3EU4A

Crystal structure of bdbd from bacillus subtilis (oxidised)
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
185
structure length
185
Chain Sequence
NDAVSGQPSIKGQPVLGKDDAPVTVVEFGDYKCPSCKVFNSDIFPKIQKDFIDKGDVKFSFVNVMFHGKGSRLAALASEEVWKEDPDSFWDFHEKLFEKQPDTEQEWVTPGLLGDLAKSTTKIKPETLKENLDKETFASQVEKDSDLNQKMNIQATPTIYVNDKVIKNFADYDEIKETIEKELKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BdbD
publication title Crystal Structure and Biophysical Properties of Bacillus subtilis BdbD: AN OXIDIZING THIOL:DISULFIDE OXIDOREDUCTASE CONTAINING A NOVEL METAL SITE
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Oxidoreductase
total genus 70
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13462 Thioredoxin_4 Thioredoxin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3eu4A00
1VF2A 2JACA 4L5LA 4RI6A 1K3LA 4N0ZA 2LQOA 1F2EA 2HI7A 2ON5A 3DMLA 1ABAA 4K7OA 5G2ZA 2VLUA 2YJ7A 3D5JA 3HVSA 2O7KA 2FWEA 3LYPA 4L0UA 1XWBA 1MDJA 2MBSA 5G31A 2X8HA 1KNGA 3NOFA 3EURA 1PKZA 1YEXA 1YY7A 2IMFA 1O81A 3TKSC 3PINA 3GX0A 5CYYA 2LNSA 1SK0A 4DSQA 5A5KA 3O6TA 3F9UA 4WETA 4PX1A 14GSA 1PRXA 3VWVA 4HZ4A 2NVLA 3ZREA 4ZBDA 3QAWA 5IM9A 2G2QA 3LGCA 2YJHA 3ERFA 2CZ2A 2A2SA 4OWYA 4POLA 3GRXA 5F0GA 2FUG2 2VCWA 4MPGA 3KIJA 2FHEA 3ZITA 4ECIA 4EVMA 3TKSA 4QQ7A 2VCVA 1VF1A 5JWOB 1AXDA 2H19A 1BQ7A 5HFKA 3ZIJA 2CAIA 1VF4A 3P90A 3WGXA 2A4VA 2IMIA 2GLRA 6GSUA 4LL4B 2H71A 4BWQA 4MJBA 4AJ6A 3GTUB 4F2IA 5ECRB 1PQNA 4WXTA 1YQ1A 1XOAA 3PGTA 1AW9A 1ACVA 1A2JA 1O8XA 2WFCA 3NIVA 3D6IA 4ZBAA 4TVEA 4DSSA 1U88A 2DLXA 4ECBA 2CQ9A 4KDYA 1M2AA 5IIZA 4WF5A 1GTBA 1SL2B 5IOWA 2HE3A 2HZFA 2JZRA 1EEJA 4O5RA 6GSWA 4MJAA 1LU4A 1NM3A 1G7OA 2VD0A 3KTBA 3KXOA 1K3YA 2LRCA 3CYNA 4IGJA 1F37A 1EV9A 3DYRA 4TR0A 3UBKA 2HRFA 4PURA 2GTUA 3QMXA 2K18A 2YWOA 3Q74A 3QR6A 1K0NA 4XCSA 2H0GA 1PX6A 3UMAA 2X8GA 1ZMAA 1JZWA 3DIEA 4G19A 2X64A 2OADA 4IS0A 2AAWA 2OBKA 3EINA 2RIIA 4G9HA 3EVIA 4JR4A 4MJEA 3HDCA 3HYPA 2L6CA 1HNAA 2GQLA 4IW9A 4BWSA 2IJYA 2YWIA 1RK4A 3W6GA 2GSRA 1XIYA 12GSA 2YV7A 3FHKA 3E0UA 5A4WA 3KH9A 2OBIA 5F06A 4KAEA 2MMZA 5LCZA 2VCXA 4WF4A 5HR1A 2O89A 4MF6A 4JRRA 2DJ0A 4HJ2A 4NHWA 4MZWA 3WYWA 8GSSA 1C72A 1WIKA 1T4ZA 3VLNA 1GLPA 3L9UA 1UA5A 1EZKA 3GYKA 5ECPB 5ECQB 4O7HA 5J4UA 3HA9A 2JSZA 3ZZXA 3TUEA 4HQSA 2OA7A 2REMA 3LYKA 4JEDA 5IMCA 1Z6NA 2LNTA 4J2FA 5F8BA 2H6YA 1ON4A 3WGEA 1ERWA 2KP1A 1M0UA 3SBCA 1IYHA 2P31A 3UL3A 3TB2A 4G2EA 1QGVA 4DSRA 5EY6A 4MABA 2OE3A 5L71A 3FR3A 4MF7A 2HZEB 1GTAA 1GNWA 5C00A 1I9DA 3F3RA 3HJPA 1Z7PA 1AUCA 4X0XA 2LQQA 4POMA 5ECOB 5B8BA 4HEA2 4HU9A 1THXA 1WRYA 4YAPA 2F8FA 4JR6A 1X9WB 2GZZA 4WEYA 1FB6A 1GSEA 1GTIA 1PA3A 2FLSA 4JZQA 1I5GA 3IR4A 1AIUA 1FG4A 2PGTA 1JHBA 4O32A 2O87A 5CO3A 3H93A 4IKHA 5GAPD 3QAVA 2V6KA 2C4JA 1V40A 3IV4A 2K8SA 1XW5A 4K8MA 2HRNA 2VAFA 3L78A 1QMVA 1OC3A 1WOUA 1TKDB 2B7JA 1BYEA 1SYRA 3IC4A 1A8LA 3RPPA 3C73A 3IPZA 1TU8A 4HS1A 4KCEA 3H4KA 1JFUA 3RDWA 4V2MA 2VL9A 3DEXA 4OFNA 2XHFA 4Q5NA 3LWAA 3W8SA 3UVHA 1XWCA 3RHCA 1B4PA 3VI5A 2XC2A 2JU5A 4I2UA 1ZZYA 3EU3A 4PUFC 5INYA 4HU7A 2IPAA 3WD6A 4ZB8A 2HZEA 3KD0A 1M2BA 4GQFA 3Q18A 1A2MA 2AV4A 3H1NA 6GSVA 4TXOB 2VCTA 3KTLA 5IQYA 4TW5A 2VD1A 4QL9A 5H5SA 1EGRA 3IDVA 4GF0A 2FA8A 1XWKA 4KDXA 5ABRA 1W89A 1Z9HA 5DQYA 3O3TA 1PD21 1OKTA 5DJLA 6GSTA 2C0GA 2O85A 4F9ZA 3GKMA 4KX4A 10GSA 1T7PB 4P3YB 1QFNA 2HSHA 1PSQA 2WDUA 2L5LA 3QD9A 4J56E 2GZPA 1YEPA 3QCPA 4PNFA 4D73B 1UN2A 3VWWA 2MMNA 3BOAA 3FYGA 1BX9A 5IMFA 3FZAA 4JU5A 1PL2A 3CTFA 4GLTA 3F63A 5HQPA 2C8UA 1X5EA 3EU4A 2DJ2A 2JADA 5H5QA 3F6DA 3BCKA 3CRTA 1TI3A 4ZB6A 2GVPA 3L4NA 4I5QA 4TN8A 3G9BA 5EL8A 3FR6A 2HT9A 4EUYA 5ID2B 3F4TA 2GSSA 2C3NA 4ID0A 1LBKA 2WS2A 3LG6A 1PMTA 1VRSD 1O8WA 2WCIA 3WT2A 3ZVJD 3VURA 4PQIA 2H8LA 2I9HA 4FIWA 5GAND 4I6XA 1O85A 1R7HA 5DQSA 1DSBA 4RUVA 2YNXA 2PU9C 5A4VA 5D9TA 1WWJA 3HY2A 3DGQA 1EP8A 1EV4A 4NV2A 19GSA 3QFAC 3GX8A 1X9MB 3D4MA 3GL5A 3GMFA 2QGVA 1M99A 3ED3A 2LUSA 3S9FA 1HNCA 4IHUA 4D73A 4GXZA 2CT6A 3TRXA 1UVZA 2K6VA 2H1DA 5J5NA 2CAQA 4F0BA 2IWTA 1SK2A 4PQHA 3C1RA 1NHOA 5IO2A 3V1WA 3TKQA 1ZL9A 3C1SA 2RM5A 1QQ2A 2ZUPA 2C0DA 2B5EA 2GQMA 3J7Yk 1DBYA 3BCIA 3DD3A 5J3RA 3F8UA 1GP1A 3GL3A 1F9MA 4POKA 3GKXA 3HVVA 3KP9A 1G6WA 3HXSA 3TJJA 3ERWA 1YKAA 5JCGA 3DKSA 3CMIA 4MH2A 9GSSA 1SKRB 4HUAA 3LQ7A 4E8EA 5ID2A 2M72A 3TRPA 3DVWA 2FGXA 4WKWA 3SWLA 2VM1A 2O8VB 5ENUA 3ZMLA 4NXIA 1HD2A 2OKAA 2EIQA 4IN0A 1TJDA 4YAVA 4ZB9A 4TOPA 1PGTA 3TRQA 4GSNA 2C0EA 1OYJA 4J57E 5GSTA 4ECJA 5A4UA 1Q98A 2E2MA 2BTOT 4GWRA 3ME8A 3EE2A 3ERGA 4FYBA 2H1GA 1B9YC 5E59A 1SKWB 2GT6A 1EP7A 2LSTA 2MYGA 2A2RA 2D2ZA 1AQVA 2WB9A 2YWMA 3HZ4A 4WR5A 3WT1A 4OMVA 2DSAA 2PVQA 4HJMA 4K2DA 1Q4JA 1FHEA 5AN1A 3A2XA 4EKZA 2YP6A 3APQA 1F3AA 2H30A 3P8WA 2GSTA 1XZOA 5JWRB 1TI1A 3RPNA 3KH7A 3LXTA 2YZHA 1SYXA 3GHAA 4NHZA 4MK3A 1T00A 4XRAA 4OFMA 4NMUA 18GSA 1XPVA 3LXZA 4FO5A 1URMA 4K0NA 1YF1A 1EWXA 1WJKA 2RLIA 1HNBA 1X5DA 5ECNB 2C1YA 3E9JB 5DDLA 5HFIA 1JLWA 3KCMA 1R26A 2H1BA 2RUFA 3ZFLA 3F3QA 3EC3A 2B1LA 2GS3A 1X0RA 3EWLA 5J9BA 2M80A 4QL7A 2XBIA 4XIHA 4XRDA 3UBLA 4EDZA 2V41A 1GUKA 4EXJA 4ML1A 3CXGA 3F6FA 1A2LA 2NPBA 3KZQA 4ZBBA 3G7IA 3VPQA 1OVNA 3DRNA 4KCAA 4OCFA 3RBTA 2YANA 2KHPA 2VOCA 3ZMKA 1XW9A 1KTEA 2LEGA 1JZOA 3U6VA 4IP6A 1IYIA 1R4WA 4XTSA 1MTCA 3I6AA 1B9XC 4KE3A 2C3TA 4G10A 1JZRA 2DMLA 3VK9A 5KN3A 4LMVA 2ZNMA 2LJAA 6GSYA 5DVBA 3GTUA 1DE1A 2HFDA 2C0FA 1XW6A 4IQAA 4OO5A 4ACSA 2R4VA 4MZCA 5KN2A 1GRXA 3BD2A 1FB0A 2FA4A 4HZ2A 3VFIA 1GSUA 2M46A 3Q6OA 3BBYA 3IAS2 4KSOA 3ZVJA 4OCEA 1CQHA 4EO3A 5DALB 2H70A 3IHQA 2VIMA 3IOSA 2IIYA 1O7UA 5G1KA 2V1MA 2P5QA 1M9BA 1PX7A 1XXUA 4YH2A 1OE7A 4AJ8A 4OFTA 4OO4A 5KEJA 1B48A 4AF2A 4FYCA 2R37A 5IPHA 5JCWA 3D21A 2LRTA 3IK7A 4MCUA 4TR1B 1JLVA 4MPFA 2DJ3A 4HOJA 1WP0A 1BJXA 2V32A 3M9KA 1XFLA 3TGZA 1FW1A 1W4VA 3RAZA 3EMXA 2H76A 1ZCPA 2OE1A 2QSIA 2XBQA 2LJRA 3DWVA 3GKNA 1T8EB 3FW2A 2GT5A 2N5FA 2PN8A 1VGLA 3AY8A 3A2VA 5B8AA 1FO5A 1E2YA 2L59A 1V2AA 3CSIA 4E8HA 1AQXA 3UJ1A 2HXKA 1PKWA 4ISDA 1BG5A 1S3AA 3ME7A 3QOUA 1CQGA 1F6MC 4CHSA 1EGOA 4TR4A 3ZTLA 5AIVA 4BA7A 2LV3A 2IMEA 3GV1A 2LTKA 3FRCA 2PWJA 2R5GA 1DE2A 3A5WA 5DAKB 2CZ3A 1NHYA 2ALBA 5F07A 2TRXA 2PUKC 2LJKA 1V58A 1SU9A 4KDUA 3DVXA 5CRWA 1EEMA 2EC4A 3FZ5A 5JWQB 2YWNA 2WULA 3PR8A 1OAZA 2C3QA 1GL8A 1TRWA 1TDIA 3IBHA 3GIXA 3ZLPA 1ZYEA 1YZXA 2H74A 4AGSA 4IVFA 3HZ8A 5CNWA 4N11A 1NSWA 3L9SA 1QXHA 2F51A 4KW6A 4Q5QA 5ELAA 3GNJA 2V2GA 4ML6A 2E0QA 4ZIJA 2JSYA 5AIXA 3K8NA 4V2NA 4AJ7A 3GSSA 3HJMA 1A8YA 4TKYA 4KGIA 2F8AA 4V2LA 2HLSA 4LLRA 4NAXA 4I2TA 3APSA 1A23A 3C7MA 2OE0A 3GURA 1M7TA 4MMMA 2RUEA 1XVWA 1AQWA 2HSYA 5D73A 1ERVA 4POBA 3ZIVA 3QFBC 2R2JA 1O6JA 2VL2C 3ISOA 4Q5RA 4GCIA 4RI7A 5FT3A 1RQMA 4TR3A 3MDKA 2H73A 3GKKA 3WGDA 2IFQB 4GSTA 1K0OA 2FCHA 1X5CA 1NW2A 3E3EA 4MDCA 1T4YA 1EOHA 3HCZA 4ULXA 1DUGA 5DJMA 2E2GA 3TKPA 2HYXA 4K1FA 3LSZA 3FEUA 2VL2A 1V98A 4TXOA 5DBQA 3LFLA 1JZDA 1Z6MA 2RM6A 5HFGA 2H6XA 1Z7RA 1TP9A 4Q5FA 2BJXA 2LRNA 4ILFA 1XOBA 3LEFA 2VLVA 4IBPA 5JCUA 4LMWA 2BMXA 5ECKB 4BL7A 2B6MA 4CDOA 3APOA 1G0TA 4EC0A 1EOGA 2R3XA 2P0GA 4JE1A 4LL1B 1ZOFA 2ZCTA 1WPIA 4O92A 5LNKe 4NPBA 1QK8A 3ZYWA 5CREA 3I43A 1ERUA 4HI7A 4ZXGA 4TXVA 4PUAA 2MMOA 5B7CA 5FWGA 2MMAA 4WBJA 4V1Ap 3O76A 1GUHA 3HKRA 2VO4A 2OACA 3TKRA 2I4AA 1S3CA 5B6NA 1GLQA 4OD7A 5D93A 1RW1A 2C80A 2DMMA 4K7IA 1M2DA 4F82A 5J41A 1KEBA 3I9V2 3GFKA 2DJKA 4DSSB 5EVOA 4EDYA 5LD0A 2IFQA 1U87A 1MDIA 4X43A 4MLYA 1SKSB 4MA9A 2X99A 5HR2A 1OC8A 3QDNA 4LA1A 2H0HA 2AUVA 2QC7A 2AJQB 2FWFA 2ON7A 5FHIA 2I81A 2V6OA 3KGKA 1TTZA 3ZL5A 2DC5A 4IQ1A 3L9VA 2KUCA 3N9JA 4XS1A 3L0HA 3C71A 3HVXA 5CP1A 1GTUA 5HR0A 1U3IA 3J7Yb 2IMDA 4ZILA 4EL1A 2DJJA 4K6XA 3RHBA 4ZL8A 3KP8A 1F3BA 1TRVA 3QAGA 4IJIA 1GSDA 5J9CA 2CVBA 4EE0A 4IP1A 3BJ5A 5C04A 5DCHA 3TOUA 5CRHA 3GA4A 3F4RA 5EPFA 3CBUA 3CSJA 3U5RE 3ZFBA 3FKFA 3FY7A 1V57A 2B5XA 1J9BA 5D9WA 4DEJA 3TJFA 5G1LA 2HNLA 4NV5A 4GQCA 4GRFA 2VLTA 3TCOA 4KUNA 5H5RA 2CA8A 3ZRDA 2WZ9A 1SD8A 3VPTA 1U6TA 4NWYA 4ZL7A 4N30A 5DCGA 1FOVA 3G7YA 1GH2A 2I3YA 3H8QA 5CAXA 2N5AA 4KB3A 5IMAA 4XS4B 2IL3A 3GUSA 1AAZA 1O73A 3M8NA 2EIRA 2YCDA 4RQXA 1A0FA 3IA1A 1SL1B 1GUMA 4ECCA 17GSA 1B8XA 2X8CA 4BVYA 3M0FA 2AYTA 4XS6A 1WMJA 1TK0B 1XCCA 1KBNA 5AGYA 2G0FA 4N10A 4FYUA 2J23A 1R5PA 2JZSA 5D96A 1FVJA 3FR9A 4KA0A 1TRSA 1FAAA 3IRAA 1MD4A 1YKCA 3DXBA 5IPGA 6GSSA 3P7XA 4X1UA 4PXOA 2KOKA 4I97A 5CRDA 4I8BA 2K8VA 5D9VA 3FZ4A 2R6KA 1K0CA 3HD5A 3LORA 3GH9A 1UC7A 1LJRA 2PBJA 2JZTA 4K9ZA 4MJCA 1T3BA 1GULA 2E7PA 3G7JA 3M9JA 3Q19A 5B6MA 13GSA 4IJ3A 4FH8A 5IMVA 3KMNA 2FY6A 2P5RA 3H79A 3N5OA 1SJ6A 5ECMB 1ST9A 1SJZA 2B3SA 2Z9SA 1X9SB 3UAPA 4RQRA 2PERA 4CW9A 5KN1A 3C8EA 2CV4A 2B7KA 3VI7A 4KNDA 2GGTA 1TK5B 1R5AA 3OR5A 4V1Ag 1M9AA 2GZYA 4HQZA 4DVCA 4XS4A 1PL1A 2F3MA 2YV9A 3NZNA 4KSMA 5ELGA 4PNGA 2LS5A 1GSQA 2FNOA 3IAM2 1Z3EA 1V9WA 2XPDA 3GH6A 2FD3A 1H4OA 2MZCA 3D4TA 2MBTA 1H75A 1AC1A 1K0MA 2LKUA 4GTUA 1SL0B 1MEKA 4EF0A 1QUWA 4KH7A 5GSSA 1A24A 2K9FA 2CX4A 2DBCA 1XVQA 2JL4A 3JCML 4N0VA 2H75A 2PMTA 4TRXA 3TOTA 5G5FA 1HQOA 3KEBA 4YQVA 1Z5YE 3VWUA 2WGRA 1ILOA 4IELA 3LJRA 3FK8A 5COHA 2NDOA 1THOA 3TKSE 4YQUA 1WE0A 1B4QA 2IN3A 1Y6EA 3D0ZA 1K3OA 3TJBA 1OC9B 3US3A 5E4WA 3QPMA 1J08A 5IMDA 2FWHA 2GQKA 1E6BA 2J9HA 2PPTA 3HHVA 1GNEA 3R2QA 2CVDA 1MD3A 2NBSA 2H6ZA 1TK8B 3UEMA 1VF3A 2GSQA 1YDKA 3P2AA 3FZ9A 1TW9A 2CX3A 4YQMA 5DALA 5KN0A 1ML6A 1G7EA 1PN9A 2F9SA 5F05A 2WRTA 3GSTA 4F03A 11GSA 3UVTA 1ZYQB 2YPMA 2N5BA 1ZGNA 2B1KA 5ECHB 3TJGA 2WJUA 5GZZB 1U3AA 4BVXA 1K0DA 2IMKA 2L4QA 3UIWA 1K0AA 3I69A 3MSZA 4TR1A 1G6YA 1K0BA 2H1AA 1A0RP 3EMPA 2L4CA 1T1VA 2FWGA 2VCQA 3W8JA 1BAYA 1SJIA 5ECLB 5D8IA 1SK1A 4BPYA 4L0WA 1MDKA 2H72A 2AB6A 3IK9A 2NTOA 1YF0A 1XWGA 4MP4A 1OC9A 4K0GA 5IOXA 4XHMA 2L57A 7GSSA 2CVKA 4GSSA 3D22A 3KJYA 5AISA 3UARA 2EIOA 2TIRA 4MZBA 4MF5A 3VWXA 2H0IA 1J0FA 3PH9A 1S3DA 4JBBA 3F4SA 4WBRD 2KP2A 6GSXA 1OKDA 2GDRA 3KM6A 3MNGA 3M3MA 3MWHA 4H86A 2OJLA 1FVKA 1TRUA 2VCZA 2H01A 5IMZA 1BEDA 2AHEA 5DAKA 2DIZA 3F0IA 2DJ1A 2DIYA 5D9XA 3A2WA 1TOFA 4Z7XA 1XWAA 2I1UA 1USBA 5IO0A 3TJKA 3IE3A 2QKEA 3GN3A 4ZL9A 1SENA 1XBSA 2XPEA 3KMOA 4HDEA 16GSA 2YOIA 5HR3A 2VL3A 4WR4A 3MAKA 1GWCA 2L5OA 1GSYA 1GSFA 2VUPA 4L5OA 2VM2A 2ES7A 3HJOA 2L6DA 5G5EA 2B5YA 3CTGA 1TXXA 1TU7A 1Y25A 5ECSA 4L8EA 5G30A 5ECIB 1ERTA 2PVOC 22GSA 5CRGA 1HYUA 3UOMA 2TRCP 4MH3A 3CSHA 1YJ6A 2YN1A 3IXRA 4K7NA 1GSSA 2KLXA 3EYTA 20GSA 1OE8A 3CRUA 3M1GA 1SD9A 2H66A 2YZUA 4PQ1A 3A3TA 4F0CA 4PGTA 1N2AA 3TDGA 1N8JA
