3EUB2

Crystal structure of desulfo-xanthine oxidase with xanthine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 37
structure length 164
sequence length 164
chains with identical sequence A, J, S
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
2 PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3eub202
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3eub201
4YTPB 2KAJA 1PUTA 1J7CA 3P4PB 4USAA 3ZYYX 3SFDB 1VLBA 4C7ZA 1E0ZA 3FAHA 1NI3A 1RFKA 5C3JB 1ZP0B 1SIJA 2CJNA 5EE3A 1IUEA 1N5XA 1SF0A 2H89B 3W5VB 3DWMA 3LXFA 3AE2B 3P63A 5EE9A 2KMMA 1EWYC 1XLQA 2JX5A 3SR6A 2BS4B 1E9MA 4IDIA 1N63A 1JWBD 2L83A 1XO3A 1YQ3B 2MH7A 4P6VF 1YQ4B 1PFDA 1XLOA 3FC4A 2BS2B 2HTME 2OHFA 1FFUA 1JW9D 4WWMA 1V8CA 3KWLA 4HROA 2W54A 3AN1A 2JQRB 1PDXA 1N60A 1SB3C 1QOFA 2WS3B 4JX1C 2CJOA 4FXCA 5EE1A 2B76B 1QF6A 1FXAA 3DWGC 1AYFA 1TJEA 1JQ4A 1WYGA 4C7YA 2N0SB 3AE3B 3B2FA 5C2TB 1CZPA 1N62A 1QOAA 1RM6C 3AV8A 1ROEA 1QOGA 1L0VB 3AEDB 1FO4A 2WLBA 1N61A 1OQQA 3AB5A 1E6EB 3NVYA 1KRHA 3P4QB 4US9A 1NENB 1WGKA 1WWTA 1OFFA 2G1EA 2WDQB 3P4RB 4YXDB 2PVGC 3AM9A 3ABVB 1DOXA 3B9JA 2WU5B 2AX5A 2W55A 2QIEB 1J7BA 2MJDA 1JROA 3AE6B 3HVZA 4ZHOA 4WQMA 1DOIA 1FIQA 1WRIA 1FMAD 1I7HA 3AE7B 2MJ3A 2EKIA 4ZHPA 4ITKA 1QLBB 3CWIA 2W3RA 5H8YE 3NRZA 5G5HA 1DGJA 1JRPA 1XLPA 3NVZA 2QJLA 4C80A 2FBWB 3AECB 3RPFC 4A9AA 1E7PB 1FM0D 1KF6B 1NYQA 2Y5CA 3P4SB 2WQYB 2WDVB 3AE4B 2DBYA 1QT9A 1NEKB 3AMZA 3LB8C 4YTNB 1L6VA 1WXQA 3VR9B 4LTUA 3BIID 2MJEA 2CU3A 4N58A 1B9RA 1L6UA 1TKGA 2WP9B 1ZOYB 2M56B 2W3SA 1F0ZA 3AEAB 4JWSC 1JWAD 1RWSA 3AEBB 3VRAB 3P1MA 1FFVA 2WDRB 4YT0B 2K22A 1VDVA 1OQRA 2BT6A 2H88B 1V97A 4YSYB 1VJKA 3AEEB 1KFYB 3ETRA 3NVVA 1N5WA 1FRDA 1ZUD2 2PIAA 3AE1B 2K9XA 4YSXB 1TYGB 4JWUC 4N6EB 2L52A 2PVOD 2PKOA 3PO0A 3HRDD 1AWDA 5H92C 2LEKA 5MPOA 3NVWA 1JALA 4YTMB 1J7AA 3WCQA 1YJIA 3SFEB 1QOBA 3L4PA 2BS3B 1NYRA 3NS1A 1FXIA 1UWMA 1E10A 3CIRB 1FRRA 3B2GA 1TKYA 1DOYA 3VR8B 1CJEA 1TKEA 2Q5WD 3AH7A 5EE0A 3HUIA 1GPXA 1YJJA 1R7SA 1A70A 3AE9B 3AEFB 4HRSA 3AE8B 3VRBB 2DWQA 5AUKA 2ACZB 3AEGB 3W9CB 3EUB2 2WU2B 5AUIA 4YSZB 1T3QA 1GAQB 1RYJA 4N59A 2E3TA 1ZXIA 5G5GA 1NVID 1L5PA 4ZOHC 2M19A 4KX6B 2K5PA 3AE5B 4US8A 1XLNA 5GXGB 3W5UB
chains in the Genus database with same CATH superfamily
4HVBA 5DLFA 3UQ0A 2KAJA 2K3UA 4DXAB 8ICKA 3O13A 2JZZA 2LYHA 1HEZE 1ZP0B 1WE6A 5CB1A 4KLDA 4KN4A 3U52E 1T8EA 2J0KA 3K75D 2D3GA 4ECQA 8ICXA 4RNOA 3BQ1A 3ALBA 3B08A 4C8MA 3OGUA 3O0FA 2L1AA 1B43A 4EEWA 1V5TA 2VA3A 4IR9A 3GOEA 1MC8A 1E8YA 4L23A 3HX0A 1S0OA 3ORYA 3TADC 1ISNA 2KTFA 3RZFA 1N60A 4JV0A 3KTQA 3Q8AA 1JQ4A 4C7YA 3CRXA 1SSNA 4E71A 1WR6E 1TAMA 2Y1IA 4E74A 1L8LA 2KDEB 4HDQA 4CGZA 1SZPA 3KYDD 3DHIC 2UYZB 2W82A 3M9MB 1QQRA 3P4QB 3I1YA 1WGKA 4TQRA 4J9NA 1I4PA 2Q0ZX 1OFFA 4IQVA 3BVZA 3KZIU 4FZLA 2WAQF 2KEYA 4XGAB 2ODGA 2LFIA 2MJDA 4RQ3A 1P7EA 2KWVB 2UVVA 3MGVA 1GNUA 4ELTA 5TR5A 1P1AA 1DOIA 1FIQA 2MUTB 4IQUA 1WRIA 3SHQA 3TCAA 4ZHPA 2KJ5A 4XRHA 5J2BA 1NK5A 2QARB 2XY5A 4K7WA 1BPZA 3QX7A 2GI9A 3NHEB 4I2EA 5HFYA 5KT3A 2LXCA 5HG2A 3ZNHB 2JVCA 2DUYA 3RPFC 5BMHA 4UB2A 2Y5CA 1ECWA 4GLXA 1L6VA 3UIOB 3KZXA 4ED3A 4RQ7A 3QU9A 3ZDCA 3H7PA 2KC2A 1GB1A 2FCQA 2XO7A 4UATA 2KVZA 3AEBB 1YX5B 3PZ7A 2MBEA 5JZEB 2K8CB 1SKSA 3NVVA 1T0YA 2YN4A 1TYGB 1U9LA 1WMHA 2Y5BB 4QZAA 2NRVA 1FPYA 3NZUA 4R3DA 1TGZB 2ZUBA 3ZDEA 2HI0A 2K4HA 1ZQRA 8ICEA 2JMGA 2LGSA 1UT5A 4F71A 3KWVA 4LVSA 2V4LA 3PVLA 2BWES 4FBUA 4NV0A 5DBBA 4QZHA 4RQ1A 1B1ZA 2J42A 4IM3A 3VR8B 4GC6A 1CJEA 4M0WB 5E6PA 3V60A 4FJZA 1FNVA 5TZVA 2JEFA 2DWQA 1SL2A 3VHTC 3SAGA 2UWQA 1C4PA 4YD2A 2KX0A 2KE7A 4AP9A 1NJWA 1ZQNA 4YSZB 2Y9UA 4IOIE 2N1WA 2MBBB 4YTPB 2B3AA 4ICUA 4BUGA 7ICLA 4OZCA 4MJSB 2ZJAA 2DF4B 3FAHA 2UVUA 1XU4A 2AQ1B 2ZCBA 2V9HA 4WQOB 4MSQB 4MFFA 2W04A 1FNWA 3BYYB 3QZ8A 4MFAA 2H89B 2LJ5A 5JTIA 5ALHA 4XA5A 4B9VA 2GMIC 5ALWA 2DYMA 2BS4B 1TE2A 2KOBA 3A4SC 4PYUA 4S17A 5AKZA 3MC0B 1A0PA 3LYSA 2BS2B 2H3QA 3H0RB 2DENB 1PQSA 3Q3MC 4GFJA 8ICFA 4KLIA 4WJNA 2IGGA 3PZDA 1TIFA 2C22A 2I2YA 1WE7A 2DQNB 1WGHA 1J8CA 3PR5B 3PREA 3DV9A 4UAZA 4EZ6A 5J2CA 5IILA 3OSNA 2DPIA 1TY0A 2HOFA 4CDGA 3WKBA 5KFQA 4J9OA 2OEHA 4EBDA 1L7YA 5G55A 4RQMA 5JH5C 1ZRMA 4QW9A 4ECRA 3AM9A 2G09A 3BJYA 3DBHI 4M9LA 1J7BA 4A6QA 1RG6A 3QU7A 3I5JC 5AK6A 4NL9A 2BCSA 3OAWA 3P42A 2KC1A 1SXTA 2XK5A 4BKTA 2BPSA 1M6YA 1ZQWA 3OPXA 2RD0A 1C77A 4W9KA 2FNJB 7ICIA 1J19A 2LYBA 1FEHA 5CHFA 9ICGA 2OWOA 2NTTA 3RF9A 5KFVA 3NVZA 5HHDG 3I9V1 2ZVNA 4MACA 3R8BA 2RPVA 2W8LA 3TIXA 5KFIA 5J2KA 2KDFB 2FCSA 3QUBA 4F2RA 2DBYA 2D6FC 4DSJA 3GS2A 4KITB 2L05A 2MSED 4ARCA 1V1PA 4PHDA 2ES6A 1M94A 1AN8A 2PI5A 1TKGA 2W3SA 2WP9B 4FO6A 5EWGA 3H8JA 1UA1A 1QILA 1TTNA 3Q69A 3GZNI 4F91B 3PMNA 2MA1A 4JGHB 1UA0A 4M2YA 1KFYB 3WU2U 4TURA 1OEYJ 5D6JB 1UCVA 4F8RA 2HHXA 4AOFA 2ZG6A 4O3MA 1SWWA 2DKZA 2FLLA 2MP2A 2KJ9A 1ZQBA 2K4IA 5E6JA 7ICHA 4I2AA 3KVFB 4BKSD 2N7JA 5L83A 1SV0C 4NWIA 3IBEA 3NJTA 2VJ4A 3NS1A 3OJ3A 5BMIA 3PW2A 2K6QA 1HUZA 1KFSA 1JCKB 2AGQA 2MA9B 5G2NA 4XWWA 1V2YA 3TFRA 5DKWA 3V6EB 4BVUC 1PZNA 2MX2A 2HBMA 2ZXIA 5ALGA 4GGQA 5AUIA 5IINA 2H5XA 4RM9A 5KAIU 4DHZB 2QMTA 4RQ6A 1NK6A 2M19A 5GXGB 4TKNA 2RHFA 4EZ9A 2JR5A 4PGYA 4AWJA 2XI9A 2W9CA 2W9NA 3ZVVA 4OVVA 5ALQA 4USAA 2LGXA 3ZYYX 4ECVA 3C29A 1NI3A 3PMLA 1GC7A 1GOZA 2MAXA 5D4BA 1GUAB 3PRMB 4G3XB 4KGRA 4TSSA 2DNFA 4HEA1 2UU7A 1ZQXA 2LRWA 3DWMA 3GP7A 3ZI4A 4DLEA 3RB6A 3QIJA 3QU4A 2KMMA 1XLQA 2JZBB 2BCVA 4ACOA 2BKEA 3SV4A 1X9WA 1MHHE 3RFAA 5BOMA 4Y2SA 2JH7A 2ZIUB 3GV5B 2XC9A 2BCUA 1K52A 3ZJVA 3N3KB 1V8CA 3RAXA 3AN1A 3OWEB 3DVGY 3WAPA 2KN4A 2ZPNA 4AJYB 4RNAA 1J97A 8ICQA 1WXAA 4RUAA 4K3BA 1CZPA 1WMHB 5HR6A 2HJ1A 5KFSA 1F1HA 3BZDB 3VDZA 2GBNA 2R8HA 3HKZC 3R66C 4GXKA 3SV3A 1E8WA 4KTQA 1C7YA 2RRDA 2IBIB 4WH4A 3GDXA 2KNJA 2WF6A 1Z5SB 2L00B 4DL5A 1TK0A 2DLBA 9ICCA 4KIKB 4KLJA 4BKSA 2K1FA 4Y2UA 3WK6A 5KFZA 4Z6CA 3C0RB 9ICRA 1X1MA 1ZD4A 2J0JA 2N1RA 3L10B 5J0OA 1NK0A 1ZQOA 1RYSA 2XEWA 4UB8U 1JRPA 3L5KA 3MR6A 3A33B 3WK4A 4EUTA 1HTQA 7ICTA 1XC9A 2HJ8A 1NYQA 4B9MA 4RGMA 3Q14C 1ZQTA 9ICNA 3VQIA 1HIWA 4F4KA 1QT9A 1TV9A 1ZQMA 2C2RA 5K4LA 2N7EA 4DFKA 2WHIA 1XSNA 1F0ZA 4C00A 4RQ2A 5DPRA 5J0XA 2IBKA 1UF0A 4RNNA 3PW5A 4NPNA 