3EUB2

Crystal structure of desulfo-xanthine oxidase with xanthine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 164
sequence length 164
chains with identical sequence A, J, S
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
2 PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3eub202
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3eub201
3P4SB 3SR6A 1AYFA 2K5PA 2KAJA 3AEDB 1N5XA 1JWBD 3AEBB 3CIRB 1N5WA 2MJEA 3HRDD 1ZOYB 2BS4B 3AEGB 3LB8C 1PDXA 2ACZB 3P1MA 4YTNB 1OQQA 3FAHA 3W9CB 4ZHOA 1SIJA 2L83A 3P63A 1J7CA 1NEKB 2M56B 3B2FA 1YJIA 4A9AA 3HUIA 3EUB2 1E9MA 5EE1A 1UWMA 2CJNA 2QIEB 2WDVB 1B9RA 1CZPA 4N58A 1L5PA 1E0ZA 2W54A 1FXIA 2WQYB 1NI3A 1NVID 2BT6A 4ZHPA 1N63A 2HTME 1RYJA 3WCQA 5C3JB 1JRPA 3AEEB 1L6VA 2WDRB 2MJ3A 1WWTA 4WQMA 4N6EB 1YQ3B 2PVOD 1JROA 3P4RB 1PUTA 4YSXB 3AB5A 1NYRA 3VR9B 1RFKA 1ROEA 2BS3B 2DBYA 3AM9A 3DWMA 3AEFB 1JW9D 3LXFA 1JWAD 1NYQA 2WP9B 3ZYYX 2B76B 3P4QB 5EE0A 4WWMA 1FO4A 3NVYA 2WU2B 2PVGC 2W3RA 1V97A 3AE7B 1R7SA 4US8A 2JX5A 2K9XA 2LEKA 4KX6B 3W5UB 1JQ4A 5C2TB 4C7YA 1RWSA 4YTPB 1A70A 3VRAB 1DOIA 1RM6C 4IDIA 3NVZA 1QOBA 5MPOA 1YJJA 3HVZA 1WGKA 3P4PB 4JX1C 5EE9A 3PO0A 3NRZA 3ABVB 1XLNA 4P6VF 5GXGB 1N61A 4JWSC 3B9JA 3AV8A 2Y5CA 2WDQB 1WXQA 1TKYA 4YT0B 4C80A 2CJOA 1DOYA 1JALA 4HROA 1KFYB 3ETRA 3NVVA 2N0SB 3B2GA 1GPXA 1E10A 1WYGA 1V8CA 1F0ZA 3NVWA 3SFEB 2MH7A 1WRIA 2G1EA 1E7PB 3W5VB 4HRSA 5H92C 1FMAD 4JWUC 2KMMA 1E6EB 5G5GA 1FRRA 2L52A 2OHFA 3AE2B 3AE6B 1J7AA 1ZP0B 3AN1A 5EE3A 3VR8B 1QF6A 4YSZB 1OQRA 4N59A 1ZXIA 4C7ZA 3AE9B 3SFDB 2H88B 1VLBA 2JQRB 2BS2B 2WU5B 3AE4B 3AECB 1EWYC 2QJLA 1YQ4B 2H89B 4YTMB 1L6UA 1IUEA 1AWDA 2AX5A 2WS3B 2PKOA 1FXAA 4US9A 1NENB 3FC4A 1XLOA 4YSYB 3NS1A 1KRHA 1QOAA 1TKGA 1QOFA 1FIQA 2FBWB 1DOXA 1GAQB 4ZOHC 1QT9A 1SF0A 3AE5B 3DWGC 4YXDB 1SB3C 3L4PA 2MJDA 2Q5WD 2CU3A 5H8YE 1XLQA 1XO3A 4ITKA 2W55A 1QOGA 4USAA 1CJEA 1FM0D 2EKIA 1DGJA 3AEAB 1XLPA 3CWIA 1TYGB 3KWLA 3AMZA 4LTUA 3RPFC 3BIID 5AUKA 1FRDA 1L0VB 1I7HA 1TKEA 2DWQA 2K22A 1ZUD2 3AE3B 1VDVA 1T3QA 1PFDA 2M19A 3AE8B 2W3SA 1KF6B 1QLBB 1OFFA 1TJEA 3AE1B 3AH7A 5AUIA 2PIAA 1N60A 1FFUA 4FXCA 1FFVA 5G5HA 1VJKA 2E3TA 1J7BA 3VRBB 2WLBA 1N62A
chains in the Genus database with same CATH superfamily
4MGKE 5ALSA 2VRRB 2K89A 1WMHB 1L7OA 2E1FA 2N7EA 2AH5A 1T4GA 3LDAA 3GV8B 4DS5A 2ISPA 4IRDA 5HI1A 3H4BA 9ICAA 2K8HA 2N1VA 1JX4A 2BBCA 4FZLA 5D94A 1NEKB 3TARA 1PGBA 2BPSA 1ZETA 3O13A 1PK1B 2Q0ZX 2WDVB 2ZUCA 3KQ4A 2FPMA 2CU1A 2JXXA 2EMSA 1D9FA 3SQIA 2KDEB 4QZFA 3A33B 3NRWA 5J2JA 5C3JB 3G6XA 1L6VA 3PSPA 4M9JA 5E79U 4HKQA 2ASLA 1WIAA 3T9LA 1RPLA 4C00A 4CCHA 4OJ5A 1SEBD 2NVUI 4C0ZA 2I9GA 3EZ5A 9ICBA 3KZIU 2LYAA 2L32A 4EZLA 1ROEA 5TR5A 1V49A 2EAOA 2KACA 2KHWB 8ICIA 4O3SA 1S0OA 5DB6A 1Z00A 1JMLA 2JX5A 3KFUF 4ICAA 2CR5A 4QNLA 1RWSA 5JHAA 1IXRA 4BOZB 4C56C 3M62B 2IYDB 2KFZA 2KKVA 5ALXA 2KVZA 2Z59B 1Q5WB 4QZAA 9ICGA 4ECSA 3DVNV 2G07A 4EZJA 4YT0B 3TAPA 2RLTA 2GLSA 3NVVA 2C5LC 2YB4A 2Z7JA 2BYFA 1WYGA 4PZNA 4AP4C 3HWTA 1IGCA 2KTRA 3RZWC 2OCEA 3D6JA 4PZOA 3RJEA 2LMCA 5BOMA 7ICJA 2WX0A 2PFPA 9ICJA 5KG0A 4Z6FA 3M8SA 2B21A 1XXGA 5F9NA 2WU5B 2HHXA 4M6WA 2LJIA 3GZNB 1SV4A 4MFAA 2OM6A 2A1AA 4KV2A 2KYWA 3ZUNA 3AE5B 3AU2A 1IPGA 4DLGA 1E8WA 1OGWA 2H3IA 2KVSA 5H8YE 2JUOA 2JZBA 3KWVA 3QK0A 3PSTA 1KFDA 1UA0A 4JWMA 1KL9A 3T8MA 2SEBD 5E6OA 4B95A 5DGBA 5DDMA 3BIID 2NO4A 2MBEA 5E6PA 3PLUA 1UPHA 3Q8PB 1FNUA 4RNNA 3PO4A 1PYWD 1TKEA 1STEA 2AQ0A 1T3QA 1L3UA 4RQ0A 1B1ZA 1FCLA 8ICPA 1VJ5A 4KDLB 4FBTA 1V9JA 3W2DA 2MBHA 2NYVA 1EM7A 2BB6A 3D32A 2L5YA 5CRXA 2KXJA 3QQ8B 1RRBA 2J6UA 1LB2B 1AYFA 2LI5A 4BWMA 4ED3A 2EZXA 2MJEA 2BS4B 1V38A 5GMVA 3C5FA 2IGHA 1ZQTA 2HJ1A 4IW0A 1OW5A 5KT5A 3E2EA 1BNPA 1Z2MA 4NQLB 4TQRA 1HUZA 1K50A 3C1YA 2RDGA 1KEJA 4AJWA 4DQPA 2QMTA 1B0XA 2C2EA 2UWQA 2JEIA 1E8ZA 5D4BA 4A20A 4UAWA 4Z6DA 2R8GA 5B5EU 4BKSD 2C60A 3DVNU 4NJ6A 3TCAA 2K4PA 5DQGA 1QSSA 1YQ3B 1TY0A 2I5HA 3RNFC 8ICTA 2GOLA 1ED1A 3ZDEA 2JEJA 1NK7A 1JWAD 3L0WB 2IO3B 1RYRA 4YN4A 2WU2B 3D2QA 1QSLA 4PGXA 2C22A 9ICLA 2D11A 2MBQA 4TUPA 2Z0EB 3MHSD 4KZ0A 3JPPA 4G11A 1WGGA 2XK5A 1DOIA 4P1CC 3ZDAA 8ICRA 5ALRA 4W9LA 2OXOA 1FNVA 2K25A 2ZIVA 4UB5A 3WKAA 7ICGA 2VZKD 5KFEA 3GIKA 4HPMB 3QHTA 5AEKB 1JALA 4HROA 2C2DA 4RZRA 4KTQA 8ICLA 1LKYB 3GZFA 1DYQA 1MJDA 1T0QC 2NBWB 3R8BA 3UINB 2J4XA 2HE7A 4UBBA 4TQ0A 4UASA 3LWMA 2KSOB 2N9XA 2XGPA 2X8XX 2E6XA 3EECA 2DUYA 3D2SA 3RH5A 3TEXA 4BBNC 5G5GA 2JY6A 4N9F4 2HCFA 2RQ5A 1E8XA 4KLDA 1N6ZA 2F76X 1OUQA 4YSZB 4CYEA 4JPSA 3EW9A 2KWUB 3W5UB 8ICZA 4PS7A 4W9DA 2QARB 4NLNA 5TSSA 3PMNA 2GWSA 2Z8LA 3PHXB 1NENB 5MPOA 3H6NA 4EFOA 4UW9A 5F9LA 4KMOB 3IN5A 5KT6A 3UMBA 3J81j 1ZRNA 2IHMA 2WXOA 3Q8FA 2JXJA 1HA5A 1ZQWA 1UT5A 1ESFA 2PPHA 1TFRA 2XCAA 2KKCA 1IBXA 3PY8A 2MWSB 2EKIA 4RUCA 2INCC 2GOWA 4NZLB 2K8BB 4NLCA 3T79A 3RCZA 4AJYB 8ICJA 1KLUD 9ICSA 2A1JA 4UAZA 5DLGA 4JB3A 3ISDA 5L1MA 1F77A 1RFAA 2MEKA 4TUSA 1I4QA 4P0PA 4HPLB 1BGXT 5KFWA 2JF5A 3EA6A 2KZ3A 4RM8A 3E9SA 4A8XC 1L4DB 1ZQFA 2OYYA 4K4HA 4UATA 1UA1A 5F3XB 4ZRKA 5AI6A 4FADA 5ALMA 2FE8A 3ZDDA 4KLSA 3GIJA 1RQLA 2IO0B 1N5XA 2IBKA 1JWBD 4M8MA 3URYA 1LXDA 3QUCA 1WR6E 4TMAB 1RYSA 4RNOA 5T14A 4JL9A 4ZHOA 3UI3A 1SGGA 5DQHA 2HBMA 4PHEA 3PRPB 2XO7A 1YN3A 4F1SA 2IOFA 3EUB2 4KN4A 4NY0A 1UWMA 3TACB 4GC6A 2QIEB 1PVQA 8ICGA 1WXVA 4WURA 2AU0A 3FDSA 2KK8A 1SV0C 2WQYB 4N58A 1E0ZA 1NI3A 3APCA 1N63A 4TV3A 3UQBA 3NASA 2F2AB 2HVHA 1WX8A 2DZIA 2WXRA 1P7FA 2W9BB 2WDRB 3QU9A 3H8MA 5KFIA 2WYQA 2NO5A 4UARA 2HTHA 2L0TA 3KBBA 1YMHE 2CHZA 4RF1A 4HPPA 3OHAA 4P2HA 4E74A 1BPBA 2YMPA 1YX5B 1RAXA 2EQYA 2AQ4A 2WF9A 2B76B 2OWOA 5B66U 1R7SA 1NZPA 2LEKA 4KZCA 2LHDA 3PW5A 3U4EG 4D2KA 4BXOB 4GXKA 2IGGA 1TK0A 3P4PB 5DGAA 2G09A 2PE6B 3M3JA 3EFCA 4XX5A 5AZFA 2CKHB 1BNOA 3BVZA 1S5LU 3KHLA 3PLVA 1SKRA 1V81A 3BJYA 2ZXIA 2D3CA 3A4RA 1GG3A 2BDPA 2NRTA 3UIOB 4M9NA 8ICCA 2JXTA 1G6JA 1F0ZA 2W7OA 3SFEB 4GDKA 2KZZA 2KMMA 3QA8A 7ICIA 1XO0A 1NK9A 4C8MA 3QXGA 2OHFA 4MEXA 2J0MA 2RD0A 3U30A 3QAQA 2KMCA 5L1JA 1D8LA 1S97A 5DB9A 1Q8KA 1ZXIA 2JR5A 1CRXA 4C7ZA 2DX5B 2DQNB 4K7SA 1YN5A 5T8IA 1KFTA 1WXAA 4FULA 2CN1A 2MLBA 1ZQXA 5EWEA 1VR9A 3VQIA 4IQVA 2PI5A 5ALTA 1EO6A 2KJRA 3CMMB 1CUKA 8ICKA 1MI0A 2XNAC 3AL0B 3L4PA 4FS2A 2J6SA 2LVOA 5BYQA 3NZ3A 2W55A 5EWFA 3ZW3A 1CJEA 2LGYA 4MF2A 3BDPA 1WGYA 3RPFC 1D5XC 2NR2A 4FA6A 2Y9TA 2DWQA 1X9WA 2W9CB 2BQQA 3BINA 4O3PA 1S76D 2E8OA 2QKQA 3SU8X 5HKHA 4DXFA 1C4AA 4Y2UA 5KFFA 2Y1JA 3AH7A 2BTEA 2PKEA 3ZNID 3GIIA 2DPIA 4OJOA 1I35A 2E3TA 4LK0M 4UB4A 2KKPA 4KIKB 3IG5A 2WLBA 2JZZA 4TQ1A 4O5CA 1V5OA 3SR6A 5D2MB 2XY5A 1SE2A 2H3VA 4ECZA 2C28A 2M0AA 3O0FA 2DNFA 2A19A 3PV1A 4QW8A 4IR9A 1H38A 4MJSB 4YL8A 4BVUC 2GLEA 4B9VA 4JGHB 2JYTA 3RFZB 3C5GA 3UQ2A 4A9AA 3L3FX 4M9LA 2FPKA 2DL0A 3EHVA 2BT6A 1TVAA 4YR3A 5KAFU 3BZCA 3KZXA 5HG2A 1L8LA 2D10A 7ICOA 4LNNA 1M4VA 3ZLZA 1UF0A 3M63B 4M9HA 2ONQA 3ZGZA 5AKEA 3WAMA 5KFGA 3TJPA 1NYRA 4YP3A 3THVA 1JW9D 2PEAA 1A77A 1HIWA 5EE0A 2K60A 3MC8A 4K3CA 2VA8A 7ICRA 1P98A 3OJ3A 3WAPA 1ZQ1C 3H7PA 4Y2QA 4DFJA 2HJ8A 4MGZE 1TAMA 4YMOA 4YXMA 4XDCA 1N48A 2FCQA 3ABVB 2M9NA 4I2IA 3JPRA 2KVCA 1AQ6A 3BY4B 1WJ6A 4L2YA 1UD7A 1Q10A 3I3TB 3R2IA 1DOYA 2CJOA 3DPDA 1NKEA 3HHMA 3MR5A 2ZIWA 2VIXA 1KLVA 2AGPA 4W9KA 1U4BA 7ICKA 5KHQA 3PNCA 5L1IA 1ZQMA 3V6EB 2G1EA 1ZJMA 4QZIA 4HCPB 4RQ6A 3X23A 2JZPA 3NTUA 3KTQA 2L52A 5AI9A 2D3BA 1J7AA 4JUZA 3ALBA 1DOQA 5EE3A 3VR8B 3BQ7A 3SHQA 1KLGD 5AI8A 5IA7A 2WF6A 5LXIB 1VZ6A 1JWMD 3RJIA 3AECB 3VTVA 1H8CA 4MFCA 2KOBA 1WGRA 9ICEA 3B0XA 5CWRA 3OPXA 3MGHA 2JEGA 2W8KA 4C4VA 4GLSC 2INDC 1S77D 3WK8A 3Q8SB 3DDHA 3ED5A 2LI6A 1VD2A 3AXCA 1HJPA 4MT5A 4ZRQA 1ZQGA 4RPYA 4Q2JA 1ZD5A 3RR8A 1ZDVA 3GOEA 4F4WA 4QAYA 3UQAA 2KDMA 5KFLA 3DBRB 3S2AA 2FCNA 1NK6A 3ZIMA 2DFLA 2PMZF 8ICYA 1FRDA 2N4FA 1L0VB 9ICWA 1WZ0A 4LVSA 3T3OA 3B0YA 4EBCA 2G5HB 5C1ZA 2M19A 2MQJA 1KF6B 4OHJA 1X1MA 3RB3A 4J9QA 2L8JA 4ELVA 3L5KA 5KFRA 5AIBA 1V2YA 5D7GA 4NQKE 2BYEA 3A1QB 4PK1A 5JHBA 1L4ZB 3GU3A 5EDSA 3KUCB 2KC1A 4B9UA 5AK4A 2MP2A 2ZXHA 4XGAB 3A9KA 2XIDA 5AKZA 4ASWC 2AL6A 4RF0A 1PDXA 2EDUA 4FZMA 3MFHA 3I9V1 5CJ7A 4P0QA 1J7CA 1YJIA 3IM1A 4UB6U 3UF8A 3QU5A 4KITB 5C5JA 1IP9A 3ETLA 5DLFA 2WF8A 1K52A 4OO1J 5FR3A 3RNCC 5KT3A 1PVRA 2ZTDA 1D8BA 2FDRA 3H40A 2RPQA 1D6EC 4I28A 1B43A 4KLQA 2FLNA 3MTNB 3MC1A 4K3BA 1D4BA 2IY1B 3WK4A 3H8SA 4GXJA 1V5TA 3RRGA 1SL1A 4RU9A 1R4MI 2INPE 1J0GA 2HBLA 2SAKA 2XBBC 3KUZA 4RQ8A 2DBYA 5FP0A 2KG5A 4F91B 4J3OD 2RSUA 4B9KA 3WALA 2EMTA 4WWPA 2K6DB 4KLEA 2Y0SC 2ZZPB 1TIFA 1JI7A 3EFUA 3BQ1A 1S3SG 4LNFA 1Z00B 5DKWA 4IDIA 1Z19A 4KLUA 3LWLA 4KLFA 4DF4A 1Z1VA 4PPXA 1UT8A 5AI0A 2WDTB 3T3NA 1AROP 4G9BA 9ICPA 4B6WA 4RGNA 5KFYA 7ICSA 3M1YA 2BCVA 3RB4A 4DSFA 1H4RA 2EANA 4XZ4A 4MFFA 1V8CA 4OZCA 4DEZA 4J6IA 4KGSA 3B08A 3Q3OC 3WK6A 2KTRB 3IAM1 1E6EB 4IM2A 1RZTA 4OJPA 3VDZA 4FZNA 4BKSA 3CNHA 3RZFA 2J7QB 3CSFA 4QZ8A 4DBGA 5GXGB 3PX4A 3AE4B 4PYZA 4F3OA 1UWXA 4JV2A 4BKGA 4US9A 5KFKA 2D6FC 1EF1A 4M6WB 2LHEA 5CHVC 1KRHA 1DOXA 4XWTA 2ZVOA 5IIOA 1UH6A 2QCZA 4RGMA 4M9GA 3H8HA 2DZJA 5CTRC 8ICVA 4J9OA 1ZW7A 3KUDB 3H8JA 5ALIA 2JZBB 2G9HD 