB2 1NK7A 2O6VB 1ZKHA 3BY4B 4IC9A 4DFPA 3PW5A 3N9YC 5KG7A 4B9SA 1CK1A 1C4PA 3KD3A 7ICQA 3EA6A 5HNKA 1VLBA 5KFJA 8ICTA 4KIKB 4DL2A 4ARCA 4B95A 4DHJD 2KMDA 4F5OA 4QNLA 3U26A 4FFDA 2G3QB 1T0YA 2XBBC 3JPSA 4ECWA 4ASWC 1QQ6A 4PZOA 1YMHE 1J0GA 4UAVA 3TARA 5IIIA 3ZTDA 1I4RA 1IBXA 3C5GA 1D8YA 5KFDA 5LLIA 3KVFB 3RN9C 2YMPA 3EC8A 3TANA 2V0GA 4Y2TA 1ZQPA 3RAXA 3AE9B 4DFMA 2BCUA 2KWVB 1KRPA 4KZCA 2BS4B 2ISPA 3ZIMA 2KD1A 3N1YC 3CYMA 3Q8EA 2KT7A 1V85A 2FDRA 1F52A 1O03A 4J9PA 3MC8A 4F8CB 3MDCA 3L54A 4KKIA 2WX1A 2CN1A 4XWWA 5KT6A 4O3PA 3JPOA 2YMLA 1TTNA 2WDTB 2GWSA 1ZQYA 1MFWA 2BW2A 2MA1A 4YR2A 3B08A 4RPZA 9ICCA 4YG2A 2K89A 3DVGY 3WAMA 2WB1C 4KDLB 2KDIA 1FEHA 4F5RA 2KHQA 1B4FA 1JWBD 1SF0A 4L2YA 2AYOB 5J0PA 3DVNU 2WS3B 1T7PA 2HHTA 4LJXA 1ZQTA 2KN5A 3RMKC 4QWAA 1UA0A 3ZD9A 2G4DB 3T5LA 1OQQA 1L7NA 2XVTA 3JVZX 4PZNA 1WXSA 3KUCB 4ED1A 5KFVA 2J4XA 2HBKA 1X6IA 5AK4A 2XO7A 2MCNB 2F76X 3JW0X 1WSPA 1NJYA 9ICEA 2ZCBA 2IO2B 5AM1A 2CRXA 5AI9A 1C3TA 2RMMA 1N48A 1NYQA 5J0RA 3PS6A 4PHPA 3BVMA 1AW7A 1YNTE 1FRDA 4ZHOA 2A5UA 1ZQVA 2EQYA 3V60A 2E8NA 1A77A 2ASLA 1RDFA 1P7EA 1U9LA 1ZQ1C 4PS7A 2L00B 3QC8B 3RULA 2EAMA 1V5TA 4LJPB 5EE0A 1FXIA 4O0IA 3SYZA 2Y5BB 3HX0A 5KFEA 2RLTA 5F9LA 2CJNA 1LB2B 3NS1A 4YL8A 4KLLA 4KGSA 3Q3FA 1ZETA 2J6UA 3T3OA 3HHMA 3Q2AC 2IGGA 5KFWA 4DSLA 1PGBA 3RF9A 4BUGA 2GRIA 2WU5B 2DAJA 2N1RA 4E3CA 3FC4A 3C23A 3PPAA 1N60A 1ZP0B 3QU4A 4Y2YA 7ICRA 2JX5A 1IPGA 3SDLC 3V72A 3CWIA 2UVRA 3PSFA 5ALSA 1ZQOA 5CTRC 2JQRB 3H4DA 2K4PA 5L1LA 8ICBA 3I63C 3BZCA 2RR9A 1L5UA 4RQ6A 4CRXA 8ICLA 1TE2A 4F5NA 1HZ6A 4TQSA 4J9NA 2XICA 2R2QA 3GOEA 1NVID 3JPRA 1V1OA 2J53A 2WB1F 5KFAA 4ED0A 1MVKA 2AGQA 2W8LA 4QZ9A 1XC9A 3H8SA 4WJ3B 4OW0A 1SEBD 3IT4B 4IUMB 4W9DA 4I2AA 3A9KB 1NJZA 3AL0B 1I4GA 4O5KA 4HJGE 1WWVA 3M6KA 5L9XA 1KLGD 1I4XA 3PSEB 3EGRA 5DGAA 5KAFU 2RRDA 4QZHA 1E7UA 2K4EA 1D4BA 4EZKA 1RG6A 4OO1J 3VXWA 1F0MA 4MF8A 1ZD4A 2RPQA 2WXOA 5AK5A 1GB1A 3AU6A 4AUQC 1CMXB 4MFCA 9ICQA 1KN5A 1KF6B 3DHGC 3M63B 2J0JA 2M1MA 1TYGB 3NZ3A 3Q6BA 3P4QB 4W9EA 4P4PA 4YWGG 4NPNA 3RJHA 4AJYB 4REZA 3ONSA 9ICAA 5FR6A 4LTUA 1YQ4B 3SAHA 3ISCA 2BWES 2HOQA 2ZJ5A 8ICNA 4ANXA 3WAOA 3VDZA 2KJ8A 4OJ5A 3QA8A 1CZPA 1NENB 4CHKA 3H0MB 2AQ0A 2D3GA 3EWAA 5L1JA 3LJ3A 8ICKA 2HE7A 5D3IB 2KZ3A 4A55A 8ICWA 2LPEA 4IQTA 4FBUA 9ICRA 4FZMA 5C0YA 2N7EA 4GDKB 4C7ZA 3OJ4B 4OCZA 4W9KA 2KICA 2ZJ8A 1WMHA 4TUSA 2DZIA 8ICXA 2ESEA 2CJOA 4DLEA 3AMZA 4P0QB 2JH7A 2KSOA 1J7AA 2HW3A 4F91B 5AKEA 4HVBA 2KNJA 1COOA 1RXVA 1JWUD 3UI3A 1QQ7A 3P42A 1A76A 1WYWB 2J6SA 2WF8A 5J2DA 2YTUA 3UM9A 2LGXA 3TEYA 4EX6A 1RYRA 4WQMA 3RJJA 3IXSA 2JEIA 5AM5A 2RPVA 1U49A 3IG8A 2Y5CA 3N7SC 2W8KA 2KWCA 5J8YC 4QJFB 3MFIA 8ICHA 4DHJB 2ZIWB 1AWDA 3RZFA 2ISOA 1M94A 3QXGA 1TT5B 4BBNC 3TACB 2KN7A 3C2LA 7ICFA 1PGAA 4LDTB 4BXOB 3W1SA 1IP9A 4A3PA 3R9KA 4PH5A 4EKUA 1TGZB 2MJDA 4FHKA 1WRDB 3PVLA 1V1PA 3UIOB 3ZVVA 3SV4A 8ICFA 1N56A 3KUZA 1WX9A 3ISDA 2L7RA 4K4GA 2GBRA 4ZDVA 5KL1B 3UMCA 1WJ6A 2MP2B 4KGRA 3DDCB 2C7HA 4RU9A 4OVZA 2O6VD 5DPRA 2LD9A 4R8UA 3NY5A 4QIWF 3HPOA 2BGFA 3Q8BA 4KDIC 3WKEA 1UHUA 2YLMA 4EBCA 3KWLA 1S77D 2MBOA 3V7KA 2EZZA 3E0FA 2YQEA 4QZBA 4DF4A 2Z59B 4XDDA 4KLHA 1EU4A 3APFA 2N7DA 3P4SB 3IM1A 1ZQHA 2CHXA 3N3KB 1ENFA 3SZ2A 3QHTA 1FFUA 2MUTB 1PK1A 2BKEA 1R4NB 5J2IA 3KH0A 4MHVA 3L4PA 3PMLA 4R65A 5LXHA 1SXEA 2K8BB 1D9DA 3IP4B 1N61A 2LGDA 1RYUA 5B66U 8ICPA 2KIWA 3PSPA 3Q8AA 2KVRA 2LFIA 3GV7B 3EPIA 4R8UB 2N9EB 1KW4A 2YEPB 3E56A 5CEHA 3N30A 3O65B 1C79A 2KAJA 2NMQA 2KANA 3OSPA 3ZDAA 2NRTA 2ZZPB 2BCRA 5JH5C 4CQNA 4KN7A 1UA1A 2M0AA 2KFNA 2NS5A 2QJLA 4Q44A 1DYQA 1VD2A 2BYVE 1TZ1A 4MH8A 3NS8A 3MHSD 1OUQA 1TV9A 4J9OA 4BOSC 3HIZA 4CGZA 1QOAA 3A1QA 1UF0A 4HRSA 5KL8B 3A0HU 3MGIA 2O6KA 3ZDDA 3WK6A 4MELA 3DVGX 3BQ0A 1WUDA 3AU2A 4FBJB 9ICKA 3KZIU 5IIKA 2WAQC 4ED6A 7ICUA 1SV0A 1TK5A 3EHVA 2KKCA 2V3SA 4IDIA 4D2KA 4LZGA 1JWSD 2BYEA 4QZEA 2HVHA 3PMNA 3Q8PB 1KM7A 2ZEQA 4ECZA 1V9PA 2FCQA 1HA5A 3MC1A 3HVZA 5E6NA 2G9HD 4ACFA 2F8LA 3SHQA 2ZTDA 2V1YA 4UARA 5ALGA 1FCLA 2F44A 2KMCA 1C4AA 3VTVA 2BPFA 3S6JA 1E0ZA 3M3JA 2EELA 3WANA 3KUDB 4BGDA 5DLGA 2FIFA 2R18A 1BPZA 4HDQA 1EWYC 1XO3A 3EW9A 2JGAA 2MJEA 2G06A 5J2HA 3A4SC 4RGTA 1V1PB 1LGRA 1WY8A 4HKZE 4KLOA 1L3VA 1PK3A 3UMBA 3KQ4A 3HVDA 4OVVA 4MJSB 1NKEA 1YT3A 1X66A 3CSTA 2WTFA 5IAAC 5EE3A 3AQEA 2V4IB 4F1SA 4YD1A 2PI4A 3QEBZ 4QZCA 3OGUA 1ZUD2 2W9MA 2BBCA 2C7MB 2IDYA 4MFAA 3DBHI 4EE2A 2WWZA 1B22A 1OQYA 5J0XA 1FIQA 3H0RB 2M0XA 1UWMA 1NK5A 3TUOA 4YXDB 1H8CA 3OAWA 5KFOA 3WA0A 1BVSA 4BKGA 2BR0A 2PFOA 1NZPA 1ZQFA 4FLHA 4NNJB 4TQ0A 1TKEA 1YN3A 3PW2A 1RYJA 4OZBA 4BXOA 1K1QA 2HI0A 2ZPYA 2H88B 4MFFA 2HDOA 1NK4A 1K8RB 3QU7A 4US9A 4RMAA 3CSFA 2VIXA 1KFSA 2R8KA 2MBHA 2PE9A 5FKAC 2WXJA 1JQ4A 5G55A 1YJ1A 1ZD2P 4MGIE 1A0PA 2NRZA 4PHDA 2GBKA 3PVXA 3AECB 3EFCA 4F3OA 3QUTA 3ZNID 3THVA 1NDDA 3C5FA 2XI9A 4ECYA 1S3SG 3KTQA 4CDGA 4II3B 5DG8A 2AQ4A 2KLCA 3N20C 4G11A 3PT2B 2M19A 3PV8A 2PKEA 3VH4B 1LO5D 2PFPA 4RF0A 1E90A 3BYYB 2KDFB 4B6WA 1V97A 5DBCA 3RD2A 3RNGC 2HHXA 4DWIA 2Z0EB 4GB9A 2AL6A 2KMMA 3QJZA 2XK5B 2KKVA 2AU0A 1BPYA 3AEAB 4O3OA 3V61A 1XNSA 5JHBA 1RLFA 2W3RA 1MC8A 1BUIC 1NK8A 5J2CA 2G4SA 5BOLA 3FYHA 4PHEA 1HEZE 3RJFA 1J97A 1E8YA 2EAPA 3V7JA 5EDSA 3QCAA 3I28A 5KT7A 4TUQA 4C56C 1I7HA 1L4DB 4IG7B 1KLNA 1WG8A 5AK6A 3KOOA 2ZUBA 2BYFA 1DGSA 1MHHE 4RQ3A 3TL5A 4QIWC 5DG7A 4Q8EA 2K25A 2D6FC 3Q14C 4LZDA 5J0QA 1I4PA 1SIJA 1ZQAA 4II2B 1C76A 2E8PA 2V3PA 4P16A 3PY8A 2L0FA 2QHOA 1XQQA 2PKOA 3I76A 1TFRA 1NKBA 2Z7JA 1SV0C 1ED1A 2PLPA 3PZPA 3U30A 3GIKA 5EWGA 4WAAA 8ICEA 3MHZA 5D6JB 4DOAA 1DGJA 2W82A 2J6TA 1PZNA 2G08A 5ALHA 5E6JA 1N2XA 1PGXA 2XC9A 1JCKB 2KD0A 2IO0B 3RNCC 1QTMA 3M95A 2DPIA 4M2YA 3G6VA 2BZFA 2LGIA 3QE9Y 1JMLA 1X9MA 5DKWA 1AARA 3H6NA 1BNPA 1S1QB 3AE3B 2N4FA 2K60A 4IWOA 3ZTCA 2QKQA 2ZW1A 4P7IA 3NJTA 3KHGA 3GP7A 2BCVA 2JMGA 2QB1A 4O3SA 2F1HA 7ICKA 3Q3OC 2LHTA 1VRAB 2F1JA 5KFIA 1WMHB 3BDPA 4KZ0A 4EZJA 4M6WB 1L3TA 2EMSA 2JPHA 3WU2U 3HP6A 4KLSA 1RFAA 3IV6A 2NBWB 4M8MA 4WWPA 3AEVA 3MR3A 4UBCA 1IG6A 4JB3A 3R7QA 2KK0A 5AKKA 5DQIA 3HM6X 3Q3JA 2ZJDA 3V62A 2MH7A 3QU5A 2BPCA 5KTQA 1H38A 2OHFA 5HP4A 2FE9A 4TQRA 2CKHB 2WXIA 2ZNVB 9ICBA 4FO6A 4HXDA 2BTEA 5GXGB 5BMGA 4IOIE 5DPTA 4ZH4A 3S2AA 3PX0A 2RD0A 4NLKA 1ZQLA 2RDJA 2BS3B 2WLBA 2ZIXA 5KG2A 4KLMA 1L6UA 1ECWA 7ICTA 7ICJA 2QSDA 3V6HA 1R4MI 4NXZA 4E0DA 5KFUA 3JPQA 1HEKA 1XLPA 3RB4A 1T5XD 4LVSA 2N9PC 3PV1A 4LDTD 3BK2A 2JXJA 4M01A 5I4DA 4IR1A 1WX7A 2LBOA 2WYQA 4QZIA 2G5HB 3UQAA 4TUUA 2M17A 4DL3A 1V9JA 3MR6A 3Q8CA 5H2FU 4QWCA 3V6JA 9ICFA 3IG5A 3DPDA 2DYOA 2KQSA 2OH2A 5G2NA 1P98A 3ZO5B 3VUYA 1WE7A 4FZNA 3K1ZA 1JIHA 5CB1A 1Z4NA 3N1XC 2FPLA 1WYGA 4OJOA 5KT4A 3C28A 4M9HA 2LUMA 2AXTU 3NHEB 2K3UA 2B3AA 3ZKJC 3KKAA 3K1RB 1XCTL 4QZAA 2M56B 3U52E 1J2MA 3UXNA 4PPXA 2IY0B 1SGGA 5AKZA 1KQQA 4YR0A 3N7PD 5J2BA 4KLUA 4RPXA 3R2TA 2KDEB 4ZRPA 5HMLA 2FPKA 4GC6A 1SIFA 4WH4A 3K4GA 3A9JA 1NEKB 2KFKB 4M04A 3KYDD 4KLJA 2HHUA 1TY0A 5JHAA 2UYZB 3T9LA 2J0KA 1PVQA 4FXCA 4NWIA 4C00A 1A6SA 3MGHA 1XLQA 1SKRA 2HJ8A 4B0EA 3Q8MA 1G6JA 1TS2A 5AKXA 4ITKA 4I27A 3HILA 5GTHU 4RT2A 3DBLB 5ALWA 3KW5B 1JWAD 4F4ZA 1AROP 2Q4TA 5TR5A 4NQKE 1M6YA 1WCNA 3GV5B 1IGDA 2JWZA 4GDLB 2L8JA 2ZNVC 