1S9FA 4WJQA 2KZ3A 1VJKA 3DVNV 4GSWA 1SL0A 2NPTA 3SMVA 2YQEA 4EEYA 4F2SA 1VZ7A 2L52A 4EZKA 1UELA 2EAPA 1COOA 2GH1A 3RR8A 2JU6X 2I1KA 5FR3A 2WXJA 1JALA 1WX9A 5AK5A 1IM4A 4YTMB 3Q8RB 2B21A 3HILA 4O9MA 1I42A 5AKKA 4IUMB 7ICUA 3ZIMA 2JXXA 4HCPB 3HVDA 4REZA 2NV3A 2KVSA 3V7JA 1YJJA 3AEFB 2AL6A 4HWIB 5C5JA 4QZDA 4HJKA 5KG1A 1FNUA 3EC8A 2C7MB 1NZBA 4Q2JA 1Z00A 3QC8B 1L5PA 4XZ4A 4M04A 4M02A 3VTUA 4O5CA 1PUTA 4PZNA 4F5PA 1X9SA 3H9DA 3L0WB 2L5YA 4XUSA 2K8HA 2HMXA 1KH0A 1ZYQA 3AU5A 2G08A 1V86A 3LXFA 1TZ1A 2LGDA 4A3PA 5EE9A 8ICGA 2LUMA 2I38A 1DK3A 4D2KA 2UVWA 1LB2B 4C4TA 4P4OA 3T5LA 3FC4A 4F72A 2PFNA 4EZJA 4O5EA 4UB4A 1YQBA 2JPHA 3LJ3A 3T5HA 2BDPA 4JX1C 1N56A 4FXCA 4FJVB 3KHGA 2ATLA 1VZ6A 2QB1A 2J7QB 5DDYA 4QIWC 7ICQA 2ZIXA 2IHMA 2HHVA 5ALSA 4I6PA 2Y0SF 3RUIB 4AJWA 3J81j 5KT4A 3AU6A 5CX3A 4IQWA 3C1YA 2A3VA 2JYEA 2DFLA 3CNHA 1SKWA 3P4RB 3ABVB 4UASA 7ICPA 4YQWA 1ZETA 2NO4A 2YEPF 2H3ZA 5KG4A 1L4DB 2XY7A 3H8SA 2KDIA 4K1RB 4RT3A 2LI6A 4QZBA 3EPIA 5AI4A 2CHWA 4WQMA 3V61A 4W9DA 4X5VA 2KFZA 1K1QA 2IOFK 1Q3VA 3UMGA 2EKIA 3MC8A 2KJHB 2YTUA 9ICBA 3QJZA 2AGOA 1SE9A 1I35A 2PKEA 1E5WA 1TKDA 4OJPA 4L1BA 4DXGA 1GO3F 2VA8A 2ZPYA 2OJWA 2WDVB 1ZJMA 2KVCA 4UB5A 1EXNA 1C78A 4I2JA 3KKAC 4IRDA 3MDAA 2LUEA 4DQQA 3TBLD 5BYSA 4GOCA 3M63B 1JWAD 1UWXA 2A19A 5AM1A 2C7HA 1S97A 3FYHA 1NNLA 1JN3A 1UGMA 1L3UA 5C0YA 4K4HA 1WG8A 3RNEC 5ALFA 4I6NB 3HRDD 1XF5L 2BBCA 3X23A 1S8OA 3RBEA 1MHXA 2M0NA 8ICUA 5DB6A 8ICSA 4NAWA 1NZPA 1ZQQA 5AKXA 3RZWC 3JSVB 4UDUC 1UD7A 3VC8A 4BX9C 1ET6A 5F9LA 1TK5A 1E10A 2LD9A 1V9PA 2FAZA 4ED2A 4Q45A 1TK8A 2QLTA 4W9FA 3OLMD 1A70A 3VTVA 2O6VD 4II3B 3M62B 4M0WA 5AI5A 3AEGB 3APFA 4RGOS 1H8CA 1T3QA 2V3SA 4DS5A 2MRPA 5E6NA 1NVID 1WGDA 1ZD2P 1CK1A 4I2FA 5IIIA 2HD5B 2KWUB 4GU2A 2WDTB 2N7DA 1WXSA 3UQBA 2RLTA 1RQNA 1FCLA 2HSZA 4OD0A 1VLBA 5J0RA 3L17A 4MSMB 1PVPA 2K89A 5J29A 2NCNA 3TQ1A 3AL0B 1KKXA 1J0GA 5KG2A 4KLQA 1S0NA 3NZSA 2RSUA 3B0YA 1SJHD 2VH2A 4KZCA 1L7OA 2HHSA 3RNAC 4C8NA 1P0RA 1C9FA 4NM1A 1E9MA 4RH6A 2A5UA 1ED1A 2BDUA 5KFKA 2L83A 2LWPA 3PV1A 3QQ8B 4P6VF 3UGBB 1EF5A 4LZGA 9ICTA 3L3FX 4A8XC 4DF8A 4DSIA 1QOFA 3C5GA 5E79U 2B76B 1Q5WB 2E1EA 1PK3A 3E0FA 4C8LA 4O1NA 1CI4A 2AQ3B 2LBOA 1R4MB 3PNCA 2Z7JA 2PMZC 3UMCA 5CHWA 4NZLB 1L8OA 3PT2B 1ZQZA 4OJ6A 4MT5A 4B6WA 3BY4B 2JRZA 4PZOA 5IO9A 2JEJA 3PR4A 4LNKA 4JK1A 5KFYA 5L1JA 3CF6E 1X6IA 4B9LA 5KFWA 4M8NA 4LNFA 1L7MA 1L3TA 1ZQSA 2IZVB 4EBEA 2JGAA 3BS7A 5J2GA 2XNAC 5BOLA 1RRBA 4M9JA 5J2AA 3RB0A 4GDKB 3K9OB 4UBBA 4KX3A 1A76A 1S0VA 4EX7A 1YT3A 2VIXA 2BQRA 1D9FA 2JEGA 2DAJA 2RDBC 2FI1A 3F2DA 2KZMA 4HKQA 3ZNGC 8ICVA 5BPCA 5DLGA 9ICAA 2WXKA 2BKFA 3BIID 3N1ZC 3G6XA 3TANA 1OTRB 4ANVA 3AEAB 2QB0B 1HQRD 2WGSA 4JL9A 3IDWA 3SZ2A 3PO5A 4W9CA 4NJ8A 3A1QA 1IBXA 2H88B 2BYFA 4WAAA 3JPRA 2PW9A 1ZQFA 3N9YC 2PKOA 1I4RA 2BB6A 2RDGA 3NZ3A 4RPZA 1ZGUB 2CPRA 3RB3A 5KFDA 2W9BB 8ICHA 1L6NA 1J7AA 2L76A 1QSSA 3MJ5A 4MFCA 3IRUA 4UW9A 4HXDA 4TQSA 2P6UA 3DEEA 1XWLA 2XGPA 4ECTA 4AQ7A 2NRWA 2AQ4A 2WXLA 2FLPA 4HJGE 3GIIA 3C8YA 3PZ8A 1ZPSA 3MR2A 2G5IB 3R9KA 2LMRA 2EAMA 1WX8A 2KLGA 2DHZA 2VANA 2MBQA 2ZEQA 4RUCA 2FUG1 3TAQA 3MFIA 3W5UB 2PFQA 3T5KA 3K1ZA 2Z0EB 4IC7B 3QUCA 1D4BA 1V49A 1ZQYA 4DL2A 3ZGZA 2DAFA 1WGYA 3BYTB 4EOYA 1E0ZA 3S6JA 5C3JB 4Y2QA 2KN5A 3RH4A 1JX4A 3V62A 3W5VB 5BYRA 2BF8B 2CN1A 2J53A 1OGWA 1EUVB 2IYDB 3RN9C 4C8OA 1NK7A 1Q3UA 4YR2A 1JMSA 3H7PB 4G9BA 2KOXA 3LYYA 3RNCC 2WS3B 2Z8LA 4DDGD 4GXJA 4KSKC 5J2RA 1QF6A 2GBJA 3Q8BA 1ZQLA 1KL9A 4Z6FA 2ISOA 4OVZA 3URYA 4J9SA 3JSVA 8ICPA 4MGZE 1XO1A 4P16A 7ICFA 4ECUA 2XIDA 2K4EA 1JWSD 4OJLA 4DL7A 4K7UA 1E6EB 2PVGC 1QQ7A 5KT7A 3RH5A 4EENA 1JROA 1K50A 2VZKB 3BS5B 4I2DA 3KBBA 5J0QA 2IO1B 1FMAD 4OHJA 3E9SA 2D3CA 2QDFA 2INDC 4P4MA 1T94A 3IHPC 2V3NA 2GBRA 5DQGA 3CWIA 4C4SA 3FDSA 2D07B 2IGDA 4U6PA 5J2HA 1JI7A 2V3PA 4TMAB 1TS2A 3CMMB 3DBRI 1FXTB 1PYWD 2D2QA 4LK0M 3U4EG 1NEKB 5AM0A 2Y3AA 3B0AA 4DDID 4TQ0A 1HA5A 4II2B 4B9UA 4IWOA 3BQ2A 3GE8C 1B9RA 7ICMA 2GBKA 2DPJA 5IN7A 1ZOYB 3IT6B 3BZKA 3KUCB 5TISU 4UQGA 2D3DA 5AIAA 1PVRA 3VRAB 4DHJB 5D7GA 3PW7A 2KTRA 3H6NA 1WZ0A 2WXIA 1DK2A 2BYEA 2KN7A 1FEZA 4P0PA 1MFWA 4Y2PA 5CHGA 4I27A 3H8HA 4TQ1A 4BZAA 4YSXB 1R4MI 2A4ZA 1F0MA 2NO5A 1LQBA 3V05A 4KGTA 1Z2MA 1U48A 1BGXT 3QUQA 4IR1A 4KZ0A 4E3CA 2M8SA 3Q8CA 3PO4A 2QC8A 1KN5A 2BPCA 1DOYA 4FBJB 3TEZA 3QUTA 1WM3A 5EE0A 4ED6A 3RJEA 2M17A 3WKEA 1B4FA 3HWTA 4HRSA 4J3OD 3VRBB 4UB1A 3TUOA 2FMQA 2IPKD 2R8IA 4A3OA 3Q6BA 3Q8SB 1CRXA 2Z0DB 3TI0A 1XLNA 1Q46A 2G0AA 3IVFA 3R2IA 2KIVA 4YG2A 2N9EB 3TEWA 4C7ZA 3ALRA 1SIJA 2WX1A 3HHMA 4NJ6A 2IOHA 4FLHA 1PK1B 3W1SC 2J4XA 4I2CA 5EOZA 3GU3A 5FKAC 2WXRA 2EQYA 3QEBZ 3VTWA 3A1QB 2INCC 3L13A 1JWBD 1TAQA 4ICVA 4KIKA 3RMKC 2BPFA 1KRPA 4KMOB 2CHXA 2W9MA 1V85A 4DHZE 2CXYA 2E8NA 4NLCA 3UM9A 1V1PB 4Y2JA 3Q3NC 4XE0A 3SAHA 1B0XA 4R65A 5DPSA 2G5HB 1SEBD 4MM3B 1ZQEA 5D46A 3OG5A 5KG7A 2BHNA 2C28A 3AE3B 4JWNA 4DSEA 1NOMA 2ZJ5A 4ED7A 2M4NA 1D8LA 4QNLA 4DBGA 1ROEA 1QOGA 1Z1BA 3Q2AC 2WLBA 3N30A 5D3IB 2KMDA 3LDAA 5KFTA 4ELUA 2MWSB 3KYCD 2I1QA 3B9JA 3L54A 3DBHB 3JVZX 2FUHB 3X0WA 3KKAA 3BDPA 3AE6B 1C3TA 4WJ3B 4JMUA 4YVZA 2ESEA 1GC6A 2V4RA 1I7HA 2AL3A 3IM1A 5ALEA 2BCQA 4JE3B 1QH9A 3JPNA 1XQQA 2P66A 1RDFA 2CU1A 4O5KA 3TAPA 1XLPA 2QJLA 2VRRB 3OJ4B 1TZOA 4C80A 4WWOA 2FBWB 4F93B 3ONSA 1S10A 1RPLA 2IO0B 1KDHA 3P4SB 2OCEA 5AIBA 7ICVA 2GB1A 2LMCA 4DL3A 2PLPA 1MI0A 4NNJB 1TT5B 1B22A 4KLMA 5KFCA 4YP3A 1L3VA 4YMNA 4DOCA 1I4QA 4BDPA 1TS3A 1WYWB 3I57A 2WF8A 4O3QA 3ETRA 4Q44A 1N5WA 2IGHA 4QWCA 2NS5A 1TY2A 2GOLA 2KFKB 1QQ6A 1SZHA 2KIWA 3QU2A 4BBNC 2OJRA 2BR0A 2DZJA 5B66U 1URJA 3QHTA 3RYTA 4PK1A 3L16A 1ET9A 1P9DU 4PHPA 3M3JA 4UAUA 1QOBA 3BQTA 4UAWA 2L0FA 5IKCM 1Q0WB 3PRZA 2BZFA 4MELA 4UB6U 9ICFA 3AH7A 9ICSA 1GJZA 4Z6DA 2KLCA 3N7PD 3EUB2 5DQHA 1XD3B 2WFAA 5DBAA 2I5HA 4RNMA 1V81A 3CSTA 5KFLA 4KLUA 1BNOA 1LGRA 3T3OA 4QZ9A 1UT8A 2NYVA 1JWUD 2RDHA 1J7CA 5AZGA 1M4VA 4FHJA 1D3ZA 3S2AA 1MPEA 5EE3A 7ICNA 3BVGA 4DLGA 1LVHA 3RJFA 4QIWF 2ZCCA 8ICCA 2MW5A 1YZ7A 1RFAA 5AZFA 2IY1B 4M9NA 1XO3A 5IIMA 2M0AA 4YFKA 2G4DB 1PVQA 1X42A 2ZUDA 5D2MB 2DKXA 1F44A 2P6RA 4U7CA 1SB3C 4F50A 3I3TB 3IXSA 4ZRKA 4UBCA 3H0LB 3H8WA 3RH6A 3DWGC 3WAOA 