chains in the Genus database with same CATH superfamily
1VF2A 2JACA 4L5LA 4RI6A 1K3LA 4N0ZA 2LQOA 1F2EA 2HI7A 2ON5A 3DMLA 1ABAA 4K7OA 5G2ZA 2VLUA 2YJ7A 3D5JA 3HVSA 2O7KA 2FWEA 3LYPA 4L0UA 1XWBA 1MDJA 2MBSA 5G31A 2X8HA 1KNGA 3NOFA 3EURA 1PKZA 1YEXA 1YY7A 2IMFA 1O81A 3TKSC 3PINA 3GX0A 5CYYA 2LNSA 1SK0A 4DSQA 5A5KA 3O6TA 3F9UA 4WETA 4PX1A 14GSA 1PRXA 3VWVA 4HZ4A 2NVLA 3ZREA 4ZBDA 3QAWA 5IM9A 2G2QA 3LGCA 2YJHA 3ERFA 2CZ2A 2A2SA 4OWYA 4POLA 3GRXA 5F0GA 2FUG2 2VCWA 4MPGA 3KIJA 2FHEA 3ZITA 4ECIA 4EVMA 3TKSA 4QQ7A 2VCVA 1VF1A 5JWOB 1AXDA 2H19A 1BQ7A 5HFKA 3ZIJA 2CAIA 1VF4A 3P90A 3WGXA 2A4VA 2IMIA 4FQUA 2GLRA 6GSUA 4LL4B 2H71A 4BWQA 4MJBA 4AJ6A 3GTUB 4F2IA 4YKFA 5ECRB 1PQNA 4WXTA 1YQ1A 1XOAA 3PGTA 1AW9A 1ACVA 1A2JA 1O8XA 2WFCA 3NIVA 3D6IA 4ZBAA 4TVEA 4DSSA 1U88A 2DLXA 4ECBA 2CQ9A 4KDYA 1M2AA 5IIZA 4WF5A 1GTBA 1SL2B 5IOWA 2HE3A 2HZFA 2JZRA 1EEJA 4O5RA 6GSWA 4MJAA 1LU4A 1NM3A 1G7OA 2VD0A 3KTBA 3KXOA 1K3YA 2LRCA 3CYNA 4IGJA 1F37A 1EV9A 3DYRA 4TR0A 3UBKA 2HRFA 4PURA 2GTUA 3QMXA 2K18A 1ZYPA 2YWOA 3Q74A 3QR6A 1K0NA 4XCSA 2H0GA 1PX6A 3UMAA 2X8GA 1ZMAA 1JZWA 3DIEA 4G19A 2X64A 2OADA 4IS0A 2AAWA 2OBKA 3EINA 2RIIA 4G9HA 3EVIA 1FOHA 4JR4A 4MJEA 3HDCA 3HYPA 2L6CA 1HNAA 2GQLA 4IW9A 4BWSA 2IJYA 2YWIA 2HRAA 1RK4A 3W6GA 2GSRA 1XIYA 12GSA 2YV7A 3FHKA 3E0UA 5A4WA 3KH9A 2OBIA 5F06A 4KAEA 2MMZA 5LCZA 2VCXA 4WF4A 5HR1A 4Z2UA 2O89A 4MF6A 4JRRA 2DJ0A 4HJ2A 4NHWA 4MZWA 3WYWA 8GSSA 1C72A 1WIKA 1T4ZA 3VLNA 1GLPA 3L9UA 1UA5A 1EZKA 3GYKA 5ECPB 5ECQB 4O7HA 4KF9A 5J4UA 3HA9A 2JSZA 3ZZXA 2A2PA 3TUEA 4HQSA 2OA7A 2REMA 3LYKA 4JEDA 5IMCA 1Z6NA 3IHGA 2LNTA 4J2FA 5F8BA 2H6YA 1ON4A 3WGEA 1ERWA 2KP1A 1M0UA 3SBCA 1IYHA 2P31A 3UL3A 3TB2A 4G2EA 1QGVA 4DSRA 5EY6A 4MABA 2OE3A 5L71A 3FR3A 4MF7A 2HZEB 1GTAA 1GNWA 5C00A 1I9DA 3F3RA 3HJPA 1Z7PA 1AUCA 4X0XA 4K5RA 2LQQA 4POMA 5ECOB 5B8BA 4HEA2 4HU9A 1THXA 1WRYA 3FMWA 2F8FA 4JR6A 4YAPA 1X9WB 2GZZA 4WEYA 1FB6A 1GSEA 1GTIA 1PA3A 2FLSA 4JZQA 1I5GA 3IR4A 1AIUA 1FG4A 2PGTA 1JHBA 4O32A 2O87A 3LW9A 5CO3A 3H93A 4IKHA 5GAPD 3QAVA 2V6KA 2C4JA 1V40A 3IV4A 2K8SA 1XW5A 4K8MA 2HRNA 2VAFA 3L78A 1QMVA 1OC3A 1WOUA 1TKDB 2B7JA 1BYEA 1SYRA 3IC4A 1A8LA 3RPPA 3C73A 3IPZA 1TU8A 3R3EA 4HS1A 4KCEA 3H4KA 1JFUA 3RDWA 4V2MA 2VL9A 3DEXA 4OFNA 2XHFA 4Q5NA 3LWAA 3W8SA 3UVHA 1XWCA 3RHCA 3CQFA 1B4PA 3VI5A 2XC2A 2JU5A 4I2UA 1ZZYA 3EU3A 4PUFC 5INYA 4HU7A 2IPAA 3WD6A 4ZB8A 2HZEA 3KD0A 1M2BA 4GQFA 3Q18A 1A2MA 2AV4A 3H1NA 6GSVA 2QA1A 4TXOB 2VCTA 3KTLA 5IQYA 4TW5A 2VD1A 4QL9A 5H5SA 1EGRA 3IDVA 4GF0A 2FA8A 1XWKA 4KDXA 5ABRA 1W89A 1Z9HA 5DQYA 3O3TA 1PD21 1OKTA 5DJLA 6GSTA 2C0GA 2O85A 4BL7B 4F9ZA 3GKMA 4KX4A 10GSA 1T7PB 4P3YB 1QFNA 2HSHA 1PSQA 2WDUA 2L5LA 3QD9A 4J56E 2GZPA 1YEPA 3QCPA 4PNFA 4D73B 2X4AA 1UN2A 3VWWA 2MMNA 3BOAA 3FYGA 1BX9A 5IMFA 3FZAA 4JU5A 1PL2A 3CTFA 4GLTA 3F63A 5HQPA 2C8UA 1X5EA 3EU4A 2DJ2A 2JADA 5H5QA 3F6DA 3BCKA 3CRTA 1TI3A 4ZB6A 2GVPA 4K5SA 3L4NA 4I5QA 4TN8A 3G9BA 5EL8A 3FR6A 2HT9A 4EUYA 5ID2B 3F4TA 2GSSA 2C3NA 4ID0A 1LBKA 2WS2A 3LG6A 1PMTA 1VRSD 1O8WA 2WCIA 3WT2A 3ZVJD 3VURA 4PQIA 2H8LA 2I9HA 4FIWA 5GAND 4I6XA 1O85A 1R7HA 5DQSA 1DSBA 4RUVA 2YNXA 2PU9C 5A4VA 5D9TA 1WWJA 3HY2A 2X49A 3DGQA 1EP8A 1EV4A 4NV2A 19GSA 3QFAC 3GX8A 1X9MB 3D4MA 3GL5A 3GMFA 2QGVA 1M99A 2DKHA 3ED3A 2LUSA 3S9FA 1ZYNA 1HNCA 4IHUA 4D73A 4GXZA 1PFOA 2CT6A 3TRXA 1UVZA 2K6VA 2H1DA 5J5NA 2CAQA 4F0BA 2IWTA 1SK2A 4PQHA 3C1RA 1NHOA 5IO2A 3V1WA 3TKQA 5KOXA 1ZL9A 3C1SA 2RM5A 1QQ2A 2ZUPA 2C0DA 2B5EA 2GQMA 3J7Yk 1DBYA 3BCIA 3DD3A 5J3RA 3F8UA 1GP1A 3GL3A 1F9MA 4POKA 3GKXA 3HVVA 3KP9A 1G6WA 3HXSA 3TJJA 3ERWA 1YKAA 5JCGA 3DKSA 3CMIA 4MH2A 9GSSA 1SKRB 4HUAA 3LQ7A 4E8EA 5ID2A 2M72A 3TRPA 3DVWA 2FGXA 4WKWA 3SWLA 2VM1A 2O8VB 5ENUA 3A5IA 3ZMLA 4NXIA 1HD2A 2OKAA 2EIQA 4IN0A 1TJDA 4YAVA 4ZB9A 4TOPA 1PGTA 3TRQA 4GSNA 2C0EA 1OYJA 4J57E 5GSTA 4ECJA 5A4UA 1Q98A 2E2MA 2BTOT 4GWRA 4BVYB 3ME8A 3EE2A 3ERGA 4FYBA 2H1GA 1B9YC 5E59A 1SKWB 2GT6A 1EP7A 2LSTA 2MYGA 2A2RA 2D2ZA 1AQVA 2WB9A 2YWMA 3HZ4A 4WR5A 3WT1A 4OMVA 2DSAA 2PVQA 4HJMA 4K2DA 1Q4JA 1FHEA 5AN1A 3A2XA 4EKZA 2YP6A 3APQA 1F3AA 2H30A 3P8WA 2GSTA 1XZOA 5JWRB 1TI1A 3EPTA 3RPNA 3KH7A 3LXTA 2YZHA 1SYXA 4G0LA 3GHAA 4NHZA 4MK3A 1T00A 4XRAA 4OFMA 4NMUA 18GSA 1XPVA 3LXZA 4FO5A 1URMA 4K0NA 1YF1A 1EWXA 1WJKA 2RLIA 1HNBA 1X5DA 5ECNB 2C1YA 3E9JB 5DDLA 5HFIA 1JLWA 3KCMA 1R26A 2H1BA 2RUFA 3ZFLA 3F3QA 3EC3A 2B1LA 2GS3A 1X0RA 3EWLA 5J9BA 2M80A 4QL7A 2XBIA 4XIHA 4XRDA 2DKIA 3UBLA 4EDZA 2V41A 1GUKA 4EXJA 4ML1A 3CXGA 3F6FA 1A2LA 2NPBA 3KZQA 4ZBBA 3G7IA 3VPQA 1OVNA 3DRNA 4KCAA 4OCFA 3RBTA 2YANA 2KHPA 2VOCA 3ZMKA 1XW9A 1KTEA 2LEGA 1JZOA 3U6VA 4IP6A 1IYIA 1R4WA 4XTSA 1MTCA 3I6AA 1B9XC 4KE3A 2C3TA 4G10A 1JZRA 2DMLA 3VK9A 5KN3A 4LMVA 2ZNMA 2LJAA 6GSYA 5DVBA 3GTUA 1DE1A 2HFDA 2C0FA 1XW6A 4IQAA 4OO5A 4ACSA 2R4VA 4MZCA 5KN2A 1GRXA 3BD2A 1FB0A 2FA4A 4HZ2A 3VFIA 1GSUA 2M46A 3Q6OA 3BBYA 3IAS2 4KSOA 3ZVJA 4K2XA 4OCEA 1CQHA 4EO3A 5DALB 2H70A 3IHQA 2VIMA 3IOSA 2IIYA 1O7UA 5G1KA 2V1MA 2P5QA 1M9BA 1PX7A 1XXUA 4YH2A 1OE7A 4AJ8A 4OFTA 4OO4A 5KEJA 1B48A 4AF2A 4FYCA 2R37A 5IPHA 4BVXB 5JCWA 3D21A 2LRTA 3IK7A 4MCUA 4TR1B 1JLVA 4MPFA 2DJ3A 4HOJA 1WP0A 1BJXA 2V32A 3M9KA 1XFLA 3TGZA 1FW1A 1W4VA 3RAZA 3EMXA 2H76A 1ZCPA 2OE1A 2QSIA 2XBQA 2LJRA 3DWVA 3GKNA 1T8EB 3FW2A 2GT5A 2N5FA 2PN8A 1VGLA 3AY8A 3A2VA 5B8AA 1FO5A 1E2YA 2L59A 1V2AA 3CSIA 4E8HA 1AQXA 3UJ1A 2HXKA 1PKWA 4BIKA 4YKGA 4ISDA 1BG5A 1S3AA 3ME7A 3QOUA 1CQGA 1F6MC 4CHSA 1EGOA 4TR4A 3ZTLA 5AIVA 4BA7A 2LV3A 2IMEA 3GV1A 2LTKA 3FRCA 2PWJA 2R5GA 1DE2A 3A5WA 5DAKB 2CZ3A 1NHYA 2ALBA 5F07A 2TRXA 2PUKC 2LJKA 1V58A 1SU9A 4KDUA 3DVXA 5CRWA 1EEMA 2HRKA 2EC4A 3FZ5A 5JWQB 4EIQA 2YWNA 2WULA 3PR8A 1OAZA 2C3QA 1GL8A 1TRWA 1TDIA 3IBHA 3GIXA 3ZLPA 1ZYEA 1YZXA 2H74A 4AGSA 4IVFA 3HZ8A 5CNWA 4N11A 1NSWA 3L9SA 1QXHA 2UZ8A 2F51A 4KW6A 4Q5QA 5ELAA 3GNJA 2V2GA 4ML6A 2E0QA 4ZIJA 2JSYA 5AIXA 3K8NA 4V2NA 4AJ7A 3GSSA 3HJMA 1A8YA 4TKYA 4KGIA 2F8AA 4V2LA 2HLSA 4LLRA 4NAXA 4I2TA 3APSA 1A23A 3C7MA 2OE0A 4USSA 3GURA 1M7TA 4MMMA 2RUEA 1XVWA 1AQWA 2HSYA 1XG8A 5D73A 1ERVA 4POBA 1M3JA 3ZIVA 1PN0A 3QFBC 2R2JA 1O6JA 2VL2C 3ISOA 4Q5RA 4GCIA 4RI7A 5FT3A 1RQMA 4TR3A 3MDKA 2H73A 3GKKA 3WGDA 2IFQB 4GSTA 1K0OA 2FCHA 1X5CA 1NW2A 3E3EA 4MDCA 1T4YA 1EOHA 3HCZA 4ULXA 1DUGA 5DJMA 2E2GA 3TKPA 2R0CA 2HYXA 4K1FA 3LSZA 3FEUA 2A4HA 2VL2A 1V98A 4TXOA 5DBQA 3LFLA 1JZDA 1Z6MA 2RM6A 5HFGA 2H6XA 1Z7RA 1TP9A 4Q5FA 2BJXA 2LRNA 4ILFA 1XOBA 3LEFA 2VLVA 4IBPA 2R0GA 5JCUA 4LMWA 2BMXA 5ECKB 4BL7A 2B6MA 4CDOA 3APOA 1G0TA 4EC0A 1EOGA 2R3XA 2P0GA 4JE1A 4LL1B 1ZOFA 2ZCTA 1WPIA 4O92A 5LNKe 4NPBA 1QK8A 3ZYWA 5CREA 3I43A 1ERUA 4G0IA 4HI7A 4ZXGA 4TXVA 4PUAA 2MMOA 5B7CA 5FWGA 2MMAA 4WBJA 4V1Ap 3O76A 1GUHA 3HKRA 2VO4A 2OACA 3TKRA 2I4AA 1S3CA 5B6NA 1GLQA 4OD7A 5D93A 1RW1A 2C80A 2DMMA 4K7IA 1M2DA 4F82A 5J41A 1KEBA 3I9V2 3GFKA 2DJKA 4DSSB 5EVOA 4EDYA 4O5QA 5LD0A 2IFQA 1U87A 1MDIA 4X43A 4MLYA 1SKSB 4MA9A 2X99A 5HR2A 1OC8A 3QDNA 4LA1A 2H0HA 2AUVA 2QC7A 2AJQB 2FWFA 2ON7A 5FHIA 2I81A 2V6OA 3KGKA 1TTZA 3ZL5A 2DC5A 4IQ1A 3L9VA 2KUCA 3PPUA 3N9JA 4XS1A 3L0HA 4MNNA 3C71A 3HVXA 5CP1A 4CY8A 1GTUA 5HR0A 1U3IA 3J7Yb 2IMDA 4ZILA 4X4JA 4EL1A 2DJJA 4K6XA 3RHBA 4ZL8A 3KP8A 1F3BA 1TRVA 4G0KA 3QAGA 4IJIA 1GSDA 5J9CA 2CVBA 4EE0A 4IP1A 3BJ5A 5C04A 5DCHA 3TOUA 5CRHA 3GA4A 3F4RA 5EPFA 3CBUA 3CSJA 3U5RE 3ZFBA 3FKFA 3FY7A 1V57A 2B5XA 1J9BA 5D9WA 4DEJA 1M3IA 3TJFA 5G1LA 2HNLA 4NV5A 4GQCA 4GRFA 2VLTA 3TCOA 4Z2TA 4KUNA 3HVNA 5H5RA 2CA8A 3ZRDA 2WZ9A 4O5UA 1SD8A 3VPTA 1U6TA 4NWYA 4ZL7A 4N30A 5DCGA 1FOVA 3G7YA 1GH2A 2I3YA 3H8QA 5CAXA 2N5AA 4KB3A 5IMAA 4XS4B 2IL3A 3GUSA 1AAZA 1O73A 3M8NA 2EIRA 2YCDA 4RQXA 1A0FA 3IA1A 1SL1B 1GUMA 4ECCA 17GSA 1B8XA 2X8CA 4BVYA 3M0FA 2AYTA 4XS6A 1WMJA 1TK0B 1XCCA 1KBNA 5AGYA 2G0FA 4N10A 4FYUA 2J23A 1R5PA 2JZSA 5D96A 1FVJA 3FR9A 4KA0A 1TRSA 1FAAA 3IRAA 2QA2A 1MD4A 1YKCA 3DXBA 5IPGA 6GSSA 3P7XA 4X1UA 4PXOA 2KOKA 4I97A 5CRDA 4I8BA 2K8VA 5D9VA 3FZ4A 2R6KA 1K0CA 3HD5A 3LORA 3GH9A 1UC7A 1LJRA 2PBJA 2JZTA 4K9ZA 4MJCA 1T3BA 1GULA 2E7PA 3G7JA 3M9JA 3Q19A 4Z2RA 5B6MA 13GSA 4IJ3A 4FH8A 5IMVA 3KMNA 2FY6A 2P5RA 3H79A 3N5OA 1SJ6A 5ECMB 1ST9A 1SJZA 2B3SA 2Z9SA 1X9SB 3UAPA 4RQRA 2PERA 4CW9A 5KN1A 3C8EA 2CV4A 2B7KA 3VI7A 4KNDA 2GGTA 1TK5B 1R5AA 3OR5A 4V1Ag 1M9AA 2GZYA 4HQZA 3MIXA 4DVCA 4XS4A 1PL1A 2F3MA 2YV9A 3NZNA 4KSMA 5ELGA 4PNGA 2LS5A 1GSQA 2FNOA 3IAM2 1Z3EA 