2K4IA 4YN4A 2W9BB 2GLEA 4L23A 3LXFA 2PPHA 5IO9A 3AEDB 1WGDA 4O3NA 2ZIVB 5BPCA 3TFSA 1F2RC 3WKCA 1QZEA 2DYMA 1QQ5A 3ZDMC 5JZEB 1L7OA 1ZQCA 3A9KA 3AI5A 3F2CA 1GG3A 3W5VB 4CO7A 3TEZA 3DBRB 2IA6A 3ZXVA 5AKHA 1J2NA 3ML9A 4JE3B 4AJWA 4DS4A 4J9MA 4B9NA 2JZBA 5EWFA 4IM3A 2BKRB 1WZ0A 3LYSA 2PMVA 4RQ2A 2ZTEA 2PVOD 1N5WA 5KG1A 2K8BA 5E6PA 1ISNA 4LJOB 2NBUA 2HTHA 2DGZA 4B9VA 2QDFA 3GZFA 5DB6A 2IYDB 5B5EU 2K1FA 3PO5A 3ZI4A 3D6JA 5KFKA 1UPHA 1ZPSA 4JWSC 4Y2PA 4AYBF 2A4ZA 2FI1A 1MG4A 3RUIB 2GBJA 2DKZA 4CF5A 1Y56A 4GXKA 3TJPA 2E3TA 1BT0A 2EANA 2UU7A 4KX5A 2XY5A 3PNCA 4PJ0U 3EPGA 2INCC 4MSMB 3NRWA 4UB3A 2HHSA 3T5JA 4YP3A 2PW9A 3ORYA 4IM0A 2KVCA 2R8JA 5HG2A 5CHFA 2KIVA 5ALUA 4ZRIA 5MPOA 1SBBB 2MP2A 5IOIA 5DB7A 3NGDA 2JSVX 2KV2A 2IHMA 1T0SC 4KX6B 1V5OA 2FCNA 2WXRA 1AQ6A 1HXYD 3ZLZA 1SXDA 4DSIA 2ES6A 4DDID 1KOTA 5HHDG 1JXLA 3IRUA 4NAWA 4R66A 4Z6DA 3D2NA 1ROEA 3N32A 2NPTA 4RFBA 2RHFA 3Q8KA 3RFZB 4ICAA 5KAIU 5J0OA 2QLTA 1HTOA 2I9GA 2HDEA 5G5HA 1X40A 2DBYA 3ETLA 4YSZB 5IKCM 2LASA 1E9MA 1V86A 4ZYNA 4CNQA 3UIPB 4LNNA 5DPWA 3VUXA 5ALQA 2LGSA 2NRVA 5AICA 2GBMA 2FMQA 2CHZA 2C7NB 3TCAA 3PX4A 3N7RC 3A33B 4UAYA 1XU4A 1RZTA 2W43A 5KG4A 5IIOA 3B9JA 3NVZA 3BS5B 4A3OA 1HJPA 2Y9TA 4I2IA 1UT5A 1Q10A 2FLPA 2LRWA 1Q8KA 2BQ3A 1L7MA 9ICPA 2LVQA 5D94A 4ZHPA 1P1AA 1NK6A 2H3QA 2O2VB 3PZDA 1VJ5A 1E5WA 2OEHA 4JQWC 1RYSA 3H9DA 4F5PA 2IHNA 2WNMA 3QX1A 1YQ3B 1TKYA 2BKFA 5HKHA 4HLEA 2JXTA 4NAWB 2Z8LA 2JHDA 1SKWA 2ZTCA 4I29A 5KFXA 4J9QA 4RGOS 3G6YA 1C9FA 3UQ2A 4USAA 2KX0A 4OJPA 1C78A 4EYHB 4PS8A 4XDCA 2IOHA 4UB5A 2CR5A 2W3SA 4FA6A 1ZE3D 1ZYQA 4ECSA 1LV5A 2W9BA 3LWLA 1MN8A 2F3NA 2KFZA 3WALA 1L2NA 1XSNA 1VR9A 4TV3A 2JEJA 2FCSA 1SE9A 5DGBA 1NZBA 1UCVA 2NPTB 4IQUA 2D3DA 2QB0A 5DG9A 8ICYA 8ICSA 4HPLB 4W9JA 2YY6A 3IHQB 5ALXA 2KYWA 3UMGA 3H7PB 3WKAA 5JRTA 1AN8A 4YTMB 4ICVA 4IQWA 5A0LA 3ML8A 3WCQA 2BT6A 4J9KA 3MBYA 5L83A 3PRMB 5KFBA 4ACOA 2FMSA 4OVUA 3RB0A 1UNSA 4M9LA 3HUIA 3ZYYX 3DBHB 3VHTC 4LNKA 4DQSA 2LYAA 1GPXA 3GZNI 2EAOA 1CEZA 4F8RA 4O5CA 1SE3A 1AYFA 2W9AA 4GU2A 1XSLA 1S76D 2KTRB 4HKQA 4OHJA 3NTUA 2RSUA 4X57B 4CF3A 4EZLA 1ZQEA 4EBEA 2N0SB 1X9WA 3OG5A 2DFLA 2DL0A 3WK5A 1TK0A 4C4VB 4DS5A 1TKGA 3AU5A 4K7SA 4JL9A 1YJJA 4MGKE 4KLQA 4BWJA 3AEBB 2JEGA
chains in the Genus database with same CATH topology
1TS4A 5HI1A 4TSSA 1QOAA 4HRSA 4WWMA 1SE2A 4XE0A 1TS3A 2KQ4X 1YN5A 1KLUD 3AE7B 1R7SA 4NZLB 2W55A 2CU3A 3O13A 3AEEB 2YEPF 4NJCA 1FO4A 1XEEA 3DWMA 1XLNA 3ETRA 3BK1A 4TQ1A 4IDIA 4D2KA 1JWSD 2SEBD 1BMLC 2LMCA 3HVZA 1HA5A 3PZ8A 2G9HD 2PVGC 3MJ5A 1FMAD 1QQRA 3BVGA 4US8A 2BS2B 2WP9B 2AQ1B 1FCLA 1C4AA 2EKIA 1E0ZA 2EELA 4LK0M 3URYA 5H8YE 2INPE 4RH6A 3GB1A 3DWGC 4KKJA 1EWYC 1XO3A 1YJIA 3FAHA 1VDVA 3C8YA 3BVZA 2MJEA 1FFVA 4RGTA 3H8HA 1FM0D 1V1PB 1UUPA 4HKZE 1T6BX 3FILA 1SSNA 3KQ4A 3HVDA 3V3XA 2V3NA 5EE3A 4L1BA 1GOZA 2V4IB 4WURA 1XLOA 2N7JA 5BMIA 1ET9A 3AE5B 4Q2JA 2BBCA 1ZUD2 4YSYB 3T3NA 2IDYA 2QIEB 4EE2A 3ZJUA 1V8CA 1QILA 1FIQA 1JALA 1HZ5A 1UWMA 3TUOA 4YXDB 4C7YA 2WXFA 3AEGB 1GAQB 2N9KA 1A70A 3KLSX 1QKZA 4TQ0A 1QF6A 2G1EA 1TKEA 1YN3A 1RYJA 3AB5A 2WXPA 4OZBA 1GB4A 3MC0B 2INNE 3LYYA 2WXLA 2H88B 4A9AA 1VZ7A 4US9A 1QOBA 4P6VF 1VZ6A 2RDHA 3AV8A 5FKAC 4MT5A 3KWVA 1HQRD 2WXJA 1JQ4A 1FRRA 1TZOA 1B1ZA 4LLGM 3AECB 2WU2B 3BIID 1JW9D 1MHXA 2K22A 3P4PB 1RFKA 3AM9A 2NTTA 1KFYB 2ACZB 2L83A 4N6EB 3ABVB 1SJHD 1KTKA 1QOFA 1TJEA 3MP9A 2M19A 1LO5D 4RF0A 2X38A 3VRBB 2ZW0A 3BYYB 1C4CA 2NTSA 5T8IA 1SB3C 1QT9A 1V97A 4OZAA 1WGKA 1IBXB 4GLSC 2KMMA 5FK9C 5EE1A 2XN9C 3OWEB 2AQ3B 2IGDA 3E9SA 3W9CB 3AEAB 1STEA 2W3RA 2MEKA 1F0ZA 1BUIC 3SFDB 5D7GA 5BYSA 1HEZE 4MACA 4ARIA 3AN1A 2DWQA 1WXQA 1EM7A 4C56C 1I7HA 1L4DB 2ICIA 2LEKA 1QLBB 1K50A 5AUIA 4RCOA 1MHHE 2WDQB 2JYTA 3VQIA 3AE4B 4O1NA 3TSSA 1F2RI 4B0MA 4M0WA 2K9XA 4WAFA 3SR6A 1I4PA 4N59A 1SIJA 1C76A 4YTPB 2V3PA 4P16A 2FBWB 2PIAA 3IAM1 2PKOA 3AEFB 3VRAB 1QOGA 1K52A 1D5ZC 2WXQA 3EUB2 1ESFA 2PLPA 4NAMA 3Q8FA 4RF1A 1T3QA 1DOIA 3B2GA 3MHZA 3N9YC 1CK1A 1DGJA 2W82A 1P7FA 1C4PA 3W5UB 5E6JA 1N63A 5C3JB 2WXHA 3EA6A 1VLBA 1PGXA 1JCKB 3BYTB 2QEJC 4ARCA 4A8XC 3NVYA 1B9RA 2WXKA 2LGIA 1PUTA 1I4QA 4TMAB 1EWCA 1JMLA 1YMHE 2DLBA 4ZOHC 2PTLA 1I4RA 1IBXA 4KGTA 3AE3B 3BWUD 2V0GA 2ZW1A 1MI0A 2R61A 1KRHA 3GP7A 1JRPA 3AE9B 2D5GA 2BS4B 1NYRA 1VRAB 3Q8EA 3IAS1 3ZQ4A 5D3DA 1PFDA 1M4VA 2WQYB 2W54A 2JYEA 4KKIA 4XWWA 1L6VA 3PO0A 1L0VB 3R2IA 3W2DA 4RGNA 2BW2A 1XXGA 4H2AA 1FEHA 1JWBD 1YN4A 4DXFA 1SF0A 4L2YA 2MJ3A 2LHDA 1SE4A 1PYWD 2MH7A 1C77A 2WS3B 3AE8B 2VZKB 1OQQA 2OHFA 1N5XA 1ZDVA 3TEWA 2BTEA 2WXIA 3B2FA 2J4XA 5BYQA 5GXGB 5BMGA 4IOIE 4ZYSA 5C2TB 4XWTA 1WSPA 2Y3AA 2BS3B 2WLBA 1K53A 1L6UA 3AEBB 2RMMA 3U7ZA 1NYQA 2Y5PA 4AQ7A 3BVMA 1AW7A 1YNTE 1FRDA 2GB1A 2QSDA 4ZHOA 1XLPA 3BZDB 1VJKA 2L32A 1L4ZB 1JWMD 1T5XD 4OZCA 1P7EA 3BK2A 3CIRB 5I4DA 1FNVA 3R8BA 3VR8B 1I4HA 2WXMA 5EE0A 1FXIA 3AE6B 3Q8CA 2CJNA 2DYOA 4DXGA 3NS1A 4KGSA 3VR9B 4N58A 3T3OA 2IGGA 1PGBA 1BXTA 1WYGA 2GRIA 1MPEA 2LUMA 2WU5B 2K3UA 3FC4A 1N60A 1XCTL 1ZP0B 2M56B 2GI9A 2ONQA 3IT6B 2JX5A 3U52E 3CWIA 1RWSA 1SJED 4JPSA 4HROA 2IPKD 3R2TA 2JQRB 4ZRPA 5H92C 2BYTA 4J3OD 4WH4A 1NEKB 3V05A 1TY0A 1HZ6A 4FXCA 1NVID 1NI3A 1XLQA 1V1OA 4B0EA 1TS2A 4ITKA 2JWUA 2J53A 1MVKA 3FILB 2SAKA 1N62A 1ET6A 4OW0A 1SEBD 3IT4B 5FR3A 1F77A 1JWAD 4RGMA 3AE1B 1E7PB 2JU6X 1I4GA 2K5PA 4HJGE 1IGDA 4GDLB 1JROA 2J42A 1KLGD 1I4XA 1FD6A 3EGRA 4L23A 3LXFA 3AEDB 2ON8A 1D4BA 4R3DA 4JWUC 1F2RC 2DYMA 3TEZA 3W5VB 3ZGZA 3U4EG 2WXOA 3U2SC 2XNAC 3GS2A 1GB1A 4JE3B 1J7BA 4MM3B 1KF6B 2N9LA 4RNAA 1TYGB 2PMVA 3NZ3A 2L1AA 3P4QB 2PVOD 1N5WA 2JZPA 4YWGG 3NRZA 4REZA 2LJIA 4DQOC 1XF5L 2WXNA 4LTUA 1YQ4B 4A6QA 4JX1C 3TEXA 1ZPSA 4JWSC 1D5XC 3RPFC 1CZPA 1NENB 3LB8C 3I57A 1E10A 1E6EB 1OQRA 5D3IB 1Y56A 4A55A 2E3TA 2KN4A 3I9V1 1PDXA 4GDKB 4C7ZA 2BB6A 5G5GA 2PW9A 5HG2A 1VZ8A 5MPOA 1SBBB 2IGHA 1ZXIA 2CJOA 2KACA 3AMZA 3ZJVA 1CQVA 2JSVX 4KX6B 2WXRA 1KH0A 2QILA 1HXYD 1J7AA 3Q69A 5HFYA 5HHDG 2I38A 2RDGA 5BYRA 1JWUD 3UI3A 3P42A 1ROEA 4RFBA 1ACCA 2E6XA 2HTME 3RFZB 2K0PA 2L52A 1K51A 1DOYA 3TEYA 3MFGA 5LNK1 2HDEA 5G5HA 4WQMA 2DBYA 3IXSA 3NUHB 4YSZB 1E9MA 2RPVA 3SFEB 2Y5CA 1FCCC 3P63A 1TY2A 5JXVA 3AH7A 4IKGA 1L5PA 1UWXA 1AWDA 2LHEA 1IUEA 1PGAA 3W1SA 3B9JA 3NVZA 2MJDA 3HRDD 1Q10A 1V1PA 2QMTA 4ZHPA 3NVWA 4YTNB 2IJ0A 1EU3A 3PZ7A 2J52A 2KWDA 2WNMA 4KGRA 4OVZA 5AUKA 4AS1A 1YQ3B 1TKYA 4WIPA 3Q8BA 4HEA1 2JXTA 4NAWB 2Z8LA 4RGOS 3KWLA 1C9FA 2I2YA 4A90A 4USAA 2WXGA 1C78A 2FUG1 4XDCA 3P4RB 4XDDA 2W3SA 4UDUC 1ZE3D 1EU4A 1ZOYB 3ZJTA 4YSXB 3P4SB 1VR9A 3SEBA 1DOXA 2OEDA 4C80A 1FNUA 1WWTA 1ENFA 1FFUA 2B76B 2KDMA 2VZKD 1AN8A 4YTMB 4PT5A 2BB5A 2AQ2B 3WCQA 2BT6A 3J9CA 1UNSA 2WDRB 3L4PA 3HUIA 3ZYYX 4ZRQA 1CJEA 3NVVA 1L0YB 1D6EC 1N61A 1GPXA 1OFFA 4YT0B 5EE9A 1WRIA 3Q8AA 5TSSA 1UGJA 1SE3A 3AE2B 1AYFA 2LFIA 2FE8A 2TSSA 1D5MC 1ZXHA 2H89B 1TS5A 4OHJA 2YEPB 3E56A 4HKQA 1RM6C 1SXTA 1XCQL 1C79A 1IGCA 2KAJA 2N0SB 2NMQA 5BMHA 1FXAA 2AX5A 3P1MA 1J7CA 2WDVB 4CQNA 1L0XB 1TKGA 1FNWA 2M0AA 1ZDXA 2QJLA 1YJJA 2Q5WD 1DYQA 4MH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZXI A;  2CJO A;  5EE1 A;  1XLP A;  1VJK A;  3AMZ A;  1QOA A;  3AEA B;  4HRS A;  3W9C B;  4KX6 B;  4WWM A;  2W3R A;  