4WAFA 2DGZA 2OXOA 4J9MA 5C2TB 3TACB 1QOAA 1PGXA 1WXMA 4LNNA 8ICTA 2KK8A 2K60A 4B9NA 1UPHA 3PW0A 1N61A 5ALRA 1L0YB 1EF1A 1SE4A 4BWMA 2N9KA 8ICBA 4PGXA 3IT4B 1KSPA 1DOXA 2K8AA 2BVCA 4NLGA 2EELA 2M0XA 1T0QC 3RR7A 5KT2A 1WY8A 3NS8A 4URKA 1NK4A 2O6KA 1ZQJA 4QJFB 3M1YA 2KWCA 2W03A 2EH9A 1RAXA 1WH3A 5ALOA 4HPMB 3RNBC 1YNTE 2WXHA 3ZQ4A 1WCLA 1T6BX 2R8GA 3HP6A 5DGBA 5AKYA 3JPQA 4BFRA 2WF9A 4HCNB 5KNIA 5L1LA 2KFJA 1NDDA 3AMZA 1JIHA 4KMUA 2LM4A 4QZ8A 1PGBA 1KLUD 1Z00B 3GFKB 2N9XA 2KDMA 1HZ5A 3WK9A 2KACA 4GXBA 5DG8A 1ZRNA 5A0LA 3Q3JA 2DX5B 4ZRJA 3A0BU 3WK5A 4R64A 1TS5A 2L32A 3U8ZA 1VDVA 2IDYA 4YSYB 1O08A 3U7ZA 1YN3A 1UUPA 4RFBA 3UIPB 1FD6A 2HCFA 4EELA 1WF9A 4DOBA 2HE7A 3RTVA 3Q8EA 4N6EB 2W11A 3RJKA 2W7OA 5KHOA 4MJSA 5AI9A 9ICVA 1S5LU 2BGWA 4F5OA 4IQTA 3RJGA 3WCQA 2F1IA 2QHOA 4C8KA 2ZVOA 2V1YA 5FK9C 2W9BA 3PHWB 2V9WA 2WAQC 3PGEA 4F5NA 2XGQA 1FRRA 2M9NA 4M6WB 1UBIA 2K8BB 1GPXA 1DXSA 3AE9B 5LXIB 9ICEA 2K8BA 1WJNA 4KDIC 5KFOA 3RNGC 3TEXA 4TUUA 5ALMA 2XVTA 4BXOA 4A90A 1A5RA 5LLIA 3ENEA 1ZD5A 2DZIA 2HBKA 3V3XA 5T14A 4Q8FA 4F3OA 1JXLA 4DFMA 3SFDB 4LNOA 2QKQA 2ZTEA 3PY8A 4YXMA 4MGYE 4OVUA 1N5XA 2H3FA 1SF0A 1MJDA 1L0XB 3KUDB 3P63A 2EZZA 1LO5D 1Y88A 5AKIA 3SQIA 2P35A 2EMSA 4IDIA 2WF7A 4FZMA 5J0PA 1WM2A 2MH7A 2ASQA 2HTME 4ELVA 9ICPA 4HPLB 3N28A 2WB1F 1JW9D 3Q8LA 4WWMA 3VXWA 1RYUA 2PFPA 4F5QA 1VRAB 3PZPA 1IPGA 1U4AA 4KVGB 4NAWB 2N0SB 3P2BA 3JPOA 1WFYA 1WSPA 3AV8A 3WA0A 5CTRC 3ZTCA 1F52A 4DWFA 4B6JA 8ICYA 2JRIB 3PTFC 3ZDBA 2ICIA 1KQQA 2WNMA 5AUKA 5KFGA 3DDHA 2Q4TA 2PPHA 1FCCC 5B5EU 2BCRA 1LM8B 2LHDA 1ZQVA 4OJOA 3K9PB 1IGCA 4BOZB 3RJJA 2QIEB 5L9XA 2J6UA 1MG8A 2Y9TA 3UXPA 3C2KA 3AQFA 5AKGA 1T4GA 2PMVA 5AKEA 2JT4B 2R18A 3A4RA 2MSNA 5CJ7A 4P4PA 3N32A 3TKAA 1MVKA 3JYUA 4HAIA 4XDCA 5I4DA 2HHWA 2AGPA 3ICXA 2M1MA 4L2YA 3WAMA 4EFOA 2KKPA 3T8MA 5IIOA 3UPQA 3EWAA 3N7RC 5CA7A 4J9RA 5HP4A 3AECB 5EDSA 3SAFA 3F53A 5AICA 3T5JA 2VZKD 3VFKA 2KSOB 4BWJA 5KAFU 4YTNB 1QSYA 5F3XB 1RQLA 3U30A 4N58A 4MGKE 2KMCA 3GZFA 5BMGA 3BVMA 4AYBC 1WRDB 4ZRPA 4EYIB 2HBJA 3IP4B 5DBCA 2D10A 2FPLA 2NVUI 4PL2A 3PVXA 2FMPA 2ZXHA 1ZQDA 2K25A 1VZ8A 1WUDA 2LGIA 3SD7A 2PVOD 4RPYA 4KGSA 4M01A 5F9NA 4QZFA 1SWVA 1X6JA 3DHHC 3M9OB 1V80A 4F8CB 4RM8A 1KFDA 1YOVB 2VH1A 2X8XX 4P2HA 5KG6A 5KL8B 4J9PA 5DGAA 1SV0A 5DCNA 4JIOU 1ZE3D 3ZDAA 2LRUA 3GIMA 3PHXB 5JU5A 1ACCA 3EPGA 3KFUF 4HK2A 1ZJNA 4QW8A 2IJ0A 3HUIA 8ICWA 1ZQPA 1C4AA 1Z19A 1T7PA 2EZXA 1I4HA 2KKCA 1V1OA 4NAMA 4DF4A 2KP7A 4EKUA 2JZPA 4LJPB 4US8A 1KLGD 5J0WA 4NY8A 3VAWA 4XC2A 5KFBA 4JB3A 1WJUA 4AP4C 2KJ6A 3A9JB 3VUXA 2ZTDA 1QLNA 4FADA 3ISBA 3EYZA 1DYQA 4GIVA 1TFRA 4O3PA 1C76A 5GMVA 2AXTU 4ASWC 5J0SA 3KQ4A 5FR6A 7ICKA 2HVHA 5D3DA 1NJXA 4AUQC 1QQ5A 1YQ4B 2XCAA 2F8LA 1F2RI 2KJRA 2NMQA 2KANA 4HROA 2AWTA 4KLOA 5IP4D 1WJ4A 1C79A 2Y0SC 3B1LX 4ED8A 4I6LB 1IGDA 2WF5A 1DGSA 5J2EA 3AQEA 5IIJA 2FLNA 4Y2XA 2PE6B 4C0ZA 1P98A 4MM3A 3NRWA 4C56C 3UQ2A 4UB3A 3NGDA 4YXDB 2IO3B 4F92B 2INPE 4W9HA 3NG0A 5KFRA 3QYPA 3JPTA 1X66A 3A9KB 2MP2B 3TL5A 1MQ3A 1N6ZA 2WXMA 1HXYD 3HM3A 3ZJTA 2ASLA 2AEHA 3THVA 3BQ7A 4M8MA 1JWMD 1HE8A 3VH3B 2LGYA 2E8OA 1IP9A 2ALZA 1BXTA 3IAS1 3G6YA 2LKYA 3N4MB 4M0AA 1ZDVA 5ALIA 3L08A 1YZ6A 4AYBF 4GLSC 4I2BA 1MSWD 5HI1A 2RDIA 9ICMA 1KF6B 3RNFC 2ZTCA 2YMPA 3T79A 4Q43A 1S1QB 5CHVC 5KT6A 1BPXA 3T3FA 2DZMA 1Q10A 4CCHA 3I63C 2YMLA 5HHIA 3PV8A 1QKZA 1OUQA 2LASA 2MRLA 5AI0A 9ICWA 1V97A 4OJ5A 1F9JA 2IMWP 3IAM1 1UH6A 3MFGA 2BKRB 5AI6A 9ICKA 4KN7A 3E2EA 2FIFA 3C5FA 3OJSA 5D49A 3Q3FA 3DDCB 3RD2A 2FE8A 1BPEA 2XCPA 3V6KA 2JEIA 1SE3A 1PGAA 1YJIA 4YXJA 2G3QB 1OW5A 2FPMA 2JF5A 1P7FA 3AUOA 3IG8A 3C2LA 2N9PC 2ZJ8A 8ICMA 1ZXHA 4K4IA 2JRHA 2PEAA 4P1BC 2FDRA 3FM9A 1LV5A 4XDDA 2EMTA 3N20C 1L3SA 2AJQA 8ICZA 8ICIA 2K8CA 4DS4A 3PX0A 4Q8EA 2WXPA 4UAVA 4QWEA 4HPPA 4ZOHC 1ZQ1C 4W9EA 4KX6B 3AE5B 2VJ5A 2ISPA 4DHJD 4RGNA 1K51A 4YR0A 1G6JA 4DQIA 4OO1J 4WJPA 4PHAA 4Y2YA 3HJEA 3WKDA 4TUSA 2G4SA 1Q1OA 1R4NI 1ZOLA 3JPSA 1KFTA 1S3SG 1KEJA 1J2NA 3M7DA 5AKLA 1KJTA 2RMMA 2YB1A 2F77X 1HJPA 4RQ0A 1SXDA 4FULA 1WWVA 4KLGA 2EKEC 4K3CA 4O0IA 2V4IB 4FS1A 4XYCA 2ZIWA 4RF1A 4B9TA 9ICJA 1SIFA 2ZIWB 3BZCA 2W54A 2CRXA 2AH5A 3IV6A 4DCCA 2CJOA 3NUQA 4Z6EA 2MBOA 4F4XA 2R2OA 1U4BA 4A55A 5JHBA 7ICRA 2RR9A 4LDTD 3H0MB 3SEBA 1L0VB 2KX3A 4DSFA 3Q8PB 2MCNB 5BYQA 3M6ZA 4RPXA 2GO7A 2KK0A 4R66A 1NENB 2G1EA 2YY6A 2E5SA 1SL1A 5AM5A 3JPPA 4YN4A 5AZHA 3PSEB 4PHEA 3V7LA 2HDOA 4J9LA 8ICRA 1STEA 3QWZB 4W9GA 3WIMA 3C19A 5L1MA 4G0NB 5HMMA 2N9LA 4JPSA 3QX1A 2KHWB 4N9F4 3AE7B 4BAXA 5KFXA 2MJ3A 1IV8A 1HUOA 3N1YC 5L1IA 1L2NA 2D5GA 2H3VA 3A9JA 2IHNA 2WB1C 1DGJA 4FA6A 3EW9A 2I1JA 4M47A 3RI7C 5KFNA 4HDOA 1T0SC 3BK2A 1Q8KA 2WQYB 8ICLA 4LDTB 2O6VA 3HW8A 2RPQA 2AYOB 3RB4A 2B0CA 4K81A 2M56B 4F4YA 4FS2A 5FP0A 4FZNA 1XXGA 3Q8KA 2NBUA 2K22A 2E1FA 4S0RA 2FIDA 5KFAA 1FRDA 4DOAA 1T3NA 4B0MA 3KLSX 2OH2A 1EU3A 3CSFA 3TFSA 4CF3A 7ICSA 1EM7A 1JMLA 1AWDA 5J2IA 2W7PA 1YIWA 2UVRA 5J8YA 1ZD3A 2H3IA 4F4WA 3ZUNA 3IG5A 4R63A 1ZQCA 1KTKA 3U7DA 3ZO5B 5HKHA 4TV3A 2JYTA 2LXAA 3CIRB 4IRKA 4HKZE 2IOFA 1LXDA 3IG3A 2ZIVB 1WJ6A 2RP5A 4NL9C 1XNSA 3PSIA 2MQJA 1KOTA 2SAKA 3H4BA 3V6JA 5ALUA 1U47A 4IL6U 3JW0X 3H8MA 4N59A 4HYKA 4E0DA 3PLUA 2J0MA 1V38A 3VCBA 1UNSA 4MEXA 1WI0A 4KKJA 4GDLA 2LI5A 2LPEA 4AS1A 2LJIA 2JUOA 4LJXA 1DRGA 2FCNA 3EGRA 5KFEA 4W9LA 4CF4A 2KFNA 1AQ6A 5KG5A 2ONQA 3DVNU 2BWFA 3AE2B 2G07A 4CNQA 3HM6X 1IIPA 7ICGA 1EWYC 2JX5A 3SR6A 4QWDA 1S76D 3DCGA 3TEYA 4NJCA 1N63A 2FPKA 1S0MA 4XX5A 4DL4A 5IIKA 4MH8A 2OHFA 4QAYA 4MGIE 4W9IA 2KQ4X 1BUIC 2B6GA 1C4CA 2JQRB 3RBDA 2ZZPB 5EE1A 5CEHA 3R3MA 4CF5A 3ISDA 3SI8A 1MG4A 4KX5A 2F1JA 4YMOA 4ZRIA 1RM6C 2G06A 4UARA 2ASJA 3U26A 8ICAA 1WIAA 5ALPA 3E58A 2DL0A 5JRTA 2QCZA 4HLEA 3HK0A 3J9CA 3AB5A 3DBSA 3MABA 1EO6A 5ALTA 1A6SA 4IWPA 3AU4A 3EFCA 3V7KA 2W55A 1LKYA 3AI5A 3R7QA 2G45B 1ZQAA 4I2GA 3HVZA 4ZHOA 2A1AA 2MEKA 1BMLC 1KTQA 1D6EC 5LXHA 4MHVA 4KLTA 2JWUA 4EX6A 2LM1A 2W43A 3F5EA 2YMQA 1JUDA 1COKA 2R8KA 4EEKA 3N7SC 4FBTA 3WKCA 9ICXA 3V6HA 3A0HU 4FN2A 2YX8A 4I29A 1JRUA 2KSOA 3OHBA 2GWSA 2F1HA 4H2AA 1L6UA 3ZNID 1SXEA 2FE9A 3I28A 1TBEA 2JY6A 2NRXA 2OYYA 1I4XA 2NBWB 4NLZA 2BT6A 1IYFA 4PPXA 2XBBC 4NXZA 4PGQA 