1V9WA 2XPDA 3GH6A 2FD3A 1H4OA 2MZCA 3D4TA 2MBTA 1H75A 1AC1A 1K0MA 2LKUA 4GTUA 1SL0B 1MEKA 4EF0A 1QUWA 4KH7A 5GSSA 1A24A 2K9FA 2CX4A 2DBCA 1XVQA 2JL4A 3JCML 4N0VA 2H75A 2PMTA 4TRXA 3TOTA 5G5FA 1HQOA 3KEBA 4YQVA 1Z5YE 3VWUA 2WGRA 1ILOA 4IELA 3LJRA 3FK8A 5COHA 2NDOA 1THOA 3TKSE 4YQUA 1WE0A 1B4QA 2IN3A 1Y6EA 3D0ZA 1K3OA 3TJBA 1OC9B 3US3A 5E4WA 3QPMA 1J08A 5IMDA 2FWHA 2GQKA 1E6BA 4ICYA 2J9HA 2PPTA 3HHVA 1GNEA 3R2QA 2CVDA 1MD3A 2NBSA 2H6ZA 1TK8B 3UEMA 1VF3A 2R0PA 2GSQA 1YDKA 3P2AA 3FZ9A 1TW9A 2CX3A 4YQMA 5DALA 5KN0A 1ML6A 1G7EA 1PN9A 2F9SA 5F05A 2WRTA 4EIPA 3GSTA 4F03A 11GSA 3UVTA 1ZYQB 2YPMA 2N5BA 1ZGNA 2B1KA 5ECHB 3TJGA 2WJUA 5GZZB 1U3AA 4BVXA 1K0DA 2IMKA 2L4QA 3UIWA 1K0AA 3I69A 3MSZA 4TR1A 1G6YA 1K0BA 2H1AA 1A0RP 3EMPA 2L4CA 1T1VA 2FWGA 2VCQA 3W8JA 1BAYA 1SJIA 5ECLB 5D8IA 1SK1A 4BPYA 4L0WA 1MDKA 2H72A 2AB6A 3IK9A 2NTOA 1YF0A 1XWGA 4MP4A 1OC9A 4K0GA 5IOXA 4XHMA 2L57A 7GSSA 2CVKA 4GSSA 3D22A 3KJYA 5AISA 3UARA 2EIOA 2TIRA 4MZBA 4MF5A 3VWXA 2H0IA 1J0FA 3PH9A 1S3DA 4JBBA 3F4SA 4WBRD 4A5PA 2KP2A 6GSXA 2HSMA 1OKDA 2GDRA 3IC8A 3KM6A 3MNGA 3M3MA 3MWHA 4H86A 2OJLA 1FVKA 1TRUA 2VCZA 2H01A 5IMZA 1BEDA 2AHEA 5DAKA 2DIZA 3F0IA 2DJ1A 3MYDA 2DIYA 5D9XA 3A2WA 1TOFA 4Z7XA 1XWAA 2I1UA 1USBA 5IO0A 3TJKA 3IE3A 1S3RA 2QKEA 3GN3A 4ZL9A 1SENA 1XBSA 2XPEA 3KMOA 4HDEA 16GSA 2YOIA 5HR3A 2VL3A 4WR4A 3MAKA 1GWCA 2L5OA 1GSYA 1GSFA 2VUPA 4L5OA 2VM2A 2ES7A 3HJOA 2L6DA 5G5EA 2B5YA 3CTGA 1TXXA 4HSCX 4CY6A 1TU7A 1Y25A 4PTSA 5ECSA 5BRTA 4L8EA 5G30A 5ECIB 1ERTA 2PVOC 22GSA 5CRGA 1HYUA 3UOMA 2TRCP 4MH3A 3CSHA 1YJ6A 2YN1A 3IXRA 5BMUA 4K7NA 1GSSA 2KLXA 3EYTA 20GSA 1OE8A 3CRUA 3M1GA 1SD9A 2H66A 2YZUA 4PQ1A 3A3TA 4F0CA 4PGTA 1N2AA 3TDGA 5KOWA 1N8JA
chains in the Genus database with same CATH topology
1VF2A 2JACA 4L5LA 4RI6A 1K3LA 4N0ZA 2LQOA 1F2EA 2HI7A 2ON5A 3DMLA 1ABAA 4K7OA 5G2ZA 2VLUA 2YJ7A 3D5JA 3HVSA 2O7KA 2FWEA 3LYPA 4L0UA 1XWBA 1MDJA 2MBSA 5G31A 2X8HA 1KNGA 3NOFA 3EURA 1PKZA 1YEXA 1YY7A 2IMFA 1O81A 3TKSC 3PINA 3GX0A 5CYYA 2LNSA 1SK0A 4DSQA 5A5KA 3O6TA 3F9UA 4WETA 4PX1A 14GSA 1PRXA 3VWVA 4HZ4A 2NVLA 3ZREA 4ZBDA 3QAWA 5IM9A 2G2QA 3LGCA 2YJHA 3ERFA 2CZ2A 2A2SA 4OWYA 4POLA 3GRXA 5F0GA 2FUG2 2VCWA 4MPGA 3KIJA 2FHEA 3ZITA 4ECIA 4EVMA 3TKSA 4QQ7A 2VCVA 1VF1A 5JWOB 1AXDA 2H19A 1BQ7A 5HFKA 3ZIJA 2CAIA 1VF4A 3P90A 3WGXA 2A4VA 2IMIA 4FQUA 2GLRA 6GSUA 4LL4B 2H71A 4BWQA 4MJBA 4AJ6A 3GTUB 4F2IA 4YKFA 5ECRB 1PQNA 4WXTA 1YQ1A 1XOAA 3PGTA 1AW9A 1ACVA 1A2JA 1O8XA 2WFCA 3NIVA 3D6IA 4ZBAA 4TVEA 4DSSA 1U88A 2DLXA 4ECBA 2CQ9A 4KDYA 1M2AA 5IIZA 4WF5A 1GTBA 1SL2B 5IOWA 2HE3A 2HZFA 2JZRA 1EEJA 4O5RA 6GSWA 4MJAA 1LU4A 1NM3A 1G7OA 2VD0A 3KTBA 3KXOA 1K3YA 2LRCA 3CYNA 4IGJA 1F37A 1EV9A 3DYRA 4TR0A 3UBKA 2HRFA 4PURA 2GTUA 3QMXA 2K18A 1ZYPA 2YWOA 3Q74A 3QR6A 1K0NA 4XCSA 2H0GA 1PX6A 3UMAA 2X8GA 1ZMAA 1JZWA 3DIEA 4G19A 2X64A 2OADA 4IS0A 2AAWA 2OBKA 3EINA 2RIIA 4G9HA 3EVIA 1FOHA 4JR4A 4MJEA 3HDCA 3HYPA 2L6CA 1HNAA 2GQLA 4IW9A 4BWSA 2IJYA 2YWIA 2HRAA 1RK4A 3W6GA 2GSRA 1XIYA 12GSA 2YV7A 3FHKA 3E0UA 5A4WA 3KH9A 2OBIA 5F06A 4KAEA 2MMZA 5LCZA 2VCXA 4WF4A 5HR1A 4Z2UA 2O89A 4MF6A 4JRRA 2DJ0A 4HJ2A 4NHWA 4MZWA 3WYWA 8GSSA 1C72A 1WIKA 1T4ZA 3VLNA 1GLPA 3L9UA 1UA5A 1EZKA 3GYKA 5ECPB 5ECQB 4O7HA 4KF9A 5J4UA 3HA9A 2JSZA 3ZZXA 2A2PA 3TUEA 4HQSA 2OA7A 2REMA 3LYKA 4JEDA 5IMCA 1Z6NA 3IHGA 2LNTA 4J2FA 5F8BA 2H6YA 1ON4A 3WGEA 1ERWA 2KP1A 1M0UA 3SBCA 1IYHA 2P31A 3UL3A 3TB2A 4G2EA 1QGVA 4DSRA 5EY6A 4MABA 2OE3A 5L71A 3FR3A 4MF7A 2HZEB 1GTAA 1GNWA 5C00A 1I9DA 3F3RA 3HJPA 1Z7PA 1AUCA 4X0XA 4K5RA 2LQQA 4POMA 5ECOB 5B8BA 4HEA2 4HU9A 1THXA 1WRYA 3FMWA 2F8FA 4JR6A 4YAPA 1X9WB 2GZZA 4WEYA 1FB6A 1GSEA 1GTIA 1PA3A 2FLSA 4JZQA 1I5GA 3IR4A 1AIUA 1FG4A 2PGTA 1JHBA 4O32A 2O87A 3LW9A 5CO3A 3H93A 4IKHA 5GAPD 3QAVA 2V6KA 2C4JA 1V40A 3IV4A 2K8SA 1XW5A 4K8MA 2HRNA 2VAFA 3L78A 1QMVA 1OC3A 1WOUA 1TKDB 2B7JA 1BYEA 1SYRA 3IC4A 1A8LA 3RPPA 3C73A 3IPZA 1TU8A 3R3EA 4HS1A 4KCEA 3H4KA 1JFUA 3RDWA 4V2MA 2VL9A 3DEXA 4OFNA 2XHFA 4Q5NA 3LWAA 3W8SA 3UVHA 1XWCA 3RHCA 1B4PA 3VI5A 2XC2A 2JU5A 4I2UA 1ZZYA 3EU3A 4PUFC 5INYA 4HU7A 2IPAA 3WD6A 4ZB8A 2HZEA 3KD0A 1M2BA 4GQFA 3Q18A 1A2MA 2AV4A 3H1NA 6GSVA 2QA1A 4TXOB 2VCTA 3KTLA 5IQYA 4TW5A 2VD1A 4QL9A 5H5SA 1EGRA 3IDVA 4GF0A 2FA8A 1XWKA 4KDXA 5ABRA 1W89A 1Z9HA 5DQYA 3O3TA 1PD21 1OKTA 5DJLA 6GSTA 2C0GA 2O85A 4BL7B 4F9ZA 3GKMA 4KX4A 10GSA 1T7PB 4P3YB 1QFNA 2HSHA 1PSQA 2WDUA 2L5LA 3QD9A 4J56E 2GZPA 1YEPA 3QCPA 4PNFA 4D73B 2X4AA 1UN2A 3VWWA 2MMNA 3BOAA 3FYGA 1BX9A 5IMFA 3FZAA 4JU5A 1PL2A 3CTFA 4GLTA 3F63A 5HQPA 2C8UA 1X5EA 3EU4A 2DJ2A 2JADA 5H5QA 3F6DA 3BCKA 3CRTA 1TI3A 4ZB6A 2GVPA 4K5SA 3L4NA 4I5QA 4TN8A 3G9BA 5EL8A 3FR6A 2HT9A 4EUYA 5ID2B 3F4TA 2GSSA 2C3NA 4ID0A 1LBKA 2WS2A 3LG6A 1PMTA 1VRSD 1O8WA 2WCIA 3WT2A 3ZVJD 3VURA 4PQIA 2H8LA 2I9HA 4FIWA 5GAND 4I6XA 1O85A 1R7HA 5DQSA 1DSBA 4RUVA 2YNXA 2PU9C 5A4VA 5D9TA 1WWJA 3HY2A 2X49A 3DGQA 1EP8A 1EV4A 4NV2A 19GSA 3QFAC 3GX8A 1X9MB 3D4MA 3GL5A 3GMFA 2QGVA 1M99A 2DKHA 3ED3A 2LUSA 3S9FA 1ZYNA 1HNCA 4IHUA 4D73A 4GXZA 2CT6A 3TRXA 1UVZA 2K6VA 2H1DA 5J5NA 2CAQA 4F0BA 2IWTA 1SK2A 4PQHA 3C1RA 1NHOA 5IO2A 3V1WA 3TKQA 5KOXA 1ZL9A 3C1SA 2RM5A 1QQ2A 2ZUPA 2C0DA 2B5EA 2GQMA 3J7Yk 1DBYA 3BCIA 3DD3A 5J3RA 3F8UA 1GP1A 3GL3A 1F9MA 4POKA 3GKXA 3HVVA 3KP9A 1G6WA 3HXSA 3TJJA 3ERWA 1YKAA 5JCGA 3DKSA 3CMIA 4MH2A 9GSSA 1SKRB 4HUAA 3LQ7A 4E8EA 5ID2A 2M72A 3TRPA 3DVWA 2FGXA 4WKWA 3SWLA 2VM1A 2O8VB 5ENUA 3A5IA 3ZMLA 4NXIA 1HD2A 2OKAA 2EIQA 4IN0A 1TJDA 4YAVA 4ZB9A 4TOPA 1PGTA 3TRQA 4GSNA 2C0EA 1OYJA 4J57E 5GSTA 4ECJA 5A4UA 1Q98A 2E2MA 2BTOT 4GWRA 4BVYB 3ME8A 3EE2A 3ERGA 4FYBA 2H1GA 1B9YC 5E59A 1SKWB 2GT6A 1EP7A 2LSTA 2MYGA 2A2RA 2D2ZA 1AQVA 2WB9A 2YWMA 3HZ4A 4WR5A 3WT1A 4OMVA 2DSAA 2PVQA 4HJMA 4K2DA 1Q4JA 1FHEA 5AN1A 3A2XA 4EKZA 2YP6A 3APQA 1F3AA 2H30A 3P8WA 2GSTA 1XZOA 5JWRB 1TI1A 3EPTA 3RPNA 3KH7A 3LXTA 2YZHA 1SYXA 4G0LA 3GHAA 4NHZA 4MK3A 1T00A 4XRAA 4OFMA 4NMUA 18GSA 1XPVA 3LXZA 4FO5A 1URMA 4K0NA 1YF1A 1EWXA 1WJKA 2RLIA 1HNBA 1X5DA 5ECNB 2C1YA 3E9JB 5DDLA 5HFIA 1JLWA 3KCMA 1R26A 2H1BA 2RUFA 3ZFLA 3F3QA 3EC3A 2B1LA 2GS3A 1X0RA 3EWLA 5J9BA 2M80A 4QL7A 2XBIA 4XIHA 4XRDA 2DKIA 3UBLA 4EDZA 2V41A 1GUKA 4EXJA 4ML1A 3CXGA 3F6FA 1A2LA 2NPBA 3KZQA 4ZBBA 3G7IA 3VPQA 1OVNA 3DRNA 4KCAA 4OCFA 3RBTA 2YANA 2KHPA 2VOCA 3ZMKA 1XW9A 1KTEA 2LEGA 1JZOA 3U6VA 4IP6A 1IYIA 1R4WA 4XTSA 1MTCA 3I6AA 1B9XC 4KE3A 2C3TA 4G10A 1JZRA 2DMLA 3VK9A 5KN3A 4LMVA 2ZNMA 2LJAA 6GSYA 5DVBA 3GTUA 1DE1A 2HFDA 2C0FA 1XW6A 4IQAA 4OO5A 4ACSA 2R4VA 4MZCA 5KN2A 1GRXA 3BD2A 1FB0A 2FA4A 4HZ2A 3VFIA 1GSUA 2M46A 3Q6OA 3BBYA 3IAS2 4KSOA 3ZVJA 4K2XA 4OCEA 1CQHA 4EO3A 5DALB 2H70A 3IHQA 2VIMA 3IOSA 2IIYA 1O7UA 5G1KA 2V1MA 2P5QA 1M9BA 1PX7A 1XXUA 4YH2A 1OE7A 4AJ8A 4OFTA 4OO4A 5KEJA 1B48A 4AF2A 4FYCA 2R37A 5IPHA 4BVXB 5JCWA 3D21A 2LRTA 3IK7A 4MCUA 4TR1B 1JLVA 4MPFA 2DJ3A 4HOJA 1WP0A 1BJXA 2V32A 3M9KA 1XFLA 3TGZA 1FW1A 1W4VA 3RAZA 3EMXA 2H76A 1ZCPA 2OE1A 2QSIA 2XBQA 2LJRA 3DWVA 3GKNA 1T8EB 3FW2A 2GT5A 2N5FA 2PN8A 1VGLA 3AY8A 3A2VA 5B8AA 1FO5A 1E2YA 2L59A 1V2AA 3CSIA 4E8HA 1AQXA 3UJ1A 2HXKA 1PKWA 4YKGA 4ISDA 1BG5A 1S3AA 3ME7A 3QOUA 1CQGA 1F6MC 4CHSA 1EGOA 4TR4A 3ZTLA 5AIVA 4BA7A 2LV3A 2IMEA 3GV1A 2LTKA 3FRCA 2PWJA 2R5GA 1DE2A 3A5WA 5DAKB 2CZ3A 1NHYA 2ALBA 5F07A 2TRXA 2PUKC 2LJKA 1V58A 1SU9A 4KDUA 3DVXA 5CRWA 1EEMA 2HRKA 2EC4A 3FZ5A 5JWQB 4EIQA 2YWNA 2WULA 3PR8A 1OAZA 2C3QA 1GL8A 1TRWA 1TDIA 3IBHA 3GIXA 3ZLPA 1ZYEA 1YZXA 2H74A 4AGSA 4IVFA 3HZ8A 5CNWA 4N11A 1NSWA 3L9SA 1QXHA 2UZ8A 2F51A 4KW6A 4Q5QA 5ELAA 3GNJA 2V2GA 4ML6A 2E0QA 4ZIJA 2JSYA 5AIXA 3K8NA 4V2NA 4AJ7A 3GSSA 3HJMA 1A8YA 4TKYA 4KGIA 2F8AA 4V2LA 2HLSA 4LLRA 4NAXA 4I2TA 3APSA 1A23A 3C7MA 2OE0A 4USSA 3GURA 1M7TA 4MMMA 2RUEA 1XVWA 1AQWA 2HSYA 5D73A 1ERVA 4POBA 3ZIVA 1PN0A 3QFBC 2R2JA 1O6JA 2VL2C 3ISOA 4Q5RA 4GCIA 4RI7A 5FT3A 1RQMA 4TR3A 3MDKA 2H73A 3GKKA 3WGDA 2IFQB 4GSTA 1K0OA 2FCHA 1X5CA 1NW2A 3E3EA 4MDCA 1T4YA 1EOHA 3HCZA 4ULXA 1DUGA 5DJMA 2E2GA 3TKPA 2R0CA 2HYXA 4K1FA 3LSZA 3FEUA 2A4HA 2VL2A 1V98A 4TXOA 5DBQA 3LFLA 1JZDA 1Z6MA 2RM6A 5HFGA 2H6XA 1Z7RA 1TP9A 4Q5FA 2BJXA 2LRNA 4ILFA 1XOBA 3LEFA 2VLVA 4IBPA 2R0GA 5JCUA 4LMWA 2BMXA 5ECKB 4BL7A 2B6MA 4CDOA 3APOA 1G0TA 4EC0A 1EOGA 2R3XA 2P0GA 4JE1A 4LL1B 1ZOFA 2ZCTA 1WPIA 4O92A 5LNKe 4NPBA 1QK8A 3ZYWA 5CREA 3I43A 1ERUA 4G0IA 4HI7A 4ZXGA 4TXVA 4PUAA 2MMOA 5B7CA 5FWGA 2MMAA 4WBJA 4V1Ap 3O76A 1GUHA 3HKRA 2VO4A 2OACA 3TKRA 2I4AA 1S3CA 5B6NA 1GLQA 4OD7A 5D93A 1RW1A 2C80A 2DMMA 4K7IA 1M2DA 4F82A 5J41A 1KEBA 3I9V2 3GFKA 2DJKA 4DSSB 5EVOA 4EDYA 4O5QA 5LD0A 2IFQA 1U87A 1MDIA 4X43A 4MLYA 1SKSB 4MA9A 2X99A 5HR2A 1OC8A 3QDNA 4LA1A 2H0HA 2AUVA 2QC7A 2AJQB 2FWFA 2ON7A 5FHIA 2I81A 2V6OA 3KGKA 1TTZA 3ZL5A 2DC5A 4IQ1A 3L9VA 2KUCA 3PPUA 3N9JA 4XS1A 3L0HA 4MNNA 3C71A 3HVXA 5CP1A 4CY8A 1GTUA 5HR0A 1U3IA 3J7Yb 2IMDA 4ZILA 4X4JA 4EL1A 2DJJA 4K6XA 3RHBA 4ZL8A 3KP8A 1F3BA 1TRVA 4G0KA 3QAGA 4IJIA 1GSDA 5J9CA 2CVBA 4EE0A 4IP1A 3BJ5A 5C04A 5DCHA 3TOUA 5CRHA 3GA4A 3F4RA 5EPFA 3CBUA 3CSJA 3U5RE 3ZFBA 3FKFA 3FY7A 1V57A 2B5XA 1J9BA 5D9WA 4DEJA 3TJFA 5G1LA 2HNLA 4NV5A 4GQCA 4GRFA 2VLTA 3TCOA 4Z2TA 4KUNA 5H5RA 2CA8A 3ZRDA 2WZ9A 4O5UA 1SD8A 3VPTA 1U6TA 4NWYA 4ZL7A 4N30A 5DCGA 1FOVA 3G7YA 1GH2A 2I3YA 3H8QA 5CAXA 2N5AA 4KB3A 5IMAA 4XS4B 2IL3A 3GUSA 1AAZA 1O73A 3M8NA 2EIRA 2YCDA 4RQXA 1A0FA 3IA1A 1SL1B 1GUMA 4ECCA 17GSA 1B8XA 2X8CA 4BVYA 3M0FA 2AYTA 4XS6A 