3CIR B;  1F0Z A;  1J7A A;  3SFD B;  3AE7 B;  1R7S A;  2W55 A;  3VR8 B;  2CU3 A;  1ROE A;  3AN1 A;  2DWQ A;  1FXI A;  3AE6 B;  3AEE B;  1WXQ A;  5EE0 A;  2HTM E;  1I7H A;  2CJN A;  1FO4 A;  3DWM A;  4N6E B;  3NS1 A;  2L52 A;  2LEK A;  1QLB B;  1XLN A;  3VR9 B;  1DOY A;  3ETR A;  5AUI A;  4N58 A;  5G5H A;  4IDI A;  4WQM A;  2DBY A;  2WDQ B;  4YSZ B;  3AE4 B;  1E9M A;  3SFE B;  1WYG A;  2K9X A;  2WU5 B;  2Y5C A;  3HVZ A;  3P63 A;  3SR6 A;  2PVG C;  4N59 A;  1SIJ A;  3FC4 A;  1FMA D;  3AH7 A;  4YTP B;  1N60 A;  4US8 A;  1ZP0 B;  2BS2 B;  1L5P A;  2M56 B;  2WP9 B;  1AWD A;  2JX5 A;  2FBW B;  2PIA A;  1IUE A;  2PKO A;  3AEF B;  3CWI A;  1RWS A;  3VRA B;  1QOG A;  3B9J A;  3NVZ A;  4HRO A;  2EKI A;  3EUB 2;  1E0Z A;  2JQR B;  5H92 C;  2MJD A;  1T3Q A;  3HRD D;  1DOI A;  3B2G A;  5H8Y E;  1DGJ A;  1NEK B;  3DWG C;  3AE2 B;  3W5U B;  1N63 A;  5C3J B;  1EWY C;  1VLB A;  1XO3 A;  1YJI A;  4ZHP A;  3NVW A;  3FAH A;  1VDV A;  4FXC A;  1NVI D;  4YTN B;  2MJE A;  3NVY A;  1NI3 A;  1FFV A;  1B9R A;  1XLQ A;  1PUT A;  5AUK A;  1YQ3 B;  1FM0 D;  1TKY A;  4ITK A;  4ZOH C;  3AE3 B;  1N62 A;  5EE3 A;  3KWL A;  1JWA D;  1KRH A;  3AE1 B;  4USA A;  1JRP A;  1E7P B;  1XLO A;  3AE5 B;  3AE9 B;  2K5P A;  1ZUD 2;  2BS4 B;  3P4R B;  2QIE B;  1NYR A;  2W3S A;  4YSY B;  1JRO A;  1V8C A;  1ZOY B;  3LXF A;  4YSX B;  4ZHO A;  1FIQ A;  1JAL A;  3P4S B;  3AED B;  1UWM A;  1PFD A;  4YXD B;  4C7Y A;  2WQY B;  4JWU C;  2W54 A;  1DOX A;  3AEG B;  4C80 A;  1GAQ B;  1WWT A;  1L6V A;  1FFU A;  1L0V B;  2B76 B;  1A70 A;  3PO0 A;  3W5V B;  1QF6 A;  2G1E A;  1TKE A;  3AB5 A;  1RYJ A;  4YTM B;  4A9A A;  1J7B A;  2H88 B;  3WCQ A;  4US9 A;  2BT6 A;  1QOB A;  1KF6 B;  4P6V F;  1JWB D;  3AV8 A;  1TYG B;  1SF0 A;  2WDR B;  3P4Q B;  3L4P A;  2PVO D;  1N5W A;  2MJ3 A;  3HUI A;  3ZYY X;  1CJE A;  1JQ4 A;  3NVV A;  1FRR A;  2MH7 A;  3NRZ A;  1N61 A;  2WS3 B;  1OFF A;  4YT0 B;  3AEC B;  2WU2 B;  3AE8 B;  1GPX A;  3BII D;  1WRI A;  5EE9 A;  4LTU A;  1YQ4 B;  1JW9 D;  2K22 A;  3P4P B;  4JX1 C;  1RFK A;  3AM9 A;  1AYF A;  1KFY B;  1OQQ A;  2ACZ B;  2L83 A;  2OHF A;  1N5X A;  3ABV B;  1QOF A;  4JWS C;  3RPF C;  2H89 B;  1CZP A;  1NEN B;  1TJE A;  2M19 A;  3B2F A;  5GXG B;  3LB8 C;  1RM6 C;  3VRB B;  2KAJ A;  1E6E B;  2N0S B;  5C2T B;  1E10 A;  1OQR A;  2E3T A;  1FXA A;  1SB3 C;  1QT9 A;  2AX5 A;  1V97 A;  1PDX A;  2BS3 B;  2WLB A;  1L6U A;  1J7C A;  2WDV B;  3P1M A;  4C7Z A;  1TKG A;  5G5G A;  1WGK A;  1NYQ A;  2QJL A;  1YJJ A;  2KMM A;  1FRD A;  2Q5W D;  3AEB B;  5MPO A; 
#chains in the Genus database with same CATH topology
 1TS4 A;  2GOL A;  3UXP A;  2JV3 A;  2KK8 A;  4TSS A;  3RB3 A;  1ZQI A;  4JWM A;  1Q5W B;  4XE0 A;  4RQ4 A;  2ZVO A;  3ZW3 A;  5D4B A;  1S9F A;  1WR6 E;  3EZ5 A;  4M8N A;  4ED8 A;  4NZL B;  4DHZ B;  5AEK B;  2W55 A;  2EZY A;  2KC2 A;  5E79 U;  3TAP A;  4MM3 A;  7ICM A;  3AEE B;  5L95 C;  2W03 A;  4RQ0 A;  4QZG A;  1UD7 A;  4NJC A;  1FO4 A;  4F4W A;  2F8K A;  4TKN A;  4Y2V A;  2MW5 A;  1BPE A;  1HUO A;  5BO4 B;  1JUD A;  2YMQ A;  1ZQN A;  4QWB A;  4TQ1 A;  4M0W B;  1BML C;  1QSS A;  3PZ8 A;  1HIW A;  2PVG C;  1V80 A;  2BHN A;  3MJ5 A;  5J0T A;  4M00 A;  3M8R A;  3WAP A;  2F1I A;  2DKX A;  4FJZ A;  4ECQ A;  2KTQ A;  5CJ7 A;  2UWQ A;  8ICA A;  7ICG A;  4Y2U A;  1E7V A;  2R8H A;  3DWG C;  2ZIW A;  4RQM A;  1BPD A;  4F50 A;  1JRU A;  1WX8 A;  4I28 A;  3QU2 A;  1YJI A;  3GQC A;  3DOW A;  3RAQ A;  5KFT A;  2Y9U A;  1TKD A;  3L16 A;  3H8H A;  3QUQ A;  1UUP A;  3DBS A;  8ICR A;  4I6L B;  1K1S A;  2W04 A;  3UXO A;  3GIM A;  4DEZ A;  3RJK A;  3EEC A;  3V3X A;  1WH3 A;  2A1J A;  3PO4 A;  1GO3 F;  4P0P A;  2LM4 A;  3HT3 A;  1ET9 A;  2IND C;  4Q2J A;  4WJN A;  4YSY B;  4RNN A;  1ZQZ A;  1X42 A;  3MR2 A;  2H3V A;  4I2F A;  2DHZ A;  4S17 A;  1ZQW A;  1V8C A;  3HM3 A;  4BKS A;  4R64 A;  3VCB A;  1Q3V A;  4WWO A;  4DDG D;  4P1C C;  1TBE A;  3AEG B;  4I2D A;  1X9S A;  4GGQ A;  3CMM B;  2E8O A;  1A70 A;  4UB8 U;  1QKZ A;  2G1E A;  1DRG A;  4A9A A;  1ZQM A;  2WXL A;  4YCX A;  2RDB C;  4UB6 U;  1Z5S B;  1JMS A;  1EF5 A;  2KX3 A;  2Y1I A;  4W9G A;  4EEW A;  5HR6 A;  4UAS A;  1D8L A;  1TZO A;  2KJ6 A;  4DK5 A;  2GMI C;  5AI4 A;  4J9S A;  3L5K A;  4MGY E;  3BII D;  4FS1 A;  1JX4 A;  4GN1 A;  3P4P B;  3GIJ A;  2NTT A;  4N6E B;  2L83 A;  4W9C A;  3ABV B;  3ZXR A;  3AQF A;  1KTK A;  2QCZ A;  2WAQ F;  4I6N B;  1RQN A;  3RFA A;  5AM0 A;  1TAM A;  3DBR I;  2BCS A;  5J18 A;  2X38 A;  3KKA C;  5CRX A;  3UQB A;  5IIL A;  5J2K A;  2HBM A;  5T8I A;  1SB3 C;  5ALK A;  1QT9 A;  5KT5 A;  2M4N A;  3ZNZ B;  3SD7 A;  4OZA A;  1X9X A;  3SU8 X;  1HTQ A;  1WGK A;  5KFM A;  1IBX B;  1ZJM A;  3M9N B;  5L1I A;  4KIK A;  3C1Z A;  1IXR A;  4YQW A;  3H7I A;  5FK9 C;  5C1Z A;  3VVW B;  2L0T A;  2XN9 C;  1STE A;  1OXJ A;  1UT8 A;  1F5S A;  4X5V A;  3LWM A;  2D3C A;  2PEA A;  2A19 A;  4ANV A;  3SFD B;  4MAC A;  1GUA B;  4DBG A;  2A1A A;  2DWQ A;  1KTQ A;  1WXQ A;  4XA5 A;  4DWF A;  5KG5 A;  1U45 A;  3ZDB A;  2LEK A;  2WDQ B;  3WIM A;  1SKS A;  2JYT A;  3VQI A;  3AE4 B;  4O1N A;  3TSS A;  2WF9 A;  2HHQ A;  2K9X A;  3GZN B;  2FCM A;  3SR6 A;  4CE6 A;  1RAX A;  3DCG A;  2F2A B;  3UIN B;  2ZUC A;  1WE6 A;  2Z0D B;  2DYB A;  2FBW B;  3IAM 1;  2DZJ A;  9ICT A;  4K81 A;  4FE3 A;  5DB9 A;  1ESF A;  1SGH A;  3Q8F A;  4OJL A;  7ICV A;  2PE6 B;  3MAB A;  3B2G A;  2MSE D;  4UB1 A;  3WK7 A;  1P7F A;  5CHW A;  1N63 A;  4G0N B;  2WXH A;  2KDB A;  5C3J B;  5KFH A;  3BYT B;  4UAZ A;  3HK0 A;  1T3N A;  4A8X C;  1B9R A;  2K39 A;  4NL9 C;  3R7R A;  2KJ5 A;  3R66 C;  1PUT A;  9ICW A;  1KLV A;  2DLB A;  4JV0 A;  4UAU A;  3H0L B;  4KGT A;  4TUP A;  3OJ3 A;  2ZCC A;  2VJ4 A;  3RCZ A;  3BWU D;  3VFK A;  3D2Q A;  1LQB A;  1WJ4 A;  1MI0 A;  2R61 A;  1JRP A;  3QZ7 A;  2PMZ F;  2JUO A;  2D5G A;  2BQU A;  3AU4 A;  3MJW A;  2PFN A;  4FAD A;  3IAS 1;  1WF9 A;  5D3D A;  1PFD A;  2W54 A;  4J9L A;  2JYE A;  1U4B A;  4RUA A;  1L6V A;  4DSJ A;  4HPM B;  3PO0 A;  1L0V B;  4IRD A;  3R2I A;  4W9L A;  2KG5 A;  1J8C A;  5AKJ A;  1XXG A;  2K8A A;  2KHW B;  3Q3N C;  2JZB B;  2WF6 A;  4G50 A;  4Q43 A;  4BVU C;  4UB2 A;  5AZG A;  9ICI A;  3WK8 A;  3SQI A;  2MWS B;  1X6J A;  1DK2 A;  4DXF A;  2UVW A;  1TAQ A;  4IM2 A;  5KFC A;  3WK9 A;  2H3I A;  2Y0S F;  5TZV A;  1SE4 A;  2KOX A;  1SL1 A;  1C77 A;  3GE8 C;  3AE8 B;  2NO4 A;  1WGR A;  2VZK B;  3X0W A;  2DZM A;  3U7D A;  2P66 A;  1ZOL A;  1RXW A;  3LVV A;  3SAF A;  3ECI A;  3WKD A;  1ZDV A;  1TK8 A;  9ICU A;  3B2F A;  5BYQ A;  2C9W B;  3BS5 A;  3C1Y A;  2Y3A A;  7ICE A;  1K53 A;  2KHV A;  4UAW A;  1MQ3 A;  3NOB A;  2I1J A;  3L3F X;  2Y5P A;  3SD5 A;  2KXJ A;  2R8I A;  1WXV A;  5HHI A;  1VJK A;  3BZD B;  2IBK A;  2L32 A;  1L4Z B;  1OW5 A;  1JWM D;  5J2A A;  3PW7 A;  2LYB A;  2GOW A;  3BQ7 A;  1D3Z A;  4Y2S A;  3M1Y A;  4Y2Q A;  1I4H A;  2C5L C;  2WXM A;  3N97 B;  2BDU A;  1Z3E B;  4Y2R A;  1HUZ A;  3AXC A;  1NOM A;  1OEY J;  2VJ5 A;  3C0R B;  1S0O A;  1WM3 A;  3T5K A;  5JUM A;  1TIF A;  3VR9 B;  1V2Y A;  1Y8R C;  4HCP B;  1IV8 A;  1EO6 