2N1VA 3CYMA 2N4FA 2REXA 3D2NA 4IC9A 1ESFA 2J6TA 1J2MA 2JXJA 2JSVX 1XSLA 2PI4A 2KTRB 2INNE 3KH0A 1ZQIA 3H40A 2YLMA 3ZDTA 3VUYA 9ICUA 2F2AB 5HNKA 4M00A 2Y5PA 3M8SA 3ZD9A 2JZ3B 3KW5B 1FXIA 1H38A 4P0PB 1TKYA 3WK8A 4NM2A 2W9CB 2EANA 2HHQA 1T5XD 1TKEA 1UGJA 2OOBB 2Q5WD 3R2TA 3RJHA 5ALLA 2RDJA 3NY5A 1E7UA 4X57B 3W9CB 4F4ZA 3HT3A 2AU0A 3Q8QB 2NRZA 2IY0B 4JUZA 2QEJC 4ED0A 2WXQA 3LVWA 3UINB 5KFFA 2E6XA 2K5PA 2K0PA 2KFKA 2L3ZA 4RQ8A 2LHEA 1L7NA 1PUZA 2KJ8A 3D2QA 1OXJA 3MFHA 5L1KA 1ZKHA 5KHQA 7ICOA 4EYHB 4DO9A 5DPWA 4ED1A 3Q8MA 2O6VB 3Q3OC 2CJNA 2YEPB 3KOOA 4PS3A 2KICA 2ZIUA 4P0QB 3ZNZB 2RQ5A 1UBQA 3M95A 4CO7A 1QTMA 1R4NB 1TS4A 4KLFA 3C23A 4LLGM 5CP2A 4I2IA 5C1ZA 2G9HD 1PFDA 3BK1A 4B95A 4P1CC 3ETLA 2Y1JA 7ICEA 5ALKA 2L7RA 3FILA 3ML9A 5C23A 4WURA 5TSSA 5J2JA 4IG7B 3D32A 1YN4A 3ED5A 2KWDA 4RQ5A 4GDKA 1AYFA 1GG3A 4G11A 1WYGA 3W1YA 4CQNA 2E8PA 3SDLC 4IM2A 4ZYNA 4WWPA 4PJ0U 4KLLA 2XN9C 3BWUD 5ALVA 5GTIU 2V0GA 2BQQA 3CP8A 2WDQB 5L95C 3HKZF 5KFHA 2A1JA 3DPDA 4DL6A 2R2QA 2WU5B 4WWNA 2AX5A 4DK5A 3V72A 1UHUA 3ZDDA 1WGRA 4QZCA 3RULA 3M8RA 2WXOA 1E8XA 4CYEA 4M9HA 3TSSA 2GLEA 3UMBA 1D5XC 3EHVA 5AM3A 1U45A 3MJWA 1YMHE 5AM2A 2BB5A 4G50A 4LCDE 4RF0A 4KLEA 2W9AA 1D9DA 3PPAA 1BPYA 3C2MA 2D3AA 3NOBA 3RCZA 2LYAA 1Z4NA 4EZLA 4J03A 3DVGX 2ZNVC 3N1XC 4EE2A 4MEYA 2D11A 4K7SA 3W2DA 4GDLB 1E7PB 3VH4B 3DQVA 3ZRFA 3WALA 1WXQA 3EA6A 3WANA 4BXOB 3QCAA 2CU3A 4GN1A 2WXFA 3U2SC 2YVCA 4ZDVA 1RWSA 2JV3A 4QZEA 1RXVA 3MC9A 4B9KA 2WDRB 1RXWA 4NLKA 4MDKE 2KO3A 1V6EA 3IFWB 3OTQA 3ONNA 4YMMA 3ZTDA 2LEKA 1DOQA 3QZ7A 5MPOA 3NVWA 4YWGG 1T0RC 1VJ5A 2JXTA 3L4PA 4OZAA 5J0TA 2KKVA 3MP9A 5J2DA 2NR2A 1UWMA 3K1RB 3F5AA 1LKYB 2NTSA 3RJIA 8ICOA 3GILA 1ENFA 2JZBA 1KLNA 4NLBA 3AE8B 2LVQA 4IM0A 2C9WB 4KKIA 4PS8A 3O65B 2NBVB 4OCZA 2L8JA 3NASA 2ZW0A 4B0EA 2E3TA 5CWRA 4MF8A 3VVWB 3W1SA 3SEIA 3LK9A 2BPGA 1LFDA 2C7NB 4OW0A 2MBHA 2O2VA 3LDZE 3I76A 4FFDA 5EWFA 3OSPA 2KMAA 1U49A 1ZQUA 2WHEA 5AHXA 2F3NA 5AKJA 2KD1A 2R8JA 2KZZA 2E8MA 5HMLA 2HOQA 5KG3A 2GOWA 3LWMA 1NKEA 4DSKA 3H4DA 4RZRA 1YQ3B 1SV4A 8ICNA 1XLOA 2BYTA 5AKHA 1FFUA 2J6SA 3KWLA 2KG5A 1X9XA 3V6CB 2C5LC 2LZ6A 3T3NA 3SU8X 5CR0A 5J0YA 3KHRA 4ZYSA 4GMVA 9ICOA 1WZ3A 1FXAA 1F5SA 3DBLI 2DYBA 2VKQA 1XEEA 2KVRA 5J17A 3B2FA 2MU2A 4MF2A 1KBUA 2PMZF 1N62A 1Y8RC 2LVPA 3WKAA 4KLSA 3QARA 4FJYA 1VD2A 4NQLB 5KT5A 1WXVA 1ZW7A 2IA6A 3AEDB 4B9SA 1OQQA 1MN8A 3PW4A 1H4RA 1KRHA 1WWTA 4QZIA 4QWBA 4DQOC 1SGGA 4ICAA 3TJPA 3TADA 3PLVA 3AU2A 3GQCA 4GIBA 4UAYA 4C4VA 1X40A 2QARA 4IWQA 2D8CA 3MDCA 2KYWA 2K4PA 4ACFA 3C28A 4KSLC 1ZQHA 4YL8A 2X38A 1VR9A 3ZKJC 5E6OA 2NPTB 3MHSD 2JWZA 4MEMA 4BKGA 9ICLA 3KUZA 5KG0A 2ZW1A 2W3RA 2KHQA 4IRCA 4ECYA 3NRZA 3PRPB 5H8YE 3VUWA 5ALJA 4I2HA 2KNBA 1F77A 4XQ8A 2BGFA 3KD3A 4IKGA 1BPBA 3AE4B 2BYVE 4DQRA 3LB8C 3VR9B 1P3QU 5LNK1 4LTUA 1ZQGA 5KTQA 1QZEA 1MA7A 3H7SA 2TSSA 4RGTA 4ANWA 5DDMA 2ZJDA 4KV2A 4F7ZA 4KDLB 4J9KA 3UF8A 1QSLA 3ZW3A 3BS5A 1FFVA 4JWMA 1SBBB 3QAQA 2GRIA 4ANUA 2K6DB 4IS7A 1XS9D 2OM6A 4NY0A 2MLBA 1BVSA 3NUHB 1QCKA 3FILB 1HEKA 4JWUC 2FMSA 4DFDA 2I9GA 3OHAA 5H92C 5IAAC 2ON8A 3T9LA 3ECIA 1BPDA 1S77D 1NJYA 2KT7A 2YB4A 3N97B 3EECA 1C20A 1OQYA 2A1JB 4O3RA 2BS3B 4PYZA 5BO4B 4CHKA 2V4QA 1PK1A 3MC1A 1A77A 3UI3A 3B2GA 3Q8FA 2HTHA 3C21A 1SJED 1KLVA 3MR5A 3HPOA 2QILA 2BTEA 5D94A 4EBCA 3DHGC 2QB0A 5ALZA 2ZIVA 2WXGA 1WCNA 1Y56A 2WXNA 3R7RA 5AI8A 4O3OA 5DPTA 1GAQB 3GB1A 1IG6A 1NBFC 5G5GA 1NKBA 4I28A 4FHKA 2F76X 5AK4A 7ICJA 4RQ4A 2EAOA 5H2FU 4BJQA 1WGGA 4RCOA 4M6WA 4GXIA 5HR7A 4G3IA 4OZBA 3LWLA 5J8YC 3P4PB 3AULA 3A9KA 1RFKA 2YMMA 4RMAA 1NK9A 1D5ZC 1RZTA 4TUQA 3APCA 4QWAA 3M6KA 4NQKE 1D8BA 9ICIA 1Z3EB 3UXNA 2WX0A 1L7PA 1L5UA 1SKRA 3RFZB 4DQSA 1YN5A 4WIPA 4R8UB 5IA7A 2HHTA 1AW7A 3DOWA 3LVVA 1BT0A 1TJEA 3UQAA 2CR5A 3F2CA 3UXOA 3ZJUA 3QEAZ 5DG9A 3ML8A 4J6IA 2WTFA 2KHVA 5HHHA 3EFUA 2BW2A 3AXCA 3PSFA 4ZRQA 2MHJA 1K1SA 3MGHA 1HZ6A 2EDUA 2C2EA 2ASDA 4K4GA 2RGFA 1KW4A 3IN5A 3PX6A 1AROP 2L0TA 1X2IA 3GIKA 1EWCA 4DWIA 3DBLB 4PS7A 3ZLZA 5EWEA 2O2VB 1CUKA 4ITKA 1C1YB 4W9JA 1OEYA 1QLBB 8ICJA 1XSPA 1IBXB 3NTUA 2GBMA 3C1ZA 2I6XA 1F2RC 4RQNA 3GIJA 1ZDXA 4DFPA 5J2FA 1N2XA 4BOSC 3RRGA 3CW2C 1SGHA 2BQ3A 4DSLA 1VCBA 4JWSC 3P1MA 9ICQA 4J9QA 4P7IA 5KFMA 1NJZA 2Z59B 5AM4A 4ECSA 1V9JA 1UQVA 3RRHA 2KTQA 1ZUD2 2KZRA 3AE1B 4PT5A 2K9XA 1MQ2A 4ECWA 4JLCA 4O3SA 3E56A 4IW0A 2HOIA 3OJUA 1E8ZA 1HTOA 4NJ7A 2KV2A 1WX7A 4ECZA 1NI2A 4PL1A 3K4GA 5T8IA 4PH5A 3SFEB 2FJ6A 2JHDA 3D6JA 3RAQA 1NYRA 3QE9Y 4KLHA 2KXJA 2WYQA 2PFOA 2KDBA 2LVOA 4DFJA 4Y2RA 4C4VB 2PE9A 5JXVA 1UZXB 4M9GA 1R7SA 1V5OA 3HIZA 2ACZB 2F44A 2BQUA 5AEKB 3SD5A 1JXEA 3MGIA 1ZXIA 4BGDA 2MUTA 1X9MA 1TVAA 1IXRA 1P7DA 3BQ0A 1YJ1A 2AHOB 2LHTA 2CS4A 5ALDA 5DG7A 5J18A 3ZDMC 1NK8A 3B0XA 2XY6A 1K8RB 1IUEA 1YD8U 2C2DA 1WWUA 2ZUCA 3QXGA 1BNPA 3ZXRA 2PJHA 5ALXA 3QU5A 1XO0A 1RLFA 5ALYA 4GC7A 3PS6A 3FKYA 1NKCA 3PSPA 2C60A 1CMXB 2CKHB 3RT3B 4YR3A 3PX4A 2K39A 1XT9B 1PDXA 4GB9A 3F2BA 3H7IA 1KM7A 1E90A 3D2SA 1AARA 2GLSA 1XCQL 3BINA 3WK7A 4XWTA 4Y2VA 3QK0A 1D5MC 3GE3C 5J0UA 2F8KA 4DXFA 4BBNF 4QZGA 2W8KA 3SENA 1FO4A 4FE3A 1CEZA 2JH1A 3NVYA 4RT2A 4US9A 1YX6B 4WJOA 5KFJA 2WWZA 2KQSA 1Z1VA 4CE6A 3ZRCA 5GTHU 3GV8B 4A20A 3MR3A 1O03A 2PXIA 5KL1B 2CHZA 4C4RA 4CRXA 2NRTA 4NLNA 2DYOA 4ECXA 3QA8A 2EZYA 5DB7A 3DBRB 5AK3A 4JV1A 3G6VA 3QNMA 5IOIA 5G5HA 3M9NB 2ZIXB 4JV2A 1TAUA 2SEBD 5JUMA 1SE2A 1RYRA 3AEVA 4A9AA 4JQWC 1FM0D 3ISCA 1GB4A 1I4GA 5KFUA 5DB9A 4DEZA 3SYZA 3GZNB 3H1UA 2MJEA 3ZD8A 2R61A 3PSTA 5KFPA 5ALNA 3ZXVA 4Y2TA 2HHUA 4LNIA 2PTLA 4YT0B 4YD1A 3MBYA 4ZH4A 1K5OA 3GV7B 3KHLA 1OQRA 5JHAA 3AEEB 3KHHA 1N48A 2PIAA 2FCMA 3TARA 5DQIA 5DB8A 4R8UA 3PO0A 4TUPA 2QSDA 4LZDA 1XCTL 2VA2A 4ANXA 1D8YA 2HVIA 2KD0A 4P0QA 4MH0E 1EU4A 2AQ0A 5CRXA 2J52A 1WR1A 2HDEA 2KQ7A 1E7VA 2AQ2B 1K53A 2D3BA 3IHQB 4YCXA 9ICHA 1CQVA 2IO2B 3APDA 4LJOB 4O3NA 2DZKA 4F1SA 2HBLA 4ARIA 1L4ZB 2OEDA 3MTNB 2WU2B 4F5RA 2HW3A 4RU9A 1RYJA 2XICA 4DQPA 2ZNVB 3TMPB 4A8EA 1ZQKA 1Z4OA 2XK5B 3MHZA 3EZ5A
chains in the Genus database with same CATH topology