1WMJA 1TK0B 1XCCA 1KBNA 5AGYA 2G0FA 4N10A 4FYUA 2J23A 1R5PA 2JZSA 5D96A 1FVJA 3FR9A 4KA0A 1TRSA 1FAAA 3IRAA 2QA2A 1MD4A 1YKCA 3DXBA 5IPGA 6GSSA 3P7XA 4X1UA 4PXOA 2KOKA 4I97A 5CRDA 4I8BA 2K8VA 5D9VA 3FZ4A 2R6KA 1K0CA 3HD5A 3LORA 3GH9A 1UC7A 1LJRA 2PBJA 2JZTA 4K9ZA 4MJCA 1T3BA 1GULA 2E7PA 3G7JA 3M9JA 3Q19A 4Z2RA 5B6MA 13GSA 4IJ3A 4FH8A 5IMVA 3KMNA 2FY6A 2P5RA 3H79A 3N5OA 1SJ6A 5ECMB 1ST9A 1SJZA 2B3SA 2Z9SA 1X9SB 3UAPA 4RQRA 2PERA 4CW9A 5KN1A 3C8EA 2CV4A 2B7KA 3VI7A 4KNDA 2GGTA 1TK5B 1R5AA 3OR5A 4V1Ag 1M9AA 2GZYA 4HQZA 3MIXA 4DVCA 4XS4A 1PL1A 2F3MA 2YV9A 3NZNA 4KSMA 5ELGA 4PNGA 2LS5A 1GSQA 2FNOA 3IAM2 1Z3EA 1V9WA 2XPDA 3GH6A 2FD3A 1H4OA 2MZCA 3D4TA 2MBTA 1H75A 1AC1A 1K0MA 2LKUA 4GTUA 1SL0B 1MEKA 4EF0A 1QUWA 4KH7A 5GSSA 1A24A 2K9FA 2CX4A 2DBCA 1XVQA 2JL4A 3JCML 4N0VA 2H75A 2PMTA 4TRXA 3TOTA 5G5FA 1HQOA 3KEBA 4YQVA 1Z5YE 3VWUA 2WGRA 1ILOA 4IELA 3LJRA 3FK8A 5COHA 2NDOA 1THOA 3TKSE 4YQUA 1WE0A 1B4QA 2IN3A 1Y6EA 3D0ZA 1K3OA 3TJBA 1OC9B 3US3A 5E4WA 3QPMA 1J08A 5IMDA 2FWHA 2GQKA 1E6BA 4ICYA 2J9HA 2PPTA 3HHVA 1GNEA 3R2QA 2CVDA 1MD3A 2NBSA 2H6ZA 1TK8B 3UEMA 1VF3A 2R0PA 2GSQA 1YDKA 3P2AA 3FZ9A 1TW9A 2CX3A 4YQMA 5DALA 5KN0A 1ML6A 1G7EA 1PN9A 2F9SA 5F05A 2WRTA 4EIPA 3GSTA 4F03A 11GSA 3UVTA 1ZYQB 2YPMA 2N5BA 1ZGNA 2B1KA 5ECHB 3TJGA 2WJUA 5GZZB 1U3AA 4BVXA 1K0DA 2IMKA 2L4QA 3UIWA 1K0AA 3I69A 3MSZA 4TR1A 1G6YA 1K0BA 2H1AA 1A0RP 3EMPA 2L4CA 1T1VA 2FWGA 2VCQA 3W8JA 1BAYA 1SJIA 5ECLB 5D8IA 1SK1A 4BPYA 4L0WA 1MDKA 2H72A 2AB6A 3IK9A 2NTOA 1YF0A 1XWGA 4MP4A 1OC9A 4K0GA 5IOXA 4XHMA 2L57A 7GSSA 2CVKA 4GSSA 3D22A 3KJYA 5AISA 3UARA 2EIOA 2TIRA 4MZBA 4MF5A 3VWXA 2H0IA 1J0FA 3PH9A 1S3DA 4JBBA 3F4SA 4WBRD 4A5PA 2KP2A 6GSXA 2HSMA 1OKDA 2GDRA 3IC8A 3KM6A 3MNGA 3M3MA 3MWHA 4H86A 2OJLA 1FVKA 1TRUA 2VCZA 2H01A 5IMZA 1BEDA 2AHEA 5DAKA 2DIZA 3F0IA 2DJ1A 3MYDA 2DIYA 5D9XA 3A2WA 1TOFA 4Z7XA 1XWAA 2I1UA 1USBA 5IO0A 3TJKA 3IE3A 2QKEA 3GN3A 4ZL9A 1SENA 1XBSA 2XPEA 3KMOA 4HDEA 16GSA 2YOIA 5HR3A 2VL3A 4WR4A 3MAKA 1GWCA 2L5OA 1GSYA 1GSFA 2VUPA 4L5OA 2VM2A 2ES7A 3HJOA 2L6DA 5G5EA 2B5YA 3CTGA 1TXXA 4CY6A 1TU7A 1Y25A 4PTSA 5ECSA 5BRTA 4L8EA 5G30A 5ECIB 1ERTA 2PVOC 22GSA 5CRGA 1HYUA 3UOMA 2TRCP 4MH3A 3CSHA 1YJ6A 2YN1A 3IXRA 5BMUA 4K7NA 1GSSA 2KLXA 3EYTA 20GSA 1OE8A 3CRUA 3M1GA 1SD9A 2H66A 2YZUA 4PQ1A 3A3TA 4F0CA 4PGTA 1N2AA 3TDGA 5KOWA 1N8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VF2 A;  2JAC A;  4L5L A;  4RI6 A;  1K3L A;  4N0Z A;  2LQO A;  1F2E A;  2HI7 A;  2ON5 A;  3DML A;  1ABA A;  4K7O A;  5G2Z A;  2VLU A;  2YJ7 A;  3D5J A;  3HVS A;  2O7K A;  2FWE A;  3LYP A;  4L0U A;  1XWB A;  1MDJ A;  2MBS A;  5G31 A;  2X8H A;  1KNG A;  3NOF A;  3EUR A;  1PKZ A;  1YEX A;  1YY7 A;  2IMF A;  1O81 A;  3TKS C;  3PIN A;  3GX0 A;  5CYY A;  2LNS A;  1SK0 A;  4DSQ A;  5A5K A;  3O6T A;  3F9U A;  4WET A;  4PX1 A;  14GS A;  1PRX A;  3VWV A;  4HZ4 A;  2NVL A;  3ZRE A;  4ZBD A;  3QAW A;  5IM9 A;  2G2Q A;  3LGC A;  2YJH A;  3ERF A;  2CZ2 A;  2A2S A;  4OWY A;  4POL A;  3GRX A;  5F0G A;  2FUG 2;  2VCW A;  4MPG A;  3KIJ A;  2FHE A;  3ZIT A;  4ECI A;  4EVM A;  3TKS A;  4QQ7 A;  2VCV A;  1VF1 A;  5JWO B;  1AXD A;  2H19 A;  1BQ7 A;  5HFK A;  3ZIJ A;  2CAI A;  1VF4 A;  3P90 A;  3WGX A;  2A4V A;  2IMI A;  2GLR A;  6GSU A;  4LL4 B;  2H71 A;  4BWQ A;  4MJB A;  4AJ6 A;  3GTU B;  4F2I A;  5ECR B;  1PQN A;  4WXT A;  1YQ1 A;  1XOA A;  3PGT A;  1AW9 A;  1ACV A;  1A2J A;  1O8X A;  2WFC A;  3NIV A;  3D6I A;  4ZBA A;  4TVE A;  4DSS A;  1U88 A;  2DLX A;  4ECB A;  2CQ9 A;  4KDY A;  1M2A A;  5IIZ A;  4WF5 A;  1GTB A;  1SL2 B;  5IOW A;  2HE3 A;  2HZF A;  2JZR A;  1EEJ A;  4O5R A;  6GSW A;  4MJA A;  1LU4 A;  1NM3 A;  1G7O A;  2VD0 A;  3KTB A;  3KXO A;  1K3Y A;  2LRC A;  3CYN A;  4IGJ A;  1F37 A;  1EV9 A;  3DYR A;  4TR0 A;  3UBK A;  2HRF A;  4PUR A;  2GTU A;  3QMX A;  2K18 A;  2YWO A;  3Q74 A;  3QR6 A;  1K0N A;  4XCS A;  2H0G A;  1PX6 A;  3UMA A;  2X8G A;  1ZMA A;  1JZW A;  3DIE A;  4G19 A;  2X64 A;  2OAD A;  4IS0 A;  2AAW A;  2OBK A;  3EIN A;  2RII A;  4G9H A;  3EVI A;  4JR4 A;  4MJE A;  3HDC A;  3HYP A;  2L6C A;  1HNA A;  2GQL A;  4IW9 A;  4BWS A;  2IJY A;  2YWI A;  1RK4 A;  3W6G A;  2GSR A;  1XIY A;  12GS A;  2YV7 A;  3FHK A;  3E0U A;  5A4W A;  3KH9 A;  2OBI A;  5F06 A;  4KAE A;  2MMZ A;  5LCZ A;  2VCX A;  4WF4 A;  5HR1 A;  2O89 A;  4MF6 A;  4JRR A;  2DJ0 A;  4HJ2 A;  4NHW A;  4MZW A;  3WYW A;  8GSS A;  1C72 A;  1WIK A;  1T4Z A;  3VLN A;  1GLP A;  3L9U A;  1UA5 A;  1EZK A;  3GYK A;  5ECP B;  5ECQ B;  4O7H A;  5J4U A;  3HA9 A;  2JSZ A;  3ZZX A;  3TUE A;  4HQS A;  2OA7 A;  2REM A;  3LYK A;  4JED A;  5IMC A;  1Z6N A;  2LNT A;  4J2F A;  5F8B A;  2H6Y A;  1ON4 A;  3WGE A;  1ERW A;  2KP1 A;  1M0U A;  3SBC A;  1IYH A;  2P31 A;  3UL3 A;  3TB2 A;  4G2E A;  1QGV A;  4DSR A;  5EY6 A;  4MAB A;  2OE3 A;  5L71 A;  3FR3 A;  4MF7 A;  2HZE B;  1GTA A;  1GNW A;  5C00 A;  1I9D A;  3F3R A;  3HJP A;  1Z7P A;  1AUC A;  4X0X A;  2LQQ A;  4POM A;  5ECO B;  5B8B A;  4HEA 2;  4HU9 A;  1THX A;  1WRY A;  4YAP A;  2F8F A;  4JR6 A;  1X9W B;  2GZZ A;  4WEY A;  1FB6 A;  1GSE A;  1GTI A;  1PA3 A;  2FLS A;  4JZQ A;  1I5G A;  3IR4 A;  1AIU A;  1FG4 A;  2PGT A;  1JHB A;  4O32 A;  2O87 A;  5CO3 A;  3H93 A;  4IKH A;  5GAP D;  3QAV A;  2V6K A;  2C4J A;  1V40 A;  3IV4 A;  2K8S A;  1XW5 A;  4K8M A;  2HRN A;  2VAF A;  3L78 A;  1QMV A;  1OC3 A;  1WOU A;  1TKD B;  2B7J A;  1BYE A;  1SYR A;  3IC4 A;  1A8L A;  3RPP A;  3C73 A;  3IPZ A;  1TU8 A;  4HS1 A;  4KCE A;  3H4K A;  1JFU A;  3RDW A;  4V2M A;  2VL9 A;  3DEX A;  4OFN A;  2XHF A;  4Q5N A;  3LWA A;  3W8S A;  3UVH A;  1XWC A;  3RHC A;  1B4P A;  3VI5 A;  2XC2 A;  2JU5 A;  4I2U A;  1ZZY A;  3EU3 A;  4PUF C;  5INY A;  4HU7 A;  2IPA A;  3WD6 A;  4ZB8 A;  2HZE A;  3KD0 A;  1M2B A;  4GQF A;  3Q18 A;  1A2M A;  2AV4 A;  3H1N A;  6GSV A;  4TXO B;  2VCT A;  3KTL A;  5IQY A;  4TW5 A;  2VD1 A;  4QL9 A;  5H5S A;  1EGR A;  3IDV A;  4GF0 A;  2FA8 A;  1XWK A;  4KDX A;  5ABR A;  1W89 A;  1Z9H A;  5DQY A;  3O3T A;  1PD2 1;  1OKT A;  5DJL A;  6GST A;  2C0G A;  2O85 A;  4F9Z A;  3GKM A;  4KX4 A;  10GS A;  1T7P B;  4P3Y B;  1QFN A;  2HSH A;  1PSQ A;  2WDU A;  2L5L A;  3QD9 A;  4J56 E;  2GZP A;  1YEP A;  3QCP A;  4PNF A;  4D73 B;  1UN2 A;  3VWW A;  2MMN A;  3BOA A;  3FYG A;  1BX9 A;  5IMF A;  3FZA A;  4JU5 A;  1PL2 A;  3CTF A;  4GLT A;  3F63 A;  5HQP A;  2C8U A;  1X5E A;  3EU4 A;  2DJ2 A;  2JAD A;  5H5Q A;  3F6D A;  3BCK A;  3CRT A;  1TI3 A;  4ZB6 A;  2GVP A;  3L4N A;  4I5Q A;  4TN8 A;  3G9B A;  5EL8 A;  3FR6 A;  2HT9 A;  4EUY A;  5ID2 B;  3F4T A;  2GSS A;  2C3N A;  4ID0 A;  1LBK A;  2WS2 A;  3LG6 A;  1PMT A;  1VRS D;  1O8W A;  2WCI A;  3WT2 A;  3ZVJ D;  3VUR A;  4PQI A;  2H8L A;  2I9H A;  4FIW A;  5GAN D;  4I6X A;  1O85 A;  1R7H A;  5DQS A;  1DSB A;  4RUV A;  2YNX A;  2PU9 C;  5A4V A;  5D9T A;  1WWJ A;  3HY2 A;  3DGQ A;  1EP8 A;  1EV4 A;  4NV2 A;  19GS A;  3QFA C;  3GX8 A;  1X9M B;  3D4M A;  3GL5 A;  3GMF A;  2QGV A;  1M99 A;  3ED3 A;  2LUS A;  3S9F A;  1HNC A;  4IHU A;  4D73 A;  4GXZ A;  2CT6 A;  3TRX A;  1UVZ A;  2K6V A;  2H1D A;  5J5N A;  2CAQ A;  4F0B A;  2IWT A;  1SK2 A;  4PQH A;  3C1R A;  1NHO A;  5IO2 A;  3V1W A;  3TKQ A;  1ZL9 A;  3C1S A;  2RM5 A;  1QQ2 A;  2ZUP A;  2C0D A;  2B5E A;  2GQM A;  3J7Y k;  1DBY A;  3BCI A;  3DD3 A;  5J3R A;  3F8U A;  1GP1 A;  3GL3 A;  1F9M A;  4POK A;  3GKX A;  3HVV A;  3KP9 A;  1G6W A;  3HXS A;  3TJJ A;  3ERW A;  1YKA A;  5JCG A;  3DKS A;  3CMI A;  4MH2 A;  9GSS A;  1SKR B;  4HUA A;  3LQ7 A;  4E8E A;  5ID2 A;  2M72 A;  3TRP A;  3DVW A;  2FGX A;  4WKW A;  3SWL A;  2VM1 A;  2O8V B;  5ENU A;  3ZML A;  4NXI A;  1HD2 A;  2OKA A;  2EIQ A;  4IN0 A;  1TJD A;  4YAV A;  4ZB9 A;  4TOP A;  1PGT A;  3TRQ A;  4GSN A;  2C0E A;  1OYJ A;  4J57 E;  5GST A;  4ECJ A;  5A4U A;  1Q98 A;  2E2M A;  2BTO T;  4GWR A;  3ME8 A;  3EE2 A;  3ERG A;  4FYB A;  2H1G A;  1B9Y C;  5E59 A;  1SKW B;  2GT6 A;  1EP7 A;  2LST A;  2MYG A;  2A2R A;  2D2Z A;  1AQV A;  2WB9 A;  2YWM A;  3HZ4 A;  4WR5 A;  3WT1 A;  4OMV A;  2DSA A;  2PVQ A;  4HJM A;  4K2D A;  1Q4J A;  1FHE A;  5AN1 A;  3A2X A;  4EKZ A;  2YP6 A;  3APQ A;  1F3A A;  2H30 A;  3P8W A;  2GST A;  1XZO A;  5JWR B;  1TI1 A;  3RPN A;  3KH7 A;  3LXT A;  2YZH A;  1SYX A;  3GHA A;  4NHZ A;  4MK3 A;  1T00 A;  4XRA A;  4OFM A;  4NMU A;  18GS A;  1XPV A;  3LXZ A;  4FO5 A;  1URM A;  4K0N A;  1YF1 A;  1EWX A;  1WJK A;  2RLI A;  1HNB A;  1X5D A;  5ECN B;  2C1Y A;  3E9J B;  5DDL A;  5HFI A;  1JLW A;  3KCM A;  1R26 A;  2H1B A;  2RUF A;  3ZFL A;  3F3Q A;  3EC3 A;  2B1L A;  2GS3 A;  1X0R A;  3EWL A;  5J9B A;  2M80 A;  4QL7 A;  2XBI A;  4XIH A;  4XRD A;  3UBL A;  4EDZ A;  2V41 A;  1GUK A;  4EXJ A;  4ML1 A;  3CXG A;  3F6F A;  1A2L A;  2NPB A;  3KZQ A;  4ZBB A;  3G7I A;  3VPQ A;  1OVN A;  3DRN A;  4KCA A;  4OCF A;  3RBT A;  2YAN A;  2KHP A;  2VOC A;  3ZMK A;  1XW9 A;  1KTE A;  2LEG A;  1JZO A;  3U6V A;  4IP6 A;  1IYI A;  1R4W A;  4XTS A;  1MTC A;  3I6A A;  1B9X C;  4KE3 A;  2C3T A;  4G10 A;  1JZR A;  2DML A;  3VK9 A;  5KN3 A;  4LMV A;  2ZNM A;  2LJA A;  6GSY A;  5DVB A;  3GTU A;  1DE1 A;  2HFD A;  2C0F A;  1XW6 A;  4IQA A;  4OO5 A;  4ACS A;  2R4V A;  4MZC A;  5KN2 A;  1GRX A;  3BD2 A;  1FB0 A;  2FA4 A;  4HZ2 A;  3VFI A;  1GSU A;  2M46 A;  3Q6O A;  3BBY A;  3IAS 