A;  3M8S A;  4C4R A;  3RZW C;  4FHJ A;  1S5L U;  3K9O B;  5J2R A;  4C4T A;  5AI6 A;  2LXA A;  3RNA C;  3ZNG C;  3IT6 B;  1V49 A;  2GI9 A;  2ONQ A;  5J2E A;  3Q3M C;  2EMT A;  4FJY A;  3VTU A;  2VA2 A;  4TUR A;  4AP4 C;  1SJE D;  3TFR A;  2ZXI A;  3JPT A;  4EEK A;  3QZ8 A;  5H92 C;  4PGQ A;  1NBF C;  4XX5 A;  3HKZ C;  3ZD8 A;  1WGY A;  4F2R A;  4KN4 A;  3V05 A;  5ALR A;  2BQQ A;  1WGG A;  2RGF A;  4GIB A;  3QQ8 B;  3RJG A;  2HHV A;  1ZRN A;  4URK A;  3UGB B;  1L7P A;  1SZH A;  3TAD C;  2NRW A;  2WF5 A;  4YXJ A;  2BGW A;  4M9N A;  3N4M B;  1KFD A;  2JWU A;  4GDL A;  4MF2 A;  2HVI A;  1KKX A;  2OWO A;  1WM2 A;  2XGQ A;  4BZA A;  1FXT B;  2A1J B;  2C2R A;  1XD3 B;  4RGM A;  5KG6 A;  2XCA A;  3AE1 B;  4HJK A;  5AZF A;  4KV2 A;  1UEL A;  2EDU A;  2KSO B;  2LGY A;  2V4L A;  5KG0 A;  1U47 A;  2YN4 A;  1JRO A;  2ATL A;  1UGM A;  1FD6 A;  4FN2 A;  4PYZ A;  1CRX A;  2HBL A;  5ALL A;  2ON8 A;  4R3D A;  3APD A;  3JYU A;  2KTF A;  4F4Y A;  2DQN B;  4GXB A;  2KKP A;  4DQI A;  1LXD A;  1Z19 A;  4HPP A;  3ZGZ A;  3U2S C;  4YFK A;  2MHJ A;  4JV1 A;  3GS2 A;  3RYT A;  4KLE A;  4RNA A;  8ICZ A;  3ENE A;  2L1A A;  1Z1V A;  3NRZ A;  5FP0 A;  1YIW A;  1T4G A;  4PL1 A;  4I2J A;  1ZQB A;  1L3U A;  3OTQ A;  2JF5 A;  4A6Q A;  4JX1 C;  2MA9 B;  3RPF C;  4B9M A;  2KFK A;  3Q8L A;  2MLB A;  1XWL A;  3I57 A;  1E10 A;  1E6E B;  3PRE A;  3BQ2 A;  1NI2 A;  1BGX T;  4ED7 A;  2KN4 A;  4Z6F A;  2G45 B;  4K7U A;  4EEY A;  1QSL A;  4NV0 A;  4F5Q A;  1S10 A;  3DDH A;  5ALE A;  5J0Y A;  1JI7 A;  5G5G A;  4GSW A;  1CI4 A;  2JY6 A;  4DXA B;  1VZ8 A;  3F53 A;  8ICG A;  1ZXI A;  4IRC A;  3V6K A;  2JH1 A;  4YXM A;  2IGH A;  3P2B A;  2KAC A;  4BDP A;  3ZJV A;  4UW9 A;  1R4M B;  1WJU A;  2M8S A;  2CU1 A;  1RRB A;  1KH0 A;  2QIL A;  3Q69 A;  4LNF A;  3T8M A;  2RDG A;  4ED3 A;  4DQP A;  2KZZ A;  2FID A;  4U7C A;  1ACC A;  1WR1 A;  2E6X A;  3UPQ A;  1T0Q C;  4UQG A;  2KLG A;  1DOY A;  1PUZ A;  3MFG A;  5LNK 1;  2MSN A;  1WIA A;  2BPG A;  5DBB A;  4DSK A;  3MDA A;  3SFE B;  2IO3 B;  3IVF A;  5KT2 A;  5J0U A;  1FCC C;  2N9X A;  3P63 A;  1TY2 A;  3Q8R B;  3WKB A;  1L5P A;  4HYK A;  1WCL A;  2LXC A;  3KHR A;  4NM1 A;  4CYE A;  2KJH B;  4NLG A;  8ICI A;  1E8X A;  2D3A A;  4XUS A;  3E58 A;  3PHX B;  4HDO A;  5AM2 A;  2KP7 A;  3NUQ A;  2IOF A;  2QMT A;  5L1K A;  4QW9 A;  4DFK A;  5AM3 A;  3NVW A;  4RQ8 A;  4YTN B;  2IJ0 A;  2X8X X;  1EU3 A;  2D11 A;  4J9R A;  3MR5 A;  2W11 A;  4MEX A;  3RR7 A;  2ASQ A;  2J52 A;  2KWD A;  5AUK A;  3X23 A;  1YX6 B;  8ICV A;  4WIP A;  5DCN A;  4F2S A;  3SV3 A;  4IQV A;  4RNM A;  5E6O A;  3RBD A;  2I2Y A;  4K4I A;  4P0Q A;  2WXG A;  3AUL A;  3RI7 C;  4XQ8 A;  2K6Q A;  4KTQ A;  4UDU C;  4EYI B;  2N1V A;  3ZJT A;  4YSX B;  1O08 A;  2L76 A;  3SEB A;  1DOX A;  5AI5 A;  2OED A;  1T94 A;  5F3X B;  1ZQU A;  2B76 B;  2PXI A;  1YZ7 A;  2KDM A;  3C2K A;  4BFR A;  2GLS A;  4PT5 A;  2V4R A;  2HBJ A;  4DLG A;  2OYY A;  4GOC A;  3F5A A;  1GC6 A;  1CUK A;  1NNL A;  2KTR A;  1KJT A;  3J9C A;  3T5H A;  3ED5 A;  4I6P A;  3RR8 A;  4DFD A;  1CJE A;  4ZRQ A;  1ZGU B;  2GO7 A;  5D49 A;  5ALJ A;  1OFF A;  1QLN A;  4KLT A;  5AHX A;  5KFR A;  4RM9 A;  5C5J A;  5ALY A;  5EOZ A;  4WJP A;  1I35 A;  5CP2 A;  7ICN A;  3RNB C;  1D5M C;  4EOY A;  3CNH A;  1RM6 C;  2MBB B;  4IW0 A;  4QWE A;  1C20 A;  4WJQ A;  5KFY A;  3QYP A;  3TAD A;  3VH3 B;  2GH1 A;  1GNU A;  1FXA A;  2AX5 A;  1J7C A;  2WDV B;  4K7W A;  2ASJ A;  1L0X B;  4G3X B;  2JZ3 B;  5AKY A;  2VH2 A;  5ALM A;  1UZX B;  1P9D U;  4B9U A;  5HI1 A;  1PVP A;  1TS3 A;  1YN5 A;  4W9H A;  1ZQD A;  1WI0 A;  2MBE A;  2KO3 A;  4PGX A;  1L8L A;  4XZ4 A;  3DHH C;  3O13 A;  1ZQK A;  3M62 B;  3W1Y A;  3QIJ A;  4FJV B;  9ICO A;  1F1H A;  2JZZ A;  1XLN A;  3ETR A;  4RZR A;  3SEN A;  9ICH A;  2SEB D;  3F2B A;  3LDA A;  2O6V A;  5IA7 A;  4O3R A;  2FLL A;  3EFU A;  5HR7 A;  2OOB B;  1FMA D;  1QQR A;  1KSP A;  4US8 A;  2LMR A;  5EWE A;  3H4B A;  2BS2 B;  5IP4 D;  5J2G A;  3MGV A;  3I1Y A;  1PQS A;  5T14 A;  3DQV A;  3TQ1 A;  3CP8 A;  1EF1 A;  1FPY A;  5KG3 A;  2K8C A;  4BWM A;  1LFD A;  4J03 A;  2W9N A;  4I2H A;  4LK0 M;  5J17 A;  5H8Y E;  2INP E;  4RH6 A;  3GB1 A;  5AIA A;  5ALF A;  4M02 A;  4DL6 A;  3HWT A;  3C8Y A;  4HCN B;  4GXI A;  4MEY A;  1UBQ A;  3BVZ A;  4NJ6 A;  2HMX A;  1WXA A;  4KSK C;  4BX9 C;  3RT3 B;  2KVZ A;  5IIN A;  1VCB A;  7ICP A;  1DXS A;  1D9F A;  1J19 A;  1T6B X;  3FIL A;  1SSN A;  1XS9 D;  1NK0 A;  3Q8S B;  4DO9 A;  2MBQ A;  5KHO A;  4WUR A;  3TAQ A;  1XLO A;  3AE5 B;  1WFY A;  1S0V A;  2E1F A;  3T3N A;  1ZJN A;  2VH1 A;  4NM2 A;  1QCK A;  4F71 A;  4ELU A;  1YX5 B;  4MH0 E;  4I2B A;  4DQQ A;  5ALN A;  5DQH A;  5HMM A;  3KFU F;  2WXF A;  5ALI A;  3OJU A;  1V38 A;  4KSL C;  2N9K A;  3KLS X;  2ZXH A;  1GB4 A;  4PGY A;  1ZQS A;  4GMV A;  3VUW A;  4KMO B;  5ALV A;  4DF8 A;  2KMA A;  3LYY A;  4J6I A;  1VZ7 A;  2QAR A;  2LRU A;  3BS7 A;  2NV3 A;  2I5H A;  4DOB A;  4C8M A;  3QNM A;  3KWV A;  2NO5 A;  1Q1O A;  3M9M B;  3B1L X;  2XGP A;  1B1Z A;  1V6E A;  1YD8 U;  2LI5 A;  2LYH A;  1C1Y B;  2HSZ A;  1V81 A;  4U6P A;  2WU2 B;  3QAR A;  2PFQ A;  1JW9 D;  2K22 A;  2LZ6 A;  1RFK A;  4FUL A;  2ACZ B;  3IDW A;  1QOF A;  2D2Q A;  2D8C A;  2IBI B;  9ICL A;  2AGO A;  2FLN A;  3VRB B;  5DQG A;  4DL4 A;  8ICC A;  1E8Z A;  2FAZ A;  3NAS A;  4K4H A;  1C4C A;  3MC9 A;  4NY0 A;  2NTS A;  2I1Q A;  5KFP A;  2WX0 A;  3PGE A;  1ZW7 A;  2ALZ A;  2F77 X;  2V9W A;  1RQL A;  3RBE A;  4ECV A;  4GLS C;  4HAI A;  4IC7 B;  3M7D A;  2G0A A;  3V7L A;  3FDS A;  5EE1 A;  3OWE B;  5D46 A;  4NL9 A;  2AQ3 B;  2IGD A;  3E9S A;  3ZNH B;  4JUZ A;  2ZPN A;  3L17 A;  1PK1 B;  3PR5 B;  5D7G A;  5BYS A;  1NJW A;  3FKY A;  2KVS A;  3AN1 A;  2E1E A;  2CHW A;  3SEI A;  1EM7 A;  3PRP B;  3UQ0 A;  2ICI A;  4F4X A;  3RRH A;  3BQT A;  2XY7 A;  1BNO A;  1SWW A;  2JRI B;  1S97 A;  2EZX A;  3PLU A;  3QUB A;  1XO0 A;  3UF8 A;  1F2R I;  3J81 j;  1XSP A;  8ICU A;  3DVN V;  4M0W A;  4WAF A;  4N59 A;  2QAR B;  3A9J B;  2FNJ B;  2D3B A;  5BOM A;  4PS3 A;  1EXN A;  4DL5 A;  5C23 A;  1SWV A;  4P4M A;  3AEF B;  3B0A A;  4ZRK A;  3VRA B;  1QOG A;  1K52 A;  2WXQ A;  5CWR A;  1R4N I;  4NAM A;  5KT3 A;  4RF1 A;  1T3Q A;  1Q3U A;  4EEN A;  2ASD A;  1DOI A;  4DQR A;  1WXM A;  3W5U B;  1MA7 A;  3I3T B;  4F93 B;  5AIB A;  2QEJ C;  1P0R A;  3ICX A;  5KFF A;  2FPM A;  3NVY A;  9ICV A;  2WXK A;  1I4Q A;  3GE3 C;  3PW4 A;  4TMA B;  1EWC A;  3RH6 A;  4ZOH C;  2PTL A;  2LKY A;  5AKL A;  5KFL A;  2DF4 B;  2E8M A;  3JPP A;  3LVW A;  3PLV A;  3Q8Q B;  2KEY A;  1KRH A;  3JSV B;  2ZIU B;  1NYR A;  1MJD A;  4P1B C;  2JEF A;  3ZQ4 A;  2MU2 A;  4DSF A;  3V6E B;  4FZL A;  4UBB A;  3TIX A;  2AWT A;  3RNF C;  4I2G A;  4UB4 A;  4YMM A;  1M4V A;  2NR2 A;  2WQY B;  4XC2 A;  1URJ A;  5AI8 A;  2RP5 A;  4QWD A;  1KBU A;  2MUT A;  3ZUN A;  3B0Y A;  2AL3 A;  4DL7 A;  5IIM A;  3MFH A;  2NCN A;  4IR9 A;  3W2D A;  1Y88 A;  4UAT A;  4RGN A;  4QZ8 A;  4H2A A;  5CHV C;  4PHA A;  2IMW P;  2KZR A;  2MRL A;  2C2D A;  4O3M A;  1YN4 A;  3H8W A;  2MJ3 A;  