3V3XA 2KAJA 2K3UA 1FCLA 3O13A 3SFDB 1VLBA 1HEZE 1ZP0B 2CJNA 2YEPB 1N5XA 1SF0A 1SJHD 3U52E 1L0XB 3P63A 1LO5D 1TS4A 1C9FA 1E9MA 4IDIA 4RH6A 2L1AA 2L83A 4LLGM 2MH7A 4P6VF 2G9HD 1PFDA 2HTME 3BK1A 4L23A 4A8XC 1JW9D 4WWMA 5TSSA 3FILA 4WURA 1QOFA 1N60A 1YN4A 2KWDA 2B76B 1VRAB 1AYFA 3Q8AA 1JQ4A 1WYGA 4C7YA 4NAWB 2N0SB 4CQNA 1SSNA 1WSPA 3AV8A 4O1NA 2AQ3B 4NZLB 2ICIA 2XN9C 2W82A 3BWUD 2V0GA 2WNMA 5AUKA 1QQRA 3P4QB 1WGKA 1I4PA 2WDQB 1OFFA 4MT5A 3BVZA 1FCCC 2LHDA 2WU5B 2AX5A 1IGCA 2QIEB 2LFIA 2MJDA 1P7EA 2WXOA 2PMVA 1DOIA 1FIQA 1WRIA 3TSSA 1D5XC 1MVKA 2XNAC 4ZHPA 1YMHE 4GDKB 4XDCA 2BB5A 5I4DA 4RF0A 4L2YA 2GI9A 5HFYA 4EE2A 5HG2A 3AECB 3RPFC 3W2DA 5BMHA 4GDLB 1E7PB 2VZKD 2Y5CA 4HKQA 4YTNB 1L6VA 1WXQA 3EA6A 2WXKA 3BIID 2CU3A 2WXFA 4N58A 3U2SC 1GB1A 3AEAB 1HQRD 1RWSA 3AEBB 5BMGA 1IBXA 3PZ7A 3BVMA 2WDRB 2H88B 4ZRPA 3NVVA 2PW9A 1VZ8A 1TYGB 2LGIA 3N9YC 2PVOD 2PKOA 4R3DA 4KGSA 1I4RA 2BB6A 2RDGA 3NZ3A 2LEKA 5MPOA 3NVWA 1J7AA 3MJ5A 2JXTA 3L4PA 3KWVA 4OZAA 3MP9A 1ZE3D 1UWMA 1B1ZA 2J42A 2NTSA 1ACCA 1CJEA 3VR8B 1ENFA 2IJ0A 3HUIA 4AQ7A 1FNVA 1C4AA 3AE8B 2DWQA 2WXLA 4HJGE 3C8YA 4KKIA 3PZ8A 1C4PA 1ZPSA 4YSZB 1I4HA 2ZW0A 4B0EA 1V1OA 2E3TA 4IOIE 4NAMA 3W1SA 2FUG1 2JZPA 4US8A 3W5UB 1KLGD 4OW0A 4YTPB 1D4BA 3ZGZA 4OZCA 3BYTB 1E0ZA 3FAHA 2AQ1B 5C3JB 1DYQA 1FNWA 3BYYB 3W5VB 2H89B 5BYRA 1C76A 2J53A 2DYMA 3KQ4A 2BS4B 5D3DA 1YQ3B 1YQ4B 3MC0B 1F2RI 1XLOA 2BYTA 2BS2B 2NMQA 1FFUA 3KWLA 4HROA 3LYYA 3T3NA 2WS3B 2Z8LA 4ZYSA 1QF6A 2IGGA 3Q8BA 2I2YA 1C79A 1FXAA 1XEEA 1IGDA 4OVZA 3B2FA 3URYA 1N62A 4P16A 1TY0A 3AEDB 1JWSD 1OQQA 4C56C 1E6EB 1KRHA 1WWTA 4DQOC 4YXDB 2PVGC 3AM9A 2INPE 1J7BA 4A6QA 1JROA 1K50A 2VZKB 2WXMA 1HXYD 3ZJTA 3P42A 1SXTA 1FMAD 1JWMD 4OHJA 3E9SA 2X38A 1VR9A 1C77A 1BXTA 3IAS1 2V3NA 1FEHA 2ZW1A 1ZDVA 3CWIA 2W3RA 5H8YE 4GLSC 3NRZA 2IGDA 2NTTA 2V3PA 3NVZA 4TMAB 5HHDG 3I9V1 1TS2A 5HI1A 4MACA 1F77A 2RPVA 3R8BA 1KF6B 1PYWD 4IKGA 3AE4B 4LK0M 2DBYA 3LB8C 1NEKB 3U4EG 3VR9B 2Y3AA 4TQ0A 1HA5A 3GS2A 4LTUA 5LNK1 4ARCA 1V1PA 1Q10A 1B9RA 2TSSA 1TKGA 2WP9B 1AN8A 1ZOYB 4RGTA 2W3SA 3IT6B 1QKZA 3Q69A 1QILA 3VRAB 1FFVA 1SBBB 5D7GA 2GRIA 1V97A 2WXIA 3IAM1 3MFGA 1KFYB 3H8HA 4TQ1A 3NUHB 4YSXB 3FILB 4JWUC 3V05A 5E6JA 5H92C 2ON8A 2FE8A 1SE3A 4KGTA 1PGAA 1YJIA 2N7JA 2BS3B 3Q8CA 1P7FA 3NS1A 5BMIA 3UI3A 3B2GA 3Q8FA 1SJED 1DOYA 3TEZA 1JCKB 2QILA 2BTEA 5EE0A 4XWWA 1ZXHA 4HRSA 4J3OD 3VRBB 3TUOA 2WXGA 1Y56A 2WXNA 2IPKD 4XDDA 5AUIA 1GAQB 3GB1A 2WXPA 5G5GA 2QMTA 4ZOHC 2M19A 4KX6B 3AE5B 5GXGB 1XLNA 4RGNA 1K51A 4RCOA 3R2IA 4OZBA 3P4PB 4USAA 3ZYYX 3TEWA 4C7ZA 1NI3A 1RFKA 1GOZA 1SIJA 4KGRA 4TSSA 1D5ZC 4HEA1 2J4XA 3GP7A 2RMMA 3DWMA 5FKAC 2WXRA 2KMMA 1XLQA 2V4IB 1JWBD 1MHHE 3RFZB 4RF1A 1K52A 1YN5A 4WIPA 3ZJVA 1V8CA 4XE0A 1V1PB 2W54A 3AN1A 3OWEB 1SEBD 2CJOA 1AW7A 2KN4A 4MM3B 1TJEA 4RNAA 3AE3B 4A55A 3ZJUA 1CZPA 3SEBA 1ROEA 1QOGA 1L0VB 3BZDB 2BW2A 2WLBA 5BYQA 4ZRQA 5D3IB 1NENB 1HZ6A 2G1EA 4WH4A 3B9JA 1STEA 2DLBA 1EWCA 3AE6B 2N9LA 4JPSA 1I7HA 3AE7B 2MJ3A 4ITKA 4JE3B 1QLBB 2D5GA 1IBXB 1DGJA 1JRPA 1XLPA 2QJLA 1TZOA 4C80A 2FBWB 1F2RC 3BK2A 1NYQA 3P4SB 3VQIA 4RGMA 1ZDXA 2WQYB 1QT9A 2GB1A 2LMCA 2PLPA 1MI0A 1F0ZA 2M56B 4JWSC 1XXGA 3P1MA 2K22A 1I4QA 1TS3A 3I57A 1VJKA 3ETRA 1ZUD2 1N5WA 1FRDA 2IGHA 3AE1B 4PT5A 2K9XA 3KLSX 4B0MA 1TY2A 1EU3A 1VZ7A 2L52A 1EM7A 1JMLA 3E56A 1AWDA 2JU6X 5FR3A 2WXJA 1JALA 4YTMB 5T8IA 1ET9A 3SFEB 1QOBA 1KTKA 1NYRA 2JYTA 3CIRB 4HKZE 3HVDA 4REZA 3AH7A 5JXVA 1YJJA 1R7SA 2SAKA 3AEFB 2ACZB 3EUB2 1FNUA 4N59A 4Q2JA 1ZXIA 1UNSA 1L5PA 4KKJA 3T3OA 2RDHA 1JWUD 4AS1A 2LJIA 1PUTA 1J7CA 3EGRA 1M4VA 1MPEA 5EE3A 1KH0A 1IUEA 3BVGA 2ONQA 3LXFA 3AE2B 5EE9A 1EWYC 2JX5A 3SR6A 2LUMA 3TEYA 2I38A 1N63A 4NJCA 1XO3A 4D2KA 2M0AA 4MH8A 3FC4A 2OHFA 2KQ4X 1BUIC 1C4CA 2JQRB 1PDXA 1SB3C 3IXSA 4JX1C 5EE1A 4FXCA 1VZ6A 3DWGC 1XCQL 4WAFA 4XWTA 1D5MC 5C2TB 1QOAA 1RM6C 1PGXA 4DXFA 1FO4A 1N61A 3J9CA 1L0YB 3AB5A 1SE4A 3NVYA 2N9KA 4US9A 3IT4B 2JYEA 3P4RB 3ABVB 1DOXA 2EELA 2YEPF 1L4DB 2W55A 3HVZA 4ZHOA 4WQMA 1YNTE 2MEKA 2WXHA 1BMLC 1D6EC 2DYOA 2EKIA 3ZQ4A 1T6BX 2JWUA 5G5HA 2SEBD 4L1BA 1SE2A 4DXGA 4A9AA 1FM0D 1GB4A 1I4GA 2WDVB 3AMZA 1C78A 1PGBA 1KLUD 2MJEA 5BYSA 2KDMA 1HZ5A 2R61A 1L6UA 4H2AA 2KACA 1JWAD 1UWXA 1TS5A 1I4XA 2L32A 2PTLA 4YT0B 1VDVA 1OQRA 2BT6A 2IDYA 4YSYB 3AEEB 2PIAA 3U7ZA 1YN3A 1UUPA 4RFBA 1FD6A 1ESFA 4N6EB 2JSVX 3Q8EA 3PO0A 3HRDD 1XF5L 2QSDA 2INNE 2BBCA 1XCTL 1MHXA 3WCQA 2Y5PA 4UDUC 1ET6A 5FK9C 1EU4A 2J52A 1FXIA 1E10A 2HDEA 1FRRA 1TKYA 1K53A 2AQ2B 4YWGG 1CQVA 1T5XD 3R2TA 1TKEA 1UGJA 2Q5WD 1GPXA 4ARIA 1L4ZB 1A70A 3AE9B 2OEDA 4M0WA 3AEGB 3W9CB 4RGOS 2WU2B 3TEXA 1T3QA 1RYJA 2QEJC 2WXQA 1NVID 4A90A 1CK1A 2E6XA 2K5PA 2K0PA 3MHZA 2LHEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YTP B;  2KAJ A;  1PUT A;  1J7C A;  3P4P B;  4USA A;  3ZYY X;  3SFD B;  1VLB A;  4C7Z A;  1E0Z A;  3FAH A;  1NI3 A;  1RFK A;  5C3J B;  1ZP0 B;  1SIJ A;  2CJN A;  5EE3 A;  1IUE A;  1N5X A;  1SF0 A;  2H89 B;  3W5V B;  3DWM A;  3LXF A;  3AE2 B;  3P63 A;  5EE9 A;  2KMM A;  1EWY C;  1XLQ A;  2JX5 A;  3SR6 A;  2BS4 B;  1E9M A;  4IDI A;  1N63 A;  1JWB D;  2L83 A;  1XO3 A;  1YQ3 B;  2MH7 A;  4P6V F;  1YQ4 B;  1PFD A;  1XLO A;  3FC4 A;  2BS2 B;  2HTM E;  2OHF A;  1FFU A;  1JW9 D;  4WWM A;  1V8C A;  3KWL A;  4HRO A;  2W54 A;  3AN1 A;  2JQR B;  1PDX A;  1N60 A;  1SB3 C;  1QOF A;  2WS3 B;  4JX1 C;  2CJO A;  4FXC A;  5EE1 A;  2B76 B;  1QF6 A;  1FXA A;  3DWG C;  1AYF A;  1TJE A;  1JQ4 A;  1WYG A;  4C7Y A;  2N0S B;  3AE3 B;  3B2F A;  5C2T B;  1CZP A;  1N62 A;  1QOA A;  1RM6 C;  3AV8 A;  1ROE A;  1QOG A;  1L0V B;  3AED B;  1FO4 A;  2WLB A;  1N61 A;  1OQQ A;  3AB5 A;  1E6E B;  3NVY A;  1KRH A;  3P4Q B;  4US9 A;  1NEN B;  1WGK A;  1WWT A;  1OFF A;  2G1E A;  2WDQ B;  3P4R B;  4YXD B;  2PVG C;  3AM9 A;  3ABV B;  1DOX A;  3B9J A;  2WU5 B;  2AX5 A;  2W55 A;  2QIE B;  1J7B A;  2MJD A;  1JRO A;  3AE6 B;  3HVZ A;  4ZHO A;  4WQM A;  1DOI A;  1FIQ A;  1WRI A;  1FMA D;  1I7H A;  3AE7 B;  2MJ3 A;  2EKI A;  4ZHP A;  4ITK A;  1QLB B;  3CWI A;  2W3R A;  5H8Y E;  3NRZ A;  5G5H A;  1DGJ A;  1JRP A;  1XLP A;  3NVZ A;  2QJL A;  4C80 A;  2FBW B;  3AEC B;  3RPF C;  4A9A A;  1E7P B;  1FM0 D;  1KF6 B;  1NYQ A;  2Y5C A;  3P4S B;  2WQY B;  2WDV B;  3AE4 B;  2DBY A;  1QT9 A;  1NEK