2;  4KSO A;  3ZVJ A;  4OCE A;  1CQH A;  4EO3 A;  5DAL B;  2H70 A;  3IHQ A;  2VIM A;  3IOS A;  2IIY A;  1O7U A;  5G1K A;  2V1M A;  2P5Q A;  1M9B A;  1PX7 A;  1XXU A;  4YH2 A;  1OE7 A;  4AJ8 A;  4OFT A;  4OO4 A;  5KEJ A;  1B48 A;  4AF2 A;  4FYC A;  2R37 A;  5IPH A;  5JCW A;  3D21 A;  2LRT A;  3IK7 A;  4MCU A;  4TR1 B;  1JLV A;  4MPF A;  2DJ3 A;  4HOJ A;  1WP0 A;  1BJX A;  2V32 A;  3M9K A;  1XFL A;  3TGZ A;  1FW1 A;  1W4V A;  3RAZ A;  3EMX A;  2H76 A;  1ZCP A;  2OE1 A;  2QSI A;  2XBQ A;  2LJR A;  3DWV A;  3GKN A;  1T8E B;  3FW2 A;  2GT5 A;  2N5F A;  2PN8 A;  1VGL A;  3AY8 A;  3A2V A;  5B8A A;  1FO5 A;  1E2Y A;  2L59 A;  1V2A A;  3CSI A;  4E8H A;  1AQX A;  3UJ1 A;  2HXK A;  1PKW A;  4ISD A;  1BG5 A;  1S3A A;  3ME7 A;  3QOU A;  1CQG A;  1F6M C;  4CHS A;  1EGO A;  4TR4 A;  3ZTL A;  5AIV A;  4BA7 A;  2LV3 A;  2IME A;  3GV1 A;  2LTK A;  3FRC A;  2PWJ A;  2R5G A;  1DE2 A;  3A5W A;  5DAK B;  2CZ3 A;  1NHY A;  2ALB A;  5F07 A;  2TRX A;  2PUK C;  2LJK A;  1V58 A;  1SU9 A;  4KDU A;  3DVX A;  5CRW A;  1EEM A;  2EC4 A;  3FZ5 A;  5JWQ B;  2YWN A;  2WUL A;  3PR8 A;  1OAZ A;  2C3Q A;  1GL8 A;  1TRW A;  1TDI A;  3IBH A;  3GIX A;  3ZLP A;  1ZYE A;  1YZX A;  2H74 A;  4AGS A;  4IVF A;  3HZ8 A;  5CNW A;  4N11 A;  1NSW A;  3L9S A;  1QXH A;  2F51 A;  4KW6 A;  4Q5Q A;  5ELA A;  3GNJ A;  2V2G A;  4ML6 A;  2E0Q A;  4ZIJ A;  2JSY A;  5AIX A;  3K8N A;  4V2N A;  4AJ7 A;  3GSS A;  3HJM A;  1A8Y A;  4TKY A;  4KGI A;  2F8A A;  4V2L A;  2HLS A;  4LLR A;  4NAX A;  4I2T A;  3APS A;  1A23 A;  3C7M A;  2OE0 A;  3GUR A;  1M7T A;  4MMM A;  2RUE A;  1XVW A;  1AQW A;  2HSY A;  5D73 A;  1ERV A;  4POB A;  3ZIV A;  3QFB C;  2R2J A;  1O6J A;  2VL2 C;  3ISO A;  4Q5R A;  4GCI A;  4RI7 A;  5FT3 A;  1RQM A;  4TR3 A;  3MDK A;  2H73 A;  3GKK A;  3WGD A;  2IFQ B;  4GST A;  1K0O A;  2FCH A;  1X5C A;  1NW2 A;  3E3E A;  4MDC A;  1T4Y A;  1EOH A;  3HCZ A;  4ULX A;  1DUG A;  5DJM A;  2E2G A;  3TKP A;  2HYX A;  4K1F A;  3LSZ A;  3FEU A;  2VL2 A;  1V98 A;  4TXO A;  5DBQ A;  3LFL A;  1JZD A;  1Z6M A;  2RM6 A;  5HFG A;  2H6X A;  1Z7R A;  1TP9 A;  4Q5F A;  2BJX A;  2LRN A;  4ILF A;  1XOB A;  3LEF A;  2VLV A;  4IBP A;  5JCU A;  4LMW A;  2BMX A;  5ECK B;  4BL7 A;  2B6M A;  4CDO A;  3APO A;  1G0T A;  4EC0 A;  1EOG A;  2R3X A;  2P0G A;  4JE1 A;  4LL1 B;  1ZOF A;  2ZCT A;  1WPI A;  4O92 A;  5LNK e;  4NPB A;  1QK8 A;  3ZYW A;  5CRE A;  3I43 A;  1ERU A;  4HI7 A;  4ZXG A;  4TXV A;  4PUA A;  2MMO A;  5B7C A;  5FWG A;  2MMA A;  4WBJ A;  4V1A p;  3O76 A;  1GUH A;  3HKR A;  2VO4 A;  2OAC A;  3TKR A;  2I4A A;  1S3C A;  5B6N A;  1GLQ A;  4OD7 A;  5D93 A;  1RW1 A;  2C80 A;  2DMM A;  4K7I A;  1M2D A;  4F82 A;  5J41 A;  1KEB A;  3I9V 2;  3GFK A;  2DJK A;  4DSS B;  5EVO A;  4EDY A;  5LD0 A;  2IFQ A;  1U87 A;  1MDI A;  4X43 A;  4MLY A;  1SKS B;  4MA9 A;  2X99 A;  5HR2 A;  1OC8 A;  3QDN A;  4LA1 A;  2H0H A;  2AUV A;  2QC7 A;  2AJQ B;  2FWF A;  2ON7 A;  5FHI A;  2I81 A;  2V6O A;  3KGK A;  1TTZ A;  3ZL5 A;  2DC5 A;  4IQ1 A;  3L9V A;  2KUC A;  3N9J A;  4XS1 A;  3L0H A;  3C71 A;  3HVX A;  5CP1 A;  1GTU A;  5HR0 A;  1U3I A;  3J7Y b;  2IMD A;  4ZIL A;  4EL1 A;  2DJJ A;  4K6X A;  3RHB A;  4ZL8 A;  3KP8 A;  1F3B A;  1TRV A;  3QAG A;  4IJI A;  1GSD A;  5J9C A;  2CVB A;  4EE0 A;  4IP1 A;  3BJ5 A;  5C04 A;  5DCH A;  3TOU A;  5CRH A;  3GA4 A;  3F4R A;  5EPF A;  3CBU A;  3CSJ A;  3U5R E;  3ZFB A;  3FKF A;  3FY7 A;  1V57 A;  2B5X A;  1J9B A;  5D9W A;  4DEJ A;  3TJF A;  5G1L A;  2HNL A;  4NV5 A;  4GQC A;  4GRF A;  2VLT A;  3TCO A;  4KUN A;  5H5R A;  2CA8 A;  3ZRD A;  2WZ9 A;  1SD8 A;  3VPT A;  1U6T A;  4NWY A;  4ZL7 A;  4N30 A;  5DCG A;  1FOV A;  3G7Y A;  1GH2 A;  2I3Y A;  3H8Q A;  5CAX A;  2N5A A;  4KB3 A;  5IMA A;  4XS4 B;  2IL3 A;  3GUS A;  1AAZ A;  1O73 A;  3M8N A;  2EIR A;  2YCD A;  4RQX A;  1A0F A;  3IA1 A;  1SL1 B;  1GUM A;  4ECC A;  17GS A;  1B8X A;  2X8C A;  4BVY A;  3M0F A;  2AYT A;  4XS6 A;  1WMJ A;  1TK0 B;  1XCC A;  1KBN A;  5AGY A;  2G0F A;  4N10 A;  4FYU A;  2J23 A;  1R5P A;  2JZS A;  5D96 A;  1FVJ A;  3FR9 A;  4KA0 A;  1TRS A;  1FAA A;  3IRA A;  1MD4 A;  1YKC A;  3DXB A;  5IPG A;  6GSS A;  3P7X A;  4X1U A;  4PXO A;  2KOK A;  4I97 A;  5CRD A;  4I8B A;  2K8V A;  5D9V A;  3FZ4 A;  2R6K A;  1K0C A;  3HD5 A;  3LOR A;  3GH9 A;  1UC7 A;  1LJR A;  2PBJ A;  2JZT A;  4K9Z A;  4MJC A;  1T3B A;  1GUL A;  2E7P A;  3G7J A;  3M9J A;  3Q19 A;  5B6M A;  13GS A;  4IJ3 A;  4FH8 A;  5IMV A;  3KMN A;  2FY6 A;  2P5R A;  3H79 A;  3N5O A;  1SJ6 A;  5ECM B;  1ST9 A;  1SJZ A;  2B3S A;  2Z9S A;  1X9S B;  3UAP A;  4RQR A;  2PER A;  4CW9 A;  5KN1 A;  3C8E A;  2CV4 A;  2B7K A;  3VI7 A;  4KND A;  2GGT A;  1TK5 B;  1R5A A;  3OR5 A;  4V1A g;  1M9A A;  2GZY A;  4HQZ A;  4DVC A;  4XS4 A;  1PL1 A;  2F3M A;  2YV9 A;  3NZN A;  4KSM A;  5ELG A;  4PNG A;  2LS5 A;  1GSQ A;  2FNO A;  3IAM 2;  1Z3E A;  1V9W A;  2XPD A;  3GH6 A;  2FD3 A;  1H4O A;  2MZC A;  3D4T A;  2MBT A;  1H75 A;  1AC1 A;  1K0M A;  2LKU A;  4GTU A;  1SL0 B;  1MEK A;  4EF0 A;  1QUW A;  4KH7 A;  5GSS A;  1A24 A;  2K9F A;  2CX4 A;  2DBC A;  1XVQ A;  2JL4 A;  3JCM L;  4N0V A;  2H75 A;  2PMT A;  4TRX A;  3TOT A;  5G5F A;  1HQO A;  3KEB A;  4YQV A;  1Z5Y E;  3VWU A;  2WGR A;  1ILO A;  4IEL A;  3LJR A;  3FK8 A;  5COH A;  2NDO A;  1THO A;  3TKS E;  4YQU A;  1WE0 A;  1B4Q A;  2IN3 A;  1Y6E A;  3D0Z A;  1K3O A;  3TJB A;  1OC9 B;  3US3 A;  5E4W A;  3QPM A;  1J08 A;  5IMD A;  2FWH A;  2GQK A;  1E6B A;  2J9H A;  2PPT A;  3HHV A;  1GNE A;  3R2Q A;  2CVD A;  1MD3 A;  2NBS A;  2H6Z A;  1TK8 B;  3UEM A;  1VF3 A;  2GSQ A;  1YDK A;  3P2A A;  3FZ9 A;  1TW9 A;  2CX3 A;  4YQM A;  5DAL A;  5KN0 A;  1ML6 A;  1G7E A;  1PN9 A;  2F9S A;  5F05 A;  2WRT A;  3GST A;  4F03 A;  11GS A;  3UVT A;  1ZYQ B;  2YPM A;  2N5B A;  1ZGN A;  2B1K A;  5ECH B;  3TJG A;  2WJU A;  5GZZ B;  1U3A A;  4BVX A;  1K0D A;  2IMK A;  2L4Q A;  3UIW A;  1K0A A;  3I69 A;  3MSZ A;  4TR1 A;  1G6Y A;  1K0B A;  2H1A A;  1A0R P;  3EMP A;  2L4C A;  1T1V A;  2FWG A;  2VCQ A;  3W8J A;  1BAY A;  1SJI A;  5ECL B;  5D8I A;  1SK1 A;  4BPY A;  4L0W A;  1MDK A;  2H72 A;  2AB6 A;  3IK9 A;  2NTO A;  1YF0 A;  1XWG A;  4MP4 A;  1OC9 A;  4K0G A;  5IOX A;  4XHM A;  2L57 A;  7GSS A;  2CVK A;  4GSS A;  3D22 A;  3KJY A;  5AIS A;  3UAR A;  2EIO A;  2TIR A;  4MZB A;  4MF5 A;  3VWX A;  2H0I A;  1J0F A;  3PH9 A;  1S3D A;  4JBB A;  3F4S A;  4WBR D;  2KP2 A;  6GSX A;  1OKD A;  2GDR A;  3KM6 A;  3MNG A;  3M3M A;  3MWH A;  4H86 A;  2OJL A;  1FVK A;  1TRU A;  2VCZ A;  2H01 A;  5IMZ A;  1BED A;  2AHE A;  5DAK A;  2DIZ A;  3F0I A;  2DJ1 A;  2DIY A;  5D9X A;  3A2W A;  1TOF A;  4Z7X A;  1XWA A;  2I1U A;  1USB A;  5IO0 A;  3TJK A;  3IE3 A;  2QKE A;  3GN3 A;  4ZL9 A;  1SEN A;  1XBS A;  2XPE A;  3KMO A;  4HDE A;  16GS A;  2YOI A;  5HR3 A;  2VL3 A;  4WR4 A;  3MAK A;  1GWC A;  2L5O A;  1GSY A;  1GSF A;  2VUP A;  4L5O A;  2VM2 A;  2ES7 A;  3HJO A;  2L6D A;  5G5E A;  2B5Y A;  3CTG A;  1TXX A;  1TU7 A;  1Y25 A;  5ECS A;  4L8E A;  5G30 A;  5ECI B;  1ERT A;  2PVO C;  22GS A;  5CRG A;  1HYU A;  3UOM A;  2TRC P;  4MH3 A;  3CSH A;  1YJ6 A;  2YN1 A;  3IXR A;  4K7N A;  1GSS A;  2KLX A;  3EYT A;  20GS A;  1OE8 A;  3CRU A;  3M1G A;  1SD9 A;  2H66 A;  2YZU A;  4PQ1 A;  3A3T A;  4F0C A;  4PGT A;  1N2A A;  3TDG A;  1N8J A; 
#chains in the Genus database with same CATH topology
 1VF2 A;  2JAC A;  4L5L A;  4RI6 A;  1K3L A;  4N0Z A;  2LQO A;  1F2E A;  2HI7 A;  2ON5 A;  3DML A;  1ABA A;  4K7O A;  5G2Z A;  2VLU A;  2YJ7 A;  3D5J A;  3HVS A;  2O7K A;  2FWE A;  3LYP A;  4L0U A;  1XWB A;  1MDJ A;  2MBS A;  5G31 A;  2X8H A;  1KNG A;  3NOF A;  3EUR A;  1PKZ A;  1YEX A;  1YY7 A;  2IMF A;  1O81 A;  3TKS C;  3PIN A;  3GX0 A;  5CYY A;  2LNS A;  1SK0 A;  4DSQ A;  5A5K A;  3O6T A;  3F9U A;  4WET A;  4PX1 A;  14GS A;  1PRX A;  3VWV A;  4HZ4 A;  2NVL A;  3ZRE A;  4ZBD A;  3QAW A;  5IM9 A;  2G2Q A;  3LGC A;  2YJH A;  3ERF A;  2CZ2 A;  2A2S A;  4OWY A;  4POL A;  3GRX A;  5F0G A;  2FUG 2;  2VCW A;  4MPG A;  3KIJ A;  2FHE A;  3ZIT A;  4ECI A;  4EVM A;  3TKS A;  4QQ7 A;  2VCV A;  1VF1 A;  5JWO B;  1AXD A;  2H19 A;  1BQ7 A;  5HFK A;  3ZIJ A;  2CAI A;  1VF4 A;  3P90 A;  3WGX A;  2A4V A;  2IMI A;  4FQU A;  2GLR A;  6GSU A;  4LL4 B;  2H71 A;  4BWQ A;  4MJB A;  4AJ6 A;  3GTU B;  4F2I A;  4YKF A;  5ECR B;  1PQN A;  4WXT A;  1YQ1 A;  1XOA A;  3PGT A;  1AW9 A;  1ACV A;  1A2J A;  1O8X A;  2WFC A;  3NIV A;  3D6I A;  4ZBA A;  4TVE A;  4DSS A;  1U88 A;  2DLX A;  4ECB A;  2CQ9 A;  4KDY A;  1M2A A;  5IIZ A;  4WF5 A;  1GTB A;  1SL2 B;  5IOW A;  2HE3 A;  2HZF A;  2JZR A;  1EEJ A;  4O5R A;  6GSW A;  4MJA A;  1LU4 A;  1NM3 A;  1G7O A;  2VD0 A;  3KTB A;  3KXO A;  1K3Y A;  2LRC A;  3CYN A;  4IGJ A;  1F37 A;  1EV9 A;  3DYR A;  4TR0 A;  3UBK A;  2HRF A;  4PUR A;  2GTU A;  3QMX A;  2K18 A;  1ZYP A;  2YWO A;  3Q74 A;  3QR6 A;  1K0N A;  4XCS A;  2H0G A;  1PX6 A;  3UMA A;  2X8G A;  1ZMA A;  1JZW A;  3DIE A;  4G19 A;  2X64 A;  2OAD A;  4IS0 A;  2AAW A;  2OBK A;  3EIN A;  2RII A;  4G9H A;  3EVI A;  1FOH A;  4JR4 A;  4MJE A;  3HDC A;  3HYP A;  2L6C A;  1HNA A;  2GQL A;  4IW9 A;  4BWS A;  2IJY A;  2YWI A;  2HRA A;  1RK4 A;  3W6G A;  2GSR A;  1XIY A;  12GS A;  2YV7 A;  3FHK A;  3E0U A;  5A4W A;  3KH9 A;  2OBI A;  5F06 A;  