3AEAB 3E58A 2VH2A 3OSNA 1HTQA 1ZQJA 5KG7A 4RM9A 1HTOA 3AQFA 4M01A 1I7HA 1LO5D 3AE3B 4IQWA 1YOVB 2IJ0A 2UYZB 4QZBA 4IRCA 9ICCA 1WH3A 2GRIA 1QQ6A 1N2XA 3H8WA 1JUDA 1WCLA 1T0YA 1J2MA 2CPRA 4B6JA 2ZCBA 4JIOU 2R2QA 2MA9B 4AQ7A 1FNWA 5CHGA 8ICEA 2F1IA 3N7SC 8ICUA 3IG8A 3F2DA 5HHIA 3PO5A 4I2BA 4MEYA 1HEZE 2Y0SF 1NKBA 5J0OA 3LB8C 1UUPA 3FAHA 3IV6A 4ED6A 3U52E 2V4RA 2G3QB 2L83A 2KX0A 1NK8A 2DKXA 3B2FA 1SV0A 5DBBA 1UELA 4PJ0U 2V9HA 3HUIA 1E9MA 4GIVA 2DYOA 1JXEA 3UQ0A 2Y1IA 5AKKA 3SV4A 2YY6A 2IGDA 1ZQYA 5J17A 1T6BX 2WF7A 4I2AA 4HEA1 3SD5A 5J0SA 3N20C 4YR0A 1ZQVA 3WKBA 2MJ3A 3L10B 2L1AA 4N6EB 4JE3B 4WIPA 5AICA 4DHZB 4YMMA 2TSSA 3VXWA 3UGBB 5AHXA 4RUAA 3ZRCA 3QIJA 3K9PB 3QCAA 3OTQA 2MU2A 4P4MA 3RD2A 4HK2A 1JQ4A 5CB1A 4KX6B 3Q8LA 3TANA 1U4AA 1MFWA 4FFDA 1C76A 2GBNA 2YTUA 1RM6C 2V3PA 4IM0A 1L6NA 3RYTA 5KFXA 3BQ0A 1WGKA 4XE0A 2XK5B 2B0CA 2WFAA 2LBOA 2KV2A 3GDXA 1L8OA 4I2GA 1TKYA 2ZIVB 3WIMA 3ZNZB 2GBRA 4MHVA 4XA5A 3H7SA 1T7PA 4CF3A 3U8ZA 4NJCA 1E10A 1R4NI 3APDA 5J2FA 1WRIA 1MHHE 4XC2A 3HPOA 2NS5A 2ZJDA 4MELA 9ICKA 3PS6A 4EELA 4XDDA 2GB1A 5AKIA 1TV9A 4RQ7A 3K1ZA 2KTQA 4O3RA 3DDCB 1KLNA 2BF8B 2DENB 3SFDB 2XVTA 4W9GA 3MR6A 1S9FA 4DQOC 2K4EA 4GIBA 2BKRB 2PFQA 1CMXB 3FC4A 2W9MA 1KM7A 3NUHB 2WB1C 4NM2A 2OEHA 4YMNA 3S6JA 3RB0A 1ACCA 3UIPB 4GFJA 3EC8A 1ZQRA 2F8LA 3QU7A 2KVRA 4A55A 4IWOA 2FCMA 1D8YA 4LJOB 1YJ1A 4USAA 2K8CA 2A4ZA 4DLEA 3ZTCA 2H5XA 5L83A 1IBXB 1I4XA 2K22A 2BB5A 2EAMA 2ZW0A 2L00B 1PFDA 4ACFA 2W3SA 1QLBB 4ANUA 7ICLA 2KN7A 1F1HA 2A1JB 1SE3A 4X5VA 1WI0A 4IWQA 5CHWA 1D3ZA 4P0PB 2PI4A 4M02A 3E0FA 4KSLC 3PZ7A 1NJWA 1MQ2A 4F2RA 2KFNA 1C1YB 4HKZE 1N62A 1FPYA 2V4IB 4HJKA 2HBKA 2JV3A 5KG6A 2AWTA 2EH9A 3FYHA 4DSLA 3HRDD 4XUSA 5AIAA 4F50A 1BUIC 2QDFA 2WHEA 1PVPA 4Q45A 1CK1A 1OTRB 1PZNA 3F5AA 4OVZA 2NTSA 2JGAA 2J53A 2BHNA 2IA6A 2HBJA 2W7PA 2MHJA 4EEYA 4UAVA 1SKWA 1CZPA 4DO9A 4URKA 2W54A 2RMMA 2HMXA 2V1YA 2WHIA 1BPXA 1SIFA 4OVVA 1P1AA 4NWIA 4IG7B 5IP4D 3ZKJC 1V86A 3H0MB 1FEHA 3JPSA 1CEZA 4WAAA 2ZTEA 4DK5A 2A3VA 1JROA 5KG5A 4BDPA 4KLIA 1T0RC 2QB0A 3RT3B 3NHEB 2VANA 1COOA 2WP9B 1T3NA 1V97A 4DWIA 1ZJNA 4KLOA 3H0RB 3N28A 2BPGA 1GB1A 3NOBA 2X38A 1QOBA 2P6RA 4YXJA 3GIMA 1PK3A 4DQRA 1X9SA 4KLLA 7ICFA 9ICFA 3N9YC 1DGSA 3LK9A 2WB1F 4WJ3B 4R65A 4ZRIA 1BXTA 5AKHA 2F44A 2MRLA 3B9JA 3AV8A 4W9FA 3VH3B 1SXEA 3CSTA 3V6CB 4B9TA 4F72A 7ICNA 2WGSA 2C2RA 3ZJTA 2WWZA 1V1PA 3C1ZA 3N1ZC 3M7DA 3JVZX 1C77A 4P1BC 4I2JA 1XNSA 1YX6B 2K4IA 2MCNB 4JWUC 3Q8MA 1XWLA 4PS8A 4RQ3A 4GDKB 4RGTA 1SWWA 4BUGA 4Y2PA 3IDWA 4QWAA 3KHRA 3V6JA 1QF6A 4BJQA 1YN4A 1WSPA 2D3GA 2BQUA 4W9HA 2V3NA 5KHOA 4UBCA 1EXNA 3SZ2A 2H88B 5E6JA 1TY2A 4DL6A 2NV3A 3SEIA 2GI9A 3Q3NC 1KRPA 4DL3A 2AX5A 3T5LA 3DVGX 1FIQA 1F0MA 3KKAA 1XCTL 2KX3A 1XO3A 2D07B 3NS8A 5J8YA 1KW4A 1JWSD 3AQEA 1TYGB 2ZG6A 1V6EA 3BQ2A 3UPQA 5AUKA 5GTIU 2QC8A 2JEFA 3OAWA 4YFKA 4O3QA 3TUOA 2W9AA 3NGDA 3R2TA 2AHOB 3EGRA 4RFBA 2F77X 1P3QU 1TJEA 4FHKA 1XD3B 4F92B 5KTQA 1X66A 3CW2C 3ZD8A 1O08A 5AM5A 5KT4A 1D9DA 4LDTD 2ZIUA 4J9LA 4REZA 3HVDA 4EE2A 3RUIB 1EU3A 5DB7A 2G4DB 4FHJA 1BPEA 4FJVB 2N9KA 2KFKA 5KFAA 3V72A 3DBHI 3W9CB 1WZ3A 2KK0A 3R3MA 2G06A 2FCSA 4QWDA 1ISNA 4H2AA 8ICWA 1RG6A 1X2IA 3G6YA 2F3NA 3I57A 2N1WA 4ZHPA 9ICHA 2J42A 1WGHA 3WANA 3WCQA 3KOOA 3RBDA 3AEEB 4II3B 3E56A 2UU7A 4BFRA 1IYFA 4F4ZA 3BVGA 3RNAC 4A6QA 1L3SA 1XQQA 4IM3A 4M04A 4IQTA 1TS4A 4WJPA 2MAXA 3P4RB 3K75D 5GTHU 5HMLA 4KLGA 4KMUA 4CF4A 1ZQEA 5AI4A 1SE4A 3RNEC 4OW0A 3ZYYX 2IY0B 5ALUA 1YZ6A 5KFTA 1WYWB 2PJHA 5KT2A 1FO4A 4UB3A 3AE7B 1V85A 5ALVA 3RNBC 3VUYA 3TFSA 3C0RB 4E0DA 5IIMA 5ALJA 9ICIA 4G50A 4TUUA 3H7PB 1WRDB 5EE9A 2YMLA 2HOIA 2WNMA 1HZ5A 2ZNVC 1N61A 4X57B 5TZVA 4PGQA 1ZYQA 2KQ7A 2ZPYA 5KFZA 5DPTA 5ALWA 4BX9C 1ZQSA 1Q46A 4Z6CA 5IKCM 1ET9A 3UXNA 1YT3A 2ZIWB 2EELA 4MGYE 4BBNF 4IC7B 1XT9B 2FLLA 4QZEA 4WH4A 5H92C 3P42A 4IWPA 1KTQA 3V7LA 2KWDA 3R7RA 1ZQNA 2G08A 1RLFA 5FK9C 2UVVA 4N59A 4DHZE 2O2VB 2B6GA 3VHTC 4RQNA 1XSPA 4AWJA 4YTMB 9ICMA 2BS2B 3Q8EA 3C21A 3QZ7A 1AWDA 2O6VD 2N9EB 2RRDA 2LZ6A 2KTFA 3RBEA 2N9LA 3B0AA 3NS1A 2FPLA 4GN1A 3PHWB 4MM3A 3QJZA 3C2KA 2LRUA 1C4CA 4QJFB 4DHJD 4ZOHC 1X42A 1WG8A 2W11A 1SF0A 4Q8EA 2ON8A 1ZQUA 2BGWA 2Q5WD 1XLQA 4C4VB 4DFDA 2NPTA 3ZNGC 4FLHA 7ICUA 2AGQA 2LMRA 3LJ3A 4PL2A 3DBSA 3GQCA 4QZCA 2LRWA 4HWIB 3H1UA 5ALYA 3ORYA 1UNSA 1T0SC 1ZUD2 5C0YA 4GDLA 2PE9A 4UDUC 3J9CA 2KC2A 1ZD3A 2R8IA 4BOSC 4LCDE 3I1YA 4OCZA 3DHGC 4QWEA 4FXCA 5H2FU 5G5HA 1WCNA 4I2FA 2YEPF 1C79A 4OZBA 4WWNA 3P4SB 3RFAA 1UZXB 2AJQA 3RMKC 4O3MA 2MA1A 3TKAA 2MP2B 4K4IA 3PSEB 4UB8U 2PXIA 3A9KB 5AKYA 1FEZA 1TS2A 1JRUA 5D49A 3HIZA 2DKZA 2IO1B 2BPCA 1WXSA 4J9SA 4P0QB 2K39A 4DOBA 1E90A 2XC9A 3Q2AC 1ZD4A 4R63A 1FXIA 3GB1A 5BMGA 4P4OA 3OJSA 1HXYD 1URJA 5J2DA 4C8NA 3MDAA 1NJYA 5KFUA 3Q8QB 4XRHA 5KFMA 3HW8A 2ZW1A 3K9OB 2EZZA 2HD5B 1ZRMA 4DFPA 3TAQA 1O03A 4NAMA 1NNLA 4RGOS 3OJ4B 2DHZA 4EUTA 5CX3A 4IQUA 3ONNA 2ZUBA 4BGDA 3PW4A 1GC6A 2NRVA 2VJ4A 1XO1A 4C7YA 3ISBA 3TFRA 2G5IB 1DRGA 2WXFA 8ICHA 3PO0A 2LGDA 1XLNA 1ZQAA 1NK0A 4K7WA 4RQMA 4O5KA 3PSIA 4J9RA 3LYYA 1ZQKA 3BZKA 3MABA 2LM4A 5KFHA 1ZQZA 3P2BA 5IIKA 2JH7A 1HUOA 1ZQHA 1Y8RC 2Q4TA 1MG8A 4ECRA 2J0KA 2RP5A 8ICXA 2D5GA 1TAUA 4QZ9A 1GOZA 4UQGA 5D6JB 1FRRA 3AE6B 1TK8A 3TMPB 3KHHA 5KAIU 2BCUA 4KX3A 3KHGA 4FJYA 5AK3A 3AE9B 2BW2A 1J97A 3HKZC 5AM3A 3QEAZ 4IS7A 1EWYC 2KHVA 2RDHA 1WM2A 2FIFA 2PKOA 4YSYB 4Y2SA 4PHAA 1TK5A 2XGQA 3IT6B 4DXGA 5L9XA 1QOAA 1TKGA 1QOFA 4PT5A 2KNBA 3U7DA 1FD6A 3DWGC 5J29A 2ZIXA 2JRZA 4DOCA 4ACOA 3UMCA 3QWZB 3ZJVA 3GFKB 4F5NA 4CRXA 1FM0D 2BQRA 1ZD2P 1IGDA 3DBLI 5HMMA 3L08A 1T94A 1SL0A 3LYSA 2CRXA 4JQWC 3BK2A 2VZKB 2KD0A 5J0WA 1Z4OA 1A76A 2G0AA 5DBCA 4A3PA 2PIAA 2INNE 3IFWB 2AXTU 5HR7A 5CHFA 2NBUA 3VFKA 4B9SA 1VJKA 3AUOA 3NUQA 1NJXA 3OLMD 3RJGA 5AZGA 2JHDA 3JPNA 2YEPB 7ICHA 3NJTA 2BCQA 2P66A 3FILA 5ALEA 3C8YA 4F2SA 3M8RA 3RTVA 1SXDA 3P1MA 4YTNB 2PFOA 3KKAC 4DQSA 2OH2A 1I4HA 4Y2JA 2LD9A 4JK1A 2YMQA 1OEYA 5J8YC 1F2RC 5KL1B 3MGIA 3PR4A 2AEHA 2V9WA 2KP7A 1Q3UA 2ZNVB 3DCGA 1C9FA 5J2AA 2IMWP 5CR0A 5AM0A 4UB1A 3ECIA 3MC0B 4EEKA 2VJ5A 5J2KA 8ICQA 4ECXA 2XY7A 4RQ2A 2KQSA 1RXWA 3IHQB 3PPAA 5D3IB 2KZRA 4NLKA 4YSXB 4CO7A 2LKYA 2DZKA 5BPCA 2R8HA 4ANWA 3KVFB 5JU5A 1PQSA 3R7QA 3K1RB 4NJ7A 1IG6A 3HKZF 4US8A 1TAQA 2LGSA 1HZ6A 1MC8A 5EWGA 2FJ6A 1S10A 2HHQA 2UVWA 1A70A 3FKYA 3AEVA 4G0NB 2CHXA 3N32A 4KDIC 1KN5A 4MSQB 4MSMB 1TS5A 3WKEA 2GO7A 2KZMA 2HI0A 2FUG1 3SENA 9ICQA 4UB2A 3H4DA 1BPZA 3N7PD 3LDZE 1I4GA 3ZNHB 3NVWA 1FCCC 4F8RA 2W82A 4DCCA 1F2RI 1FMAD 4JLCA 4JMUA 3CP8A 2KO3A 3C19A 3QU2A 4ECTA 1KBUA 1F52A 3RJFA 2K6QA 2KT7A 2DYBA 9ICNA 2IZVB 2RHFA 1OQRA 1A5RA 2FLPA 5ALOA 1RQNA 1ZDXA 1NDDA 5BO4B 1V1OA 2QJLA 1K1SA 1AN8A 4ECQA 1FXAA 1LQBA 3VAWA 3UMGA 2KDIA 3VTWA 2K4HA 9ICRA 1QT9A 2FMQA 1QQRA 3MHZA 5J0YA 2CU3A 1K5OA 4CDGA 2MRPA 2BZFA 3CWIA 2H3FA 3PMLA 1SJED 2E8NA 1S0MA 2FMPA 3N1YC 4F4YA 2K8CB 3Q8KA 1SE9A 2C7HA 4TUQA 4R3DA 4I2DA 4NAWA 2YX8A 1BVSA 4WJNA 1ENFA 3HM6X 4KLTA 1XEEA 3VTUA 1XS9D 1QQ7A 5D3DA 5AI5A 2ASJA 1C78A 5AM4A 4GLXA 2H3ZA 2DLBA 2MSED 4NL9C 2W43A 4B0MA 7ICTA 3GE3C 4LLGM 2R8KA 2W8LA 2WAQC 2ATLA 3KYCD 3CIRB 4EZ6A 3TI0A 5CA7A 4ECYA 4F71A 1TKDA 5JZEB 3BVMA 4GXBA 1MVKA 4I27A 3O65B 2J52A 3AU5A 3ZXRA 5J2CA 7ICEA 3AULA 3MBYA 4QW9A 1L5PA 2FE9A 2XICA 3GZNI 2MBBB 4E71A 2KFJA 3WAOA 5IN7A 4YQWA 5IILA 1GJZA 3F53A 2DGZA 5DG7A 3NZSA 4LJXA 4NNJB 4HAIA 1T8EA 4ED1A 3F2BA 4B9MA 9ICUA 2K3UA 1MG4A 2QB0B 2KHQA 1NJZA 3C28A 5JRTA 3JPTA 3TADA 4W9CA 3Q69A 4KLMA 9ICOA 4I2CA 2KDBA 2R2OA 4EOYA 3ZD9A 1T5XD 3NY5A 4LNOA 1X40A 4S0RA 4JX1C 4OJ6A 4B9NA 1RDFA 4HYKA 4JWSC 1F44A 1NZBA 2Y5CA 5G2NA 2IBIB 5BOLA 1COKA 2NCNA 3ZO5B 4W9JA 3V7JA 3I5JC 1RYUA 2F8KA 1QH9A 2JH1A 5DDYA 4C8LA 2RPVA 4XYCA 1N56A 3MJWA 3PRMB 2MUTA 2LVPA 1GPXA 1I4PA 5HHDG 3EPIA 1UGJA 3L13A 3SYZA 1V1PB 1VZ8A 1XCQL 3ZRFA 2M1MA 4AP9A 1I4RA 1JCKB 3ALRA 2KE7A 4F4XA 2UVUA 1K8RB 1KH0A 2PTLA 3HK0A 4II2B 4BKTA 4IRKA 2LASA 3OWEB 4GOCA 4IL6U 4CQNA 5BMHA 2KEYA 4NY8A 4I6PA 2H3QA 2IHNA 2D2QA 3A0BU 4EZ9A 2WAQF 2ZUDA 3Q6BA 5L1KA 3WKDA 2KICA 5J0QA 2C7NB 2OJWA 3KLSX 4YXDB 4WJOA 2L05A 1R4MB 3TBLD 3DOWA 3M95A 3ISCA 1DGJA 2NRZA 4C4RA 3A9JA 3RJJA 1HE8A 3A4SC 4HLEA 2E1EA 1LV5A 2IOFK 1P7DA 5ALLA 2ASQA 5CEHA 4MF8A 1C4PA 2KJHB 1TZ1A 2ODGA 5KFVA 4O0IA 4KN7A 2C9WB 4M0WA 2LM1A 3PVXA 2J0JA 4YR2A 1J7BA 5IIJA 1A6SA 3VRBB 4DQQA 1EWCA 2LFIA 2JVCA 1S8OA 2HDOA 2ZIUB 3QX7A 2I1KA 2N9PC 1HQRD 3AEDB 3X0WA 4CHKA 1D5ZC 1S0NA 1WE6A 4FE3A 3UXOA 3VC8A 4O3NA 2O6VA 1J8CA 2KFKB 1SXTA 1CQVA 4LZDA 1KJTA 3PGEA 2F1HA 4TSSA 9ICTA 1B22A 4F7ZA 4MEMA 3Q8AA 4O1NA 3WK9A 4HVBA 1Q3VA 3G6VA 1SL2A 4S17A 3M9NB 1Y88A 2D3AA 7ICQA 2LUMA 2HVIA 4ED8A 3T5KA 1WWTA 4C4SA 2ISOA 4WQMA 1XU4A 4C8OA 5J0XA 4NXZA 3AEFB 1NYQA 1UQVA 5KFQA 5KG2A 4LJPB 2K1FA 8ICFA 3NG0A 2PVGC 1XSLA 3HT3A 4PH5A 1K51A 1YNTE 3OSPA 1X6JA 4QIWC 3F5EA 3VRAB 3R66C 3NRZA 2KWVB 2KIVA 8ICOA 1U49A 1Z5SB 4NM1A 4LNIA 2WXKA 5I4DA 2XCPA 2YMMA 1WE7A 1BPDA 3PT2B 4C80A 4F5PA 4KKIA 2N0SB 4EENA 1J19A 3APFA 5J2GA 1LGRA 1GB4A 4KVGB 2KLCA 3WKCA 4F5QA 2ZEQA 5ALPA 2MH7A 2RDJA 3EYZA 1YQBA 5DQIA 3T5JA 