B;  3AMZ A;  3LB8 C;  4YTN B;  1L6V A;  1WXQ A;  3VR9 B;  4LTU A;  3BII D;  2MJE A;  2CU3 A;  4N58 A;  1B9R A;  1L6U A;  1TKG A;  2WP9 B;  1ZOY B;  2M56 B;  2W3S A;  1F0Z A;  3AEA B;  4JWS C;  1JWA D;  1RWS A;  3AEB B;  3VRA B;  3P1M A;  1FFV A;  2WDR B;  4YT0 B;  2K22 A;  1VDV A;  1OQR A;  2BT6 A;  2H88 B;  1V97 A;  4YSY B;  1VJK A;  3AEE B;  1KFY B;  3ETR A;  3NVV A;  1N5W A;  1FRD A;  1ZUD 2;  2PIA A;  3AE1 B;  2K9X A;  4YSX B;  1TYG B;  4JWU C;  4N6E B;  2L52 A;  2PVO D;  2PKO A;  3PO0 A;  3HRD D;  1AWD A;  5H92 C;  2LEK A;  5MPO A;  3NVW A;  1JAL A;  4YTM B;  1J7A A;  3WCQ A;  1YJI A;  3SFE B;  1QOB A;  3L4P A;  2BS3 B;  1NYR A;  3NS1 A;  1FXI A;  1UWM A;  1E10 A;  3CIR B;  1FRR A;  3B2G A;  1TKY A;  1DOY A;  3VR8 B;  1CJE A;  1TKE A;  2Q5W D;  3AH7 A;  5EE0 A;  3HUI A;  1GPX A;  1YJJ A;  1R7S A;  1A70 A;  3AE9 B;  3AEF B;  4HRS A;  3AE8 B;  3VRB B;  2DWQ A;  5AUK A;  2ACZ B;  3AEG B;  3W9C B;  3EUB 2;  2WU2 B;  5AUI A;  4YSZ B;  1T3Q A;  1GAQ B;  1RYJ A;  4N59 A;  2E3T A;  1ZXI A;  5G5G A;  1NVI D;  1L5P A;  4ZOH C;  2M19 A;  4KX6 B;  2K5P A;  3AE5 B;  4US8 A;  1XLN A;  5GXG B;  3W5U B; 
#chains in the Genus database with same CATH topology
 4HVB A;  5DLF A;  3UQ0 A;  2KAJ A;  2K3U A;  4DXA B;  8ICK A;  3O13 A;  2JZZ A;  2LYH A;  1HEZ E;  1ZP0 B;  1WE6 A;  5CB1 A;  4KLD A;  4KN4 A;  3U52 E;  1T8E A;  2J0K A;  3K75 D;  2D3G A;  4ECQ A;  8ICX A;  4RNO A;  3BQ1 A;  3ALB A;  3B08 A;  4C8M A;  3OGU A;  3O0F A;  2L1A A;  1B43 A;  4EEW A;  1V5T A;  2VA3 A;  4IR9 A;  3GOE A;  1MC8 A;  1E8Y A;  4L23 A;  3HX0 A;  1S0O A;  3ORY A;  3TAD C;  1ISN A;  2KTF A;  3RZF A;  1N60 A;  4JV0 A;  3KTQ A;  3Q8A A;  1JQ4 A;  4C7Y A;  3CRX A;  1SSN A;  4E71 A;  1WR6 E;  1TAM A;  2Y1I A;  4E74 A;  1L8L A;  2KDE B;  4HDQ A;  4CGZ A;  1SZP A;  3KYD D;  3DHI C;  2UYZ B;  2W82 A;  3M9M B;  1QQR A;  3P4Q B;  3I1Y A;  1WGK A;  4TQR A;  4J9N A;  1I4P A;  2Q0Z X;  1OFF A;  4IQV A;  3BVZ A;  3KZI U;  4FZL A;  2WAQ F;  2KEY A;  4XGA B;  2ODG A;  2LFI A;  2MJD A;  4RQ3 A;  1P7E A;  2KWV B;  2UVV A;  3MGV A;  1GNU A;  4ELT A;  5TR5 A;  1P1A A;  1DOI A;  1FIQ A;  2MUT B;  4IQU A;  1WRI A;  3SHQ A;  3TCA A;  4ZHP A;  2KJ5 A;  4XRH A;  5J2B A;  1NK5 A;  2QAR B;  2XY5 A;  4K7W A;  1BPZ A;  3QX7 A;  2GI9 A;  3NHE B;  4I2E A;  5HFY A;  5KT3 A;  2LXC A;  5HG2 A;  3ZNH B;  2JVC A;  2DUY A;  3RPF C;  5BMH A;  4UB2 A;  2Y5C A;  1ECW A;  4GLX A;  1L6V A;  3UIO B;  3KZX A;  4ED3 A;  4RQ7 A;  3QU9 A;  3ZDC A;  3H7P A;  2KC2 A;  1GB1 A;  2FCQ A;  2XO7 A;  4UAT A;  2KVZ A;  3AEB B;  1YX5 B;  3PZ7 A;  2MBE A;  5JZE B;  2K8C B;  1SKS A;  3NVV A;  1T0Y A;  2YN4 A;  1TYG B;  1U9L A;  1WMH A;  2Y5B B;  4QZA A;  2NRV A;  1FPY A;  3NZU A;  4R3D A;  1TGZ B;  2ZUB A;  3ZDE A;  2HI0 A;  2K4H A;  1ZQR A;  8ICE A;  2JMG A;  2LGS A;  1UT5 A;  4F71 A;  3KWV A;  4LVS A;  2V4L A;  3PVL A;  2BWE S;  4FBU A;  4NV0 A;  5DBB A;  4QZH A;  4RQ1 A;  1B1Z A;  2J42 A;  4IM3 A;  3VR8 B;  4GC6 A;  1CJE A;  4M0W B;  5E6P A;  3V60 A;  4FJZ A;  1FNV A;  5TZV A;  2JEF A;  2DWQ A;  1SL2 A;  3VHT C;  3SAG A;  2UWQ A;  1C4P A;  4YD2 A;  2KX0 A;  2KE7 A;  4AP9 A;  1NJW A;  1ZQN A;  4YSZ B;  2Y9U A;  4IOI E;  2N1W A;  2MBB B;  4YTP B;  2B3A A;  4ICU A;  4BUG A;  7ICL A;  4OZC A;  4MJS B;  2ZJA A;  2DF4 B;  3FAH A;  2UVU A;  1XU4 A;  2AQ1 B;  2ZCB A;  2V9H A;  4WQO B;  4MSQ B;  4MFF A;  2W04 A;  1FNW A;  3BYY B;  3QZ8 A;  4MFA A;  2H89 B;  2LJ5 A;  5JTI A;  5ALH A;  4XA5 A;  4B9V A;  2GMI C;  5ALW A;  2DYM A;  2BS4 B;  1TE2 A;  2KOB A;  3A4S C;  4PYU A;  4S17 A;  5AKZ A;  3MC0 B;  1A0P A;  3LYS A;  2BS2 B;  2H3Q A;  3H0R B;  2DEN B;  1PQS A;  3Q3M C;  4GFJ A;  8ICF A;  4KLI A;  4WJN A;  2IGG A;  3PZD A;  1TIF A;  2C22 A;  2I2Y A;  1WE7 A;  2DQN B;  1WGH A;  1J8C A;  3PR5 B;  3PRE A;  3DV9 A;  4UAZ A;  4EZ6 A;  5J2C A;  5IIL A;  3OSN A;  2DPI A;  1TY0 A;  2HOF A;  4CDG A;  3WKB A;  5KFQ A;  4J9O A;  2OEH A;  4EBD A;  1L7Y A;  5G55 A;  4RQM A;  5JH5 C;  1ZRM A;  4QW9 A;  4ECR A;  3AM9 A;  2G09 A;  3BJY A;  3DBH I;  4M9L A;  1J7B A;  4A6Q A;  1RG6 A;  3QU7 A;  3I5J C;  5AK6 A;  4NL9 A;  2BCS A;  3OAW A;  3P42 A;  2KC1 A;  1SXT A;  2XK5 A;  4BKT A;  2BPS A;  1M6Y A;  1ZQW A;  3OPX A;  2RD0 A;  1C77 A;  4W9K A;  2FNJ B;  7ICI A;  1J19 A;  2LYB A;  1FEH A;  5CHF A;  9ICG A;  2OWO A;  2NTT A;  3RF9 A;  5KFV A;  3NVZ A;  5HHD G;  3I9V 1;  2ZVN A;  4MAC A;  3R8B A;  2RPV A;  2W8L A;  3TIX A;  5KFI A;  5J2K A;  2KDF B;  2FCS A;  3QUB A;  4F2R A;  2DBY A;  2D6F C;  4DSJ A;  3GS2 A;  4KIT B;  2L05 A;  2MSE D;  4ARC A;  1V1P A;  4PHD A;  2ES6 A;  1M94 A;  1AN8 A;  2PI5 A;  1TKG A;  2W3S A;  2WP9 B;  4FO6 A;  5EWG A;  3H8J A;  1UA1 A;  1QIL A;  1TTN A;  3Q69 A;  3GZN I;  4F91 B;  3PMN A;  2MA1 A;  4JGH B;  1UA0 A;  4M2Y A;  1KFY B;  3WU2 U;  4TUR A;  1OEY J;  5D6J B;  1UCV A;  4F8R A;  2HHX A;  4AOF A;  2ZG6 A;  4O3M A;  1SWW A;  2DKZ A;  2FLL A;  2MP2 A;  2KJ9 A;  1ZQB A;  2K4I A;  5E6J A;  7ICH A;  4I2A A;  3KVF B;  4BKS D;  2N7J A;  5L83 A;  1SV0 C;  4NWI A;  3IBE A;  3NJT A;  2VJ4 A;  3NS1 A;  3OJ3 A;  5BMI A;  3PW2 A;  2K6Q A;  1HUZ A;  1KFS A;  1JCK B;  2AGQ A;  2MA9 B;  5G2N A;  4XWW A;  1V2Y A;  3TFR A;  5DKW A;  3V6E B;  4BVU C;  1PZN A;  2MX2 A;  2HBM A;  2ZXI A;  5ALG A;  4GGQ A;  5AUI A;  5IIN A;  2H5X A;  4RM9 A;  5KAI U;  4DHZ B;  2QMT A;  4RQ6 A;  1NK6 A;  2M19 A;  5GXG B;  4TKN A;  2RHF A;  4EZ9 A;  2JR5 A;  4PGY A;  4AWJ A;  2XI9 A;  2W9C A;  2W9N A;  3ZVV A;  4OVV A;  5ALQ A;  4USA A;  2LGX A;  3ZYY X;  4ECV A;  3C29 A;  1NI3 A;  3PML A;  1GC7 A;  1GOZ A;  2MAX A;  5D4B A;  1GUA B;  3PRM B;  4G3X B;  4KGR A;  4TSS A;  2DNF A;  4HEA 1;  2UU7 A;  1ZQX A;  2LRW A;  3DWM A;  3GP7 A;  3ZI4 A;  4DLE A;  3RB6 A;  3QIJ A;  3QU4 A;  2KMM A;  1XLQ A;  2JZB B;  2BCV A;  4ACO A;  2BKE A;  3SV4 A;  1X9W A;  1MHH E;  3RFA A;  5BOM A;  4Y2S A;  2JH7 A;  2ZIU B;  3GV5 B;  2XC9 A;  2BCU A;  1K52 A;  3ZJV A;  3N3K B;  1V8C A;  3RAX A;  3AN1 A;  3OWE B;  3DVG Y;  3WAP A;  2KN4 A;  2ZPN A;  4AJY B;  