4KAE A;  2MMZ A;  5LCZ A;  2VCX A;  4WF4 A;  5HR1 A;  4Z2U A;  2O89 A;  4MF6 A;  4JRR A;  2DJ0 A;  4HJ2 A;  4NHW A;  4MZW A;  3WYW A;  8GSS A;  1C72 A;  1WIK A;  1T4Z A;  3VLN A;  1GLP A;  3L9U A;  1UA5 A;  1EZK A;  3GYK A;  5ECP B;  5ECQ B;  4O7H A;  4KF9 A;  5J4U A;  3HA9 A;  2JSZ A;  3ZZX A;  2A2P A;  3TUE A;  4HQS A;  2OA7 A;  2REM A;  3LYK A;  4JED A;  5IMC A;  1Z6N A;  3IHG A;  2LNT A;  4J2F A;  5F8B A;  2H6Y A;  1ON4 A;  3WGE A;  1ERW A;  2KP1 A;  1M0U A;  3SBC A;  1IYH A;  2P31 A;  3UL3 A;  3TB2 A;  4G2E A;  1QGV A;  4DSR A;  5EY6 A;  4MAB A;  2OE3 A;  5L71 A;  3FR3 A;  4MF7 A;  2HZE B;  1GTA A;  1GNW A;  5C00 A;  1I9D A;  3F3R A;  3HJP A;  1Z7P A;  1AUC A;  4X0X A;  4K5R A;  2LQQ A;  4POM A;  5ECO B;  5B8B A;  4HEA 2;  4HU9 A;  1THX A;  1WRY A;  3FMW A;  2F8F A;  4JR6 A;  4YAP A;  1X9W B;  2GZZ A;  4WEY A;  1FB6 A;  1GSE A;  1GTI A;  1PA3 A;  2FLS A;  4JZQ A;  1I5G A;  3IR4 A;  1AIU A;  1FG4 A;  2PGT A;  1JHB A;  4O32 A;  2O87 A;  3LW9 A;  5CO3 A;  3H93 A;  4IKH A;  5GAP D;  3QAV A;  2V6K A;  2C4J A;  1V40 A;  3IV4 A;  2K8S A;  1XW5 A;  4K8M A;  2HRN A;  2VAF A;  3L78 A;  1QMV A;  1OC3 A;  1WOU A;  1TKD B;  2B7J A;  1BYE A;  1SYR A;  3IC4 A;  1A8L A;  3RPP A;  3C73 A;  3IPZ A;  1TU8 A;  3R3E A;  4HS1 A;  4KCE A;  3H4K A;  1JFU A;  3RDW A;  4V2M A;  2VL9 A;  3DEX A;  4OFN A;  2XHF A;  4Q5N A;  3LWA A;  3W8S A;  3UVH A;  1XWC A;  3RHC A;  3CQF A;  1B4P A;  3VI5 A;  2XC2 A;  2JU5 A;  4I2U A;  1ZZY A;  3EU3 A;  4PUF C;  5INY A;  4HU7 A;  2IPA A;  3WD6 A;  4ZB8 A;  2HZE A;  3KD0 A;  1M2B A;  4GQF A;  3Q18 A;  1A2M A;  2AV4 A;  3H1N A;  6GSV A;  2QA1 A;  4TXO B;  2VCT A;  3KTL A;  5IQY A;  4TW5 A;  2VD1 A;  4QL9 A;  5H5S A;  1EGR A;  3IDV A;  4GF0 A;  2FA8 A;  1XWK A;  4KDX A;  5ABR A;  1W89 A;  1Z9H A;  5DQY A;  3O3T A;  1PD2 1;  1OKT A;  5DJL A;  6GST A;  2C0G A;  2O85 A;  4BL7 B;  4F9Z A;  3GKM A;  4KX4 A;  10GS A;  1T7P B;  4P3Y B;  1QFN A;  2HSH A;  1PSQ A;  2WDU A;  2L5L A;  3QD9 A;  4J56 E;  2GZP A;  1YEP A;  3QCP A;  4PNF A;  4D73 B;  2X4A A;  1UN2 A;  3VWW A;  2MMN A;  3BOA A;  3FYG A;  1BX9 A;  5IMF A;  3FZA A;  4JU5 A;  1PL2 A;  3CTF A;  4GLT A;  3F63 A;  5HQP A;  2C8U A;  1X5E A;  3EU4 A;  2DJ2 A;  2JAD A;  5H5Q A;  3F6D A;  3BCK A;  3CRT A;  1TI3 A;  4ZB6 A;  2GVP A;  4K5S A;  3L4N A;  4I5Q A;  4TN8 A;  3G9B A;  5EL8 A;  3FR6 A;  2HT9 A;  4EUY A;  5ID2 B;  3F4T A;  2GSS A;  2C3N A;  4ID0 A;  1LBK A;  2WS2 A;  3LG6 A;  1PMT A;  1VRS D;  1O8W A;  2WCI A;  3WT2 A;  3ZVJ D;  3VUR A;  4PQI A;  2H8L A;  2I9H A;  4FIW A;  5GAN D;  4I6X A;  1O85 A;  1R7H A;  5DQS A;  1DSB A;  4RUV A;  2YNX A;  2PU9 C;  5A4V A;  5D9T A;  1WWJ A;  3HY2 A;  2X49 A;  3DGQ A;  1EP8 A;  1EV4 A;  4NV2 A;  19GS A;  3QFA C;  3GX8 A;  1X9M B;  3D4M A;  3GL5 A;  3GMF A;  2QGV A;  1M99 A;  2DKH A;  3ED3 A;  2LUS A;  3S9F A;  1ZYN A;  1HNC A;  4IHU A;  4D73 A;  4GXZ A;  1PFO A;  2CT6 A;  3TRX A;  1UVZ A;  2K6V A;  2H1D A;  5J5N A;  2CAQ A;  4F0B A;  2IWT A;  1SK2 A;  4PQH A;  3C1R A;  1NHO A;  5IO2 A;  3V1W A;  3TKQ A;  5KOX A;  1ZL9 A;  3C1S A;  2RM5 A;  1QQ2 A;  2ZUP A;  2C0D A;  2B5E A;  2GQM A;  3J7Y k;  1DBY A;  3BCI A;  3DD3 A;  5J3R A;  3F8U A;  1GP1 A;  3GL3 A;  1F9M A;  4POK A;  3GKX A;  3HVV A;  3KP9 A;  1G6W A;  3HXS A;  3TJJ A;  3ERW A;  1YKA A;  5JCG A;  3DKS A;  3CMI A;  4MH2 A;  9GSS A;  1SKR B;  4HUA A;  3LQ7 A;  4E8E A;  5ID2 A;  2M72 A;  3TRP A;  3DVW A;  2FGX A;  4WKW A;  3SWL A;  2VM1 A;  2O8V B;  5ENU A;  3A5I A;  3ZML A;  4NXI A;  1HD2 A;  2OKA A;  2EIQ A;  4IN0 A;  1TJD A;  4YAV A;  4ZB9 A;  4TOP A;  1PGT A;  3TRQ A;  4GSN A;  2C0E A;  1OYJ A;  4J57 E;  5GST A;  4ECJ A;  5A4U A;  1Q98 A;  2E2M A;  2BTO T;  4GWR A;  4BVY B;  3ME8 A;  3EE2 A;  3ERG A;  4FYB A;  2H1G A;  1B9Y C;  5E59 A;  1SKW B;  2GT6 A;  1EP7 A;  2LST A;  2MYG A;  2A2R A;  2D2Z A;  1AQV A;  2WB9 A;  2YWM A;  3HZ4 A;  4WR5 A;  3WT1 A;  4OMV A;  2DSA A;  2PVQ A;  4HJM A;  4K2D A;  1Q4J A;  1FHE A;  5AN1 A;  3A2X A;  4EKZ A;  2YP6 A;  3APQ A;  1F3A A;  2H30 A;  3P8W A;  2GST A;  1XZO A;  5JWR B;  1TI1 A;  3EPT A;  3RPN A;  3KH7 A;  3LXT A;  2YZH A;  1SYX A;  4G0L A;  3GHA A;  4NHZ A;  4MK3 A;  1T00 A;  4XRA A;  4OFM A;  4NMU A;  18GS A;  1XPV A;  3LXZ A;  4FO5 A;  1URM A;  4K0N A;  1YF1 A;  1EWX A;  1WJK A;  2RLI A;  1HNB A;  1X5D A;  5ECN B;  2C1Y A;  3E9J B;  5DDL A;  5HFI A;  1JLW A;  3KCM A;  1R26 A;  2H1B A;  2RUF A;  3ZFL A;  3F3Q A;  3EC3 A;  2B1L A;  2GS3 A;  1X0R A;  3EWL A;  5J9B A;  2M80 A;  4QL7 A;  2XBI A;  4XIH A;  4XRD A;  2DKI A;  3UBL A;  4EDZ A;  2V41 A;  1GUK A;  4EXJ A;  4ML1 A;  3CXG A;  3F6F A;  1A2L A;  2NPB A;  3KZQ A;  4ZBB A;  3G7I A;  3VPQ A;  1OVN A;  3DRN A;  4KCA A;  4OCF A;  3RBT A;  2YAN A;  2KHP A;  2VOC A;  3ZMK A;  1XW9 A;  1KTE A;  2LEG A;  1JZO A;  3U6V A;  4IP6 A;  1IYI A;  1R4W A;  4XTS A;  1MTC A;  3I6A A;  1B9X C;  4KE3 A;  2C3T A;  4G10 A;  1JZR A;  2DML A;  3VK9 A;  5KN3 A;  4LMV A;  2ZNM A;  2LJA A;  6GSY A;  5DVB A;  3GTU A;  1DE1 A;  2HFD A;  2C0F A;  1XW6 A;  4IQA A;  4OO5 A;  4ACS A;  2R4V A;  4MZC A;  5KN2 A;  1GRX A;  3BD2 A;  1FB0 A;  2FA4 A;  4HZ2 A;  3VFI A;  1GSU A;  2M46 A;  3Q6O A;  3BBY A;  3IAS 2;  4KSO A;  3ZVJ A;  4K2X A;  4OCE A;  1CQH A;  4EO3 A;  5DAL B;  2H70 A;  3IHQ A;  2VIM A;  3IOS A;  2IIY A;  1O7U A;  5G1K A;  2V1M A;  2P5Q A;  1M9B A;  1PX7 A;  1XXU A;  4YH2 A;  1OE7 A;  4AJ8 A;  4OFT A;  4OO4 A;  5KEJ A;  1B48 A;  4AF2 A;  4FYC A;  2R37 A;  5IPH A;  4BVX B;  5JCW A;  3D21 A;  2LRT A;  3IK7 A;  4MCU A;  4TR1 B;  1JLV A;  4MPF A;  2DJ3 A;  4HOJ A;  1WP0 A;  1BJX A;  2V32 A;  3M9K A;  1XFL A;  3TGZ A;  1FW1 A;  1W4V A;  3RAZ A;  3EMX A;  2H76 A;  1ZCP A;  2OE1 A;  2QSI A;  2XBQ A;  2LJR A;  3DWV A;  3GKN A;  1T8E B;  3FW2 A;  2GT5 A;  2N5F A;  2PN8 A;  1VGL A;  3AY8 A;  3A2V A;  5B8A A;  1FO5 A;  1E2Y A;  2L59 A;  1V2A A;  3CSI A;  4E8H A;  1AQX A;  3UJ1 A;  2HXK A;  1PKW A;  4BIK A;  4YKG A;  4ISD A;  1BG5 A;  1S3A A;  3ME7 A;  3QOU A;  1CQG A;  1F6M C;  4CHS A;  1EGO A;  4TR4 A;  3ZTL A;  5AIV A;  4BA7 A;  2LV3 A;  2IME A;  3GV1 A;  2LTK A;  3FRC A;  2PWJ A;  2R5G A;  1DE2 A;  3A5W A;  5DAK B;  2CZ3 A;  1NHY A;  2ALB A;  5F07 A;  2TRX A;  2PUK C;  2LJK A;  1V58 A;  1SU9 A;  4KDU A;  3DVX A;  5CRW A;  1EEM A;  2HRK A;  2EC4 A;  3FZ5 A;  5JWQ B;  4EIQ A;  2YWN A;  2WUL A;  3PR8 A;  1OAZ A;  2C3Q A;  1GL8 A;  1TRW A;  1TDI A;  3IBH A;  3GIX A;  3ZLP A;  1ZYE A;  1YZX A;  2H74 A;  4AGS A;  4IVF A;  3HZ8 A;  5CNW A;  4N11 A;  1NSW A;  3L9S A;  1QXH A;  2UZ8 A;  2F51 A;  4KW6 A;  4Q5Q A;  5ELA A;  3GNJ A;  2V2G A;  4ML6 A;  2E0Q A;  4ZIJ A;  2JSY A;  5AIX A;  3K8N A;  4V2N A;  4AJ7 A;  3GSS A;  3HJM A;  1A8Y A;  4TKY A;  4KGI A;  2F8A A;  4V2L A;  2HLS A;  4LLR A;  4NAX A;  4I2T A;  3APS A;  1A23 A;  3C7M A;  2OE0 A;  4USS A;  3GUR A;  1M7T A;  4MMM A;  2RUE A;  1XVW A;  1AQW A;  2HSY A;  1XG8 A;  5D73 A;  1ERV A;  4POB A;  1M3J A;  3ZIV A;  1PN0 A;  3QFB C;  2R2J A;  1O6J A;  2VL2 C;  3ISO A;  4Q5R A;  4GCI A;  4RI7 A;  5FT3 A;  1RQM A;  4TR3 A;  3MDK A;  2H73 A;  3GKK A;  3WGD A;  2IFQ B;  4GST A;  1K0O A;  2FCH A;  1X5C A;  1NW2 A;  3E3E A;  4MDC A;  1T4Y A;  1EOH A;  3HCZ A;  4ULX A;  1DUG A;  5DJM A;  2E2G A;  3TKP A;  2R0C A;  2HYX A;  4K1F A;  3LSZ A;  3FEU A;  2A4H A;  2VL2 A;  1V98 A;  4TXO A;  5DBQ A;  3LFL A;  1JZD A;  1Z6M A;  2RM6 A;  5HFG A;  2H6X A;  1Z7R A;  1TP9 A;  4Q5F A;  2BJX A;  2LRN A;  4ILF A;  1XOB A;  3LEF A;  2VLV A;  4IBP A;  2R0G A;  5JCU A;  4LMW A;  2BMX A;  5ECK B;  4BL7 A;  2B6M A;  4CDO A;  3APO A;  1G0T A;  4EC0 A;  1EOG A;  2R3X A;  2P0G A;  4JE1 A;  4LL1 B;  1ZOF A;  2ZCT A;  1WPI A;  4O92 A;  5LNK e;  4NPB A;  1QK8 A;  3ZYW A;  5CRE A;  3I43 A;  1ERU A;  4G0I A;  4HI7 A;  4ZXG A;  4TXV A;  4PUA A;  2MMO A;  5B7C A;  5FWG A;  2MMA A;  4WBJ A;  4V1A p;  3O76 A;  1GUH A;  3HKR A;  2VO4 A;  2OAC A;  3TKR A;  2I4A A;  1S3C A;  5B6N A;  1GLQ A;  4OD7 A;  5D93 A;  1RW1 A;  2C80 A;  2DMM A;  4K7I A;  1M2D A;  4F82 A;  5J41 A;  1KEB A;  3I9V 2;  3GFK A;  2DJK A;  4DSS B;  5EVO A;  4EDY A;  4O5Q A;  5LD0 A;  2IFQ A;  1U87 A;  1MDI A;  4X43 A;  4MLY A;  1SKS B;  4MA9 A;  2X99 A;  5HR2 A;  1OC8 A;  3QDN A;  4LA1 A;  2H0H A;  2AUV A;  2QC7 A;  2AJQ B;  2FWF A;  2ON7 A;  5FHI A;  2I81 A;  2V6O A;  3KGK A;  1TTZ A;  3ZL5 A;  2DC5 A;  4IQ1 A;  3L9V A;  2KUC A;  3PPU A;  3N9J A;  4XS1 A;  3L0H A;  4MNN A;  3C71 A;  3HVX A;  5CP1 A;  4CY8 A;  1GTU A;  5HR0 A;  1U3I A;  3J7Y b;  2IMD A;  4ZIL A;  4X4J A;  4EL1 A;  2DJJ A;  4K6X A;  3RHB A;  4ZL8 A;  3KP8 A;  1F3B A;  1TRV A;  4G0K A;  3QAG A;  4IJI A;  1GSD A;  5J9C A;  2CVB A;  4EE0 A;  4IP1 A;  3BJ5 A;  5C04 A;  5DCH A;  3TOU A;  5CRH A;  3GA4 A;  3F4R A;  5EPF A;  3CBU A;  3CSJ A;  3U5R E;  3ZFB A;  3FKF A;  3FY7 A;  1V57 A;  2B5X A;  1J9B A;  5D9W A;  4DEJ A;  1M3I A;  3TJF A;  5G1L A;  2HNL A;  4NV5 A;  4GQC A;  4GRF A;  2VLT A;  3TCO A;  4Z2T A;  4KUN A;  3HVN A;  5H5R A;  2CA8 A;  3ZRD A;  2WZ9 A;  4O5U A;  1SD8 A;  3VPT A;  1U6T A;  4NWY A;  4ZL7 A;  4N30 A;  5DCG A;  1FOV A;  3G7Y A;  1GH2 A;  2I3Y A;  3H8Q A;  5CAX A;  2N5A A;  4KB3 A;  5IMA A;  4XS4 B;  2IL3 A;  3GUS A;  1AAZ A;  1O73 A;  