2I38A 1HEKA 2LYBA 4RQ5A 3OHBA 4FBUA 3Q8BA 1MA7A 4DL2A 4YCXA 3MFGA 4JV1A 4YD1A 5HHHA 1UCVA 1WGDA 3R9KA 1ZQCA 3QX1A 4KX5A 2MW5A 1U45A 1VLBA 2JQRB 3V7KA 1L0YB 2IOHA 3I63C 2AQ2B 1SWVA 4I2EA 4MACA 2HOQA 1B4FA 3Q8CA 4OVUA 2J6TA 4DDGD 5KFPA 4IKGA 2E8PA 3C2MA 7ICPA 2PFNA 2JSVX 3RJHA 4MM3B 2IPKD 2QILA 1C7YA 1TE2A 2ASDA 1X9MA 2BCSA 1C20A 3ZTDA 3ZXVA 3M9MB 4LTUA 2NMQA 3KWLA 3SD7A 1TGZB 2NPTB 1SSNA 3ML9A 4FJZA 2KJ5A 3JSVA 2DPJA 5KG3A 2GBJA 4WJQA 2O6KA 3SAGA 2KIWA 2KD1A 3F2CA 4RNMA 1DK2A 4W9IA 4R8UA 2KOXA 4OD0A 3L17A 1N60A 2D8CA 4GDLB 1KOTA 1PUZA 3BS5A 2YN4A 1WWUA 2R61A 2EAPA 4DOAA 1WMHA 1WUDA 1M94A 1MPEA 3SI8A 2K5PA 1JMSA 3AEBB 2BWES 3AEGB 1ZQLA 2KANA 1OQQA 2BDUA 4QIWF 1BPYA 1R4NB 2YQEA 2AL3A 2HDEA 1PK1A 2KJ8A 5DG8A 1Z4NA 5HNKA 4ARIA 4I6NB 1EF5A 5IO9A 3QU4A 3GILA 2KWCA 2CJNA 3V60A 5IOIA 4ANXA 4HDQA 4IUMB 3ZDMC 3CYMA 3MDCA 5IAAC 4WWOA 5J0PA 2AYOB 3QZ8A 5IIIA 1P7EA 2N1RA 1WJNA 3RR7A 4K7UA 4HDOA 3PX6A 1E7UA 2IDYA 4LZGA 2L7RA 3B1LX 3QNMA 4G3XB 1V80A 5DCNA 2NRWA 1QQ5A 2KJ6A 4ICVA 3AM9A 3PW2A 2LYHA 2XEWA 1Z1BA 3H0LB 3ZDTA 1C3TA 3I76A 2W9NA 2W3RA 4A8EA 5AK6A 4Q43A 4ZDVA 1WX7A 3RI7C 1GC7A 1QSYA 2BVCA 3Q3FA 1MHXA 1YJJA 2BQ3A 2WX1A 5J0TA 2L0FA 1L7YA 1A0PA 4HXDA 2HHTA 3ZJUA 2HOFA 3WA0A 1QZEA 3BQTA 3Q3JA 4FN2A 3GS2A 1L2NA 5E6NA 2WXGA 5DPWA 5AKXA 2BCRA 1WXMA 1LFDA 4EEWA 4G3IA 4EX7A 1AW7A 2CXYA 4CNQA 2P6UA 2AGOA 2FAZA 3JW0X 2VKQA 4EX6A 3RN9C 4RQ1A 1ZP0B 3AN1A 4K81A 1L7PA 4J9PA 4B9LA 1YD8U 2G4SA 3PW0A 4QZGA 3UM9A 4KGRA 4WAFA 3TADC 2V3SA 3MR2A 2JRIB 1IUEA 4DL5A 2RDIA 3V6KA 1WY8A 4DXAB 2FBWB 3CF6E 3HX0A 4O3OA 1KFSA 2LPEA 4M0AA 3FM9A 3N1XC 5ALNA 4BZAA 4BWJA 3QC8B 4ZRPA 3RULA 4ITKA 2W04A 2BKFA 2ZIXB 3C2LA 1KDHA 4I2HA 1QOGA 2WXPA 4HCNB 4ELTA 3PVLA 4RCOA 1LM8B 2M8SA 2HHUA 2BYTA 1Y56A 3RAXA 1WWVA 5C23A 5BMIA 1SJHD 3TIXA 3AE8B 3OGUA 2YB1A 4ZYNA 2JYEA 4DFMA 4NL9A 5AUIA 1UBQA 1FFUA 1WR1A 1PGAA 3V3XA 2DAFA 4M00A 3ZDCA 4KSKC 3RJKA 3T3FA 4K1RB 3GV7B 3W1SA 2KAJA 1LVHA 4F4KA 2K8AA 3PV8A 4FBJB 2REXA 3FILB 1JIHA 1U47A 2C7MB 2OOBB 1VRAB 3T5HA 2M56B 5JTIA 3RH4A 4KLJA 4DWFA 1K53A 4W9EA 1XSNA 4E3CA 1B9RA 5CP2A 2W03A 2K0PA 2Y5BB 4ED7A 3BZDB 4DSIA 1NVID 2CHWA 3BS7A 3SAFA 3RH6A 3AU6A 2PMVA 2QSDA 3RRHA 4CF5A 1P9DU 2ZJ8A 2BR0A 2RGFA 4GC7A 1WX9A 2PVOD 4EKUA 1YIWA 1AARA 4C8KA 2LWPA 1PUTA 4U6PA 3RNGC 3AB5A 1JWUD 2OEDA 4EBDA 1RFKA 4DL7A 2BS3B 3DBRI 3VH4B 3VR9B 5KFBA 3DWMA 4AUQC 1SZPA 3LXFA 3IP4B 2DF4B 5KFDA 2KMAA 4Q44A 3P4QB 2Z0DB 4WWMA 5JXVA 3NVYA 2JRHA 1ECWA 7ICMA 2B3AA 2L76A 3C23A 1ZOLA 4CE6A 4FS1A 3HILA 4IR1A 3N30A 1BMLC 3BK1A 3MC9A 3VCBA 4Y2XA 5DBAA 3V6HA 3Q3MC 2WXHA 4F8CB 4P6VF 4KLHA 2VA2A 3U26A 1YZ7A 4U7CA 1LKYA 9ICXA 2WDQB 3TEWA 3IRUA 2KJ9A 4P16A 5ALDA 5KT7A 2L3ZA 4ECVA 2PLPA 2KSOA 4J03A 2ZPNA 3SDLC 3PZPA 1ZQOA 3TQ1A 1S1QB 2ESEA 1L3TA 3KD3A 4F93B 1J2NA 2N7JA 4GGQA 3DVGY 4TURA 5AZHA 4KGTA 4YVZA 1DK3A 1WFYA 1TS3A 3DBHB 1VZ7A 2BKEA 4M47A 4M8NA 4ANVA 3HP6A 2M17A 4K4GA 4CGZA 2V0GA 3ICXA 1EU4A 2MBOA 2QARA 2DYMA 2GH1A 2GBMA 1ZXHA 2MX2A 1E8YA 4GSWA 5LXHA 5DB8A 2JPHA 1YQ4B 5AM1A 1QILA 2GMIC 2JMGA 2FIDA 2R8JA 1U48A 4DSKA 3MGVA 4EYIB 1GAQB 5BYRA 3WK5A 2WXLA 2MJDA 1V9PA 1MQ3A 4ARCA 4YG2A 5KL8B 5AM2A 2K8BA 4AOFA 2RDBC 3SAHA 4GU2A 3AMZA 1KTKA 3IHPC 3KYDD 1IV8A 3QUTA 3ONSA 5AK5A 3TEZA 1L3VA 1VDVA 3PREA 3PSFA 5EOZA 3VUWA 3W1YA 2PMZC 2FI1A 2I1QA 3QYPA 2RR9A 3AE1B 4NAWB 4EYHB 1L5UA 1QKZA 3HM3A 2WXJA 4YD2A 5IINA 4MH0E 5J2RA 3ENEA 3D2NA 4EBEA 5HP4A 3SMVA 1L7NA 5KFSA 1SZHA 3QARA 1GO3F 2HW3A 4KKJA 4UAYA 4RMAA 4M2YA 1BT0A 4F5RA 3JYUA 4RPZA 3IAS1 2D3DA 8ICMA 2EKEC 2KN4A 4QZDA 2VH1A 8ICAA 2YLMA 4RPXA 1RXVA 1L0XB 1MN8A 1TTNA 4DSEA 5HFYA 5EE1A 1U9LA 2DAJA 5KG1A 4P4PA 3ML8A 3VUXA 3TSSA 1NK5A 1X9XA 4TKNA 4DQIA 1OEYJ 2W9BA 2KLGA 5J18A 4RT2A 1RYJA 1JRPA 3K4GA 3RF9A 4WQOB 4R66A 3PTFC 3SEBA 2XY6A 3TL5A 1UHUA 2AQ3B 1WJ4A 3VVWB 4DSJA 1MSWD 4BAXA 2KQ4X 1GNUA 3PRZA 5L95C 2I2YA 2Y5PA 2LXAA 4AYBC 3MJ5A 4I29A 3L16A 3BYTB 2I6XA 4R64A 2M0XA 2O2VA 5J0UA 2K9XA 4BXOA 3H7IA 5C2TB 5KFCA 1KKXA 4IC9A 8ICNA 2BPFA 4YTPB 1ZPSA 3HVZA 2GBKA 5TISU 1DXSA 4LDTB 2UVRA 1OXJA 3OG5A 1SBBB 4A3OA 4ECUA 2WTFA 4J9KA 1WXQA 1FXTB 4JV0A 5G55A 2JT4B 3AI5A 4J9NA 1IIPA 1KFYB 3B2GA 3BYYB 3PW7A 2EZYA 3PR5B 1Q0WB 5HR6A 4HJGE 3C29A 2R18A 3V05A 1CI4A 2MUTB 3W5VB 2FMSA 3U7ZA 3QEBZ 1ET6A 2BWFA 5ALZA 3PZDA 2HHVA 3U2SC 4B0EA 3DQVA 5J2HA 3DHIC 1NK4A 1ZKHA 1F5SA 5JUMA 4NLZA 4LNKA 2H89B 3QUBA 5KNIA 3QE9Y 1L6UA 1EUVB 2WS3B 3WU2U 1ZE3D 3JPQA 1XLOA 3BWUD 2QLTA 2A5UA 3I28A 2JWUA 5JH5C 2JWZA 2JZ3B 2BYVE 3MR3A 4NPNA 1SB3C 5FR6A 5KFJA 3DV9A 3DHHC 4GXIA 2P35A 4NJ8A 5AKJA 5LLIA 4FO6A 3H9DA 3ZVVA 4GB9A 7ICVA 2I1JA 2QB1A 3EPGA 1E7VA 4ZRJA 2W9CA 1TZOA 5J2BA 1L7MA 2LGXA 1NOMA 2CS4A 3L54A 4ZH4A 3N3KB 4ICUA 2ICIA 3A9JB 1WF9A 2MSNA 5BYSA 2WXNA 4QZHA 4DS4A 3CRXA 1OFFA 2N7DA 3M9OB 3A0HU 4KIKA 4F5OA 2LUEA 3RAQA 4AYBF 5A0LA 2YVCA 4M0WB 4AS1A 4EZKA 1UBIA 1WJUA 8ICSA 5DPSA 5KG4A 1N5WA 4DDID 4PGYA 1ZOYB 4MJSA 2ACZB 2XI9A 1QLNA 3GV5B 2ZJ5A 2QEJC 1JN3A 1SIJA 2NRXA 1XF5L 1Z3EB 1F9JA 2QHOA 4QWCA 2LHTA 1SKSA 1NI2A 2LJ5A 5ALQA 4Y2RA 2O6VB 3N4MB 2JU6X 4OZAA 4TQSA 2FUHB 4PL1A 2WXIA 4PHPA 4O9MA 1QTMA 2NBVB 3SV3A 3IXSA 2HTME 3V62A 4DHJB 1QCKA 4L23A 3ZQ4A 4OJLA 4Y2YA 1X6IA 5DG9A 4IOIE 2ES6A 1TBEA 4ECWA 2Y9UA 3Q8RB 1ZQPA 4J9MA 3N97B 4L1BA 1P0RA 4NLBA 5FKAC 3KW5B 4ZYSA 2HHWA 2M4NA 5ALKA 5KFOA 3MP9A 4DL4A 1D5MC 3IT4B 3ZDBA 3W1SC 2HHSA 1ZQIA 4UAUA 1OQYA 3KH0A 5L1LA 1KQQA 5DPRA 3DBLB 3MFIA 4MH8A 2AQ1B 5K4LA 1ZQQA 3NVZA 3GP7A 4XWWA 3UXPA 4RH6A 1I42A 2LXCA 2PW9A 3JPOA 3HJEA 4O5EA 2V4LA 3IBEA 1S0VA 2WF5A 5J2EA 3WK7A 3ZI4A 3GE8C 3ETRA 4JWNA 5ALFA 1Q1OA 4QWBA 2KN5A 3Q14C 1WM3A 2M0NA 4Z6EA 4Q8FA 2F1JA 9ICVA 5AKGA 1GUAB 1E7PB 3LVVA 2LGIA 4HRSA 4DF8A 3PZ8A 4PS3A 2ALZA 2XN9C 2WXMA 1SGHA 5D46A 3AE2B 2BGFA 2E5SA 4GMVA 1M6YA 4PHDA 3AU4A 2ZJAA 2VA3A 4RNAA 3IVFA 3TEYA 4Y2TA 4DFKA 4YWGG 4XQ8A 2ZCCA 4Y2VA 2ZTCA 8ICBA 4NLGA 4ED0A 2LVQA 4PYUA 3RB6A 3DEEA 3M6ZA 5J2IA 1NBFC 3EWAA 4NV0A 1E5WA 2KDFB 2FNJB 4C4TA 4A90A 3QUQA 5AKLA 4MDKE 1ZQDA 3NZUA 1NKCA 2KMDA 1JXLA 1KSPA 1UGMA 3N7RC 4ED2A 1ZQBA 1ZGUB 3PX0A 2V4QA 1TT5B 3P63A 1XLPA 3LVWA 4MGIE 3M6KA 4RT3A 1XC9A 5J0RA 2E8MA 4RQ4A 2ZVNA 1VCBA 1K1QA 5LNK1 4ELUA 2NTTA 2KNJA 2HSZA 2WXQA 1IM4A 3JSVB 5KFNA 2G45B 2OJRA 3IG3A 3V61A 4I6LB 2DZMA 3A1QA 2IO2B 1FFVA 5ALHA 4R8UB 2Y3AA 5ALGA 1PGXA 4P7IA 3BS5B 3OJUA
chains in the Genus database with same CATH topology
1MPEA 3P4SB 2K5PA 3AEBB 3AEGB 4RF0A 1PDXA 1OQQA 5HI1A 1TS2A 2BBCA 2HDEA 3I9V1 1J7CA 1NEKB 1PGBA 1YJIA 3O13A 4ARIA 2CJNA 2WDVB 3KQ4A 1K52A 5FR3A 1FXIA 3GB1A 5BMGA 1P7EA 1HXYD 5C3JB 1L6VA 1D6EC 2IDYA 4HKQA 1D4BA 2ZW1A 1SEBD 2INPE 2L32A 2SAKA 1ROEA 2DBYA 4NAMA 4RGOS 3AM9A 4J3OD 2KACA 2W3RA 1JMLA 2JX5A 4C7YA 1RWSA 4IDIA 2WXFA 4C56C 1MHXA 1YJJA 3PO0A 1XLNA 3T3NA 3ZJUA 3LYYA 4YT0B 3GS2A 4RGNA 3NVVA 2WXGA 4OZCA 1WYGA 1V8CA 1IGCA 4KGSA 1AW7A 2D5GA 1GOZA 3IAM1 1E6EB 2LMCA 1FRRA 3AE6B 1ZP0B 3AN1A 3AE9B 4WAFA 2BW2A 4KGRA 1XXGA 5GXGB 2WU5B 2LJIA 3AE4B 1EWYC 1UWXA 1IUEA 2RDHA 2PKOA 4US9A 4YSYB 2LHEA 4DXGA 1KRHA 3IT6B 1QOAA 1TKGA 1QOFA 2FBWB 4PT5A 1DOXA 4XWTA 3AE5B 1FD6A 3DWGC 4RGMA 5H8YE 3H8HA 4ZRPA 4ITKA 3KWVA 3ZJVA 1QOGA 2WXPA 1FM0D 2SEBD 2G9HD 3AEAB 4RCOA 1IGDA 3BIID 2BYTA 1Y56A 1I7HA 5BMIA 1FNUA 1LO5D 1PYWD 1TKEA 1SJHD 3BK2A 1STEA 3AE3B 2VZKB 2IJ0A 1T3QA 3AE8B 1B1ZA 1FCLA 2JYEA 2GRIA 5AUIA 2PIAA 3W2DA 2INNE 1FFUA 1EM7A 2BB6A 1PGAA 1VJKA 3V3XA 4AQ7A 1FNWA 2YEPB 3W1SA 3FILA 1AYFA 2KAJA 3C8YA 1HEZE 3LB8C 2MJEA 3P1MA 2BS4B 4YTNB 3FILB 2IGHA 1UUPA 3FAHA 1I4HA 1VRAB 3U52E 2L83A 2M56B 3B2FA 1F2RC 1K53A 1K50A 1E9MA 3HUIA 2DYOA 2RDGA 1B9RA 1C9FA 2QMTA 2K0PA 3BZDB 1NVID 2IGDA 2PMVA 1T6BX 2QSDA 3MC0B 4HEA1 2MJ3A 2L1AA 4N6EB 1YQ3B 2PVOD 4JE3B 1TY0A 4WIPA 5D3IB 1PUTA 4YSXB 2TSSA 1JWUD 2OEDA 1RFKA 3AB5A 2BS3B 3VR9B 3DWMA 3LXFA 1JWAD 5JXVA 3P4QB 4WWMA 2WU2B 3NVYA 4US8A 1JQ4A 4KX6B 1HZ6A 1C76A 1A70A 1BMLC 1DOIA 1RM6C 2V3PA 3BK1A 1WGKA 4XE0A 1FNVA 2WXHA 4P6VF 2VZKD 1TS5A 3TEWA 2WDQB 1TKYA 2FUG1 4P16A 1JALA 4HROA 1DYQA 2PLPA 3R8BA 2J4XA 4NJCA 4TQ0A 1I4GA 1E10A 3NVWA 1FCCC 1WRIA 1MHHE 2W82A 2N7JA 1F2RI 1FMAD 2E6XA 3TEXA 4KGTA 5G5GA 1TS3A 4XDDA 2GB1A 1VZ7A 4YSZB 1OQRA 4JPSA 2V0GA 1EU4A 3SFDB 1ZDXA 2DYMA 1ZXHA 3W5UB 4DQOC 1V1OA 2QJLA 1YQ4B 1AN8A 5TSSA 2Z8LA 1FXAA 1NENB 3FC4A 1QILA 3NUHB 1GAQB 1QT9A 1ACCA 1QQRA 2WXOA 3MHZA 3Q8FA 2WXLA 2MJDA 5BYRA 2CU3A 4A55A 4ARCA 1HA5A 1ESFA 1IBXA 4USAA 3CWIA 2EKIA 3AMZA 1KTKA 1SJED 4NZLB 1IBXB 1I4XA 1KLUD 2K22A 4R3DA 2BB5A 3TEZA 2ZW0A 1VDVA 1F77A 1PFDA 2MEKA 1ENFA 2W3SA 1I4QA 1QLBB 3EA6A 1SE3A 3AE1B 4NAWB 3E9SA 1XEEA 4A8XC 1L4DB 5D3DA 1QKZA 1C78A 2WXJA 3PZ7A 2DLBA 4HKZE 2FE8A 1N62A 2V4IB 4B0MA 4LLGM 4KKJA 1N5XA 1JWBD 3CIRB 3URYA 3HRDD 1BUIC 4TMAB 1CK1A 3IAS1 4ZHOA 4OVZA 2KN4A 2NTSA 3UI3A 3BVMA 2J53A 1MVKA 1L0XB 1YN3A 2J52A 3EUB2 5HFYA 5EE1A 1UWMA 2QIEB 4WURA 1CZPA 3TSSA 4N58A 1L5PA 1E0ZA 2W54A 2WQYB 2RMMA 1NI3A 1N63A 1RYJA 1JRPA 2WXRA 1P7FA 2WDRB 3SEBA 1FEHA 2AQ3B 2I2YA 1JROA 2KQ4X 1YMHE 4RF1A 2Y5PA 3MJ5A 2K3UA 2WP9B 3BYTB 2B76B 1V97A 1R7SA 2K9XA 3Q69A 2LEKA 2LHDA 5C2TB 