2LHD A;  1PYW D;  2OJR A;  4Z6E A;  2H5X A;  2KE7 A;  3A4R A;  3TKA A;  2KWU B;  3ALR A;  4A8E A;  2ZIX B;  1N5X A;  3TEW A;  1DK3 A;  1EUV B;  2NRX A;  5JTI A;  5F9N A;  1MG8 A;  4MEM A;  7ICO A;  4ZYS A;  5C2T B;  2C28 A;  3JPN A;  2JRH A;  4LNO A;  8ICO A;  4XWT A;  2ODG A;  4NLB A;  3U7Z A;  2KJR A;  3ONN A;  4AQ7 A;  3N28 A;  3WK4 A;  2KZM A;  1IIP A;  2GB1 A;  4NLZ A;  2VA8 A;  2XK5 A;  4E71 A;  4YMN A;  4PK1 A;  3DEE A;  1NK9 A;  1Z00 A;  4EUT A;  4OZC A;  2BVC A;  2LVP A;  4RQ7 A;  3CIR B;  3H7S A;  2KFJ A;  4IL6 U;  3C29 A;  1WZ3 A;  1FNV A;  2BPS A;  2HJ1 A;  3R8B A;  3F5E A;  2C60 A;  2N1W A;  2RQ5 A;  3VR8 B;  1ZRM A;  2W7P A;  5DLF A;  2DPJ A;  5J8Y A;  3AE6 B;  3GIL A;  2ZIV A;  4DXG A;  2HHW A;  1YZ6 A;  4LNI A;  4N58 A;  3TI0 A;  1X2I A;  5ALT A;  4ICU A;  3BJY A;  4W9F A;  1L8O A;  4F7Z A;  4QZF A;  3GFK B;  1BXT A;  3RH4 A;  1SV4 A;  1MPE A;  2G09 A;  2DNF A;  4RPY A;  2HOF A;  3QUC A;  3ISB A;  4C4S A;  3KYC D;  1RWS A;  1YOV B;  2R8G A;  4AP9 A;  2D10 A;  4HRO A;  4JPS A;  2IPK D;  1A5R A;  4FBT A;  1Q0W B;  3TMP B;  4RNO A;  4JGH B;  2BYT A;  4J3O D;  5J2J A;  4CCH A;  1JN3 A;  4PL2 A;  3R3M A;  5AI0 A;  4EZ6 A;  4N9F 4;  1UH6 A;  1NI3 A;  5JU5 A;  1LM8 B;  2G5I B;  3HW8 A;  3KHH A;  2BF8 B;  2P35 A;  4O5E A;  4HWI B;  1S0N A;  8ICM A;  3FIL B;  3QEA Z;  2SAK A;  4MDK E;  1N62 A;  1ET6 A;  1ZD3 A;  5FR3 A;  1F77 A;  4OD0 A;  2DX5 B;  3QAQ A;  1E7P B;  2JU6 X;  3IG3 A;  2W7O A;  2DZK A;  2K5P A;  3VTW A;  4RQ1 A;  2J42 A;  3DV9 A;  4Y2J A;  2DUY A;  3PST A;  4MGZ E;  4EEL A;  4E74 A;  2OCE A;  4KMU A;  1FEZ A;  4IWP A;  4JWU C;  5HHH A;  3HJE A;  4CF4 A;  5KHQ A;  5KNI A;  1Z2M A;  3IBE A;  2K8H A;  3QU9 A;  3U4E G;  2IY1 B;  4M0A A;  3MTN B;  2XNA C;  2YVC A;  3L10 B;  2FJ6 A;  5D2M B;  3B0X A;  1J7B A;  3A0B U;  2B21 A;  4MM3 B;  9ICX A;  5GMV A;  3ZRC A;  3QX7 A;  2HCF A;  2N9L A;  4LCD E;  5KFQ A;  1Z4O A;  2JZP A;  7ICL A;  3GU3 A;  4KLG A;  2LJI A;  4Y2X A;  4DQO C;  1XF5 L;  2WXN A;  1GJZ A;  4R63 A;  3TEX A;  2B6G A;  1D5X C;  4C8K A;  1F9J A;  3D2S A;  1PVR A;  2J7Q B;  3LB8 C;  2C22 A;  4QW8 A;  1OQR A;  4B9L A;  2AGP A;  2MAX A;  4M9J A;  3C2M A;  1HE8 A;  3I9V 1;  2K4H A;  1PDX A;  1U48 A;  1OEY A;  2BB6 A;  1KEJ A;  5KFN A;  5GTI U;  1ZQJ A;  1LKY A;  4NQL B;  3AUO A;  2XCP A;  4NY8 A;  3RJE A;  4JIO U;  2LI6 A;  3KBB A;  1CQV A;  3QWZ B;  4IWQ A;  4BOZ B;  1S8O A;  5ALD A;  1DOQ A;  4BAX A;  1RPL A;  4HK2 A;  4RM8 A;  5HFY A;  2NYV A;  3HKZ F;  2VA3 A;  2I38 A;  5BYR A;  3OHA A;  4MJS A;  1S0M A;  2KQ7 A;  3RNE C;  2CXY A;  1GC7 A;  2HTM E;  1Q46 A;  7ICS A;  1T0R C;  1N6Z A;  2K0P A;  3ZRF A;  9ICG A;  2L52 A;  1F44 A;  1K51 A;  3E2E A;  2ZVN A;  3T79 A;  3NUH B;  5ALZ A;  4ECR A;  4QAY A;  5CHG A;  1B43 A;  4KVG B;  9ICN A;  2KJ9 A;  4K3C A;  5JXV A;  5DDY A;  2L3Z A;  4DFJ A;  1NKC A;  3AH7 A;  4IKG A;  4NLC A;  3IHP C;  1UWX A;  2K6D B;  4WWN A;  2LHE A;  1IUE A;  1P3Q U;  2R2O A;  4BKT A;  3H8M A;  4S0R A;  2I6X A;  3HRD D;  4GIV A;  3LK9 A;  2IOF K;  1ZQX A;  4EFO A;  4EX7 A;  2UVV A;  1MQ2 A;  4AOF A;  2OXO A;  1E8W A;  2V9H A;  5DB8 A;  2HD5 B;  2WHE A;  3ALB A;  4Z6C A;  1T8E A;  2WF7 A;  1XT9 B;  1MSW D;  5L1M A;  1ZQQ A;  5J29 A;  1YQB A;  4GLX A;  3PZ7 A;  2JVC A;  4Q8F A;  2AJQ A;  4AS1 A;  1NJX A;  4GDK A;  5DPS A;  1ZQG A;  1WJN A;  5KFS A;  4HEA 1;  5AM4 A;  2MX2 A;  3V6C B;  1P7D A;  4GFJ A;  4F72 A;  5J0W A;  2BDP A;  2HOI A;  4I2C A;  3EYZ A;  2LWP A;  3PRZ A;  5AKG A;  3VAW A;  2NVU I;  4A90 A;  1BPB A;  3OJS A;  2FUG 1;  2H3F A;  1ZQR A;  2E5S A;  3P4R B;  2LJ5 A;  3M9O B;  1K5O A;  1SL0 A;  3PTF C;  1ZOY B;  1I42 A;  2LUE A;  2CPR A;  4DCC A;  5KFG A;  4C80 A;  5CA7 A;  1FNU A;  1WWT A;  4RQN A;  3FM9 A;  4ANU A;  2VKQ A;  3W1S C;  3M6Z A;  3CW2 C;  2VZK D;  1U4A A;  1L7Y A;  3SAG A;  2AH5 A;  3KHL A;  2BB5 A;  2AQ2 B;  5IN7 A;  3OHB A;  2QB0 B;  4ELV A;  2WDR B;  4DOC A;  3H40 A;  1L6N A;  3NVV A;  1L0Y B;  1D6E C;  2DEN B;  2IO1 B;  4EBD A;  5CX3 A;  4YT0 B;  5EE9 A;  1WRI A;  4B9K A;  2PMZ C;  5K4L A;  1UGJ A;  3L13 A;  5TSS A;  4KLF A;  3H1U A;  3AE2 B;  4BKS D;  4ELT A;  2FE8 A;  4PYU A;  5AK3 A;  2YB1 A;  2TSS A;  3CF6 E;  4ZRJ A;  1ZXH A;  2H89 B;  1TS5 A;  2B0C A;  4QZD A;  1SXT A;  1XCQ L;  1IGC A;  2P6U A;  3RTV A;  3KZX A;  4BJQ A;  1OTR B;  1XO1 A;  5BMH A;  3CRX A;  4YVZ A;  3VC8 A;  3P1M A;  3ZDT A;  1B0X A;  1FNW A;  3H8J A;  1WWU A;  1ZDX A;  4XRH A;  2MRP A;  2YX8 A;  5J0S A;  2Q5W D;  4KIT B;  4BBN F;  3PR4 A;  2KC1 A;  2LVO A;  1OGW A;  2JR5 A;  3D32 A;  2FMP A;  5ALP A;  1Z00 B;  2LM1 A;  1QH9 A;  2CS4 A;  3GDX A;  4P0P B;  2DAF A;  3I5J C;  4WWM A;  1SE2 A;  9ICS A;  2KQ4 X;  5LXI B;  1KLU D;  3AE7 B;  1R7S A;  9ICM A;  3SMV A;  2I1K A;  4NLN A;  2G07 A;  3ZDE A;  3F2D A;  1KL9 A;  2VAN A;  2XY6 A;  1L3S A;  2PI5 A;  2CU3 A;  3T3F A;  3RB6 A;  2YEP F;  4B9T A;  2PJH A;  3A1Q B;  1XEE A;  4ECT A;  3DWM A;  1KFT A;  4IS7 A;  3BK1 A;  2BWF A;  4JV2 A;  2LMC A;  4YMO A;  3PW0 A;  3ZDC A;  2REX A;  1SL2 A;  3BVG A;  2WP9 B;  2AHO B;  3RJI A;  2W9C A;  4KLI A;  1D8B A;  3PHW B;  2AQ1 B;  4K3B A;  2MQJ A;  1TAU A;  2J0M A;  4JLC A;  2EKI A;  4JMU A;  3URY A;  4NJ8 A;  2L05 A;  3GII A;  3APC A;  3RH5 A;  4XYC A;  4G9B A;  2W9C B;  4KKJ A;  4I2E A;  4IRK A;  4M9G A;  3N1Z C;  2EH9 A;  3FAH A;  1VDV A;  4FS2 A;  2O2V A;  3PSI A;  1FFV A;  4JK1 A;  1BPX A;  2YMM A;  2ZJA A;  4C4V A;  2ZIU A;  1FM0 D;  2FUH B;  3IFW B;  3LDZ E;  1IYF A;  4YR3 A;  4WJO A;  5DDM A;  4RQ5 A;  4ECX A;  3NG0 A;  2V3N A;  3U8Z A;  5TIS U;  3PX6 A;  8ICJ A;  4A20 A;  4L1B A;  1GOZ A;  2V4Q A;  5BMI A;  2N7J A;  2OM6 A;  2EKE C;  1JXE A;  4OJ6 A;  4ED2 A;  3DHI C;  3K9P B;  2QIE B;  2XEW A;  5KFZ A;  2RDI A;  2BCQ A;  3ZJU A;  1QIL A;  1JAL A;  1HZ5 A;  4F92 B;  8ICQ A;  4C7Y A;  3NZS A;  1GAQ B;  2L5Y A;  3BQ1 A;  2WFA A;  3C21 A;  3BIN A;  1KDH A;  4YD2 A;  2XID A;  9ICJ A;  2KNB A;  5CR0 A;  1QF6 A;  3K75 D;  3AB5 A;  2WXP A;  3MC0 B;  4O3Q A;  4GXJ A;  2K8C B;  2JRZ A;  3H7P A;  5AKI A;  2INN E;  3L0W B;  3OLM D;  1QOB A;  4P6V F;  1VZ6 A;  4KX3 A;  3OPX A;  2RDH A;  2P6R A;  3AV8 A;  1H4R A;  3SI8 A;  4MT5 A;  1HQR D;  2WHI A;  1Z1B A;  1FRR A;  2BQR A;  2QC8 A;  3GV8 B;  4LLG M;  4B6J A;  4K1R B;  1QSY A;  4ANW A;  3BZK A;  2M0N A;  1UQV A;  1MHX A;  3C19 A;  1C7Y A;  3AM9 A;  1KFY B;  4M47 A;  2AEH A;  2JXX A;  5AZH A;  1SJH D;  4RUC A;  2KOB A;  3RRG A;  1TVA A;  1TJE A;  3MP9 A;  1IM4 A;  4ECU A;  4JWN A;  4C8L A;  4AWJ A;  7ICI A;  3TBL D;  5IIJ A;  3G6X A;  2ZW0 A;  1UBI A;  4MSQ B;  4P4O A;  4KLD A;  2ZG6 A;  4NJ7 A;  2NBV B;  1WGH A;  1LKY B;  2UVU A;  4W9I A;  2A3V A;  3QK0 A;  4F4K A;  4RT3 A;  2JT4 B;  3W9C B;  1ZD5 A;  3JSV A;  2VRR B;  2Y0S C;  3DBL I;  4DHZ E;  1COK A;  2MEK A;  2H3Z A;  4GC7 A;  4G3I A;  1F0Z A;  1X1M A;  3L08 A;  2Y1J A;  2GBN A;  2C2E A;  4ARI A;  4Q45 A;  4EZ9 A;  4O9M A;  2D07 B;  2WGS A;  4DSE A;  4C0Z A;  3IN5 A;  1SZP A;  4AYB C;  5DBA A;  1QLB B;  1K50 A;  1LVH