3M8N A;  2EIR A;  2YCD A;  4RQX A;  1A0F A;  3IA1 A;  1SL1 B;  1GUM A;  4ECC A;  17GS A;  1B8X A;  2X8C A;  4BVY A;  3M0F A;  2AYT A;  4XS6 A;  1WMJ A;  1TK0 B;  1XCC A;  1KBN A;  5AGY A;  2G0F A;  4N10 A;  4FYU A;  2J23 A;  1R5P A;  2JZS A;  5D96 A;  1FVJ A;  3FR9 A;  4KA0 A;  1TRS A;  1FAA A;  3IRA A;  2QA2 A;  1MD4 A;  1YKC A;  3DXB A;  5IPG A;  6GSS A;  3P7X A;  4X1U A;  4PXO A;  2KOK A;  4I97 A;  5CRD A;  4I8B A;  2K8V A;  5D9V A;  3FZ4 A;  2R6K A;  1K0C A;  3HD5 A;  3LOR A;  3GH9 A;  1UC7 A;  1LJR A;  2PBJ A;  2JZT A;  4K9Z A;  4MJC A;  1T3B A;  1GUL A;  2E7P A;  3G7J A;  3M9J A;  3Q19 A;  4Z2R A;  5B6M A;  13GS A;  4IJ3 A;  4FH8 A;  5IMV A;  3KMN A;  2FY6 A;  2P5R A;  3H79 A;  3N5O A;  1SJ6 A;  5ECM B;  1ST9 A;  1SJZ A;  2B3S A;  2Z9S A;  1X9S B;  3UAP A;  4RQR A;  2PER A;  4CW9 A;  5KN1 A;  3C8E A;  2CV4 A;  2B7K A;  3VI7 A;  4KND A;  2GGT A;  1TK5 B;  1R5A A;  3OR5 A;  4V1A g;  1M9A A;  2GZY A;  4HQZ A;  3MIX A;  4DVC A;  4XS4 A;  1PL1 A;  2F3M A;  2YV9 A;  3NZN A;  4KSM A;  5ELG A;  4PNG A;  2LS5 A;  1GSQ A;  2FNO A;  3IAM 2;  1Z3E A;  1V9W A;  2XPD A;  3GH6 A;  2FD3 A;  1H4O A;  2MZC A;  3D4T A;  2MBT A;  1H75 A;  1AC1 A;  1K0M A;  2LKU A;  4GTU A;  1SL0 B;  1MEK A;  4EF0 A;  1QUW A;  4KH7 A;  5GSS A;  1A24 A;  2K9F A;  2CX4 A;  2DBC A;  1XVQ A;  2JL4 A;  3JCM L;  4N0V A;  2H75 A;  2PMT A;  4TRX A;  3TOT A;  5G5F A;  1HQO A;  3KEB A;  4YQV A;  1Z5Y E;  3VWU A;  2WGR A;  1ILO A;  4IEL A;  3LJR A;  3FK8 A;  5COH A;  2NDO A;  1THO A;  3TKS E;  4YQU A;  1WE0 A;  1B4Q A;  2IN3 A;  1Y6E A;  3D0Z A;  1K3O A;  3TJB A;  1OC9 B;  3US3 A;  5E4W A;  3QPM A;  1J08 A;  5IMD A;  2FWH A;  2GQK A;  1E6B A;  4ICY A;  2J9H A;  2PPT A;  3HHV A;  1GNE A;  3R2Q A;  2CVD A;  1MD3 A;  2NBS A;  2H6Z A;  1TK8 B;  3UEM A;  1VF3 A;  2R0P A;  2GSQ A;  1YDK A;  3P2A A;  3FZ9 A;  1TW9 A;  2CX3 A;  4YQM A;  5DAL A;  5KN0 A;  1ML6 A;  1G7E A;  1PN9 A;  2F9S A;  5F05 A;  2WRT A;  4EIP A;  3GST A;  4F03 A;  11GS A;  3UVT A;  1ZYQ B;  2YPM A;  2N5B A;  1ZGN A;  2B1K A;  5ECH B;  3TJG A;  2WJU A;  5GZZ B;  1U3A A;  4BVX A;  1K0D A;  2IMK A;  2L4Q A;  3UIW A;  1K0A A;  3I69 A;  3MSZ A;  4TR1 A;  1G6Y A;  1K0B A;  2H1A A;  1A0R P;  3EMP A;  2L4C A;  1T1V A;  2FWG A;  2VCQ A;  3W8J A;  1BAY A;  1SJI A;  5ECL B;  5D8I A;  1SK1 A;  4BPY A;  4L0W A;  1MDK A;  2H72 A;  2AB6 A;  3IK9 A;  2NTO A;  1YF0 A;  1XWG A;  4MP4 A;  1OC9 A;  4K0G A;  5IOX A;  4XHM A;  2L57 A;  7GSS A;  2CVK A;  4GSS A;  3D22 A;  3KJY A;  5AIS A;  3UAR A;  2EIO A;  2TIR A;  4MZB A;  4MF5 A;  3VWX A;  2H0I A;  1J0F A;  3PH9 A;  1S3D A;  4JBB A;  3F4S A;  4WBR D;  4A5P A;  2KP2 A;  6GSX A;  2HSM A;  1OKD A;  2GDR A;  3IC8 A;  3KM6 A;  3MNG A;  3M3M A;  3MWH A;  4H86 A;  2OJL A;  1FVK A;  1TRU A;  2VCZ A;  2H01 A;  5IMZ A;  1BED A;  2AHE A;  5DAK A;  2DIZ A;  3F0I A;  2DJ1 A;  3MYD A;  2DIY A;  5D9X A;  3A2W A;  1TOF A;  4Z7X A;  1XWA A;  2I1U A;  1USB A;  5IO0 A;  3TJK A;  3IE3 A;  1S3R A;  2QKE A;  3GN3 A;  4ZL9 A;  1SEN A;  1XBS A;  2XPE A;  3KMO A;  4HDE A;  16GS A;  2YOI A;  5HR3 A;  2VL3 A;  4WR4 A;  3MAK A;  1GWC A;  2L5O A;  1GSY A;  1GSF A;  2VUP A;  4L5O A;  2VM2 A;  2ES7 A;  3HJO A;  2L6D A;  5G5E A;  2B5Y A;  3CTG A;  1TXX A;  4HSC X;  4CY6 A;  1TU7 A;  1Y25 A;  4PTS A;  5ECS A;  5BRT A;  4L8E A;  5G30 A;  5ECI B;  1ERT A;  2PVO C;  22GS A;  5CRG A;  1HYU A;  3UOM A;  2TRC P;  4MH3 A;  3CSH A;  1YJ6 A;  2YN1 A;  3IXR A;  5BMU A;  4K7N A;  1GSS A;  2KLX A;  3EYT A;  20GS A;  1OE8 A;  3CRU A;  3M1G A;  1SD9 A;  2H66 A;  2YZU A;  4PQ1 A;  3A3T A;  4F0C A;  4PGT A;  1N2A A;  3TDG A;  5KOW A;  1N8J A; 
#chains in the Genus database with same CATH homology
 1VF2 A;  2JAC A;  4L5L A;  4RI6 A;  1K3L A;  4N0Z A;  2LQO A;  1F2E A;  2HI7 A;  2ON5 A;  3DML A;  1ABA A;  4K7O A;  5G2Z A;  2VLU A;  2YJ7 A;  3D5J A;  3HVS A;  2O7K A;  2FWE A;  3LYP A;  4L0U A;  1XWB A;  1MDJ A;  2MBS A;  5G31 A;  2X8H A;  1KNG A;  3NOF A;  3EUR A;  1PKZ A;  1YEX A;  1YY7 A;  2IMF A;  1O81 A;  3TKS C;  3PIN A;  3GX0 A;  5CYY A;  2LNS A;  1SK0 A;  4DSQ A;  5A5K A;  3O6T A;  3F9U A;  4WET A;  4PX1 A;  14GS A;  1PRX A;  3VWV A;  4HZ4 A;  2NVL A;  3ZRE A;  4ZBD A;  3QAW A;  5IM9 A;  2G2Q A;  3LGC A;  2YJH A;  3ERF A;  2CZ2 A;  2A2S A;  4OWY A;  4POL A;  3GRX A;  5F0G A;  2FUG 2;  2VCW A;  4MPG A;  3KIJ A;  2FHE A;  3ZIT A;  4ECI A;  4EVM A;  3TKS A;  4QQ7 A;  2VCV A;  1VF1 A;  5JWO B;  1AXD A;  2H19 A;  1BQ7 A;  5HFK A;  3ZIJ A;  2CAI A;  1VF4 A;  3P90 A;  3WGX A;  2A4V A;  2IMI A;  4FQU A;  2GLR A;  6GSU A;  4LL4 B;  2H71 A;  4BWQ A;  4MJB A;  4AJ6 A;  3GTU B;  4F2I A;  4YKF A;  5ECR B;  1PQN A;  4WXT A;  1YQ1 A;  1XOA A;  3PGT A;  1AW9 A;  1ACV A;  1A2J A;  1O8X A;  2WFC A;  3NIV A;  3D6I A;  4ZBA A;  4TVE A;  4DSS A;  1U88 A;  2DLX A;  4ECB A;  2CQ9 A;  4KDY A;  1M2A A;  5IIZ A;  4WF5 A;  1GTB A;  1SL2 B;  5IOW A;  2HE3 A;  2HZF A;  2JZR A;  1EEJ A;  4O5R A;  6GSW A;  4MJA A;  1LU4 A;  1NM3 A;  1G7O A;  2VD0 A;  3KTB A;  3KXO A;  1K3Y A;  2LRC A;  3CYN A;  4IGJ A;  1F37 A;  1EV9 A;  3DYR A;  4TR0 A;  3UBK A;  2HRF A;  4PUR A;  2GTU A;  3QMX A;  2K18 A;  1ZYP A;  2YWO A;  3Q74 A;  3QR6 A;  1K0N A;  4XCS A;  2H0G A;  1PX6 A;  3UMA A;  2X8G A;  1ZMA A;  1JZW A;  3DIE A;  4G19 A;  2X64 A;  2OAD A;  4IS0 A;  2AAW A;  2OBK A;  3EIN A;  2RII A;  4G9H A;  3EVI A;  1FOH A;  4JR4 A;  4MJE A;  3HDC A;  3HYP A;  2L6C A;  1HNA A;  2GQL A;  4IW9 A;  4BWS A;  2IJY A;  2YWI A;  2HRA A;  1RK4 A;  3W6G A;  2GSR A;  1XIY A;  12GS A;  2YV7 A;  3FHK A;  3E0U A;  5A4W A;  3KH9 A;  2OBI A;  5F06 A;  4KAE A;  2MMZ A;  5LCZ A;  2VCX A;  4WF4 A;  5HR1 A;  4Z2U A;  2O89 A;  4MF6 A;  4JRR A;  2DJ0 A;  4HJ2 A;  4NHW A;  4MZW A;  3WYW A;  8GSS A;  1C72 A;  1WIK A;  1T4Z A;  3VLN A;  1GLP A;  3L9U A;  1UA5 A;  1EZK A;  3GYK A;  5ECP B;  5ECQ B;  4O7H A;  4KF9 A;  5J4U A;  3HA9 A;  2JSZ A;  3ZZX A;  2A2P A;  3TUE A;  4HQS A;  2OA7 A;  2REM A;  3LYK A;  4JED A;  5IMC A;  1Z6N A;  3IHG A;  2LNT A;  4J2F A;  5F8B A;  2H6Y A;  1ON4 A;  3WGE A;  1ERW A;  2KP1 A;  1M0U A;  3SBC A;  1IYH A;  2P31 A;  3UL3 A;  3TB2 A;  4G2E A;  1QGV A;  4DSR A;  5EY6 A;  4MAB A;  2OE3 A;  5L71 A;  3FR3 A;  4MF7 A;  2HZE B;  1GTA A;  1GNW A;  5C00 A;  1I9D A;  3F3R A;  3HJP A;  1Z7P A;  1AUC A;  4X0X A;  4K5R A;  2LQQ A;  4POM A;  5ECO B;  5B8B A;  4HEA 2;  4HU9 A;  1THX A;  1WRY A;  3FMW A;  2F8F A;  4JR6 A;  4YAP A;  1X9W B;  2GZZ A;  4WEY A;  1FB6 A;  1GSE A;  1GTI A;  1PA3 A;  2FLS A;  4JZQ A;  1I5G A;  3IR4 A;  1AIU A;  1FG4 A;  2PGT A;  1JHB A;  4O32 A;  2O87 A;  3LW9 A;  5CO3 A;  3H93 A;  4IKH A;  5GAP D;  3QAV A;  2V6K A;  2C4J A;  1V40 A;  3IV4 A;  2K8S A;  1XW5 A;  4K8M A;  2HRN A;  2VAF A;  3L78 A;  1QMV A;  1OC3 A;  1WOU A;  1TKD B;  2B7J A;  1BYE A;  1SYR A;  3IC4 A;  1A8L A;  3RPP A;  3C73 A;  3IPZ A;  1TU8 A;  3R3E A;  4HS1 A;  4KCE A;  3H4K A;  1JFU A;  3RDW A;  4V2M A;  2VL9 A;  3DEX A;  4OFN A;  2XHF A;  4Q5N A;  3LWA A;  3W8S A;  3UVH A;  1XWC A;  3RHC A;  1B4P A;  3VI5 A;  2XC2 A;  2JU5 A;  4I2U A;  1ZZY A;  3EU3 A;  4PUF C;  5INY A;  4HU7 A;  2IPA A;  3WD6 A;  4ZB8 A;  2HZE A;  3KD0 A;  1M2B A;  4GQF A;  3Q18 A;  1A2M A;  2AV4 A;  3H1N A;  6GSV A;  2QA1 A;  4TXO B;  2VCT A;  3KTL A;  5IQY A;  4TW5 A;  2VD1 A;  4QL9 A;  5H5S A;  1EGR A;  3IDV A;  4GF0 A;  2FA8 A;  1XWK A;  4KDX A;  5ABR A;  1W89 A;  1Z9H A;  5DQY A;  3O3T A;  1PD2 1;  1OKT A;  5DJL A;  6GST A;  2C0G A;  2O85 A;  4BL7 B;  4F9Z A;  3GKM A;  4KX4 A;  10GS A;  1T7P B;  4P3Y B;  1QFN A;  2HSH A;  1PSQ A;  2WDU A;  2L5L A;  3QD9 A;  4J56 E;  2GZP A;  1YEP A;  3QCP A;  4PNF A;  4D73 B;  2X4A A;  1UN2 A;  3VWW A;  2MMN A;  3BOA A;  3FYG A;  1BX9 A;  5IMF A;  3FZA A;  4JU5 A;  1PL2 A;  3CTF A;  4GLT A;  3F63 A;  5HQP A;  2C8U A;  1X5E A;  3EU4 A;  2DJ2 A;  2JAD A;  5H5Q A;  3F6D A;  3BCK A;  3CRT A;  1TI3 A;  4ZB6 A;  2GVP A;  4K5S A;  3L4N A;  4I5Q A;  4TN8 A;  3G9B A;  5EL8 A;  3FR6 A;  2HT9 A;  4EUY A;  5ID2 B;  3F4T A;  2GSS A;  2C3N A;  4ID0 A;  1LBK A;  2WS2 A;  3LG6 A;  1PMT A;  1VRS D;  1O8W A;  2WCI A;  3WT2 A;  3ZVJ D;  3VUR A;  4PQI A;  2H8L A;  2I9H A;  4FIW A;  5GAN D;  4I6X A;  1O85 A;  1R7H A;  5DQS A;  1DSB A;  4RUV A;  2YNX A;  2PU9 C;  5A4V A;  5D9T A;  1WWJ A;  3HY2 A;  2X49 A;  3DGQ A;  1EP8 A;  1EV4 A;  4NV2 A;  19GS A;  3QFA C;  3GX8 A;  1X9M B;  3D4M A;  3GL5 A;  3GMF A;  2QGV A;  1M99 A;  2DKH A;  3ED3 A;  2LUS A;  3S9F A;  1ZYN A;  1HNC A;  4IHU A;  4D73 A;  4GXZ A;  2CT6 A;  3TRX A;  1UVZ A;  2K6V A;  2H1D A;  5J5N A;  2CAQ A;  4F0B A;  2IWT A;  1SK2 A;  4PQH A;  3C1R A;  1NHO A;  5IO2 A;  3V1W A;  3TKQ A;  5KOX A;  1ZL9 A;  3C1S A;  2RM5 A;  1QQ2 A;  2ZUP A;  2C0D A;  2B5E A;  2GQM A;  3J7Y k;  1DBY A;  3BCI A;  3DD3 A;  5J3R A;  3F8U A;  1GP1 A;  3GL3 A;  1F9M A;  4POK A;  3GKX A;  3HVV A;  3KP9 A;  1G6W A;  3HXS A;  3TJJ A;  3ERW A;  1YKA A;  5JCG A;  3DKS A;  3CMI A;  4MH2 A;  9GSS A;  1SKR B;  4HUA A;  3LQ7 A;  4E8E A;  5ID2 A;  2M72 A;  3TRP A;  3DVW A;  2FGX A;  4WKW A;  3SWL A;  2VM1 A;  2O8V B;  5ENU A;  3A5I A;  3ZML A;  4NXI A;  1HD2 A;  2OKA A;  2EIQ A;  4IN0 A;  1TJD A;  4YAV A;  4ZB9 A;  4TOP A;  1PGT A;  3TRQ A;  4GSN A;  2C0E