1T5XD 3U4EG 4YTPB 4D2KA 1GB1A 2IGGA 2X38A 1QOBA 1ZPSA 5MPOA 3HVZA 3P4PB 4JX1C 3N9YC 3BVZA 1BXTA 1SBBB 4JWSC 3B9JA 3AV8A 2Y5CA 1WXQA 1KFYB 3B2GA 3BYYB 3ZJTA 2RPVA 1GPXA 1V1PA 2JXTA 1F0ZA 1I4PA 4HJGE 5HHDG 3SFEB 1UGJA 1C77A 1V1PB 3V05A 3W5VB 1VZ8A 4JWUC 1XCQL 2KMMA 3U7ZA 4GDKB 4RGTA 1ET6A 1I4RA 1JCKB 2OHFA 2PTLA 1KH0A 3U2SC 4B0EA 1QF6A 1YN4A 1WSPA 1ZXIA 4C7ZA 2V3NA 1YN5A 5T8IA 3OWEB 2H88B 5E6JA 1TY2A 4CQNA 2H89B 1VR9A 1L6UA 2GI9A 3VQIA 2WS3B 1ZE3D 2AX5A 5BMHA 1XLOA 3BWUD 2JWUA 1FIQA 1XCTL 2XNAC 1MI0A 3KLSX 4YXDB 1SB3C 3L4PA 5BYQA 1XO3A 3NZ3A 2W55A 1JWSD 1CJEA 1DGJA 1TYGB 3RPFC 5AUKA 1D5XC 1TZOA 3TUOA 2DWQA 2ICIA 3R2TA 5BYSA 3EGRA 2WXNA 1C4PA 4RFBA 1C4AA 4DXFA 1OFFA 1TJEA 3AH7A 2BTEA 4M0WA 2E3TA 1J7BA 4LK0M 4EE2A 3VRBB 2WLBA 4REZA 3HVDA 4AS1A 1EWCA 1EU3A 4TQ1A 3SR6A 2LFIA 3AEDB 1HQRD 1N5WA 1D5ZC 1ZOYB 1SE2A 2ACZB 2N9KA 2M0AA 2QEJC 3W9CB 1SIJA 1XF5L 3RFZB 1SXTA 2JYTA 1CQVA 4A9AA 4TSSA 4H2AA 2JU6X 4OZAA 2WXIA 3I57A 3Q8AA 4O1NA 2BT6A 3IXSA 4ZHPA 2HTME 2J42A 3WCQA 3AEEB 4L23A 3E56A 5HG2A 3ZQ4A 3BVGA 2LUMA 4IOIE 4A6QA 1WWTA 1M4VA 4WQMA 1TS4A 2ONQA 3P4RB 4L1BA 3ZGZA 1NYRA 5FKAC 4ZYSA 1SE4A 3AEFB 1JW9D 4OW0A 1NYQA 3ZYYX 3MP9A 1D5MC 5EE0A 3IT4B 1FO4A 3AE7B 2PVGC 1K51A 1YNTE 4MH8A 2AQ1B 3VRAB 3NVZA 4XDCA 5EE9A 3GP7A 4XWWA 3NRZA 3ABVB 5I4DA 2WNMA 1HZ5A 4RH6A 2WXKA 1N61A 2PW9A 4L2YA 1Q10A 3R2IA 1DOYA 4C80A 2CJOA 4KKIA 3ETRA 2N0SB 1GB4A 1ET9A 2EELA 2MH7A 2G1EA 2I38A 1E7PB 4WH4A 2LGIA 4HRSA 5H92C 3P42A 2JZPA 3PZ8A 3Q8BA 3MFGA 2KWDA 2L52A 2WXMA 2XN9C 3AE2B 1J7AA 5EE3A 3VR8B 5FK9C 4N59A 4RNAA 1KLGD 1VZ6A 3TEYA 4YWGG 1JWMD 1VLBA 2JQRB 2BS2B 4YTMB 3AECB 3Q8EA 1L0YB 2AQ2B 4MACA 1AWDA 2N9LA 3Q8CA 3NS1A 4IKGA 1C4CA 4A90A 2JSVX 4ZOHC 2ON8A 1SF0A 4GLSC 4MM3B 2Q5WD 4MT5A 4ZRQA 1XLQA 2IPKD 2QILA 4Q2JA 1ZDVA 2KDMA 3P63A 4LTUA 2NMQA 1XLPA 3KWLA 1SSNA 1FRDA 1L0VB 5LNK1 3T3OA 1UNSA 1ZUD2 2NTTA 2M19A 2WXQA 1KF6B 4UDUC 4OHJA 3J9CA 4GDLB 1N60A 5D7GA 4FXCA 1FFVA 5G5HA 2Y3AA 2R61A 1PGXA 1C79A 2YEPF 1L4ZB 4OZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4S B;  3SR6 A;  1AYF A;  2K5P A;  2KAJ A;  3AED B;  1N5X A;  1JWB D;  3AEB B;  3CIR B;  1N5W A;  2MJE A;  3HRD D;  1ZOY B;  2BS4 B;  3AEG B;  3LB8 C;  1PDX A;  2ACZ B;  3P1M A;  4YTN B;  1OQQ A;  3FAH A;  3W9C B;  4ZHO A;  1SIJ A;  2L83 A;  3P63 A;  1J7C A;  1NEK B;  2M56 B;  3B2F A;  1YJI A;  4A9A A;  3HUI A;  3EUB 2;  1E9M A;  5EE1 A;  1UWM A;  2CJN A;  2QIE B;  2WDV B;  1B9R A;  1CZP A;  4N58 A;  1L5P A;  1E0Z A;  2W54 A;  1FXI A;  2WQY B;  1NI3 A;  1NVI D;  2BT6 A;  4ZHP A;  1N63 A;  2HTM E;  1RYJ A;  3WCQ A;  5C3J B;  1JRP A;  3AEE B;  1L6V A;  2WDR B;  2MJ3 A;  1WWT A;  4WQM A;  4N6E B;  1YQ3 B;  2PVO D;  1JRO A;  3P4R B;  1PUT A;  4YSX B;  3AB5 A;  1NYR A;  3VR9 B;  1RFK A;  1ROE A;  2BS3 B;  2DBY A;  3AM9 A;  3DWM A;  3AEF B;  1JW9 D;  3LXF A;  1JWA D;  1NYQ A;  2WP9 B;  3ZYY X;  2B76 B;  3P4Q B;  5EE0 A;  4WWM A;  1FO4 A;  3NVY A;  2WU2 B;  2PVG C;  2W3R A;  1V97 A;  3AE7 B;  1R7S A;  4US8 A;  2JX5 A;  2K9X A;  2LEK A;  4KX6 B;  3W5U B;  1JQ4 A;  5C2T B;  4C7Y A;  1RWS A;  4YTP B;  1A70 A;  3VRA B;  1DOI A;  1RM6 C;  4IDI A;  3NVZ A;  1QOB A;  5MPO A;  1YJJ A;  3HVZ A;  1WGK A;  3P4P B;  4JX1 C;  5EE9 A;  3PO0 A;  3NRZ A;  3ABV B;  1XLN A;  4P6V F;  5GXG B;  1N61 A;  4JWS C;  3B9J A;  3AV8 A;  2Y5C A;  2WDQ B;  1WXQ A;  1TKY A;  4YT0 B;  4C80 A;  2CJO A;  1DOY A;  1JAL A;  4HRO A;  1KFY B;  3ETR A;  3NVV A;  2N0S B;  3B2G A;  1GPX A;  1E10 A;  1WYG A;  1V8C A;  1F0Z A;  3NVW A;  3SFE B;  2MH7 A;  1WRI A;  2G1E A;  1E7P B;  3W5V B;  4HRS A;  5H92 C;  1FMA D;  4JWU C;  2KMM A;  1E6E B;  5G5G A;  1FRR A;  2L52 A;  2OHF A;  3AE2 B;  3AE6 B;  1J7A A;  1ZP0 B;  3AN1 A;  5EE3 A;  3VR8 B;  1QF6 A;  4YSZ B;  1OQR A;  4N59 A;  1ZXI A;  4C7Z A;  3AE9 B;  3SFD B;  2H88 B;  1VLB A;  2JQR B;  2BS2 B;  2WU5 B;  3AE4 B;  3AEC B;  1EWY C;  2QJL A;  1YQ4 B;  2H89 B;  4YTM B;  1L6U A;  1IUE A;  1AWD A;  2AX5 A;  2WS3 B;  2PKO A;  1FXA A;  4US9 A;  1NEN B;  3FC4 A;  1XLO A;  4YSY B;  3NS1 A;  1KRH A;  1QOA A;  1TKG A;  1QOF A;  1FIQ A;  2FBW B;  1DOX A;  1GAQ B;  4ZOH C;  1QT9 A;  1SF0 A;  3AE5 B;  3DWG C;  4YXD B;  1SB3 C;  3L4P A;  2MJD A;  2Q5W D;  2CU3 A;  5H8Y E;  1XLQ A;  1XO3 A;  4ITK A;  2W55 A;  1QOG A;  4USA A;  1CJE A;  1FM0 D;  2EKI A;  1DGJ A;  3AEA B;  1XLP A;  3CWI A;  1TYG B;  3KWL A;  3AMZ A;  4LTU A;  3RPF C;  3BII D;  5AUK A;  1FRD A;  1L0V B;  1I7H A;  1TKE A;  2DWQ A;  2K22 A;  1ZUD 2;  3AE3 B;  1VDV A;  1T3Q A;  1PFD A;  2M19 A;  3AE8 B;  2W3S A;  1KF6 B;  1QLB B;  1OFF A;  1TJE A;  3AE1 B;  3AH7 A;  5AUI A;  2PIA A;  1N60 A;  1FFU A;  4FXC A;  1FFV A;  5G5H A;  1VJK A;  2E3T A;  1J7B A;  3VRB B;  2WLB A;  1N62 A; 
#chains in the Genus database with same CATH topology
 4MGK E;  5ALS A;  2VRR B;  2K89 A;  1WMH B;  1L7O A;  2E1F A;  2N7E A;  2AH5 A;  1T4G A;  3LDA A;  3GV8 B;  4DS5 A;  2ISP A;  4IRD A;  5HI1 A;  3H4B A;  9ICA A;  2K8H A;  2N1V A;  1JX4 A;  2BBC A;  4FZL A;  5D94 A;  1NEK B;  3TAR A;  1PGB A;  2BPS A;  1ZET A;  3O13 A;  1PK1 B;  2Q0Z X;  2WDV B;  2ZUC A;  3KQ4 A;  2FPM A;  2CU1 A;  2JXX A;  2EMS A;  1D9F A;  3SQI A;  2KDE B;  4QZF A;  3A33 B;  3NRW A;  5J2J A;  5C3J B;  3G6X A;  1L6V A;  3PSP A;  4M9J A;  5E79 U;  4HKQ A;  2ASL A;  1WIA A;  3T9L A;  1RPL A;  4C00 A;  4CCH A;  4OJ5 A;  1SEB D;  2NVU I;  4C0Z A;  2I9G A;  3EZ5 A;  9ICB A;  3KZI U;  2LYA A;  2L32 A;  4EZL A;  1ROE A;  5TR5 A;  1V49 A;  2EAO A;  2KAC A;  2KHW B;  8ICI A;  4O3S A;  1S0O A;  5DB6 A;  1Z00 A;  1JML A;  2JX5 A;  3KFU F;  4ICA A;  2CR5 A;  4QNL A;  1RWS A;  5JHA A;  1IXR A;  4BOZ B;  4C56 C;  3M62 B;  2IYD B;  2KFZ A;  2KKV A;  5ALX A;  2KVZ A;  2Z59 B;  1Q5W B;  4QZA A;  9ICG A;  4ECS A;  3DVN V;  2G07 A;  4EZJ A;  4YT0 B;  3TAP A;  2RLT A;  2GLS A;  3NVV A;  2C5L C;  2YB4 A;  2Z7J A;  2BYF A;  1WYG A;  4PZN A;  4AP4 C;  3HWT A;  1IGC A;  2KTR A;  3RZW C;  2OCE A;  3D6J A;  4PZO A;  3RJE A;  2LMC A;  5BOM A;  7ICJ A;  2WX0 A;  2PFP A;  9ICJ A;  5KG0 A;  4Z6F A;  3M8S A;  2B21 A;  1XXG A;  5F9N A;  2WU5 B;  2HHX A;  4M6W A;  2LJI A;  3GZN B;  1SV4 A;  4MFA A;  2OM6 A;  2A1A A;  4KV2 A;  2KYW A;  3ZUN A;  3AE5 B;  3AU2 A;  1IPG A;  4DLG A;  1E8W A;  1OGW A;  2H3I A;  2KVS A;  5H8Y E;  2JUO A;  2JZB A;  3KWV A;  3QK0 A;  3PST A;  1KFD A;  1UA0 A;  4JWM A;  1KL9 A;  3T8M A;  2SEB D;  5E6O A;  4B95 A;  5DGB A;  5DDM A;  3BII D;  2NO4 A;  2MBE A;  5E6P A;  3PLU A;  1UPH A;  3Q8P B;  1FNU A;  4RNN A;  3PO4 A;  1PYW D;  1TKE A;  1STE A;  2AQ0 A;  1T3Q A;  1L3U A;  4RQ0 A;  1B1Z A;  1FCL A;  8ICP A;  1VJ5 A;  4KDL B;  4FBT A;  1V9J A;  3W2D A;  2MBH A;  2NYV A;  1EM7 A;  2BB6 A;  3D32 A;  2L5Y A;  5CRX A;  2KXJ A;  3QQ8 B;  1RRB A;  2J6U A;  1LB2 B;  1AYF A;  2LI5 A;  4BWM A;  4ED3 A;  2EZX A;  2MJE A;  2BS4 B;  1V38 A;  5GMV A;  3C5F A;  2IGH A;  1ZQT A;  2HJ1 A;  4IW0 A;  1OW5 A;  5KT5 A;  3E2E A;  1BNP A;  1Z2M A;  4NQL B;  4TQR A;  1HUZ A;  1K50 A;  3C1Y A;  2RDG A;  1KEJ A;  4AJW A;  4DQP A;  2QMT A;  1B0X A;  2C2E A;  2UWQ A;  2JEI A;  1E8Z A;  5D4B A;  4A20 A;  4UAW A;  4Z6D A;  2R8G A;  5B5E U;  4BKS D;  2C60 A;  3DVN U;  4NJ6 A;  3TCA A;  2K4P A;  5DQG A;  1QSS A;  1YQ3 B;  1TY0 A;  2I5H A;  3RNF C;  8ICT A;  2GOL A;  1ED1 A;  3ZDE A;  2JEJ A;  1NK7 A;  1JWA D;  3L0W B;  2IO3 B;  1RYR A;  4YN4 A;  2WU2 B;  3D2Q A;  1QSL A;  4PGX A;  2C22 A;  9ICL A;  2D11 A;  2MBQ A;  4TUP A;  2Z0E B;  3MHS D;  4KZ0 A;  3JPP A;  4G11 A;  1WGG A;  2XK5 A;  1DOI A;  4P1C C;  3ZDA A;  8ICR A;  5ALR A;  4W9L A;  2OXO A;  1FNV A;  2K25 A;  2ZIV A;  4UB5 A;  3WKA A;  7ICG A;  2VZK D;  5KFE A;  3GIK A;  4HPM B;  3QHT A;  5AEK B;  1JAL A;  4HRO A;  2C2D A;  4RZR A;  4KTQ A;  8ICL A;  1LKY B;  3GZF A;  1DYQ A;  1MJD A;  1T0Q C;  2NBW B;  3R8B A;  3UIN B;  2J4X A;  2HE7 A;  4UBB A;  4TQ0 A;  4UAS A;  3LWM A;  2KSO B;  2N9X A;  2XGP A;  2X8X X;  2E6X A;  3EEC A;  2DUY A;  3D2S A;  3RH5 A;  3TEX A;  4BBN C;  5G5G A;  2JY6 A;  4N9F 4;  2HCF A;  2RQ5 A;  1E8X A;  4KLD A;  1N6Z A;  2F76 X;  1OUQ A;  4YSZ B;  4CYE A;  4JPS A;  3EW9 A;  2KWU B;  3W5U B;  8ICZ A;  4PS7 A;  4W9D A;  2QAR B;  4NLN A;  5TSS A;  3PMN A;  2GWS A;  2Z8L A;  3PHX B;  1NEN B;  5MPO A;  3H6N A;  4EFO A;  4UW9 A;  5F9L A;  4KMO B;  3IN5 A;  5KT6 A;  3UMB A;  3J81 j;  1ZRN A;  2IHM A;  2WXO A;  3Q8F A;  2JXJ A;  1HA5 A;  1ZQW A;  1UT5 A;  1ESF A;  2PPH A;  1TFR A;  2XCA A;  2KKC A;  1IBX A;  3PY8 A;  2MWS B;  2EKI A;  4RUC A;  2INC C;  2GOW A;  4NZL B;  2K8B B;  4NLC A;  3T79 A;  3RCZ A;  4AJY B;  8ICJ A;  1KLU D;  9ICS A;  2A1J A;  4UAZ A;  5DLG A;  4JB3 A;  3ISD A;  5L1M A;  1F77 A;  1RFA A;  2MEK A;  4TUS A;  1I4Q A;  4P0P A;  4HPL B;  1BGX T;  5KFW A;  2JF5 A;  3EA6 A;  2KZ3 A;  4RM8 A;  3E9S A;  4A8X C;  1L4D B;  1ZQF A;  2OYY A;  4K4H A;  4UAT A;  1UA1 A;  5F3X B;  4ZRK A;  5AI6 A;  4FAD A;  5ALM A;  2FE8 A;  3ZDD