4RNA A;  1J97 A;  8ICQ A;  1WXA A;  4RUA A;  4K3B A;  1CZP A;  1WMH B;  5HR6 A;  2HJ1 A;  5KFS A;  1F1H A;  3BZD B;  3VDZ A;  2GBN A;  2R8H A;  3HKZ C;  3R66 C;  4GXK A;  3SV3 A;  1E8W A;  4KTQ A;  1C7Y A;  2RRD A;  2IBI B;  4WH4 A;  3GDX A;  2KNJ A;  2WF6 A;  1Z5S B;  2L00 B;  4DL5 A;  1TK0 A;  2DLB A;  9ICC A;  4KIK B;  4KLJ A;  4BKS A;  2K1F A;  4Y2U A;  3WK6 A;  5KFZ A;  4Z6C A;  3C0R B;  9ICR A;  1X1M A;  1ZD4 A;  2J0J A;  2N1R A;  3L10 B;  5J0O A;  1NK0 A;  1ZQO A;  1RYS A;  2XEW A;  4UB8 U;  1JRP A;  3L5K A;  3MR6 A;  3A33 B;  3WK4 A;  4EUT A;  1HTQ A;  7ICT A;  1XC9 A;  2HJ8 A;  1NYQ A;  4B9M A;  4RGM A;  3Q14 C;  1ZQT A;  9ICN A;  3VQI A;  1HIW A;  4F4K A;  1QT9 A;  1TV9 A;  1ZQM A;  2C2R A;  5K4L A;  2N7E A;  4DFK A;  2WHI A;  1XSN A;  1F0Z A;  4C00 A;  4RQ2 A;  5DPR A;  5J0X A;  2IBK A;  1UF0 A;  4RNN A;  3PW5 A;  4NPN A;  1S9F A;  4WJQ A;  2KZ3 A;  1VJK A;  3DVN V;  4GSW A;  1SL0 A;  2NPT A;  3SMV A;  2YQE A;  4EEY A;  4F2S A;  1VZ7 A;  2L52 A;  4EZK A;  1UEL A;  2EAP A;  1COO A;  2GH1 A;  3RR8 A;  2JU6 X;  2I1K A;  5FR3 A;  2WXJ A;  1JAL A;  1WX9 A;  5AK5 A;  1IM4 A;  4YTM B;  3Q8R B;  2B21 A;  3HIL A;  4O9M A;  1I42 A;  5AKK A;  4IUM B;  7ICU A;  3ZIM A;  2JXX A;  4HCP B;  3HVD A;  4REZ A;  2NV3 A;  2KVS A;  3V7J A;  1YJJ A;  3AEF B;  2AL6 A;  4HWI B;  5C5J A;  4QZD A;  4HJK A;  5KG1 A;  1FNU A;  3EC8 A;  2C7M B;  1NZB A;  4Q2J A;  1Z00 A;  3QC8 B;  1L5P A;  4XZ4 A;  4M04 A;  4M02 A;  3VTU A;  4O5C A;  1PUT A;  4PZN A;  4F5P A;  1X9S A;  3H9D A;  3L0W B;  2L5Y A;  4XUS A;  2K8H A;  2HMX A;  1KH0 A;  1ZYQ A;  3AU5 A;  2G08 A;  1V86 A;  3LXF A;  1TZ1 A;  2LGD A;  4A3P A;  5EE9 A;  8ICG A;  2LUM A;  2I38 A;  1DK3 A;  4D2K A;  2UVW A;  1LB2 B;  4C4T A;  4P4O A;  3T5L A;  3FC4 A;  4F72 A;  2PFN A;  4EZJ A;  4O5E A;  4UB4 A;  1YQB A;  2JPH A;  3LJ3 A;  3T5H A;  2BDP A;  4JX1 C;  1N56 A;  4FXC A;  4FJV B;  3KHG A;  2ATL A;  1VZ6 A;  2QB1 A;  2J7Q B;  5DDY A;  4QIW C;  7ICQ A;  2ZIX A;  2IHM A;  2HHV A;  5ALS A;  4I6P A;  2Y0S F;  3RUI B;  4AJW A;  3J81 j;  5KT4 A;  3AU6 A;  5CX3 A;  4IQW A;  3C1Y A;  2A3V A;  2JYE A;  2DFL A;  3CNH A;  1SKW A;  3P4R B;  3ABV B;  4UAS A;  7ICP A;  4YQW A;  1ZET A;  2NO4 A;  2YEP F;  2H3Z A;  5KG4 A;  1L4D B;  2XY7 A;  3H8S A;  2KDI A;  4K1R B;  4RT3 A;  2LI6 A;  4QZB A;  3EPI A;  5AI4 A;  2CHW A;  4WQM A;  3V61 A;  4W9D A;  4X5V A;  2KFZ A;  1K1Q A;  2IOF K;  1Q3V A;  3UMG A;  2EKI A;  3MC8 A;  2KJH B;  2YTU A;  9ICB A;  3QJZ A;  2AGO A;  1SE9 A;  1I35 A;  2PKE A;  1E5W A;  1TKD A;  4OJP A;  4L1B A;  4DXG A;  1GO3 F;  2VA8 A;  2ZPY A;  2OJW A;  2WDV B;  1ZJM A;  2KVC A;  4UB5 A;  1EXN A;  1C78 A;  4I2J A;  3KKA C;  4IRD A;  3MDA A;  2LUE A;  4DQQ A;  3TBL D;  5BYS A;  4GOC A;  3M63 B;  1JWA D;  1UWX A;  2A19 A;  5AM1 A;  2C7H A;  1S97 A;  3FYH A;  1NNL A;  1JN3 A;  1UGM A;  1L3U A;  5C0Y A;  4K4H A;  1WG8 A;  3RNE C;  5ALF A;  4I6N B;  3HRD D;  1XF5 L;  2BBC A;  3X23 A;  1S8O A;  3RBE A;  1MHX A;  2M0N A;  8ICU A;  5DB6 A;  8ICS A;  4NAW A;  1NZP A;  1ZQQ A;  5AKX A;  3RZW C;  3JSV B;  4UDU C;  1UD7 A;  3VC8 A;  4BX9 C;  1ET6 A;  5F9L A;  1TK5 A;  1E10 A;  2LD9 A;  1V9P A;  2FAZ A;  4ED2 A;  4Q45 A;  1TK8 A;  2QLT A;  4W9F A;  3OLM D;  1A70 A;  3VTV A;  2O6V D;  4II3 B;  3M62 B;  4M0W A;  5AI5 A;  3AEG B;  3APF A;  4RGO S;  1H8C A;  1T3Q A;  2V3S A;  4DS5 A;  2MRP A;  5E6N A;  1NVI D;  1WGD A;  1ZD2 P;  1CK1 A;  4I2F A;  5III A;  2HD5 B;  2KWU B;  4GU2 A;  2WDT B;  2N7D A;  1WXS A;  3UQB A;  2RLT A;  1RQN A;  1FCL A;  2HSZ A;  4OD0 A;  1VLB A;  5J0R A;  3L17 A;  4MSM B;  1PVP A;  2K89 A;  5J29 A;  2NCN A;  3TQ1 A;  3AL0 B;  1KKX A;  1J0G A;  5KG2 A;  4KLQ A;  1S0N A;  3NZS A;  2RSU A;  3B0Y A;  1SJH D;  2VH2 A;  4KZC A;  1L7O A;  2HHS A;  3RNA C;  4C8N A;  1P0R A;  1C9F A;  4NM1 A;  1E9M A;  4RH6 A;  2A5U A;  1ED1 A;  2BDU A;  5KFK A;  2L83 A;  2LWP A;  3PV1 A;  3QQ8 B;  4P6V F;  3UGB B;  1EF5 A;  4LZG A;  9ICT A;  3L3F X;  4A8X C;  4DF8 A;  4DSI A;  1QOF A;  3C5G A;  5E79 U;  2B76 B;  1Q5W B;  2E1E A;  1PK3 A;  3E0F A;  4C8L A;  4O1N A;  1CI4 A;  2AQ3 B;  2LBO A;  1R4M B;  3PNC A;  2Z7J A;  2PMZ C;  3UMC A;  5CHW A;  4NZL B;  1L8O A;  3PT2 B;  1ZQZ A;  4OJ6 A;  4MT5 A;  4B6W A;  3BY4 B;  2JRZ A;  4PZO A;  5IO9 A;  2JEJ A;  3PR4 A;  4LNK A;  4JK1 A;  5KFY A;  5L1J A;  3CF6 E;  1X6I A;  4B9L A;  5KFW A;  4M8N A;  4LNF A;  1L7M A;  1L3T A;  1ZQS A;  2IZV B;  4EBE A;  2JGA A;  3BS7 A;  5J2G A;  2XNA C;  5BOL A;  1RRB A;  4M9J A;  5J2A A;  3RB0 A;  4GDK B;  3K9O B;  4UBB A;  4KX3 A;  1A76 A;  1S0V A;  4EX7 A;  1YT3 A;  2VIX A;  2BQR A;  1D9F A;  2JEG A;  2DAJ A;  2RDB C;  2FI1 A;  3F2D A;  2KZM A;  4HKQ A;  3ZNG C;  8ICV A;  5BPC A;  5DLG A;  9ICA A;  2WXK A;  2BKF A;  3BII D;  3N1Z C;  3G6X A;  3TAN A;  1OTR B;  4ANV A;  3AEA B;  2QB0 B;  1HQR D;  2WGS A;  4JL9 A;  3IDW A;  3SZ2 A;  3PO5 A;  4W9C A;  4NJ8 A;  3A1Q A;  1IBX A;  2H88 B;  2BYF A;  4WAA A;  3JPR A;  2PW9 A;  1ZQF A;  3N9Y C;  2PKO A;  1I4R A;  2BB6 A;  2RDG A;  3NZ3 A;  4RPZ A;  1ZGU B;  2CPR A;  3RB3 A;  5KFD A;  2W9B B;  8ICH A;  1L6N A;  1J7A A;  2L76 A;  1QSS A;  3MJ5 A;  4MFC A;  3IRU A;  4UW9 A;  4HXD A;  4TQS A;  2P6U A;  3DEE A;  1XWL A;  2XGP A;  4ECT A;  4AQ7 A;  2NRW A;  2AQ4 A;  2WXL A;  2FLP A;  4HJG E;  3GII A;  3C8Y A;  3PZ8 A;  1ZPS A;  3MR2 A;  2G5I B;  3R9K A;  2LMR A;  2EAM A;  1WX8 A;  2KLG A;  2DHZ A;  2VAN A;  2MBQ A;  2ZEQ A;  4RUC A;  2FUG 1;  3TAQ A;  3MFI A;  3W5U B;  2PFQ A;  3T5K A;  3K1Z A;  2Z0E B;  4IC7 B;  3QUC A;  1D4B A;  1V49 A;  1ZQY A;  4DL2 A;  3ZGZ A;  2DAF A;  1WGY A;  3BYT B;  4EOY A;  1E0Z A;  3S6J A;  5C3J B;  4Y2Q A;  2KN5 A;  3RH4 A;  1JX4 A;  3V62 A;  3W5V B;  5BYR A;  2BF8 B;  2CN1 A;  2J53 A;  1OGW A;  1EUV B;  2IYD B;  3RN9 C;  4C8O A;  1NK7 A;  1Q3U A;  4YR2 A;  1JMS A;  3H7P B;  4G9B A;  2KOX A;  3LYY A;  3RNC C;  2WS3 B;  2Z8L A;  4DDG D;  4GXJ A;  4KSK C;  5J2R A;  1QF6 A;  2GBJ A;  3Q8B A;  1ZQL A;  1KL9 A;  4Z6F A;  2ISO A;  4OVZ A;  3URY A;  4J9S A;  