A;  2M9N A;  4C8O A;  4P2H A;  4WQO B;  4RCO A;  5AUI A;  2Q0Z X;  4XGA B;  4M6W A;  5J2F A;  4B0M A;  3OSN A;  7ICH A;  2IZV B;  2YB4 A;  5ALO A;  2ZUD A;  2OJW A;  4YTP B;  4C8N A;  3O0F A;  2PIA A;  3NZU A;  1D5Z C;  3EUB 2;  1NK7 A;  2O6V B;  1ZKH A;  3BY4 B;  4IC9 A;  4DFP A;  3PW5 A;  3N9Y C;  5KG7 A;  4B9S A;  1CK1 A;  1C4P A;  3KD3 A;  7ICQ A;  3EA6 A;  5HNK A;  1VLB A;  5KFJ A;  8ICT A;  4KIK B;  4DL2 A;  4ARC A;  4B95 A;  4DHJ D;  2KMD A;  4F5O A;  4QNL A;  3U26 A;  4FFD A;  2G3Q B;  1T0Y A;  2XBB C;  3JPS A;  4ECW A;  4ASW C;  1QQ6 A;  4PZO A;  1YMH E;  1J0G A;  4UAV A;  3TAR A;  5III A;  3ZTD A;  1I4R A;  1IBX A;  3C5G A;  1D8Y A;  5KFD A;  5LLI A;  3KVF B;  3RN9 C;  2YMP A;  3EC8 A;  3TAN A;  2V0G A;  4Y2T A;  1ZQP A;  3RAX A;  3AE9 B;  4DFM A;  2BCU A;  2KWV B;  1KRP A;  4KZC A;  2BS4 B;  2ISP A;  3ZIM A;  2KD1 A;  3N1Y C;  3CYM A;  3Q8E A;  2KT7 A;  1V85 A;  2FDR A;  1F52 A;  1O03 A;  4J9P A;  3MC8 A;  4F8C B;  3MDC A;  3L54 A;  4KKI A;  2WX1 A;  2CN1 A;  4XWW A;  5KT6 A;  4O3P A;  3JPO A;  2YML A;  1TTN A;  2WDT B;  2GWS A;  1ZQY A;  1MFW A;  2BW2 A;  2MA1 A;  4YR2 A;  3B08 A;  4RPZ A;  9ICC A;  4YG2 A;  2K89 A;  3DVG Y;  3WAM A;  2WB1 C;  4KDL B;  2KDI A;  1FEH A;  4F5R A;  2KHQ A;  1B4F A;  1JWB D;  1SF0 A;  4L2Y A;  2AYO B;  5J0P A;  3DVN U;  2WS3 B;  1T7P A;  2HHT A;  4LJX A;  1ZQT A;  2KN5 A;  3RMK C;  4QWA A;  1UA0 A;  3ZD9 A;  2G4D B;  3T5L A;  1OQQ A;  1L7N A;  2XVT A;  3JVZ X;  4PZN A;  1WXS A;  3KUC B;  4ED1 A;  5KFV A;  2J4X A;  2HBK A;  1X6I A;  5AK4 A;  2XO7 A;  2MCN B;  2F76 X;  3JW0 X;  1WSP A;  1NJY A;  9ICE A;  2ZCB A;  2IO2 B;  5AM1 A;  2CRX A;  5AI9 A;  1C3T A;  2RMM A;  1N48 A;  1NYQ A;  5J0R A;  3PS6 A;  4PHP A;  3BVM A;  1AW7 A;  1YNT E;  1FRD A;  4ZHO A;  2A5U A;  1ZQV A;  2EQY A;  3V60 A;  2E8N A;  1A77 A;  2ASL A;  1RDF A;  1P7E A;  1U9L A;  1ZQ1 C;  4PS7 A;  2L00 B;  3QC8 B;  3RUL A;  2EAM A;  1V5T A;  4LJP B;  5EE0 A;  1FXI A;  4O0I A;  3SYZ A;  2Y5B B;  3HX0 A;  5KFE A;  2RLT A;  5F9L A;  2CJN A;  1LB2 B;  3NS1 A;  4YL8 A;  4KLL A;  4KGS A;  3Q3F A;  1ZET A;  2J6U A;  3T3O A;  3HHM A;  3Q2A C;  2IGG A;  5KFW A;  4DSL A;  1PGB A;  3RF9 A;  4BUG A;  2GRI A;  2WU5 B;  2DAJ A;  2N1R A;  4E3C A;  3FC4 A;  3C23 A;  3PPA A;  1N60 A;  1ZP0 B;  3QU4 A;  4Y2Y A;  7ICR A;  2JX5 A;  1IPG A;  3SDL C;  3V72 A;  3CWI A;  2UVR A;  3PSF A;  5ALS A;  1ZQO A;  5CTR C;  2JQR B;  3H4D A;  2K4P A;  5L1L A;  8ICB A;  3I63 C;  3BZC A;  2RR9 A;  1L5U A;  4RQ6 A;  4CRX A;  8ICL A;  1TE2 A;  4F5N A;  1HZ6 A;  4TQS A;  4J9N A;  2XIC A;  2R2Q A;  3GOE A;  1NVI D;  3JPR A;  1V1O A;  2J53 A;  2WB1 F;  5KFA A;  4ED0 A;  1MVK A;  2AGQ A;  2W8L A;  4QZ9 A;  1XC9 A;  3H8S A;  4WJ3 B;  4OW0 A;  1SEB D;  3IT4 B;  4IUM B;  4W9D A;  4I2A A;  3A9K B;  1NJZ A;  3AL0 B;  1I4G A;  4O5K A;  4HJG E;  1WWV A;  3M6K A;  5L9X A;  1KLG D;  1I4X A;  3PSE B;  3EGR A;  5DGA A;  5KAF U;  2RRD A;  4QZH A;  1E7U A;  2K4E A;  1D4B A;  4EZK A;  1RG6 A;  4OO1 J;  3VXW A;  1F0M A;  4MF8 A;  1ZD4 A;  2RPQ A;  2WXO A;  5AK5 A;  1GB1 A;  3AU6 A;  4AUQ C;  1CMX B;  4MFC A;  9ICQ A;  1KN5 A;  1KF6 B;  3DHG C;  3M63 B;  2J0J A;  2M1M A;  1TYG B;  3NZ3 A;  3Q6B A;  3P4Q B;  4W9E A;  4P4P A;  4YWG G;  4NPN A;  3RJH A;  4AJY B;  4REZ A;  3ONS A;  9ICA A;  5FR6 A;  4LTU A;  1YQ4 B;  3SAH A;  3ISC A;  2BWE S;  2HOQ A;  2ZJ5 A;  8ICN A;  4ANX A;  3WAO A;  3VDZ A;  2KJ8 A;  4OJ5 A;  3QA8 A;  1CZP A;  1NEN B;  4CHK A;  3H0M B;  2AQ0 A;  2D3G A;  3EWA A;  5L1J A;  3LJ3 A;  8ICK A;  2HE7 A;  5D3I B;  2KZ3 A;  4A55 A;  8ICW A;  2LPE A;  4IQT A;  4FBU A;  9ICR A;  4FZM A;  5C0Y A;  2N7E A;  4GDK B;  4C7Z A;  3OJ4 B;  4OCZ A;  4W9K A;  2KIC A;  2ZJ8 A;  1WMH A;  4TUS A;  2DZI A;  8ICX A;  2ESE A;  2CJO A;  4DLE A;  3AMZ A;  4P0Q B;  2JH7 A;  2KSO A;  1J7A A;  2HW3 A;  4F91 B;  5AKE A;  4HVB A;  2KNJ A;  1COO A;  1RXV A;  1JWU D;  3UI3 A;  1QQ7 A;  3P42 A;  1A76 A;  1WYW B;  2J6S A;  2WF8 A;  5J2D A;  2YTU A;  3UM9 A;  2LGX A;  3TEY A;  4EX6 A;  1RYR A;  4WQM A;  3RJJ A;  3IXS A;  2JEI A;  5AM5 A;  2RPV A;  1U49 A;  3IG8 A;  2Y5C A;  3N7S C;  2W8K A;  2KWC A;  5J8Y C;  4QJF B;  3MFI A;  8ICH A;  4DHJ B;  2ZIW B;  1AWD A;  3RZF A;  2ISO A;  1M94 A;  3QXG A;  1TT5 B;  4BBN C;  3TAC B;  2KN7 A;  3C2L A;  7ICF A;  1PGA A;  4LDT B;  4BXO B;  3W1S A;  1IP9 A;  4A3P A;  3R9K A;  4PH5 A;  4EKU A;  1TGZ B;  2MJD A;  4FHK A;  1WRD B;  3PVL A;  1V1P A;  3UIO B;  3ZVV A;  3SV4 A;  8ICF A;  1N56 A;  3KUZ A;  1WX9 A;  3ISD A;  2L7R A;  4K4G A;  2GBR A;  4ZDV A;  5KL1 B;  3UMC A;  1WJ6 A;  2MP2 B;  4KGR A;  3DDC B;  2C7H A;  4RU9 A;  4OVZ A;  2O6V D;  5DPR A;  2LD9 A;  4R8U A;  3NY5 A;  4QIW F;  3HPO A;  2BGF A;  3Q8B A;  4KDI C;  3WKE A;  1UHU A;  2YLM A;  4EBC A;  3KWL A;  1S77 D;  2MBO A;  3V7K A;  2EZZ A;  3E0F A;  2YQE A;  4QZB A;  4DF4 A;  2Z59 B;  4XDD A;  4KLH A;  1EU4 A;  3APF A;  2N7D A;  3P4S B;  3IM1 A;  1ZQH A;  2CHX A;  3N3K B;  1ENF A;  3SZ2 A;  3QHT A;  1FFU A;  2MUT B;  1PK1 A;  2BKE A;  1R4N B;  5J2I A;  3KH0 A;  4MHV A;  3L4P A;  3PML A;  4R65 A;  5LXH A;  1SXE A;  2K8B B;  1D9D A;  3IP4 B;  1N61 A;  2LGD A;  1RYU A;  5B66 U;  8ICP A;  2KIW A;  3PSP A;  3Q8A A;  2KVR A;  2LFI A;  3GV7 B;  3EPI A;  4R8U B;  2N9E B;  1KW4 A;  2YEP B;  3E56 A;  5CEH A;  3N30 A;  3O65 B;  1C79 A;  2KAJ A;  2NMQ A;  2KAN A;  3OSP A;  3ZDA A;  2NRT A;  2ZZP B;  2BCR A;  5JH5 C;  4CQN A;  4KN7 A;  1UA1 A;  2M0A A;  2KFN A;  2NS5 A;  2QJL A;  4Q44 A;  1DYQ A;  1VD2 A;  2BYV E;  1TZ1 A;  4MH8 A;  3NS8 A;  3MHS D;  1OUQ A;  1TV9 A;  4J9O A;  4BOS C;  3HIZ A;  4CGZ A;  1QOA A;  3A1Q A;  1UF0 A;  4HRS A;  5KL8 B;  3A0H U;  3MGI A;  2O6K A;  3ZDD A;  3WK6 A;  4MEL A;  3DVG X;  3BQ0 A;  1WUD A;  3AU2 A;  4FBJ B;  9ICK A;  3KZI U;  5IIK A;  2WAQ C;  4ED6 A;  7ICU A;  1SV0 A;  1TK5 A;  3EHV A;  2KKC A;  2V3S A;  4IDI A;  4D2K A;  4LZG A;  1JWS D;  2BYE A;  4QZE A;  2HVH A;  3PMN A;  3Q8P B;  1KM7 A;  2ZEQ A;  4ECZ A;  1V9P A;  2FCQ A;  1HA5 A;  3MC1 A;  3HVZ A;  5E6N A;  2G9H D;  4ACF A;  2F8L A;  3SHQ A;  2ZTD A;  2V1Y A;  4UAR A;  5ALG A;  1FCL A;  2F44 A;  2KMC A;  1C4A A;  3VTV A;  2BPF A;  3S6J A;  1E0Z A;  3M3J A;  2EEL A;  3WAN A;  3KUD B;  4BGD A;  5DLG A;  2FIF A;  2R18 A;  1BPZ A;  4HDQ A;  1EWY C;  1XO3 A;  3EW9 A;  2JGA A;  2MJE A;  2G06 A;  5J2H A;  3A4S C;  4RGT A;  1V1P B;  1LGR A;  1WY8 A;  4HKZ E;  4KLO A;  1L3V A;  1PK3 A;  3UMB A;  3KQ4 A;  3HVD A;  4OVV A;  4MJS B;  1NKE A;  1YT3 A;  1X66 A;  3CST A;  2WTF A;  5IAA C;  5EE3 A;  3AQE A;  2V4I B;  4F1S A;  4YD1 A;  2PI4 A;  3QEB Z;  4QZC A;  3OGU A;  1ZUD 2;  2W9M A;  2BBC A;  2C7M B;  2IDY A;  4MFA A;  3DBH I;  4EE2 A;  2WWZ A;  1B22 A;  1OQY A;  5J0X A;  1FIQ A;  3H0R B;  2M0X A;  1UWM A;  1NK5 A;  3TUO A;  4YXD B;  1H8C A;  3OAW A;  5KFO A;  3WA0 A;  1BVS A;  4BKG A;  2BR0 A;  2PFO A;  1NZP A;  1ZQF A;  4FLH A;  4NNJ B;  4TQ0 A;  1TKE A;  1YN3 A;  3PW2 A;  1RYJ A;  4OZB A;  4BXO A;  1K1Q A;  2HI0 A;  2ZPY A;  2H88 B;  4MFF A;  2HDO A;  1NK4 