A;  1OYJ A;  4J57 E;  5GST A;  4ECJ A;  5A4U A;  1Q98 A;  2E2M A;  2BTO T;  4GWR A;  4BVY B;  3ME8 A;  3EE2 A;  3ERG A;  4FYB A;  2H1G A;  1B9Y C;  5E59 A;  1SKW B;  2GT6 A;  1EP7 A;  2LST A;  2MYG A;  2A2R A;  2D2Z A;  1AQV A;  2WB9 A;  2YWM A;  3HZ4 A;  4WR5 A;  3WT1 A;  4OMV A;  2DSA A;  2PVQ A;  4HJM A;  4K2D A;  1Q4J A;  1FHE A;  5AN1 A;  3A2X A;  4EKZ A;  2YP6 A;  3APQ A;  1F3A A;  2H30 A;  3P8W A;  2GST A;  1XZO A;  5JWR B;  1TI1 A;  3EPT A;  3RPN A;  3KH7 A;  3LXT A;  2YZH A;  1SYX A;  4G0L A;  3GHA A;  4NHZ A;  4MK3 A;  1T00 A;  4XRA A;  4OFM A;  4NMU A;  18GS A;  1XPV A;  3LXZ A;  4FO5 A;  1URM A;  4K0N A;  1YF1 A;  1EWX A;  1WJK A;  2RLI A;  1HNB A;  1X5D A;  5ECN B;  2C1Y A;  3E9J B;  5DDL A;  5HFI A;  1JLW A;  3KCM A;  1R26 A;  2H1B A;  2RUF A;  3ZFL A;  3F3Q A;  3EC3 A;  2B1L A;  2GS3 A;  1X0R A;  3EWL A;  5J9B A;  2M80 A;  4QL7 A;  2XBI A;  4XIH A;  4XRD A;  2DKI A;  3UBL A;  4EDZ A;  2V41 A;  1GUK A;  4EXJ A;  4ML1 A;  3CXG A;  3F6F A;  1A2L A;  2NPB A;  3KZQ A;  4ZBB A;  3G7I A;  3VPQ A;  1OVN A;  3DRN A;  4KCA A;  4OCF A;  3RBT A;  2YAN A;  2KHP A;  2VOC A;  3ZMK A;  1XW9 A;  1KTE A;  2LEG A;  1JZO A;  3U6V A;  4IP6 A;  1IYI A;  1R4W A;  4XTS A;  1MTC A;  3I6A A;  1B9X C;  4KE3 A;  2C3T A;  4G10 A;  1JZR A;  2DML A;  3VK9 A;  5KN3 A;  4LMV A;  2ZNM A;  2LJA A;  6GSY A;  5DVB A;  3GTU A;  1DE1 A;  2HFD A;  2C0F A;  1XW6 A;  4IQA A;  4OO5 A;  4ACS A;  2R4V A;  4MZC A;  5KN2 A;  1GRX A;  3BD2 A;  1FB0 A;  2FA4 A;  4HZ2 A;  3VFI A;  1GSU A;  2M46 A;  3Q6O A;  3BBY A;  3IAS 2;  4KSO A;  3ZVJ A;  4K2X A;  4OCE A;  1CQH A;  4EO3 A;  5DAL B;  2H70 A;  3IHQ A;  2VIM A;  3IOS A;  2IIY A;  1O7U A;  5G1K A;  2V1M A;  2P5Q A;  1M9B A;  1PX7 A;  1XXU A;  4YH2 A;  1OE7 A;  4AJ8 A;  4OFT A;  4OO4 A;  5KEJ A;  1B48 A;  4AF2 A;  4FYC A;  2R37 A;  5IPH A;  4BVX B;  5JCW A;  3D21 A;  2LRT A;  3IK7 A;  4MCU A;  4TR1 B;  1JLV A;  4MPF A;  2DJ3 A;  4HOJ A;  1WP0 A;  1BJX A;  2V32 A;  3M9K A;  1XFL A;  3TGZ A;  1FW1 A;  1W4V A;  3RAZ A;  3EMX A;  2H76 A;  1ZCP A;  2OE1 A;  2QSI A;  2XBQ A;  2LJR A;  3DWV A;  3GKN A;  1T8E B;  3FW2 A;  2GT5 A;  2N5F A;  2PN8 A;  1VGL A;  3AY8 A;  3A2V A;  5B8A A;  1FO5 A;  1E2Y A;  2L59 A;  1V2A A;  3CSI A;  4E8H A;  1AQX A;  3UJ1 A;  2HXK A;  1PKW A;  4YKG A;  4ISD A;  1BG5 A;  1S3A A;  3ME7 A;  3QOU A;  1CQG A;  1F6M C;  4CHS A;  1EGO A;  4TR4 A;  3ZTL A;  5AIV A;  4BA7 A;  2LV3 A;  2IME A;  3GV1 A;  2LTK A;  3FRC A;  2PWJ A;  2R5G A;  1DE2 A;  3A5W A;  5DAK B;  2CZ3 A;  1NHY A;  2ALB A;  5F07 A;  2TRX A;  2PUK C;  2LJK A;  1V58 A;  1SU9 A;  4KDU A;  3DVX A;  5CRW A;  1EEM A;  2HRK A;  2EC4 A;  3FZ5 A;  5JWQ B;  4EIQ A;  2YWN A;  2WUL A;  3PR8 A;  1OAZ A;  2C3Q A;  1GL8 A;  1TRW A;  1TDI A;  3IBH A;  3GIX A;  3ZLP A;  1ZYE A;  1YZX A;  2H74 A;  4AGS A;  4IVF A;  3HZ8 A;  5CNW A;  4N11 A;  1NSW A;  3L9S A;  1QXH A;  2UZ8 A;  2F51 A;  4KW6 A;  4Q5Q A;  5ELA A;  3GNJ A;  2V2G A;  4ML6 A;  2E0Q A;  4ZIJ A;  2JSY A;  5AIX A;  3K8N A;  4V2N A;  4AJ7 A;  3GSS A;  3HJM A;  1A8Y A;  4TKY A;  4KGI A;  2F8A A;  4V2L A;  2HLS A;  4LLR A;  4NAX A;  4I2T A;  3APS A;  1A23 A;  3C7M A;  2OE0 A;  4USS A;  3GUR A;  1M7T A;  4MMM A;  2RUE A;  1XVW A;  1AQW A;  2HSY A;  5D73 A;  1ERV A;  4POB A;  3ZIV A;  1PN0 A;  3QFB C;  2R2J A;  1O6J A;  2VL2 C;  3ISO A;  4Q5R A;  4GCI A;  4RI7 A;  5FT3 A;  1RQM A;  4TR3 A;  3MDK A;  2H73 A;  3GKK A;  3WGD A;  2IFQ B;  4GST A;  1K0O A;  2FCH A;  1X5C A;  1NW2 A;  3E3E A;  4MDC A;  1T4Y A;  1EOH A;  3HCZ A;  4ULX A;  1DUG A;  5DJM A;  2E2G A;  3TKP A;  2R0C A;  2HYX A;  4K1F A;  3LSZ A;  3FEU A;  2A4H A;  2VL2 A;  1V98 A;  4TXO A;  5DBQ A;  3LFL A;  1JZD A;  1Z6M A;  2RM6 A;  5HFG A;  2H6X A;  1Z7R A;  1TP9 A;  4Q5F A;  2BJX A;  2LRN A;  4ILF A;  1XOB A;  3LEF A;  2VLV A;  4IBP A;  2R0G A;  5JCU A;  4LMW A;  2BMX A;  5ECK B;  4BL7 A;  2B6M A;  4CDO A;  3APO A;  1G0T A;  4EC0 A;  1EOG A;  2R3X A;  2P0G A;  4JE1 A;  4LL1 B;  1ZOF A;  2ZCT A;  1WPI A;  4O92 A;  5LNK e;  4NPB A;  1QK8 A;  3ZYW A;  5CRE A;  3I43 A;  1ERU A;  4G0I A;  4HI7 A;  4ZXG A;  4TXV A;  4PUA A;  2MMO A;  5B7C A;  5FWG A;  2MMA A;  4WBJ A;  4V1A p;  3O76 A;  1GUH A;  3HKR A;  2VO4 A;  2OAC A;  3TKR A;  2I4A A;  1S3C A;  5B6N A;  1GLQ A;  4OD7 A;  5D93 A;  1RW1 A;  2C80 A;  2DMM A;  4K7I A;  1M2D A;  4F82 A;  5J41 A;  1KEB A;  3I9V 2;  3GFK A;  2DJK A;  4DSS B;  5EVO A;  4EDY A;  4O5Q A;  5LD0 A;  2IFQ A;  1U87 A;  1MDI A;  4X43 A;  4MLY A;  1SKS B;  4MA9 A;  2X99 A;  5HR2 A;  1OC8 A;  3QDN A;  4LA1 A;  2H0H A;  2AUV A;  2QC7 A;  2AJQ B;  2FWF A;  2ON7 A;  5FHI A;  2I81 A;  2V6O A;  3KGK A;  1TTZ A;  3ZL5 A;  2DC5 A;  4IQ1 A;  3L9V A;  2KUC A;  3PPU A;  3N9J A;  4XS1 A;  3L0H A;  4MNN A;  3C71 A;  3HVX A;  5CP1 A;  4CY8 A;  1GTU A;  5HR0 A;  1U3I A;  3J7Y b;  2IMD A;  4ZIL A;  4X4J A;  4EL1 A;  2DJJ A;  4K6X A;  3RHB A;  4ZL8 A;  3KP8 A;  1F3B A;  1TRV A;  4G0K A;  3QAG A;  4IJI A;  1GSD A;  5J9C A;  2CVB A;  4EE0 A;  4IP1 A;  3BJ5 A;  5C04 A;  5DCH A;  3TOU A;  5CRH A;  3GA4 A;  3F4R A;  5EPF A;  3CBU A;  3CSJ A;  3U5R E;  3ZFB A;  3FKF A;  3FY7 A;  1V57 A;  2B5X A;  1J9B A;  5D9W A;  4DEJ A;  3TJF A;  5G1L A;  2HNL A;  4NV5 A;  4GQC A;  4GRF A;  2VLT A;  3TCO A;  4Z2T A;  4KUN A;  5H5R A;  2CA8 A;  3ZRD A;  2WZ9 A;  4O5U A;  1SD8 A;  3VPT A;  1U6T A;  4NWY A;  4ZL7 A;  4N30 A;  5DCG A;  1FOV A;  3G7Y A;  1GH2 A;  2I3Y A;  3H8Q A;  5CAX A;  2N5A A;  4KB3 A;  5IMA A;  4XS4 B;  2IL3 A;  3GUS A;  1AAZ A;  1O73 A;  3M8N A;  2EIR A;  2YCD A;  4RQX A;  1A0F A;  3IA1 A;  1SL1 B;  1GUM A;  4ECC A;  17GS A;  1B8X A;  2X8C A;  4BVY A;  3M0F A;  2AYT A;  4XS6 A;  1WMJ A;  1TK0 B;  1XCC A;  1KBN A;  5AGY A;  2G0F A;  4N10 A;  4FYU A;  2J23 A;  1R5P A;  2JZS A;  5D96 A;  1FVJ A;  3FR9 A;  4KA0 A;  1TRS A;  1FAA A;  3IRA A;  2QA2 A;  1MD4 A;  1YKC A;  3DXB A;  5IPG A;  6GSS A;  3P7X A;  4X1U A;  4PXO A;  2KOK A;  4I97 A;  5CRD A;  4I8B A;  2K8V A;  5D9V A;  3FZ4 A;  2R6K A;  1K0C A;  3HD5 A;  3LOR A;  3GH9 A;  1UC7 A;  1LJR A;  2PBJ A;  2JZT A;  4K9Z A;  4MJC A;  1T3B A;  1GUL A;  2E7P A;  3G7J A;  3M9J A;  3Q19 A;  4Z2R A;  5B6M A;  13GS A;  4IJ3 A;  4FH8 A;  5IMV A;  3KMN A;  2FY6 A;  2P5R A;  3H79 A;  3N5O A;  1SJ6 A;  5ECM B;  1ST9 A;  1SJZ A;  2B3S A;  2Z9S A;  1X9S B;  3UAP A;  4RQR A;  2PER A;  4CW9 A;  5KN1 A;  3C8E A;  2CV4 A;  2B7K A;  3VI7 A;  4KND A;  2GGT A;  1TK5 B;  1R5A A;  3OR5 A;  4V1A g;  1M9A A;  2GZY A;  4HQZ A;  3MIX A;  4DVC A;  4XS4 A;  1PL1 A;  2F3M A;  2YV9 A;  3NZN A;  4KSM A;  5ELG A;  4PNG A;  2LS5 A;  1GSQ A;  2FNO A;  3IAM 2;  1Z3E A;  1V9W A;  2XPD A;  3GH6 A;  2FD3 A;  1H4O A;  2MZC A;  3D4T A;  2MBT A;  1H75 A;  1AC1 A;  1K0M A;  2LKU A;  4GTU A;  1SL0 B;  1MEK A;  4EF0 A;  1QUW A;  4KH7 A;  5GSS A;  1A24 A;  2K9F A;  2CX4 A;  2DBC A;  1XVQ A;  2JL4 A;  3JCM L;  4N0V A;  2H75 A;  2PMT A;  4TRX A;  3TOT A;  5G5F A;  1HQO A;  3KEB A;  4YQV A;  1Z5Y E;  3VWU A;  2WGR A;  1ILO A;  4IEL A;  3LJR A;  3FK8 A;  5COH A;  2NDO A;  1THO A;  3TKS E;  4YQU A;  1WE0 A;  1B4Q A;  2IN3 A;  1Y6E A;  3D0Z A;  1K3O A;  3TJB A;  1OC9 B;  3US3 A;  5E4W A;  3QPM A;  1J08 A;  5IMD A;  2FWH A;  2GQK A;  1E6B A;  4ICY A;  2J9H A;  2PPT A;  3HHV A;  1GNE A;  3R2Q A;  2CVD A;  1MD3 A;  2NBS A;  2H6Z A;  1TK8 B;  3UEM A;  1VF3 A;  2R0P A;  2GSQ A;  1YDK A;  3P2A A;  3FZ9 A;  1TW9 A;  2CX3 A;  4YQM A;  5DAL A;  5KN0 A;  1ML6 A;  1G7E A;  1PN9 A;  2F9S A;  5F05 A;  2WRT A;  4EIP A;  3GST A;  4F03 A;  11GS A;  3UVT A;  1ZYQ B;  2YPM A;  2N5B A;  1ZGN A;  2B1K A;  5ECH B;  3TJG A;  2WJU A;  5GZZ B;  1U3A A;  4BVX A;  1K0D A;  2IMK A;  2L4Q A;  3UIW A;  1K0A A;  3I69 A;  3MSZ A;  4TR1 A;  1G6Y A;  1K0B A;  2H1A A;  1A0R P;  3EMP A;  2L4C A;  1T1V A;  2FWG A;  2VCQ A;  3W8J A;  1BAY A;  1SJI A;  5ECL B;  5D8I A;  1SK1 A;  4BPY A;  4L0W A;  1MDK A;  2H72 A;  2AB6 A;  3IK9 A;  2NTO A;  1YF0 A;  1XWG A;  4MP4 A;  1OC9 A;  4K0G A;  5IOX A;  4XHM A;  2L57 A;  7GSS A;  2CVK A;  4GSS A;  3D22 A;  3KJY A;  5AIS A;  3UAR A;  2EIO A;  2TIR A;  4MZB A;  4MF5 A;  3VWX A;  2H0I A;  1J0F A;  3PH9 A;  1S3D A;  4JBB A;  3F4S A;  4WBR D;  4A5P A;  2KP2 A;  6GSX A;  2HSM A;  1OKD A;  2GDR A;  3IC8 A;  3KM6 A;  3MNG A;  3M3M A;  3MWH A;  4H86 A;  2OJL A;  1FVK A;  1TRU A;  2VCZ A;  2H01 A;  5IMZ A;  1BED A;  2AHE A;  5DAK A;  2DIZ A;  3F0I A;  2DJ1 A;  3MYD A;  2DIY A;  5D9X A;  3A2W A;  1TOF A;  4Z7X A;  1XWA A;  2I1U A;  1USB A;  5IO0 A;  3TJK A;  3IE3 A;  2QKE A;  3GN3 A;  4ZL9 A;  1SEN A;  1XBS A;  2XPE A;  3KMO A;  4HDE A;  16GS A;  2YOI A;  5HR3 A;  2VL3 A;  4WR4 A;  3MAK A;  1GWC A;  2L5O A;  1GSY A;  1GSF A;  2VUP A;  4L5O A;  2VM2 A;  2ES7 A;  3HJO A;  2L6D A;  5G5E A;  2B5Y A;  3CTG A;  1TXX A;  4CY6 A;  1TU7 A;  1Y25 A;  4PTS A;  5ECS A;  5BRT A;  4L8E A;  5G30 A;  5ECI B;  1ERT A;  2PVO C;  22GS A;  5CRG A;  1HYU A;  3UOM A;  2TRC P;  4MH3 A;  3CSH A;  1YJ6 A;  2YN1 A;  3IXR A;  5BMU A;  4K7N A;  1GSS A;  2KLX A;  3EYT A;  20GS A;  1OE8 A;  3CRU A;  3M1G A;  1SD9 A;  2H66 A;  2YZU A;  4PQ1 A;  3A3T A;  4F0C A;  4PGT A;  1N2A A;  3TDG A;  5KOW A;  1N8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...