A;  4KLS A;  3GIJ A;  1RQL A;  2IO0 B;  1N5X A;  2IBK A;  1JWB D;  4M8M A;  3URY A;  1LXD A;  3QUC A;  1WR6 E;  4TMA B;  1RYS A;  4RNO A;  5T14 A;  4JL9 A;  4ZHO A;  3UI3 A;  1SGG A;  5DQH A;  2HBM A;  4PHE A;  3PRP B;  2XO7 A;  1YN3 A;  4F1S A;  2IOF A;  3EUB 2;  4KN4 A;  4NY0 A;  1UWM A;  3TAC B;  4GC6 A;  2QIE B;  1PVQ A;  8ICG A;  1WXV A;  4WUR A;  2AU0 A;  3FDS A;  2KK8 A;  1SV0 C;  2WQY B;  4N58 A;  1E0Z A;  1NI3 A;  3APC A;  1N63 A;  4TV3 A;  3UQB A;  3NAS A;  2F2A B;  2HVH A;  1WX8 A;  2DZI A;  2WXR A;  1P7F A;  2W9B B;  2WDR B;  3QU9 A;  3H8M A;  5KFI A;  2WYQ A;  2NO5 A;  4UAR A;  2HTH A;  2L0T A;  3KBB A;  1YMH E;  2CHZ A;  4RF1 A;  4HPP A;  3OHA A;  4P2H A;  4E74 A;  1BPB A;  2YMP A;  1YX5 B;  1RAX A;  2EQY A;  2AQ4 A;  2WF9 A;  2B76 B;  2OWO A;  5B66 U;  1R7S A;  1NZP A;  2LEK A;  4KZC A;  2LHD A;  3PW5 A;  3U4E G;  4D2K A;  4BXO B;  4GXK A;  2IGG A;  1TK0 A;  3P4P B;  5DGA A;  2G09 A;  2PE6 B;  3M3J A;  3EFC A;  4XX5 A;  5AZF A;  2CKH B;  1BNO A;  3BVZ A;  1S5L U;  3KHL A;  3PLV A;  1SKR A;  1V81 A;  3BJY A;  2ZXI A;  2D3C A;  3A4R A;  1GG3 A;  2BDP A;  2NRT A;  3UIO B;  4M9N A;  8ICC A;  2JXT A;  1G6J A;  1F0Z A;  2W7O A;  3SFE B;  4GDK A;  2KZZ A;  2KMM A;  3QA8 A;  7ICI A;  1XO0 A;  1NK9 A;  4C8M A;  3QXG A;  2OHF A;  4MEX A;  2J0M A;  2RD0 A;  3U30 A;  3QAQ A;  2KMC A;  5L1J A;  1D8L A;  1S97 A;  5DB9 A;  1Q8K A;  1ZXI A;  2JR5 A;  1CRX A;  4C7Z A;  2DX5 B;  2DQN B;  4K7S A;  1YN5 A;  5T8I A;  1KFT A;  1WXA A;  4FUL A;  2CN1 A;  2MLB A;  1ZQX A;  5EWE A;  1VR9 A;  3VQI A;  4IQV A;  2PI5 A;  5ALT A;  1EO6 A;  2KJR A;  3CMM B;  1CUK A;  8ICK A;  1MI0 A;  2XNA C;  3AL0 B;  3L4P A;  4FS2 A;  2J6S A;  2LVO A;  5BYQ A;  3NZ3 A;  2W55 A;  5EWF A;  3ZW3 A;  1CJE A;  2LGY A;  4MF2 A;  3BDP A;  1WGY A;  3RPF C;  1D5X C;  2NR2 A;  4FA6 A;  2Y9T A;  2DWQ A;  1X9W A;  2W9C B;  2BQQ A;  3BIN A;  4O3P A;  1S76 D;  2E8O A;  2QKQ A;  3SU8 X;  5HKH A;  4DXF A;  1C4A A;  4Y2U A;  5KFF A;  2Y1J A;  3AH7 A;  2BTE A;  2PKE A;  3ZNI D;  3GII A;  2DPI A;  4OJO A;  1I35 A;  2E3T A;  4LK0 M;  4UB4 A;  2KKP A;  4KIK B;  3IG5 A;  2WLB A;  2JZZ A;  4TQ1 A;  4O5C A;  1V5O A;  3SR6 A;  5D2M B;  2XY5 A;  1SE2 A;  2H3V A;  4ECZ A;  2C28 A;  2M0A A;  3O0F A;  2DNF A;  2A19 A;  3PV1 A;  4QW8 A;  4IR9 A;  1H38 A;  4MJS B;  4YL8 A;  4BVU C;  2GLE A;  4B9V A;  4JGH B;  2JYT A;  3RFZ B;  3C5G A;  3UQ2 A;  4A9A A;  3L3F X;  4M9L A;  2FPK A;  2DL0 A;  3EHV A;  2BT6 A;  1TVA A;  4YR3 A;  5KAF U;  3BZC A;  3KZX A;  5HG2 A;  1L8L A;  2D10 A;  7ICO A;  4LNN A;  1M4V A;  3ZLZ A;  1UF0 A;  3M63 B;  4M9H A;  2ONQ A;  3ZGZ A;  5AKE A;  3WAM A;  5KFG A;  3TJP A;  1NYR A;  4YP3 A;  3THV A;  1JW9 D;  2PEA A;  1A77 A;  1HIW A;  5EE0 A;  2K60 A;  3MC8 A;  4K3C A;  2VA8 A;  7ICR A;  1P98 A;  3OJ3 A;  3WAP A;  1ZQ1 C;  3H7P A;  4Y2Q A;  4DFJ A;  2HJ8 A;  4MGZ E;  1TAM A;  4YMO A;  4YXM A;  4XDC A;  1N48 A;  2FCQ A;  3ABV B;  2M9N A;  4I2I A;  3JPR A;  2KVC A;  1AQ6 A;  3BY4 B;  1WJ6 A;  4L2Y A;  1UD7 A;  1Q10 A;  3I3T B;  3R2I A;  1DOY A;  2CJO A;  3DPD A;  1NKE A;  3HHM A;  3MR5 A;  2ZIW A;  2VIX A;  1KLV A;  2AGP A;  4W9K A;  1U4B A;  7ICK A;  5KHQ A;  3PNC A;  5L1I A;  1ZQM A;  3V6E B;  2G1E A;  1ZJM A;  4QZI A;  4HCP B;  4RQ6 A;  3X23 A;  2JZP A;  3NTU A;  3KTQ A;  2L52 A;  5AI9 A;  2D3B A;  1J7A A;  4JUZ A;  3ALB A;  1DOQ A;  5EE3 A;  3VR8 B;  3BQ7 A;  3SHQ A;  1KLG D;  5AI8 A;  5IA7 A;  2WF6 A;  5LXI B;  1VZ6 A;  1JWM D;  3RJI A;  3AEC B;  3VTV A;  1H8C A;  4MFC A;  2KOB A;  1WGR A;  9ICE A;  3B0X A;  5CWR A;  3OPX A;  3MGH A;  2JEG A;  2W8K A;  4C4V A;  4GLS C;  2IND C;  1S77 D;  3WK8 A;  3Q8S B;  3DDH A;  3ED5 A;  2LI6 A;  1VD2 A;  3AXC A;  1HJP A;  4MT5 A;  4ZRQ A;  1ZQG A;  4RPY A;  4Q2J A;  1ZD5 A;  3RR8 A;  1ZDV A;  3GOE A;  4F4W A;  4QAY A;  3UQA A;  2KDM A;  5KFL A;  3DBR B;  3S2A A;  2FCN A;  1NK6 A;  3ZIM A;  2DFL A;  2PMZ F;  8ICY A;  1FRD A;  2N4F A;  1L0V B;  9ICW A;  1WZ0 A;  4LVS A;  3T3O A;  3B0Y A;  4EBC A;  2G5H B;  5C1Z A;  2M19 A;  2MQJ A;  1KF6 B;  4OHJ A;  1X1M A;  3RB3 A;  4J9Q A;  2L8J A;  4ELV A;  3L5K A;  5KFR A;  5AIB A;  1V2Y A;  5D7G A;  4NQK E;  2BYE A;  3A1Q B;  4PK1 A;  5JHB A;  1L4Z B;  3GU3 A;  5EDS A;  3KUC B;  2KC1 A;  4B9U A;  5AK4 A;  2MP2 A;  2ZXH A;  4XGA B;  3A9K A;  2XID A;  5AKZ A;  4ASW C;  2AL6 A;  4RF0 A;  1PDX A;  2EDU A;  4FZM A;  3MFH A;  3I9V 1;  5CJ7 A;  4P0Q A;  1J7C A;  1YJI A;  3IM1 A;  4UB6 U;  3UF8 A;  3QU5 A;  4KIT B;  5C5J A;  1IP9 A;  3ETL A;  5DLF A;  2WF8 A;  1K52 A;  4OO1 J;  5FR3 A;  3RNC C;  5KT3 A;  1PVR A;  2ZTD A;  1D8B A;  2FDR A;  3H40 A;  2RPQ A;  1D6E C;  4I28 A;  1B43 A;  4KLQ A;  2FLN A;  3MTN B;  3MC1 A;  4K3B A;  1D4B A;  2IY1 B;  3WK4 A;  3H8S A;  4GXJ A;  1V5T A;  3RRG A;  1SL1 A;  4RU9 A;  1R4M I;  2INP E;  1J0G A;  2HBL A;  2SAK A;  2XBB C;  3KUZ A;  4RQ8 A;  2DBY A;  5FP0 A;  2KG5 A;  4F91 B;  4J3O D;  2RSU A;  4B9K A;  3WAL A;  2EMT A;  4WWP A;  2K6D B;  4KLE A;  2Y0S C;  2ZZP B;  1TIF A;  1JI7 A;  3EFU A;  3BQ1 A;  1S3S G;  4LNF A;  1Z00 B;  5DKW A;  4IDI A;  1Z19 A;  4KLU A;  3LWL A;  4KLF A;  4DF4 A;  1Z1V A;  4PPX A;  1UT8 A;  5AI0 A;  2WDT B;  3T3N A;  1ARO P;  4G9B A;  9ICP A;  4B6W A;  4RGN A;  5KFY A;  7ICS A;  3M1Y A;  2BCV A;  3RB4 A;  4DSF A;  1H4R A;  2EAN A;  4XZ4 A;  4MFF A;  1V8C A;  4OZC A;  4DEZ A;  4J6I A;  4KGS A;  3B08 A;  3Q3O C;  3WK6 A;  2KTR B;  3IAM 1;  1E6E B;  4IM2 A;  1RZT A;  4OJP A;  3VDZ A;  4FZN A;  4BKS A;  3CNH A;  3RZF A;  2J7Q B;  3CSF A;  4QZ8 A;  4DBG A;  5GXG B;  3PX4 A;  3AE4 B;  4PYZ A;  4F3O A;  1UWX A;  4JV2 A;  4BKG A;  4US9 A;  5KFK A;  2D6F C;  1EF1 A;  4M6W B;  2LHE A;  5CHV C;  1KRH A;  1DOX A;  4XWT A;  2ZVO A;  5IIO A;  1UH6 A;  2QCZ A;  4RGM A;  4M9G A;  3H8H A;  2DZJ A;  5CTR C;  8ICV A;  4J9O A;  1ZW7 A;  3KUD B;  3H8J A;  5ALI A;  2JZB B;  2G9H D;  3AEA B;  3E58 A;  2VH2 A;  3OSN A;  1HTQ A;  1ZQJ A;  5KG7 A;  4RM9 A;  1HTO A;  3AQF A;  4M01 A;  1I7H A;  1LO5 D;  3AE3 B;  4IQW A;  1YOV B;  2IJ0 A;  2UYZ B;  4QZB A;  4IRC A;  9ICC A;  1WH3 A;  2GRI A;  1QQ6 A;  1N2X A;  3H8W A;  1JUD A;  1WCL A;  1T0Y A;  1J2M A;  2CPR A;  4B6J A;  2ZCB A;  4JIO U;  2R2Q A;  2MA9 B;  4AQ7 A;  1FNW A;  5CHG A;  8ICE A;  2F1I A;  3N7S C;  8ICU A;  3IG8 A;  3F2D A;  5HHI A;  3PO5 A;  4I2B A;  4MEY A;  1HEZ E;  2Y0S F;  1NKB A;  5J0O A;  3LB8 C;  1UUP A;  3FAH A;  3IV6 A;  4ED6 A;  3U52 E;  2V4R A;  2G3Q B;  2L83 A;  2KX0 A;  1NK8 A;  2DKX A;  3B2F A;  1SV0 A;  5DBB A;  1UEL A;  4PJ0 U;  2V9H A;  3HUI A;  1E9M A;  4GIV A;  2DYO A;  1JXE A;  3UQ0 A;  2Y1I A;  5AKK A;  3SV4 A;  2YY6 A;  2IGD A;  1ZQY A;  5J17 A;  1T6B X;  2WF7 A;  4I2A A;  4HEA 1;  3SD5 A;  5J0S A;  3N20 C;  4YR0 A;  1ZQV A;  3WKB A;  2MJ3 A;  3L10 B;  2L1A A;  4N6E B;  4JE3 B;  4WIP A;  5AIC A;  4DHZ B;  4YMM A;  2TSS A;  3VXW A;  3UGB B;  5AHX A;  4RUA A;  3ZRC A;  3QIJ A;  3K9P B;  3QCA A;  3OTQ A;  2MU2 A;  4P4M A;  3RD2 A;  4HK2 A;  1JQ4 A;  5CB1 A;  4KX6 B;  3Q8L A;  3TAN A;  1U4A A;  1MFW A;  4FFD A;  1C76 A;  2GBN A;  2YTU A;  1RM6 C;  2V3P A;  4IM0 A;  1L6N A;  3RYT A;  5KFX A;  3BQ0 A;  1WGK A;  4XE0 A;  2XK5 B;  2B0C A;  2WFA A;  2LBO A;  2KV2 A;  3GDX A;  1L8O A;  4I2G A;  1TKY A;  2ZIV B;  3WIM A;  3ZNZ B;  2GBR A;  4MHV A;  4XA5 A;  3H7S A;  1T7P A;  4CF3 A;  3U8Z A;  4NJC A;  1E10 A;  1R4N I;  3APD A;  5J2F A;  1WRI A;  1MHH E;  4XC2 A;  3HPO A;  2NS5 A;  2ZJD A;  4MEL A;  9ICK A;  3PS6 A;  4EEL A;  4XDD A;  2GB1 A;  5AKI A;  1TV9 A;  4RQ7 A;  3K1Z A;  2KTQ A;  4O3R A;  3DDC B;  1KLN A;  2BF8 B;  2DEN B;  3SFD B;  2XVT A;  4W9G A;  3MR6 A;  1S9F A;  4DQO C;  2K4E A;  4GIB A;  2BKR B;  2PFQ A;  1CMX B;  3FC4 A;  2W9M A;  1KM7 A;  3NUH B;  2WB1 C;  4NM2 A;  2OEH A;  4YMN A;  3S6J A;  3RB0 A;  1ACC A;  3UIP B;  4GFJ A;  3EC8 A;  1ZQR A;  2F8L A;  3QU7 A;  2KVR A;  4A55 A;  4IWO A;  2FCM A;  1D8Y A;  4LJO B;  1YJ1 A;  4USA A;  2K8C A;  2A4Z A;  4DLE A;  3ZTC A;  2H5X A;  5L83 A;  1IBX B;  1I4X A;  2K22 A;  2BB5 A;  2EAM A;  2ZW0 A;  2L00 B;  1PFD A;  4ACF A;  2W3S A;  1QLB B;  4ANU A;  7ICL A;  2KN7 A;  1F1H A;  2A1J B;  1SE3 A;  4X5V A;  1WI0 A;  4IWQ A;  5CHW A;  1D3Z A;  4P0P B;  2PI4 A;  4M02 A;  3E0F A;  4KSL C;  3PZ7 A;  1NJW A;  1MQ2 A;  4F2R A;  2KFN A;  1C1Y B;  4HKZ E;  1N62 A;  1FPY A;  2V4I B;  4HJK A;  2HBK A;  2JV3 A;  5KG6 A;  2AWT A;  2EH9 A;  3FYH A;  4DSL A;  3HRD D;  4XUS A;  5AIA A;  4F50 A;  1BUI C;  2QDF A;  2WHE A;  1PVP A;  4Q45 A;  1CK1 A;  1OTR B;  1PZN A;  3F5A A;  4OVZ A;  2NTS A;  2JGA A;  2J53 A;  2BHN A;  2IA6 A;  2HBJ A;  2W7P A;  2MHJ A;  4EEY A;  4UAV A;  1SKW A;  1CZP A;  4DO9 A;  4URK A;  2W54 A;  2RMM A;  2HMX A;  2V1Y A;  2WHI A;  1BPX A;  1SIF A;  4OVV A;  1P1A A;  4NWI A;  4IG7 B;  5IP4 D;  3ZKJ C;  1V86 A;  3H0M B;  1FEH A;  3JPS A;  1CEZ A;  4WAA A;  2ZTE A;  4DK5 A;  2A3V A;  1JRO A;  