A;  1K8R B;  3QU7 A;  4US9 A;  4RMA A;  3CSF A;  2VIX A;  1KFS A;  2R8K A;  2MBH A;  2PE9 A;  5FKA C;  2WXJ A;  1JQ4 A;  5G55 A;  1YJ1 A;  1ZD2 P;  4MGI E;  1A0P A;  2NRZ A;  4PHD A;  2GBK A;  3PVX A;  3AEC B;  3EFC A;  4F3O A;  3QUT A;  3ZNI D;  3THV A;  1NDD A;  3C5F A;  2XI9 A;  4ECY A;  1S3S G;  3KTQ A;  4CDG A;  4II3 B;  5DG8 A;  2AQ4 A;  2KLC A;  3N20 C;  4G11 A;  3PT2 B;  2M19 A;  3PV8 A;  2PKE A;  3VH4 B;  1LO5 D;  2PFP A;  4RF0 A;  1E90 A;  3BYY B;  2KDF B;  4B6W A;  1V97 A;  5DBC A;  3RD2 A;  3RNG C;  2HHX A;  4DWI A;  2Z0E B;  4GB9 A;  2AL6 A;  2KMM A;  3QJZ A;  2XK5 B;  2KKV A;  2AU0 A;  1BPY A;  3AEA B;  4O3O A;  3V61 A;  1XNS A;  5JHB A;  1RLF A;  2W3R A;  1MC8 A;  1BUI C;  1NK8 A;  5J2C A;  2G4S A;  5BOL A;  3FYH A;  4PHE A;  1HEZ E;  3RJF A;  1J97 A;  1E8Y A;  2EAP A;  3V7J A;  5EDS A;  3QCA A;  3I28 A;  5KT7 A;  4TUQ A;  4C56 C;  1I7H A;  1L4D B;  4IG7 B;  1KLN A;  1WG8 A;  5AK6 A;  3KOO A;  2ZUB A;  2BYF A;  1DGS A;  1MHH E;  4RQ3 A;  3TL5 A;  4QIW C;  5DG7 A;  4Q8E A;  2K25 A;  2D6F C;  3Q14 C;  4LZD A;  5J0Q A;  1I4P A;  1SIJ A;  1ZQA A;  4II2 B;  1C76 A;  2E8P A;  2V3P A;  4P16 A;  3PY8 A;  2L0F A;  2QHO A;  1XQQ A;  2PKO A;  3I76 A;  1TFR A;  1NKB A;  2Z7J A;  1SV0 C;  1ED1 A;  2PLP A;  3PZP A;  3U30 A;  3GIK A;  5EWG A;  4WAA A;  8ICE A;  3MHZ A;  5D6J B;  4DOA A;  1DGJ A;  2W82 A;  2J6T A;  1PZN A;  2G08 A;  5ALH A;  5E6J A;  1N2X A;  1PGX A;  2XC9 A;  1JCK B;  2KD0 A;  2IO0 B;  3RNC C;  1QTM A;  3M95 A;  2DPI A;  4M2Y A;  3G6V A;  2BZF A;  2LGI A;  3QE9 Y;  1JML A;  1X9M A;  5DKW A;  1AAR A;  3H6N A;  1BNP A;  1S1Q B;  3AE3 B;  2N4F A;  2K60 A;  4IWO A;  3ZTC A;  2QKQ A;  2ZW1 A;  4P7I A;  3NJT A;  3KHG A;  3GP7 A;  2BCV A;  2JMG A;  2QB1 A;  4O3S A;  2F1H A;  7ICK A;  3Q3O C;  2LHT A;  1VRA B;  2F1J A;  5KFI A;  1WMH B;  3BDP A;  4KZ0 A;  4EZJ A;  4M6W B;  1L3T A;  2EMS A;  2JPH A;  3WU2 U;  3HP6 A;  4KLS A;  1RFA A;  3IV6 A;  2NBW B;  4M8M A;  4WWP A;  3AEV A;  3MR3 A;  4UBC A;  1IG6 A;  4JB3 A;  3R7Q A;  2KK0 A;  5AKK A;  5DQI A;  3HM6 X;  3Q3J A;  2ZJD A;  3V62 A;  2MH7 A;  3QU5 A;  2BPC A;  5KTQ A;  1H38 A;  2OHF A;  5HP4 A;  2FE9 A;  4TQR A;  2CKH B;  2WXI A;  2ZNV B;  9ICB A;  4FO6 A;  4HXD A;  2BTE A;  5GXG B;  5BMG A;  4IOI E;  5DPT A;  4ZH4 A;  3S2A A;  3PX0 A;  2RD0 A;  4NLK A;  1ZQL A;  2RDJ A;  2BS3 B;  2WLB A;  2ZIX A;  5KG2 A;  4KLM A;  1L6U A;  1ECW A;  7ICT A;  7ICJ A;  2QSD A;  3V6H A;  1R4M I;  4NXZ A;  4E0D A;  5KFU A;  3JPQ A;  1HEK A;  1XLP A;  3RB4 A;  1T5X D;  4LVS A;  2N9P C;  3PV1 A;  4LDT D;  3BK2 A;  2JXJ A;  4M01 A;  5I4D A;  4IR1 A;  1WX7 A;  2LBO A;  2WYQ A;  4QZI A;  2G5H B;  3UQA A;  4TUU A;  2M17 A;  4DL3 A;  1V9J A;  3MR6 A;  3Q8C A;  5H2F U;  4QWC A;  3V6J A;  9ICF A;  3IG5 A;  3DPD A;  2DYO A;  2KQS A;  2OH2 A;  5G2N A;  1P98 A;  3ZO5 B;  3VUY A;  1WE7 A;  4FZN A;  3K1Z A;  1JIH A;  5CB1 A;  1Z4N A;  3N1X C;  2FPL A;  1WYG A;  4OJO A;  5KT4 A;  3C28 A;  4M9H A;  2LUM A;  2AXT U;  3NHE B;  2K3U A;  2B3A A;  3ZKJ C;  3KKA A;  3K1R B;  1XCT L;  4QZA A;  2M56 B;  3U52 E;  1J2M A;  3UXN A;  4PPX A;  2IY0 B;  1SGG A;  5AKZ A;  1KQQ A;  4YR0 A;  3N7P D;  5J2B A;  4KLU A;  4RPX A;  3R2T A;  2KDE B;  4ZRP A;  5HML A;  2FPK A;  4GC6 A;  1SIF A;  4WH4 A;  3K4G A;  3A9J A;  1NEK B;  2KFK B;  4M04 A;  3KYD D;  4KLJ A;  2HHU A;  1TY0 A;  5JHA A;  2UYZ B;  3T9L A;  2J0K A;  1PVQ A;  4FXC A;  4NWI A;  4C00 A;  1A6S A;  3MGH A;  1XLQ A;  1SKR A;  2HJ8 A;  4B0E A;  3Q8M A;  1G6J A;  1TS2 A;  5AKX A;  4ITK A;  4I27 A;  3HIL A;  5GTH U;  4RT2 A;  3DBL B;  5ALW A;  3KW5 B;  1JWA D;  4F4Z A;  1ARO P;  2Q4T A;  5TR5 A;  4NQK E;  1M6Y A;  1WCN A;  3GV5 B;  1IGD A;  2JWZ A;  4GDL B;  2L8J A;  2ZNV C;  2K4I A;  4YN4 A;  2W9B B;  2GLE A;  4L23 A;  3LXF A;  2PPH A;  5IO9 A;  3AED B;  1WGD A;  4O3N A;  2ZIV B;  5BPC A;  3TFS A;  1F2R C;  3WKC A;  1QZE A;  2DYM A;  1QQ5 A;  3ZDM C;  5JZE B;  1L7O A;  1ZQC A;  3A9K A;  3AI5 A;  3F2C A;  1GG3 A;  3W5V B;  4CO7 A;  3TEZ A;  3DBR B;  2IA6 A;  3ZXV A;  5AKH A;  1J2N A;  3ML9 A;  4JE3 B;  4AJW A;  4DS4 A;  4J9M A;  4B9N A;  2JZB A;  5EWF A;  4IM3 A;  2BKR B;  1WZ0 A;  3LYS A;  2PMV A;  4RQ2 A;  2ZTE A;  2PVO D;  1N5W A;  5KG1 A;  2K8B A;  5E6P A;  1ISN A;  4LJO B;  2NBU A;  2HTH A;  2DGZ A;  4B9V A;  2QDF A;  3GZF A;  5DB6 A;  2IYD B;  5B5E U;  2K1F A;  3PO5 A;  3ZI4 A;  3D6J A;  5KFK A;  1UPH A;  1ZPS A;  4JWS C;  4Y2P A;  4AYB F;  2A4Z A;  2FI1 A;  1MG4 A;  3RUI B;  2GBJ A;  2DKZ A;  4CF5 A;  1Y56 A;  4GXK A;  3TJP A;  2E3T A;  1BT0 A;  2EAN A;  2UU7 A;  4KX5 A;  2XY5 A;  3PNC A;  4PJ0 U;  3EPG A;  2INC C;  4MSM B;  3NRW A;  4UB3 A;  2HHS A;  3T5J A;  4YP3 A;  2PW9 A;  3ORY A;  4IM0 A;  2KVC A;  2R8J A;  5HG2 A;  5CHF A;  2KIV A;  5ALU A;  4ZRI A;  5MPO A;  1SBB B;  2MP2 A;  5IOI A;  5DB7 A;  3NGD A;  2JSV X;  2KV2 A;  2IHM A;  1T0S C;  4KX6 B;  1V5O A;  2FCN A;  2WXR A;  1AQ6 A;  1HXY D;  3ZLZ A;  1SXD A;  4DSI A;  2ES6 A;  4DDI D;  1KOT A;  5HHD G;  1JXL A;  3IRU A;  4NAW A;  4R66 A;  4Z6D A;  3D2N A;  1ROE A;  3N32 A;  2NPT A;  4RFB A;  2RHF A;  3Q8K A;  3RFZ B;  4ICA A;  5KAI U;  5J0O A;  2QLT A;  1HTO A;  2I9G A;  2HDE A;  5G5H A;  1X40 A;  2DBY A;  3ETL A;  4YSZ B;  5IKC M;  2LAS A;  1E9M A;  1V86 A;  4ZYN A;  4CNQ A;  3UIP B;  4LNN A;  5DPW A;  3VUX A;  5ALQ A;  2LGS A;  2NRV A;  5AIC A;  2GBM A;  2FMQ A;  2CHZ A;  2C7N B;  3TCA A;  3PX4 A;  3N7R C;  3A33 B;  4UAY A;  1XU4 A;  1RZT A;  2W43 A;  5KG4 A;  5IIO A;  3B9J A;  3NVZ A;  3BS5 B;  4A3O A;  1HJP A;  2Y9T A;  4I2I A;  1UT5 A;  1Q10 A;  2FLP A;  2LRW A;  1Q8K A;  2BQ3 A;  1L7M A;  9ICP A;  2LVQ A;  5D94 A;  4ZHP A;  1P1A A;  1NK6 A;  2H3Q A;  2O2V B;  3PZD A;  1VJ5 A;  1E5W A;  2OEH A;  4JQW C;  1RYS A;  3H9D A;  4F5P A;  2IHN A;  2WNM A;  3QX1 A;  1YQ3 B;  1TKY A;  2BKF A;  5HKH A;  4HLE A;  2JXT A;  4NAW B;  2Z8L A;  2JHD A;  1SKW A;  2ZTC A;  4I29 A;  5KFX A;  4J9Q A;  4RGO S;  3G6Y A;  1C9F A;  3UQ2 A;  4USA A;  2KX0 A;  4OJP A;  1C78 A;  4EYH B;  4PS8 A;  4XDC A;  2IOH A;  4UB5 A;  2CR5 A;  2W3S A;  4FA6 A;  1ZE3 D;  1ZYQ A;  4ECS A;  1LV5 A;  2W9B A;  3LWL A;  1MN8 A;  2F3N A;  2KFZ A;  3WAL A;  1L2N A;  1XSN A;  1VR9 A;  4TV3 A;  2JEJ A;  2FCS A;  1SE9 A;  5DGB A;  1NZB A;  1UCV A;  2NPT B;  4IQU A;  2D3D A;  2QB0 A;  5DG9 A;  8ICY A;  8ICS A;  4HPL B;  4W9J A;  2YY6 A;  3IHQ B;  5ALX A;  2KYW A;  3UMG A;  3H7P B;  3WKA A;  5JRT A;  1AN8 A;  4YTM B;  4ICV A;  4IQW A;  5A0L A;  3ML8 A;  3WCQ A;  2BT6 A;  4J9K A;  3MBY A;  5L83 A;  3PRM B;  5KFB A;  4ACO A;  2FMS A;  4OVU A;  3RB0 A;  1UNS A;  4M9L A;  3HUI A;  3ZYY X;  3DBH B;  3VHT C;  4LNK A;  4DQS A;  2LYA A;  1GPX A;  3GZN I;  2EAO A;  1CEZ A;  4F8R A;  4O5C A;  1SE3 A;  1AYF A;  2W9A A;  4GU2 A;  1XSL A;  1S76 D;  2KTR B;  4HKQ A;  4OHJ A;  3NTU A;  2RSU A;  4X57 B;  4CF3 A;  4EZL A;  1ZQE A;  4EBE A;  2N0S B;  1X9W A;  3OG5 A;  2DFL A;  2DL0 A;  3WK5 A;  1TK0 A;  4C4V B;  4DS5 A;  1TKG A;  3AU5 A;  4K7S A;  4JL9 A;  1YJJ A;  4MGK E;  4KLQ A;  4BWJ A;  3AEB B;  2JEG A; 
#chains in the Genus database with same CATH homology
 1TS4 A;  5HI1 A;  4TSS A;  1QOA A;  4HRS A;  4WWM A;  1SE2 A;  4XE0 A;  1TS3 A;  2KQ4 X;  1YN5 A;  1KLU D;  3AE7 B;  1R7S A;  4NZL B;  2W55 A;  2CU3 A;  3O13 A;  3AEE B;  2YEP F;  4NJC A;  1FO4 A;  1XEE A;  3DWM A;  1XLN A;  3ETR A;  3BK1 A;  4TQ1 A;  4IDI A;  4D2K A;  1JWS D;  2SEB D;  1BML C;  2LMC A;  3HVZ A;  1HA5 A;  3PZ8 A;  2G9H D;  2PVG C;  3MJ5 A;  1FMA D;  1QQR A;  3BVG A;  4US8 A;  2BS2 B;  2WP9 B;  2AQ1 B;  1FCL A;  1C4A A;  2EKI A;  1E0Z A;  2EEL A;  4LK0 M;  3URY A;  5H8Y E;  2INP E;  4RH6 A;  3GB1 A;  3DWG C;  4KKJ A;  1EWY C;  1XO3 A;  1YJI A;  3FAH A;  1VDV A;  3C8Y A;  3BVZ A;  2MJE A;  1FFV A;  4RGT A;  3H8H A;  1FM0 D;  1V1P B;  1UUP A;  4HKZ E;  1T6B X;  3FIL A;  1SSN A;  3KQ4 A;  3HVD A;  3V3X A;  2V3N A;  5EE3 A;  4L1B A;  1GOZ A;  2V4I B;  4WUR A;  1XLO A;  2N7J A;  5BMI A;  1ET9 A;  3AE5 B;  4Q2J A;  2BBC A;  1ZUD 2;  4YSY B;  3T3N A;  2IDY A;  2QIE B;  4EE2 A;  3ZJU A;  1V8C A;  1QIL A;  1FIQ A;  1JAL A;  1HZ5 A;  1UWM A;  3TUO A;  4YXD B;  4C7Y A;  2WXF A;  3AEG B;  1GAQ B;  2N9K A;  1A70 A;  3KLS X;  1QKZ A;  4TQ0 A;  1QF6 A;  2G1E A;  1TKE A;  1YN3 A;  1RYJ A;  3AB5 A;  2WXP A;  4OZB A;  1GB4 A;  3MC0 B;  2INN E;  3LYY A;  2WXL A;  2H88 B;  4A9A A;  1VZ7 A;  4US9 A;  1QOB A;  4P6V F;  1VZ6 A;  2RDH A;  3AV8 A;  5FKA C;  4MT5 A;  3KWV A;  1HQR D;  2WXJ A;  1JQ4 A;  1FRR A;  1TZO A;  1B1Z A;  4LLG M;  3AEC B;  2WU2 B;  3BII D;  1JW9 D;  1MHX A;  2K22 A;  3P4P B;  1RFK A;  3AM9 A;  2NTT A;  1KFY B;  2ACZ B;  2L83 A;  4N6E B;  3ABV B;  1SJH D;  1KTK A;  1QOF A;  1TJE A;  3MP9 A;  2M19 A;  1LO5 D;  4RF0 A;  2X38 A;  3VRB B;  2ZW0 A;  3BYY B;  1C4C A;  2NTS A;  5T8I A;  1SB3 C;  1QT9 A;  1V97 A;  4OZA A;  1WGK A;  1IBX B;  4GLS C;  2KMM A;  5FK9 C;  5EE1 A;  2XN9 C;  3OWE B;  2AQ3 B;  2IGD A;  3E9S A;  3W9C B;  3AEA B;  1STE A;  2W3R A;  2MEK A;  1F0Z A;  1BUI C;  3SFD B;  5D7G A;  5BYS A;  1HEZ E;  4MAC A;  4ARI A;  3AN1 A;  2DWQ A;  1WXQ A;  1EM7 A;  4C56 C;  1I7H A;  1L4D B;  2ICI A;  2LEK A;  1QLB B;  1K50 A;  5AUI A;  4RCO A;  1MHH E;  2WDQ B;  2JYT A;  3VQI A;  3AE4 B;  4O1N A;  3TSS A;  1F2R I;  4B0M A;  4M0W A;  2K9X A;  4WAF A;  3SR6 A;  1I4P A;  4N59 A;  1SIJ A;  1C76 A;  4YTP B;  2V3P A;  4P16 A;  2FBW B;  2PIA A;  3IAM 1;  2PKO A;  3AEF B;  3VRA B;  1QOG A;  1K52 A;  1D5Z C;  2WXQ A;  3EUB 2;  1ESF A;  2PLP A;  4NAM A;  3Q8F A;  4RF1 A;  1T3Q A;  1DOI A;  3B2G A;  3MHZ A;  3N9Y C;  1CK1 A;  1DGJ A;  2W82 A;  1P7F A;  1C4P A;  3W5U B;  5E6J A;  1N63 A;  5C3J B;  2WXH A;  3EA6 A;  1VLB A;  1PGX A;  1JCK B;  3BYT B;  2QEJ C;  4ARC A;  4A8X C;  3NVY A;  1B9R A;  2WXK A;  2LGI A;  1PUT A;  1I4Q A;  4TMA B;  1EWC A;  1JML A;  1YMH E;  2DLB A;  4ZOH C;  2PTL A;  1I4R A;  1IBX A;  4KGT A;  3AE3 B;  3BWU D;  2V0G A;  2ZW1 A;  1MI0 A;  2R61 A;  1KRH A;  3GP7 A;  1JRP A;  3AE9 B;  2D5G A;  2BS4 B;  1NYR A;  1VRA B;  3Q8E A;  3IAS 1;  3ZQ4 A;  5D3D A;  1PFD A;  1M4V A;  2WQY B;  2W54 A;  2JYE A;  4KKI A;  4XWW A;  1L6V A;  3PO0 A;  1L0V B;  3R2I A;  3W2D A;  4RGN A;  2BW2 A;  1XXG A;  4H2A A;  1FEH A;  1JWB D;  1YN4 A;  4DXF A;  1SF0 A;  4L2Y A;  2MJ3 A;  2LHD A;  1SE4 A;  1PYW D;  2MH7 A;  1C77 A;  2WS3 B;  3AE8 B;  2VZK B;  1OQQ A;  2OHF A;  1N5X A;  1ZDV A;  3TEW A;  2BTE A;  2WXI A;  3B2F A;  2J4X A;  5BYQ A;  5GXG B;  5BMG A;  4IOI E;  4ZYS A;  5C2T B;  4XWT A;  1WSP A;  2Y3A A;  2BS3 B;  2WLB A;  1K53 A;  1L6U A;  3AEB B;  2RMM A;  3U7Z A;  1NYQ A;  2Y5P A;  4AQ7 A;  3BVM A;  1AW7 A;  1YNT E;  1FRD A;  2GB1 A;  2QSD A;  4ZHO A;  1XLP A;  3BZD B;  1VJK A;  2L32 A;  1L4Z B;  1JWM D;  1T5X D;  4OZC A;  1P7E A;  3BK2 A;  3CIR B;  5I4D A;  1FNV A;  3R8B A;  3VR8 B;  1I4H A;  2WXM A;  5EE0 A;  1FXI A;  3AE6 B;  3Q8C A;  2CJN A;  2DYO A;  4DXG A;  3NS1 A;  4KGS A;  3VR9 B;  4N58 A;  3T3O A;  2IGG A;  1PGB A;  1BXT A;  1WYG A;  2GRI A;  1MPE A;  2LUM A;  2WU5 B;  2K3U A;  3FC4 A;  1N60 A;  1XCT L;  1ZP0 B;  2M56 B;  2GI9 A;  2ONQ A;  3IT6 B;  2JX5 A;  3U52 E;  3CWI A;  1RWS A;  1SJE D;  4JPS A;  4HRO A;  2IPK D;  3R2T A;  2JQR B;  4ZRP A;  5H92 C;  2BYT A;  4J3O D;  4WH4 A;  1NEK B;  3V05 A;  1TY0 A;  1HZ6 A;  4FXC A;  1NVI D;  1NI3 A;  1XLQ A;  1V1O A;  4B0E A;  1TS2 A;  4ITK A;  2JWU A;  2J53 A;  1MVK A;  3FIL B;  2SAK A;  1N62 A;  1ET6 A;  4OW0 A;  1SEB D;  3IT4 B;  5FR3 A;  1F77 A;  1JWA D;  4RGM A;  3AE1 B;  1E7P B;  2JU6 X;  1I4G A;  2K5P A;  4HJG E;  1IGD A;  4GDL B;  1JRO A;  2J42 A;  1KLG D;  1I4X A;  1FD6 A;  3EGR A;  4L23 A;  3LXF A;  3AED B;  2ON8 A;  1D4B A;  4R3D A;  4JWU C;  1F2R C;  2DYM A;  3TEZ A;  3W5V B;  3ZGZ A;  3U4E G;  2WXO A;  3U2S C;  2XNA C;  3GS2 A;  1GB1 A;  4JE3 B;  1J7B A;  4MM3 B;  1KF6 B;  2N9L A;  4RNA A;  1TYG B;  2PMV A;  3NZ3 A;  2L1A A;  3P4Q B;  2PVO D;  1N5W A;  2JZP A;  4YWG G;  3NRZ A;  4REZ A;  2LJI A;  4DQO C;  1XF5 L;  2WXN A;  4LTU A;  1YQ4 B;  4A6Q A;  4JX1 C;  3TEX A;  1ZPS A;  4JWS C;  1D5X C;  3RPF C;  1CZP A;  1NEN B;  3LB8 C;  3I57 A;  1E10 A;  1E6E B;  1OQR A;  5D3I B;  1Y56 A;  4A55 A;  2E3T A;  2KN4 A;  3I9V 1;  1PDX A;  4GDK B;  4C7Z A;  2BB6 A;  5G5G A;  2PW9 A;  5HG2 A;  1VZ8 A;  5MPO A;  1SBB B;  2IGH A;  1ZXI A;  2CJO A;  2KAC A;  3AMZ A;  3ZJV A;  1CQV A;  2JSV X;  4KX6 B;  2WXR A;  1KH0 A;  2QIL A;  1HXY D;  1J7A A;  3Q69 A;  5HFY A;  5HHD G;  2I38 A;  2RDG A;  5BYR A;  1JWU D;  3UI3 A;  3P42 A;  1ROE A;  4RFB A;  1ACC A;  2E6X A;  2HTM E;  3RFZ B;  2K0P A;  2L52 A;  1K51 A;  1DOY A;  3TEY A;  3MFG A;  5LNK 1;  2HDE A;  5G5H A;  4WQM A;  2DBY A;  3IXS A;  3NUH B;  4YSZ B;  1E9M A;  2RPV A;  3SFE B;  2Y5C A;  1FCC C;  3P63 A;  1TY2 A;  5JXV A;  3AH7 A;  4IKG A;  1L5P A;  1UWX A;  1AWD A;  2LHE A;  1IUE A;  1PGA A;  3W1S A;  3B9J A;  3NVZ A;  2MJD A;  3HRD D;  1Q10 A;  1V1P A;  2QMT A;  4ZHP A;  3NVW A;  4YTN B;  2IJ0 A;  1EU3 A;  3PZ7 A;  2J52 A;  2KWD A;  2WNM A;  4KGR A;  4OVZ A;  5AUK A;  4AS1 A;  1YQ3 B;  1TKY A;  4WIP A;  3Q8B A;  4HEA 1;  2JXT A;  4NAW B;  2Z8L A;  4RGO S;  3KWL A;  1C9F A;  2I2Y A;  4A90 A;  4USA A;  2WXG A;  1C78 A;  2FUG 1;  4XDC A;  3P4R B;  4XDD A;  2W3S A;  4UDU C;  1ZE3 D;  1EU4 A;  1ZOY B;  3ZJT A;  4YSX B;  3P4S B;  1VR9 A;  3SEB A;  1DOX A;  2OED A;  4C80 A;  1FNU A;  1WWT A;  1ENF A;  1FFU A;  2B76 B;  2KDM A;  2VZK D;  1AN8 A;  4YTM B;  4PT5 A;  2BB5 A;  2AQ2 B;  3WCQ A;  2BT6 A;  3J9C A;  1UNS A;  2WDR B;  3L4P A;  3HUI A;  3ZYY X;  4ZRQ A;  1CJE A;  3NVV A;  1L0Y B;  1D6E C;  1N61 A;  1GPX A;  1OFF A;  4YT0 B;  5EE9 A;  1WRI A;  3Q8A A;  5TSS A;  1UGJ A;  1SE3 A;  3AE2 B;  1AYF A;  2LFI A;  2FE8 A;  2TSS A;  1D5M C;  1ZXH A;  2H89 B;  1TS5 A;  4OHJ A;  2YEP B;  3E56 A;  4HKQ A;  1RM6 C;  1SXT A;  1XCQ L;  1C79 A;  1IGC A;  2KAJ A;  2N0S B;  2NMQ A;  5BMH A;  1FXA A;  2AX5 A;  3P1M A;  1J7C A;  2WDV B;  4CQN A;  1L0X B;  1TKG A;  1FNW A;  2M0A A;  1ZDX A;  2QJL A;  1YJJ A;  2Q5W D;  1DYQ A;  4MH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...