5KG5 A;  4BDP A;  4KLI A;  1T0R C;  2QB0 A;  3RT3 B;  3NHE B;  2VAN A;  1COO A;  2WP9 B;  1T3N A;  1V97 A;  4DWI A;  1ZJN A;  4KLO A;  3H0R B;  3N28 A;  2BPG A;  1GB1 A;  3NOB A;  2X38 A;  1QOB A;  2P6R A;  4YXJ A;  3GIM A;  1PK3 A;  4DQR A;  1X9S A;  4KLL A;  7ICF A;  9ICF A;  3N9Y C;  1DGS A;  3LK9 A;  2WB1 F;  4WJ3 B;  4R65 A;  4ZRI A;  1BXT A;  5AKH A;  2F44 A;  2MRL A;  3B9J A;  3AV8 A;  4W9F A;  3VH3 B;  1SXE A;  3CST A;  3V6C B;  4B9T A;  4F72 A;  7ICN A;  2WGS A;  2C2R A;  3ZJT A;  2WWZ A;  1V1P A;  3C1Z A;  3N1Z C;  3M7D A;  3JVZ X;  1C77 A;  4P1B C;  4I2J A;  1XNS A;  1YX6 B;  2K4I A;  2MCN B;  4JWU C;  3Q8M A;  1XWL A;  4PS8 A;  4RQ3 A;  4GDK B;  4RGT A;  1SWW A;  4BUG A;  4Y2P A;  3IDW A;  4QWA A;  3KHR A;  3V6J A;  1QF6 A;  4BJQ A;  1YN4 A;  1WSP A;  2D3G A;  2BQU A;  4W9H A;  2V3N A;  5KHO A;  4UBC A;  1EXN A;  3SZ2 A;  2H88 B;  5E6J A;  1TY2 A;  4DL6 A;  2NV3 A;  3SEI A;  2GI9 A;  3Q3N C;  1KRP A;  4DL3 A;  2AX5 A;  3T5L A;  3DVG X;  1FIQ A;  1F0M A;  3KKA A;  1XCT L;  2KX3 A;  1XO3 A;  2D07 B;  3NS8 A;  5J8Y A;  1KW4 A;  1JWS D;  3AQE A;  1TYG B;  2ZG6 A;  1V6E A;  3BQ2 A;  3UPQ A;  5AUK A;  5GTI U;  2QC8 A;  2JEF A;  3OAW A;  4YFK A;  4O3Q A;  3TUO A;  2W9A A;  3NGD A;  3R2T A;  2AHO B;  3EGR A;  4RFB A;  2F77 X;  1P3Q U;  1TJE A;  4FHK A;  1XD3 B;  4F92 B;  5KTQ A;  1X66 A;  3CW2 C;  3ZD8 A;  1O08 A;  5AM5 A;  5KT4 A;  1D9D A;  4LDT D;  2ZIU A;  4J9L A;  4REZ A;  3HVD A;  4EE2 A;  3RUI B;  1EU3 A;  5DB7 A;  2G4D B;  4FHJ A;  1BPE A;  4FJV B;  2N9K A;  2KFK A;  5KFA A;  3V72 A;  3DBH I;  3W9C B;  1WZ3 A;  2KK0 A;  3R3M A;  2G06 A;  2FCS A;  4QWD A;  1ISN A;  4H2A A;  8ICW A;  1RG6 A;  1X2I A;  3G6Y A;  2F3N A;  3I57 A;  2N1W A;  4ZHP A;  9ICH A;  2J42 A;  1WGH A;  3WAN A;  3WCQ A;  3KOO A;  3RBD A;  3AEE B;  4II3 B;  3E56 A;  2UU7 A;  4BFR A;  1IYF A;  4F4Z A;  3BVG A;  3RNA C;  4A6Q A;  1L3S A;  1XQQ A;  4IM3 A;  4M04 A;  4IQT A;  1TS4 A;  4WJP A;  2MAX A;  3P4R B;  3K75 D;  5GTH U;  5HML A;  4KLG A;  4KMU A;  4CF4 A;  1ZQE A;  5AI4 A;  1SE4 A;  3RNE C;  4OW0 A;  3ZYY X;  2IY0 B;  5ALU A;  1YZ6 A;  5KFT A;  1WYW B;  2PJH A;  5KT2 A;  1FO4 A;  4UB3 A;  3AE7 B;  1V85 A;  5ALV A;  3RNB C;  3VUY A;  3TFS A;  3C0R B;  4E0D A;  5IIM A;  5ALJ A;  9ICI A;  4G50 A;  4TUU A;  3H7P B;  1WRD B;  5EE9 A;  2YML A;  2HOI A;  2WNM A;  1HZ5 A;  2ZNV C;  1N61 A;  4X57 B;  5TZV A;  4PGQ A;  1ZYQ A;  2KQ7 A;  2ZPY A;  5KFZ A;  5DPT A;  5ALW A;  4BX9 C;  1ZQS A;  1Q46 A;  4Z6C A;  5IKC M;  1ET9 A;  3UXN A;  1YT3 A;  2ZIW B;  2EEL A;  4MGY E;  4BBN F;  4IC7 B;  1XT9 B;  2FLL A;  4QZE A;  4WH4 A;  5H92 C;  3P42 A;  4IWP A;  1KTQ A;  3V7L A;  2KWD A;  3R7R A;  1ZQN A;  2G08 A;  1RLF A;  5FK9 C;  2UVV A;  4N59 A;  4DHZ E;  2O2V B;  2B6G A;  3VHT C;  4RQN A;  1XSP A;  4AWJ A;  4YTM B;  9ICM A;  2BS2 B;  3Q8E A;  3C21 A;  3QZ7 A;  1AWD A;  2O6V D;  2N9E B;  2RRD A;  2LZ6 A;  2KTF A;  3RBE A;  2N9L A;  3B0A A;  3NS1 A;  2FPL A;  4GN1 A;  3PHW B;  4MM3 A;  3QJZ A;  3C2K A;  2LRU A;  1C4C A;  4QJF B;  4DHJ D;  4ZOH C;  1X42 A;  1WG8 A;  2W11 A;  1SF0 A;  4Q8E A;  2ON8 A;  1ZQU A;  2BGW A;  2Q5W D;  1XLQ A;  4C4V B;  4DFD A;  2NPT A;  3ZNG C;  4FLH A;  7ICU A;  2AGQ A;  2LMR A;  3LJ3 A;  4PL2 A;  3DBS A;  3GQC A;  4QZC A;  2LRW A;  4HWI B;  3H1U A;  5ALY A;  3ORY A;  1UNS A;  1T0S C;  1ZUD 2;  5C0Y A;  4GDL A;  2PE9 A;  4UDU C;  3J9C A;  2KC2 A;  1ZD3 A;  2R8I A;  4BOS C;  4LCD E;  3I1Y A;  4OCZ A;  3DHG C;  4QWE A;  4FXC A;  5H2F U;  5G5H A;  1WCN A;  4I2F A;  2YEP F;  1C79 A;  4OZB A;  4WWN A;  3P4S B;  3RFA A;  1UZX B;  2AJQ A;  3RMK C;  4O3M A;  2MA1 A;  3TKA A;  2MP2 B;  4K4I A;  3PSE B;  4UB8 U;  2PXI A;  3A9K B;  5AKY A;  1FEZ A;  1TS2 A;  1JRU A;  5D49 A;  3HIZ A;  2DKZ A;  2IO1 B;  2BPC A;  1WXS A;  4J9S A;  4P0Q B;  2K39 A;  4DOB A;  1E90 A;  2XC9 A;  3Q2A C;  1ZD4 A;  4R63 A;  1FXI A;  3GB1 A;  5BMG A;  4P4O A;  3OJS A;  1HXY D;  1URJ A;  5J2D A;  4C8N A;  3MDA A;  1NJY A;  5KFU A;  3Q8Q B;  4XRH A;  5KFM A;  3HW8 A;  2ZW1 A;  3K9O B;  2EZZ A;  2HD5 B;  1ZRM A;  4DFP A;  3TAQ A;  1O03 A;  4NAM A;  1NNL A;  4RGO S;  3OJ4 B;  2DHZ A;  4EUT A;  5CX3 A;  4IQU A;  3ONN A;  2ZUB A;  4BGD A;  3PW4 A;  1GC6 A;  2NRV A;  2VJ4 A;  1XO1 A;  4C7Y A;  3ISB A;  3TFR A;  2G5I B;  1DRG A;  2WXF A;  8ICH A;  3PO0 A;  2LGD A;  1XLN A;  1ZQA A;  1NK0 A;  4K7W A;  4RQM A;  4O5K A;  3PSI A;  4J9R A;  3LYY A;  1ZQK A;  3BZK A;  3MAB A;  2LM4 A;  5KFH A;  1ZQZ A;  3P2B A;  5IIK A;  2JH7 A;  1HUO A;  1ZQH A;  1Y8R C;  2Q4T A;  1MG8 A;  4ECR A;  2J0K A;  2RP5 A;  8ICX A;  2D5G A;  1TAU A;  4QZ9 A;  1GOZ A;  4UQG A;  5D6J B;  1FRR A;  3AE6 B;  1TK8 A;  3TMP B;  3KHH A;  5KAI U;  2BCU A;  4KX3 A;  3KHG A;  4FJY A;  5AK3 A;  3AE9 B;  2BW2 A;  1J97 A;  3HKZ C;  5AM3 A;  3QEA Z;  4IS7 A;  1EWY C;  2KHV A;  2RDH A;  1WM2 A;  2FIF A;  2PKO A;  4YSY B;  4Y2S A;  4PHA A;  1TK5 A;  2XGQ A;  3IT6 B;  4DXG A;  5L9X A;  1QOA A;  1TKG A;  1QOF A;  4PT5 A;  2KNB A;  3U7D A;  1FD6 A;  3DWG C;  5J29 A;  2ZIX A;  2JRZ A;  4DOC A;  4ACO A;  3UMC A;  3QWZ B;  3ZJV A;  3GFK B;  4F5N A;  4CRX A;  1FM0 D;  2BQR A;  1ZD2 P;  1IGD A;  3DBL I;  5HMM A;  3L08 A;  1T94 A;  1SL0 A;  3LYS A;  2CRX A;  4JQW C;  3BK2 A;  2VZK B;  2KD0 A;  5J0W A;  1Z4O A;  1A76 A;  2G0A A;  5DBC A;  4A3P A;  2PIA A;  2INN E;  3IFW B;  2AXT U;  5HR7 A;  5CHF A;  2NBU A;  3VFK A;  4B9S A;  1VJK A;  3AUO A;  3NUQ A;  1NJX A;  3OLM D;  3RJG A;  5AZG A;  2JHD A;  3JPN A;  2YEP B;  7ICH A;  3NJT A;  2BCQ A;  2P66 A;  3FIL A;  5ALE A;  3C8Y A;  4F2S A;  3M8R A;  3RTV A;  1SXD A;  3P1M A;  4YTN B;  2PFO A;  3KKA C;  4DQS A;  2OH2 A;  1I4H A;  4Y2J A;  2LD9 A;  4JK1 A;  2YMQ A;  1OEY A;  5J8Y C;  1F2R C;  5KL1 B;  3MGI A;  3PR4 A;  2AEH A;  2V9W A;  2KP7 A;  1Q3U A;  2ZNV B;  3DCG A;  1C9F A;  5J2A A;  2IMW P;  5CR0 A;  5AM0 A;  4UB1 A;  3ECI A;  3MC0 B;  4EEK A;  2VJ5 A;  5J2K A;  8ICQ A;  4ECX A;  2XY7 A;  4RQ2 A;  2KQS A;  1RXW A;  3IHQ B;  3PPA A;  5D3I B;  2KZR A;  4NLK A;  4YSX B;  4CO7 A;  2LKY A;  2DZK A;  5BPC A;  2R8H A;  4ANW A;  3KVF B;  5JU5 A;  1PQS A;  3R7Q A;  3K1R B;  4NJ7 A;  1IG6 A;  3HKZ F;  4US8 A;  1TAQ A;  2LGS A;  1HZ6 A;  1MC8 A;  5EWG A;  2FJ6 A;  1S10 A;  2HHQ A;  2UVW A;  1A70 A;  3FKY A;  3AEV A;  4G0N B;  2CHX A;  3N32 A;  4KDI C;  1KN5 A;  4MSQ B;  4MSM B;  1TS5 A;  3WKE A;  2GO7 A;  2KZM A;  2HI0 A;  2FUG 1;  3SEN A;  9ICQ A;  4UB2 A;  3H4D A;  1BPZ A;  3N7P D;  3LDZ E;  1I4G A;  3ZNH B;  3NVW A;  1FCC C;  4F8R A;  2W82 A;  4DCC A;  1F2R I;  1FMA D;  4JLC A;  4JMU A;  3CP8 A;  2KO3 A;  3C19 A;  3QU2 A;  4ECT A;  1KBU A;  1F52 A;  3RJF A;  2K6Q A;  2KT7 A;  2DYB A;  9ICN A;  2IZV B;  2RHF A;  1OQR A;  1A5R A;  2FLP A;  5ALO A;  1RQN A;  1ZDX A;  1NDD A;  5BO4 B;  1V1O A;  2QJL A;  1K1S A;  1AN8 A;  4ECQ A;  1FXA A;  1LQB A;  3VAW A;  3UMG A;  2KDI A;  3VTW A;  2K4H A;  9ICR A;  1QT9 A;  2FMQ A;  1QQR A;  3MHZ A;  5J0Y A;  2CU3 A;  1K5O A;  4CDG A;  2MRP A;  2BZF A;  3CWI A;  2H3F A;  3PML A;  1SJE D;  2E8N A;  1S0M A;  2FMP A;  3N1Y C;  4F4Y A;  2K8C B;  3Q8K A;  1SE9 A;  2C7H A;  4TUQ A;  4R3D A;  4I2D A;  4NAW A;  2YX8 A;  1BVS A;  4WJN A;  1ENF A;  3HM6 X;  4KLT A;  1XEE A;  3VTU A;  1XS9 D;  1QQ7 A;  5D3D A;  5AI5 A;  2ASJ A;  1C78 A;  5AM4 A;  4GLX A;  2H3Z A;  2DLB A;  2MSE D;  4NL9 C;  2W43 A;  4B0M A;  7ICT A;  3GE3 C;  4LLG M;  2R8K A;  2W8L A;  2WAQ C;  2ATL A;  3KYC D;  3CIR B;  4EZ6 A;  3TI0 A;  5CA7 A;  4ECY A;  4F71 A;  1TKD A;  5JZE B;  3BVM A;  4GXB A;  1MVK A;  4I27 A;  3O65 B;  2J52 A;  3AU5 A;  3ZXR A;  5J2C A;  7ICE A;  3AUL A;  3MBY A;  4QW9 A;  1L5P A;  2FE9 A;  2XIC A;  3GZN I;  2MBB B;  4E71 A;  2KFJ A;  3WAO A;  5IN7 A;  4YQW A;  5IIL A;  1GJZ A;  3F53 A;  2DGZ A;  5DG7 A;  3NZS A;  4LJX A;  4NNJ B;  4HAI A;  1T8E A;  4ED1 A;  3F2B A;  4B9M A;  9ICU A;  2K3U A;  1MG4 A;  2QB0 B;  2KHQ A;  1NJZ A;  3C28 A;  5JRT A;  3JPT A;  3TAD A;  4W9C A;  3Q69 A;  4KLM A;  9ICO A;  4I2C A;  2KDB A;  2R2O A;  4EOY A;  3ZD9 A;  1T5X D;  3NY5 A;  4LNO A;  1X40 A;  4S0R A;  4JX1 C;  4OJ6 A;  4B9N A;  1RDF A;  4HYK A;  4JWS C;  1F44 A;  1NZB A;  2Y5C A;  5G2N A;  2IBI B;  5BOL A;  1COK A;  2NCN A;  3ZO5 B;  4W9J A;  3V7J A;  3I5J C;  1RYU A;  2F8K A;  1QH9 A;  2JH1 A;  5DDY A;  4C8L A;  2RPV A;  4XYC A;  1N56 A;  3MJW A;  3PRM B;  2MUT A;  2LVP A;  1GPX A;  1I4P A;  5HHD G;  3EPI A;  1UGJ A;  3L13 A;  3SYZ A;  1V1P B;  1VZ8 A;  1XCQ L;  3ZRF A;  2M1M A;  4AP9 A;  1I4R A;  1JCK B;  3ALR A;  2KE7 A;  4F4X A;  2UVU A;  1K8R B;  1KH0 A;  2PTL A;  3HK0 A;  4II2 B;  4BKT A;  4IRK A;  2LAS A;  3OWE B;  4GOC A;  4IL6 U;  4CQN A;  5BMH A;  2KEY A;  4NY8 A;  4I6P A;  2H3Q A;  2IHN A;  2D2Q A;  3A0B U;  4EZ9 A;  2WAQ F;  2ZUD A;  3Q6B A;  5L1K A;  3WKD A;  2KIC A;  5J0Q A;  2C7N B;  2OJW A;  3KLS X;  4YXD B;  4WJO A;  2L05 A;  1R4M B;  3TBL D;  3DOW A;  3M95 A;  3ISC A;  1DGJ A;  2NRZ A;  4C4R A;  3A9J A;  3RJJ A;  1HE8 A;  3A4S C;  4HLE A;  2E1E A;  1LV5 A;  2IOF K;  1P7D A;  5ALL A;  2ASQ A;  5CEH A;  4MF8 A;  1C4P A;  2KJH B;  1TZ1 A;  2ODG A;  5KFV A;  4O0I A;  4KN7 A;  2C9W B;  4M0W A;  2LM1 A;  3PVX A;  2J0J A;  4YR2 A;  1J7B A;  5IIJ A;  1A6S A;  3VRB B;  4DQQ A;  1EWC A;  2LFI A;  2JVC A;  1S8O A;  2HDO A;  2ZIU B;  3QX7 A;  2I1K A;  2N9P C;  1HQR D;  3AED B;  3X0W A;  4CHK A;  1D5Z C;  1S0N A;  1WE6 A;  4FE3 A;  3UXO A;  3VC8 A;  4O3N A;  2O6V A;  1J8C A;  2KFK B;  1SXT A;  1CQV A;  4LZD A;  1KJT A;  3PGE A;  2F1H A;  4TSS A;  9ICT A;  1B22 A;  4F7Z A;  4MEM A;  3Q8A A;  4O1N A;  3WK9 A;  4HVB A;  1Q3V A;  3G6V A;  1SL2 A;  4S17 A;  3M9N B;  1Y88 A;  2D3A A;  7ICQ A;  2LUM A;  2HVI A;  4ED8 A;  3T5K A;  1WWT A;  4C4S A;  2ISO A;  4WQM A;  1XU4 A;  4C8O A;  5J0X A;  4NXZ A;  3AEF B;  1NYQ A;  1UQV A;  5KFQ A;  5KG2 A;  4LJP B;  2K1F A;  8ICF A;  3NG0 A;  2PVG C;  1XSL A;  3HT3 A;  4PH5 A;  1K51 A;  1YNT E;  3OSP A;  1X6J A;  4QIW C;  3F5E A;  3VRA B;  3R66 C;  3NRZ A;  2KWV B;  2KIV A;  8ICO A;  1U49 A;  1Z5S B;  4NM1 A;  4LNI A;  2WXK A;  5I4D A;  2XCP A;  2YMM A;  1WE7 A;  1BPD A;  3PT2 B;  4C80 A;  4F5P A;  4KKI A;  2N0S B;  4EEN A;  1J19 A;  3APF A;  5J2G A;  1LGR A;  1GB4 A;  4KVG B;  2KLC A;  3WKC A;  4F5Q A;  2ZEQ A;  5ALP A;  2MH7 A;  2RDJ A;  3EYZ A;  1YQB A;  5DQI A;  3T5J A;  2I38 A;  1HEK A;  2LYB A;  4RQ5 A;  3OHB A;  4FBU A;  3Q8B A;  1MA7 A;  4DL2 A;  4YCX A;  3MFG A;  4JV1 A;  4YD1 A;  5HHH A;  1UCV A;  1WGD A;  3R9K A;  1ZQC A;  3QX1 A;  4KX5 A;  2MW5 A;  1U45 A;  1VLB A;  2JQR B;  3V7K A;  1L0Y B;  2IOH A;  3I63 C;  2AQ2 B;  1SWV A;  4I2E A;  4MAC A;  2HOQ A;  1B4F A;  3Q8C A;  4OVU A;  2J6T A;  4DDG D;  5KFP A;  4IKG A;  2E8P A;  3C2M A;  7ICP A;  2PFN A;  2JSV X;  3RJH A;  4MM3 B;  2IPK D;  2QIL A;  1C7Y A;  1TE2 A;  2ASD A;  1X9M A;  2BCS A;  1C20 A;  3ZTD A;  3ZXV A;  3M9M B;  4LTU A;  2NMQ A;  3KWL A;  3SD7 A;  1TGZ B;  2NPT B;  1SSN A;  3ML9 A;  4FJZ A;  2KJ5 A;  3JSV A;  2DPJ A;  5KG3 A;  2GBJ A;  4WJQ A;  2O6K A;  3SAG A;  2KIW A;  2KD1 A;  3F2C A;  4RNM A;  1DK2 A;  4W9I A;  4R8U A;  2KOX A;  4OD0 A;  3L17 A;  1N60 A;  2D8C A;  4GDL B;  1KOT A;  1PUZ A;  3BS5 A;  2YN4 A;  1WWU A;  2R61 A;  2EAP A;  4DOA A;  1WMH A;  1WUD A;  1M94 A;  1MPE A;  3SI8 A;  2K5P A;  1JMS A;  3AEB B;  2BWE S;  3AEG B;  1ZQL A;  2KAN A;  1OQQ A;  2BDU A;  4QIW F;  1BPY A;  1R4N B;  2YQE A;  2AL3 A;  2HDE A;  1PK1 A;  2KJ8 A;  5DG8 A;  1Z4N A;  5HNK A;  4ARI A;  4I6N B;  1EF5 A;  5IO9 A;  3QU4 A;  3GIL A;  2KWC A;  2CJN A;  3V60 A;  5IOI A;  4ANX A;  4HDQ A;  4IUM B;  3ZDM C;  3CYM A;  3MDC A;  5IAA C;  4WWO A;  5J0P A;  2AYO B;  3QZ8 A;  5III A;  1P7E A;  2N1R A;  1WJN A;  3RR7 A;  4K7U A;  4HDO A;  3PX6 A;  1E7U A;  2IDY A;  4LZG A;  2L7R A;  3B1L X;  3QNM A;  4G3X B;  1V80 A;  5DCN A;  2NRW A;  1QQ5 A;  2KJ6 A;  4ICV A;  3AM9 A;  3PW2 A;  2LYH A;  2XEW A;  1Z1B A;  3H0L B;  3ZDT A;  1C3T A;  3I76 A;  2W9N A;  2W3R A;  4A8E A;  5AK6 A;  4Q43 A;  4ZDV A;  1WX7 A;  3RI7 C;  1GC7 A;  1QSY A;  2BVC A;  3Q3F A;  1MHX A;  1YJJ A;  2BQ3 A;  2WX1 A;  5J0T A;  2L0F A;  1L7Y A;  1A0P A;  4HXD A;  2HHT A;  3ZJU A;  2HOF A;  3WA0 A;  1QZE A;  3BQT A;  3Q3J A;  4FN2 A;  3GS2 A;  1L2N A;  5E6N A;  2WXG A;  5DPW A;  5AKX A;  2BCR A;  1WXM A;  1LFD A;  4EEW A;  4G3I A;  4EX7 A;  1AW7 A;  2CXY A;  4CNQ A;  2P6U A;  2AGO A;  2FAZ A;  3JW0 X;  2VKQ A;  4EX6 A;  3RN9 C;  4RQ1 A;  1ZP0 B;  3AN1 A;  4K81 A;  1L7P A;  4J9P A;  4B9L A;  1YD8 U;  2G4S A;  3PW0 A;  4QZG A;  3UM9 A;  4KGR A;  4WAF A;  3TAD C;  2V3S A;  3MR2 A;  2JRI B;  1IUE A;  4DL5 A;  2RDI A;  3V6K A;  1WY8 A;  4DXA B;  2FBW B;  3CF6 E;  3HX0 A;  4O3O A;  1KFS A;  2LPE A;  4M0A A;  3FM9 A;  3N1X C;  5ALN A;  4BZA A;  4BWJ A;  3QC8 B;  4ZRP A;  3RUL A;  4ITK A;  2W04 A;  2BKF A;  2ZIX B;  3C2L A;  1KDH A;  4I2H A;  1QOG A;  2WXP A;  4HCN B;  4ELT A;  3PVL A;  4RCO A;  1LM8 B;  2M8S A;  2HHU A;  2BYT A;  1Y56 A;  3RAX A;  1WWV A;  5C23 A;  5BMI A;  1SJH D;  3TIX A;  3AE8 B;  3OGU A;  2YB1 A;  4ZYN A;  2JYE A;  4DFM A;  4NL9 A;  5AUI A;  1UBQ A;  1FFU A;  1WR1 A;  1PGA A;  3V3X A;  2DAF A;  4M00 A;  3ZDC A;  4KSK C;  3RJK A;  3T3F A;  4K1R B;  3GV7 B;  3W1S A;  2KAJ A;  1LVH A;  4F4K A;  2K8A A;  3PV8 A;  4FBJ B;  2REX A;  3FIL B;  1JIH A;  1U47 A;  2C7M B;  2OOB B;  1VRA B;  3T5H A;  2M56 B;  5JTI A;  3RH4 A;  4KLJ A;  4DWF A;  1K53 A;  4W9E A;  1XSN A;  4E3C A;  1B9R A;  5CP2 A;  2W03 A;  2K0P A;  2Y5B B;  4ED7 A;  3BZD B;  4DSI A;  1NVI D;  2CHW A;  3BS7 A;  3SAF A;  3RH6 A;  3AU6 A;  2PMV A;  2QSD A;  3RRH A;  4CF5 A;  1P9D U;  2ZJ8 A;  2BR0 A;  2RGF A;  4GC7 A;  1WX9 A;  2PVO D;  4EKU A;  1YIW A;  1AAR A;  4C8K A;  2LWP A;  1PUT A;  4U6P A;  3RNG C;  3AB5 A;  1JWU D;  2OED A;  4EBD A;  1RFK A;  4DL7 A;  2BS3 B;  3DBR I;  3VH4 B;  3VR9 B;  5KFB A;  3DWM A;  4AUQ C;  1SZP A;  3LXF A;  3IP4 B;  2DF4 B;  5KFD A;  2KMA A;  4Q44 A;  3P4Q B;  2Z0D B;  4WWM A;  5JXV A;  3NVY A;  2JRH A;  1ECW A;  7ICM A;  2B3A A;  2L76 A;  3C23 A;  1ZOL A;  4CE6 A;  4FS1 A;  3HIL A;  4IR1 A;  3N30 A;  1BML C;  3BK1 A;  3MC9 A;  3VCB A;  4Y2X A;  5DBA A;  3V6H A;  3Q3M C;  2WXH A;  4F8C B;  4P6V F;  4KLH A;  2VA2 A;  3U26 A;  1YZ7 A;  4U7C A;  1LKY A;  9ICX A;  2WDQ B;  3TEW A;  3IRU A;  2KJ9 A;  4P16 A;  5ALD A;  5KT7 A;  2L3Z A;  4ECV A;  2PLP A;  2KSO A;  4J03 A;  2ZPN A;  3SDL C;  3PZP A;  1ZQO A;  3TQ1 A;  1S1Q B;  2ESE A;  1L3T A;  3KD3 A;  4F93 B;  1J2N A;  2N7J A;  4GGQ A;  3DVG Y;  4TUR A;  5AZH A;  4KGT A;  4YVZ A;  1DK3 A;  1WFY A;  1TS3 A;  3DBH B;  1VZ7 A;  2BKE A;  4M47 A;  4M8N A;  4ANV A;  3HP6 A;  2M17 A;  4K4G A;  4CGZ A;  2V0G A;  3ICX A;  1EU4 A;  2MBO A;  2QAR A;  2DYM A;  2GH1 A;  2GBM A;  1ZXH A;  2MX2 A;  1E8Y A;  4GSW A;  5LXH A;  5DB8 A;  2JPH A;  1YQ4 B;  5AM1 A;  1QIL A;  2GMI C;  2JMG A;  2FID A;  2R8J A;  1U48 A;  4DSK A;  3MGV A;  4EYI B;  1GAQ B;  5BYR A;  3WK5 A;  2WXL A;  2MJD A;  1V9P A;  1MQ3 A;  4ARC A;  4YG2 A;  5KL8 B;  5AM2 A;  2K8B A;  4AOF A;  2RDB C;  3SAH A;  4GU2 A;  3AMZ A;  1KTK A;  3IHP C;  3KYD D;  1IV8 A;  3QUT A;  3ONS A;  5AK5 A;  3TEZ A;  1L3V A;  1VDV A;  3PRE A;  3PSF A;  5EOZ A;  3VUW A;  3W1Y A;  2PMZ C;  2FI1 A;  2I1Q A;  3QYP A;  2RR9 A;  3AE1 B;  4NAW B;  4EYH B;  1L5U A;  1QKZ A;  3HM3 A;  2WXJ A;  4YD2 A;  5IIN A;  4MH0 E;  5J2R A;  3ENE A;  3D2N A;  4EBE A;  5HP4 A;  3SMV A;  1L7N A;  5KFS A;  1SZH A;  3QAR A;  1GO3 F;  2HW3 A;  4KKJ A;  4UAY A;  4RMA A;  4M2Y A;  1BT0 A;  4F5R A;  3JYU A;  4RPZ A;  3IAS 1;  2D3D A;  8ICM A;  2EKE C;  2KN4 A;  4QZD A;  2VH1 A;  8ICA A;  2YLM A;  4RPX A;  1RXV A;  1L0X B;  1MN8 A;  1TTN A;  4DSE A;  5HFY A;  5EE1 A;  1U9L A;  2DAJ A;  5KG1 A;  4P4P A;  3ML8 A;  3VUX A;  3TSS A;  1NK5 A;  1X9X A;  4TKN A;  4DQI A;  1OEY J;  2W9B A;  2KLG A;  5J18 A;  4RT2 A;  1RYJ A;  1JRP A;  3K4G A;  3RF9 A;  4WQO B;  4R66 A;  3PTF C;  3SEB A;  2XY6 A;  3TL5 A;  1UHU A;  2AQ3 B;  1WJ4 A;  3VVW B;  4DSJ A;  1MSW D;  4BAX A;  2KQ4 X;  1GNU A;  3PRZ A;  5L95 C;  2I2Y A;  2Y5P A;  2LXA A;  4AYB C;  3MJ5 A;  4I29 A;  3L16 A;  3BYT B;  2I6X A;  4R64 A;  2M0X A;  2O2V A;  5J0U A;  2K9X A;  4BXO A;  3H7I A;  5C2T B;  5KFC A;  1KKX A;  4IC9 A;  8ICN A;  2BPF A;  4YTP B;  1ZPS A;  3HVZ A;  2GBK A;  5TIS U;  1DXS A;  4LDT B;  2UVR A;  1OXJ A;  3OG5 A;  1SBB B;  4A3O A;  4ECU A;  2WTF A;  4J9K A;  1WXQ A;  1FXT B;  4JV0 A;  5G55 A;  2JT4 B;  3AI5 A;  4J9N A;  1IIP A;  1KFY B;  3B2G A;  3BYY B;  3PW7 A;  2EZY A;  3PR5 B;  1Q0W B;  5HR6 A;  4HJG E;  3C29 A;  2R18 A;  3V05 A;  1CI4 A;  2MUT B;  3W5V B;  2FMS A;  3U7Z A;  3QEB Z;  1ET6 A;  2BWF A;  5ALZ A;  3PZD A;  2HHV A;  3U2S C;  4B0E A;  3DQV A;  5J2H A;  3DHI C;  1NK4 A;  1ZKH A;  1F5S A;  5JUM A;  4NLZ A;  4LNK A;  2H89 B;  3QUB A;  5KNI A;  3QE9 Y;  1L6U A;  1EUV B;  2WS3 B;  3WU2 U;  1ZE3 D;  3JPQ A;  1XLO A;  3BWU D;  2QLT A;  2A5U A;  3I28 A;  2JWU A;  5JH5 C;  2JWZ A;  2JZ3 B;  2BYV E;  3MR3 A;  4NPN A;  1SB3 C;  5FR6 A;  5KFJ A;  3DV9 A;  3DHH C;  4GXI A;  2P35 A;  4NJ8 A;  5AKJ A;  5LLI A;  4FO6 A;  3H9D A;  3ZVV A;  4GB9 A;  7ICV A;  2I1J A;  2QB1 A;  3EPG A;  1E7V A;  4ZRJ A;  2W9C A;  1TZO A;  5J2B A;  1L7M A;  2LGX A;  1NOM A;  2CS4 A;  3L54 A;  4ZH4 A;  3N3K B;  4ICU A;  2ICI A;  3A9J B;  1WF9 A;  2MSN A;  5BYS A;  2WXN A;  4QZH A;  4DS4 A;  3CRX A;  1OFF A;  2N7D A;  3M9O B;  3A0H U;  4KIK A;  4F5O A;  2LUE A;  3RAQ A;  4AYB F;  5A0L A;  2YVC A;  4M0W B;  4AS1 A;  4EZK A;  1UBI A;  1WJU A;  8ICS A;  5DPS A;  5KG4 A;  1N5W A;  4DDI D;  4PGY A;  1ZOY B;  4MJS A;  2ACZ B;  2XI9 A;  1QLN A;  3GV5 B;  2ZJ5 A;  2QEJ C;  1JN3 A;  1SIJ A;  2NRX A;  1XF5 L;  1Z3E B;  1F9J A;  2QHO A;  4QWC A;  2LHT A;  1SKS A;  1NI2 A;  2LJ5 A;  5ALQ A;  4Y2R A;  2O6V B;  3N4M B;  2JU6 X;  4OZA A;  4TQS A;  2FUH B;  4PL1 A;  2WXI A;  4PHP A;  4O9M A;  1QTM A;  2NBV B;  3SV3 A;  3IXS A;  2HTM E;  3V62 A;  4DHJ B;  1QCK A;  4L23 A;  3ZQ4 A;  4OJL A;  4Y2Y A;  1X6I A;  5DG9 A;  4IOI E;  2ES6 A;  1TBE A;  4ECW A;  2Y9U A;  3Q8R B;  1ZQP A;  4J9M A;  3N97 B;  4L1B A;  1P0R A;  4NLB A;  5FKA C;  3KW5 B;  4ZYS A;  2HHW A;  2M4N A;  5ALK A;  5KFO A;  3MP9 A;  4DL4 A;  1D5M C;  3IT4 B;  3ZDB A;  3W1S C;  2HHS A;  1ZQI A;  4UAU A;  1OQY A;  3KH0 A;  5L1L A;  1KQQ A;  5DPR A;  3DBL B;  3MFI A;  4MH8 A;  2AQ1 B;  5K4L A;  1ZQQ A;  3NVZ A;  3GP7 A;  4XWW A;  3UXP A;  4RH6 A;  1I42 A;  2LXC A;  2PW9 A;  3JPO A;  3HJE A;  4O5E A;  2V4L A;  3IBE A;  1S0V A;  2WF5 A;  5J2E A;  3WK7 A;  3ZI4 A;  3GE8 C;  3ETR A;  4JWN A;  5ALF A;  1Q1O A;  4QWB A;  2KN5 A;  3Q14 C;  1WM3 A;  2M0N A;  4Z6E A;  4Q8F A;  2F1J A;  9ICV A;  5AKG A;  1GUA B;  1E7P B;  3LVV A;  2LGI A;  4HRS A;  4DF8 A;  3PZ8 A;  4PS3 A;  2ALZ A;  2XN9 C;  2WXM A;  1SGH A;  5D46 A;  3AE2 B;  2BGF A;  2E5S A;  4GMV A;  1M6Y A;  4PHD A;  3AU4 A;  2ZJA A;  2VA3 A;  4RNA A;  3IVF A;  3TEY A;  4Y2T A;  4DFK A;  4YWG G;  4XQ8 A;  2ZCC A;  4Y2V A;  2ZTC A;  8ICB A;  4NLG A;  4ED0 A;  2LVQ A;  4PYU A;  3RB6 A;  3DEE A;  3M6Z A;  5J2I A;  1NBF C;  3EWA A;  4NV0 A;  1E5W A;  2KDF B;  2FNJ B;  4C4T A;  4A90 A;  3QUQ A;  5AKL A;  4MDK E;  1ZQD A;  3NZU A;  1NKC A;  2KMD A;  1JXL A;  1KSP A;  1UGM A;  3N7R C;  4ED2 A;  1ZQB A;  1ZGU B;  3PX0 A;  2V4Q A;  1TT5 B;  3P63 A;  1XLP A;  3LVW A;  4MGI E;  3M6K A;  4RT3 A;  1XC9 A;  5J0R A;  2E8M A;  4RQ4 A;  2ZVN A;  1VCB A;  1K1Q A;  5LNK 1;  4ELU A;  2NTT A;  2KNJ A;  2HSZ A;  2WXQ A;  1IM4 A;  3JSV B;  5KFN A;  2G45 B;  2OJR A;  3IG3 A;  3V61 A;  4I6L B;  2DZM A;  3A1Q A;  2IO2 B;  1FFV A;  5ALH A;  4R8U B;  2Y3A A;  5ALG A;  1PGX A;  4P7I A;  3BS5 B;  3OJU A; 
#chains in the Genus database with same CATH homology
 1MPE A;  3P4S B;  2K5P A;  3AEB B;  3AEG B;  4RF0 A;  1PDX A;  1OQQ A;  5HI1 A;  1TS2 A;  2BBC A;  2HDE A;  3I9V 1;  1J7C A;  1NEK B;  1PGB A;  1YJI A;  3O13 A;  4ARI A;  2CJN A;  2WDV B;  3KQ4 A;  1K52 A;  5FR3 A;  1FXI A;  3GB1 A;  5BMG A;  1P7E A;  1HXY D;  5C3J B;  1L6V A;  1D6E C;  2IDY A;  4HKQ A;  1D4B A;  2ZW1 A;  1SEB D;  2INP E;  2L32 A;  2SAK A;  1ROE A;  2DBY A;  4NAM A;  4RGO S;  3AM9 A;  4J3O D;  2KAC A;  2W3R A;  1JML A;  2JX5 A;  4C7Y A;  1RWS A;  4IDI A;  2WXF A;  4C56 C;  1MHX A;  1YJJ A;  3PO0 A;  1XLN A;  3T3N A;  3ZJU A;  3LYY A;  4YT0 B;  3GS2 A;  4RGN A;  3NVV A;  2WXG A;  4OZC A;  1WYG A;  1V8C A;  1IGC A;  4KGS A;  1AW7 A;  2D5G A;  1GOZ A;  3IAM 1;  1E6E B;  2LMC A;  1FRR A;  3AE6 B;  1ZP0 B;  3AN1 A;  3AE9 B;  4WAF A;  2BW2 A;  4KGR A;  1XXG A;  5GXG B;  2WU5 B;  2LJI A;  3AE4 B;  1EWY C;  1UWX A;  1IUE A;  2RDH A;  2PKO A;  4US9 A;  4YSY B;  2LHE A;  4DXG A;  1KRH A;  3IT6 B;  1QOA A;  1TKG A;  1QOF A;  2FBW B;  4PT5 A;  1DOX A;  4XWT A;  3AE5 B;  1FD6 A;  3DWG C;  4RGM A;  5H8Y E;  3H8H A;  4ZRP A;  4ITK A;  3KWV A;  3ZJV A;  1QOG A;  2WXP A;  1FM0 D;  2SEB D;  2G9H D;  3AEA B;  4RCO A;  1IGD A;  3BII D;  2BYT A;  1Y56 A;  1I7H A;  5BMI A;  1FNU A;  1LO5 D;  1PYW D;  1TKE A;  1SJH D;  3BK2 A;  1STE A;  3AE3 B;  2VZK B;  2IJ0 A;  1T3Q A;  3AE8 B;  1B1Z A;  1FCL A;  2JYE A;  2GRI A;  5AUI A;  2PIA A;  3W2D A;  2INN E;  1FFU A;  1EM7 A;  2BB6 A;  1PGA A;  1VJK A;  3V3X A;  4AQ7 A;  1FNW A;  2YEP B;  3W1S A;  3FIL A;  1AYF A;  2KAJ A;  3C8Y A;  1HEZ E;  3LB8 C;  2MJE A;  3P1M A;  2BS4 B;  4YTN B;  3FIL B;  2IGH A;  1UUP A;  3FAH A;  1I4H A;  1VRA B;  3U52 E;  2L83 A;  2M56 B;  3B2F A;  1F2R C;  1K53 A;  1K50 A;  1E9M A;  3HUI A;  2DYO A;  2RDG A;  1B9R A;  1C9F A;  2QMT A;  2K0P A;  3BZD B;  1NVI D;  2IGD A;  2PMV A;  1T6B X;  2QSD A;  3MC0 B;  4HEA 1;  2MJ3 A;  2L1A A;  4N6E B;  1YQ3 B;  2PVO D;  4JE3 B;  1TY0 A;  4WIP A;  5D3I B;  1PUT A;  4YSX B;  2TSS A;  1JWU D;  2OED A;  1RFK A;  3AB5 A;  2BS3 B;  3VR9 B;  3DWM A;  3LXF A;  1JWA D;  5JXV A;  3P4Q B;  4WWM A;  2WU2 B;  3NVY A;  4US8 A;  1JQ4 A;  4KX6 B;  1HZ6 A;  1C76 A;  1A70 A;  1BML C;  1DOI A;  1RM6 C;  2V3P A;  3BK1 A;  1WGK A;  4XE0 A;  1FNV A;  2WXH A;  4P6V F;  2VZK D;  1TS5 A;  3TEW A;  2WDQ B;  1TKY A;  2FUG 1;  4P16 A;  1JAL A;  4HRO A;  1DYQ A;  2PLP A;  3R8B A;  2J4X A;  4NJC A;  4TQ0 A;  1I4G A;  1E10 A;  3NVW A;  1FCC C;  1WRI A;  1MHH E;  2W82 A;  2N7J A;  1F2R I;  1FMA D;  2E6X A;  3TEX A;  4KGT A;  5G5G A;  1TS3 A;  4XDD A;  2GB1 A;  1VZ7 A;  4YSZ B;  1OQR A;  4JPS A;  2V0G A;  1EU4 A;  3SFD B;  1ZDX A;  2DYM A;  1ZXH A;  3W5U B;  4DQO C;  1V1O A;  2QJL A;  1YQ4 B;  1AN8 A;  5TSS A;  2Z8L A;  1FXA A;  1NEN B;  3FC4 A;  1QIL A;  3NUH B;  1GAQ B;  1QT9 A;  1ACC A;  1QQR A;  2WXO A;  3MHZ A;  3Q8F A;  2WXL A;  2MJD A;  5BYR A;  2CU3 A;  4A55 A;  4ARC A;  1HA5 A;  1ESF A;  1IBX A;  4USA A;  3CWI A;  2EKI A;  3AMZ A;  1KTK A;  1SJE D;  4NZL B;  1IBX B;  1I4X A;  1KLU D;  2K22 A;  4R3D A;  2BB5 A;  3TEZ A;  2ZW0 A;  1VDV A;  1F77 A;  1PFD A;  2MEK A;  1ENF A;  2W3S A;  1I4Q A;  1QLB B;  3EA6 A;  1SE3 A;  3AE1 B;  4NAW B;  3E9S A;  1XEE A;  4A8X C;  1L4D B;  5D3D A;  1QKZ A;  1C78 A;  2WXJ A;  3PZ7 A;  2DLB A;  4HKZ E;  2FE8 A;  1N62 A;  2V4I B;  4B0M A;  4LLG M;  4KKJ A;  1N5X A;  1JWB D;  3CIR B;  3URY A;  3HRD D;  1BUI C;  4TMA B;  1CK1 A;  3IAS 1;  4ZHO A;  4OVZ A;  2KN4 A;  2NTS A;  3UI3 A;  3BVM A;  2J53 A;  1MVK A;  1L0X B;  1YN3 A;  2J52 A;  3EUB 2;  5HFY A;  5EE1 A;  1UWM A;  2QIE B;  4WUR A;  1CZP A;  3TSS A;  4N58 A;  1L5P A;  1E0Z A;  2W54 A;  2WQY B;  2RMM A;  1NI3 A;  1N63 A;  1RYJ A;  1JRP A;  2WXR A;  1P7F A;  2WDR B;  3SEB A;  1FEH A;  2AQ3 B;  2I2Y A;  1JRO A;  2KQ4 X;  1YMH E;  4RF1 A;  2Y5P A;  3MJ5 A;  2K3U A;  2WP9 B;  3BYT B;  2B76 B;  1V97 A;  1R7S A;  2K9X A;  3Q69 A;  2LEK A;  2LHD A;  5C2T B;  1T5X D;  3U4E G;  4YTP B;  4D2K A;  1GB1 A;  2IGG A;  2X38 A;  1QOB A;  1ZPS A;  5MPO A;  3HVZ A;  3P4P B;  4JX1 C;  3N9Y C;  3BVZ A;  1BXT A;  1SBB B;  4JWS C;  3B9J A;  3AV8 A;  2Y5C A;  1WXQ A;  1KFY B;  3B2G A;  3BYY B;  3ZJT A;  2RPV A;  1GPX A;  1V1P A;  2JXT A;  1F0Z A;  1I4P A;  4HJG E;  5HHD G;  3SFE B;  1UGJ A;  1C77 A;  1V1P B;  3V05 A;  3W5V B;  1VZ8 A;  4JWU C;  1XCQ L;  2KMM A;  3U7Z A;  4GDK B;  4RGT A;  1ET6 A;  1I4R A;  1JCK B;  2OHF A;  2PTL A;  1KH0 A;  3U2S C;  4B0E A;  1QF6 A;  1YN4 A;  1WSP A;  1ZXI A;  4C7Z A;  2V3N A;  1YN5 A;  5T8I A;  3OWE B;  2H88 B;  5E6J A;  1TY2 A;  4CQN A;  2H89 B;  1VR9 A;  1L6U A;  2GI9 A;  3VQI A;  2WS3 B;  1ZE3 D;  2AX5 A;  5BMH A;  1XLO A;  3BWU D;  2JWU A;  1FIQ A;  1XCT L;  2XNA C;  1MI0 A;  3KLS X;  4YXD B;  1SB3 C;  3L4P A;  5BYQ A;  1XO3 A;  3NZ3 A;  2W55 A;  1JWS D;  1CJE A;  1DGJ A;  1TYG B;  3RPF C;  5AUK A;  1D5X C;  1TZO A;  3TUO A;  2DWQ A;  2ICI A;  3R2T A;  5BYS A;  3EGR A;  2WXN A;  1C4P A;  4RFB A;  1C4A A;  4DXF A;  1OFF A;  1TJE A;  3AH7 A;  2BTE A;  4M0W A;  2E3T A;  1J7B A;  4LK0 M;  4EE2 A;  3VRB B;  2WLB A;  4REZ A;  3HVD A;  4AS1 A;  1EWC A;  1EU3 A;  4TQ1 A;  3SR6 A;  2LFI A;  3AED B;  1HQR D;  1N5W A;  1D5Z C;  1ZOY B;  1SE2 A;  2ACZ B;  2N9K A;  2M0A A;  2QEJ C;  3W9C B;  1SIJ A;  1XF5 L;  3RFZ B;  1SXT A;  2JYT A;  1CQV A;  4A9A A;  4TSS A;  4H2A A;  2JU6 X;  4OZA A;  2WXI A;  3I57 A;  3Q8A A;  4O1N A;  2BT6 A;  3IXS A;  4ZHP A;  2HTM E;  2J42 A;  3WCQ A;  3AEE B;  4L23 A;  3E56 A;  5HG2 A;  3ZQ4 A;  3BVG A;  2LUM A;  4IOI E;  4A6Q A;  1WWT A;  1M4V A;  4WQM A;  1TS4 A;  2ONQ A;  3P4R B;  4L1B A;  3ZGZ A;  1NYR A;  5FKA C;  4ZYS A;  1SE4 A;  3AEF B;  1JW9 D;  4OW0 A;  1NYQ A;  3ZYY X;  3MP9 A;  1D5M C;  5EE0 A;  3IT4 B;  1FO4 A;  3AE7 B;  2PVG C;  1K51 A;  1YNT E;  4MH8 A;  2AQ1 B;  3VRA B;  3NVZ A;  4XDC A;  5EE9 A;  3GP7 A;  4XWW A;  3NRZ A;  3ABV B;  5I4D A;  2WNM A;  1HZ5 A;  4RH6 A;  2WXK A;  1N61 A;  2PW9 A;  4L2Y A;  1Q10 A;  3R2I A;  1DOY A;  4C80 A;  2CJO A;  4KKI A;  3ETR A;  2N0S B;  1GB4 A;  1ET9 A;  2EEL A;  2MH7 A;  2G1E A;  2I38 A;  1E7P B;  4WH4 A;  2LGI A;  4HRS A;  5H92 C;  3P42 A;  2JZP A;  3PZ8 A;  3Q8B A;  3MFG A;  2KWD A;  2L52 A;  2WXM A;  2XN9 C;  3AE2 B;  1J7A A;  5EE3 A;  3VR8 B;  5FK9 C;  4N59 A;  4RNA A;  1KLG D;  1VZ6 A;  3TEY A;  4YWG G;  1JWM D;  1VLB A;  2JQR B;  2BS2 B;  4YTM B;  3AEC B;  3Q8E A;  1L0Y B;  2AQ2 B;  4MAC A;  1AWD A;  2N9L A;  3Q8C A;  3NS1 A;  4IKG A;  1C4C A;  4A90 A;  2JSV X;  4ZOH C;  2ON8 A;  1SF0 A;  4GLS C;  4MM3 B;  2Q5W D;  4MT5 A;  4ZRQ A;  1XLQ A;  2IPK D;  2QIL A;  4Q2J A;  1ZDV A;  2KDM A;  3P63 A;  4LTU A;  2NMQ A;  1XLP A;  3KWL A;  1SSN A;  1FRD A;  1L0V B;  5LNK 1;  3T3O A;  1UNS A;  1ZUD 2;  2NTT A;  2M19 A;  2WXQ A;  1KF6 B;  4UDU C;  4OHJ A;  3J9C A;  4GDL B;  1N60 A;  5D7G A;  4FXC A;  1FFV A;  5G5H A;  2Y3A A;  2R61 A;  1PGX A;  1C79 A;  2YEP F;  1L4Z B;  4OZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...