3JSV A;  8ICP A;  4MGZ E;  1XO1 A;  4P16 A;  7ICF A;  4ECU A;  2XID A;  2K4E A;  1JWS D;  4OJL A;  4DL7 A;  4K7U A;  1E6E B;  2PVG C;  1QQ7 A;  5KT7 A;  3RH5 A;  4EEN A;  1JRO A;  1K50 A;  2VZK B;  3BS5 B;  4I2D A;  3KBB A;  5J0Q A;  2IO1 B;  1FMA D;  4OHJ A;  3E9S A;  2D3C A;  2QDF A;  2IND C;  4P4M A;  1T94 A;  3IHP C;  2V3N A;  2GBR A;  5DQG A;  3CWI A;  4C4S A;  3FDS A;  2D07 B;  2IGD A;  4U6P A;  5J2H A;  1JI7 A;  2V3P A;  4TMA B;  1TS2 A;  3CMM B;  3DBR I;  1FXT B;  1PYW D;  2D2Q A;  4LK0 M;  3U4E G;  1NEK B;  5AM0 A;  2Y3A A;  3B0A A;  4DDI D;  4TQ0 A;  1HA5 A;  4II2 B;  4B9U A;  4IWO A;  3BQ2 A;  3GE8 C;  1B9R A;  7ICM A;  2GBK A;  2DPJ A;  5IN7 A;  1ZOY B;  3IT6 B;  3BZK A;  3KUC B;  5TIS U;  4UQG A;  2D3D A;  5AIA A;  1PVR A;  3VRA B;  4DHJ B;  5D7G A;  3PW7 A;  2KTR A;  3H6N A;  1WZ0 A;  2WXI A;  1DK2 A;  2BYE A;  2KN7 A;  1FEZ A;  4P0P A;  1MFW A;  4Y2P A;  5CHG A;  4I27 A;  3H8H A;  4TQ1 A;  4BZA A;  4YSX B;  1R4M I;  2A4Z A;  1F0M A;  2NO5 A;  1LQB A;  3V05 A;  4KGT A;  1Z2M A;  1U48 A;  1BGX T;  3QUQ A;  4IR1 A;  4KZ0 A;  4E3C A;  2M8S A;  3Q8C A;  3PO4 A;  2QC8 A;  1KN5 A;  2BPC A;  1DOY A;  4FBJ B;  3TEZ A;  3QUT A;  1WM3 A;  5EE0 A;  4ED6 A;  3RJE A;  2M17 A;  3WKE A;  1B4F A;  3HWT A;  4HRS A;  4J3O D;  3VRB B;  4UB1 A;  3TUO A;  2FMQ A;  2IPK D;  2R8I A;  4A3O A;  3Q6B A;  3Q8S B;  1CRX A;  2Z0D B;  3TI0 A;  1XLN A;  1Q46 A;  2G0A A;  3IVF A;  3R2I A;  2KIV A;  4YG2 A;  2N9E B;  3TEW A;  4C7Z A;  3ALR A;  1SIJ A;  2WX1 A;  3HHM A;  4NJ6 A;  2IOH A;  4FLH A;  1PK1 B;  3W1S C;  2J4X A;  4I2C A;  5EOZ A;  3GU3 A;  5FKA C;  2WXR A;  2EQY A;  3QEB Z;  3VTW A;  3A1Q B;  2INC C;  3L13 A;  1JWB D;  1TAQ A;  4ICV A;  4KIK A;  3RMK C;  2BPF A;  1KRP A;  4KMO B;  2CHX A;  2W9M A;  1V85 A;  4DHZ E;  2CXY A;  2E8N A;  4NLC A;  3UM9 A;  1V1P B;  4Y2J A;  3Q3N C;  4XE0 A;  3SAH A;  1B0X A;  4R65 A;  5DPS A;  2G5H B;  1SEB D;  4MM3 B;  1ZQE A;  5D46 A;  3OG5 A;  5KG7 A;  2BHN A;  2C28 A;  3AE3 B;  4JWN A;  4DSE A;  1NOM A;  2ZJ5 A;  4ED7 A;  2M4N A;  1D8L A;  4QNL A;  4DBG A;  1ROE A;  1QOG A;  1Z1B A;  3Q2A C;  2WLB A;  3N30 A;  5D3I B;  2KMD A;  3LDA A;  5KFT A;  4ELU A;  2MWS B;  3KYC D;  2I1Q A;  3B9J A;  3L54 A;  3DBH B;  3JVZ X;  2FUH B;  3X0W A;  3KKA A;  3BDP A;  3AE6 B;  1C3T A;  4WJ3 B;  4JMU A;  4YVZ A;  2ESE A;  1GC6 A;  2V4R A;  1I7H A;  2AL3 A;  3IM1 A;  5ALE A;  2BCQ A;  4JE3 B;  1QH9 A;  3JPN A;  1XQQ A;  2P66 A;  1RDF A;  2CU1 A;  4O5K A;  3TAP A;  1XLP A;  2QJL A;  2VRR B;  3OJ4 B;  1TZO A;  4C80 A;  4WWO A;  2FBW B;  4F93 B;  3ONS A;  1S10 A;  1RPL A;  2IO0 B;  1KDH A;  3P4S B;  2OCE A;  5AIB A;  7ICV A;  2GB1 A;  2LMC A;  4DL3 A;  2PLP A;  1MI0 A;  4NNJ B;  1TT5 B;  1B22 A;  4KLM A;  5KFC A;  4YP3 A;  1L3V A;  4YMN A;  4DOC A;  1I4Q A;  4BDP A;  1TS3 A;  1WYW B;  3I57 A;  2WF8 A;  4O3Q A;  3ETR A;  4Q44 A;  1N5W A;  2IGH A;  4QWC A;  2NS5 A;  1TY2 A;  2GOL A;  2KFK B;  1QQ6 A;  1SZH A;  2KIW A;  3QU2 A;  4BBN C;  2OJR A;  2BR0 A;  2DZJ A;  5B66 U;  1URJ A;  3QHT A;  3RYT A;  4PK1 A;  3L16 A;  1ET9 A;  1P9D U;  4PHP A;  3M3J A;  4UAU A;  1QOB A;  3BQT A;  4UAW A;  2L0F A;  5IKC M;  1Q0W B;  3PRZ A;  2BZF A;  4MEL A;  4UB6 U;  9ICF A;  3AH7 A;  9ICS A;  1GJZ A;  4Z6D A;  2KLC A;  3N7P D;  3EUB 2;  5DQH A;  1XD3 B;  2WFA A;  5DBA A;  2I5H A;  4RNM A;  1V81 A;  3CST A;  5KFL A;  4KLU A;  1BNO A;  1LGR A;  3T3O A;  4QZ9 A;  1UT8 A;  2NYV A;  1JWU D;  2RDH A;  1J7C A;  5AZG A;  1M4V A;  4FHJ A;  1D3Z A;  3S2A A;  1MPE A;  5EE3 A;  7ICN A;  3BVG A;  4DLG A;  1LVH A;  3RJF A;  4QIW F;  2ZCC A;  8ICC A;  2MW5 A;  1YZ7 A;  1RFA A;  5AZF A;  2IY1 B;  4M9N A;  1XO3 A;  5IIM A;  2M0A A;  4YFK A;  2G4D B;  1PVQ A;  1X42 A;  2ZUD A;  5D2M B;  2DKX A;  1F44 A;  2P6R A;  4U7C A;  1SB3 C;  4F50 A;  3I3T B;  3IXS A;  4ZRK A;  4UBC A;  3H0L B;  3H8W A;  3RH6 A;  3DWG C;  3WAO A;  4WAF A;  2DGZ A;  2OXO A;  4J9M A;  5C2T B;  3TAC B;  1QOA A;  1PGX A;  1WXM A;  4LNN A;  8ICT A;  2KK8 A;  2K60 A;  4B9N A;  1UPH A;  3PW0 A;  1N61 A;  5ALR A;  1L0Y B;  1EF1 A;  1SE4 A;  4BWM A;  2N9K A;  8ICB A;  4PGX A;  3IT4 B;  1KSP A;  1DOX A;  2K8A A;  2BVC A;  4NLG A;  2EEL A;  2M0X A;  1T0Q C;  3RR7 A;  5KT2 A;  1WY8 A;  3NS8 A;  4URK A;  1NK4 A;  2O6K A;  1ZQJ A;  4QJF B;  3M1Y A;  2KWC A;  2W03 A;  2EH9 A;  1RAX A;  1WH3 A;  5ALO A;  4HPM B;  3RNB C;  1YNT E;  2WXH A;  3ZQ4 A;  1WCL A;  1T6B X;  2R8G A;  3HP6 A;  5DGB A;  5AKY A;  3JPQ A;  4BFR A;  2WF9 A;  4HCN B;  5KNI A;  5L1L A;  2KFJ A;  1NDD A;  3AMZ A;  1JIH A;  4KMU A;  2LM4 A;  4QZ8 A;  1PGB A;  1KLU D;  1Z00 B;  3GFK B;  2N9X A;  2KDM A;  1HZ5 A;  3WK9 A;  2KAC A;  4GXB A;  5DG8 A;  1ZRN A;  5A0L A;  3Q3J A;  2DX5 B;  4ZRJ A;  3A0B U;  3WK5 A;  4R64 A;  1TS5 A;  2L32 A;  3U8Z A;  1VDV A;  2IDY A;  4YSY B;  1O08 A;  3U7Z A;  1YN3 A;  1UUP A;  4RFB A;  3UIP B;  1FD6 A;  2HCF A;  4EEL A;  1WF9 A;  4DOB A;  2HE7 A;  3RTV A;  3Q8E A;  4N6E B;  2W11 A;  3RJK A;  2W7O A;  5KHO A;  4MJS A;  5AI9 A;  9ICV A;  1S5L U;  2BGW A;  4F5O A;  4IQT A;  3RJG A;  3WCQ A;  2F1I A;  2QHO A;  4C8K A;  2ZVO A;  2V1Y A;  5FK9 C;  2W9B A;  3PHW B;  2V9W A;  2WAQ C;  3PGE A;  4F5N A;  2XGQ A;  1FRR A;  2M9N A;  4M6W B;  1UBI A;  2K8B B;  1GPX A;  1DXS A;  3AE9 B;  5LXI B;  9ICE A;  2K8B A;  1WJN A;  4KDI C;  5KFO A;  3RNG C;  3TEX A;  4TUU A;  5ALM A;  2XVT A;  4BXO A;  4A90 A;  1A5R A;  5LLI A;  3ENE A;  1ZD5 A;  2DZI A;  2HBK A;  3V3X A;  5T14 A;  4Q8F A;  4F3O A;  1JXL A;  4DFM A;  3SFD B;  4LNO A;  2QKQ A;  2ZTE A;  3PY8 A;  4YXM A;  4MGY E;  4OVU A;  1N5X A;  2H3F A;  1SF0 A;  1MJD A;  1L0X B;  3KUD B;  3P63 A;  2EZZ A;  1LO5 D;  1Y88 A;  5AKI A;  3SQI A;  2P35 A;  2EMS A;  4IDI A;  2WF7 A;  4FZM A;  5J0P A;  1WM2 A;  2MH7 A;  2ASQ A;  2HTM E;  4ELV A;  9ICP A;  4HPL B;  3N28 A;  2WB1 F;  1JW9 D;  3Q8L A;  4WWM A;  3VXW A;  1RYU A;  2PFP A;  4F5Q A;  1VRA B;  3PZP A;  1IPG A;  1U4A A;  4KVG B;  4NAW B;  2N0S B;  3P2B A;  3JPO A;  1WFY A;  1WSP A;  3AV8 A;  3WA0 A;  5CTR C;  3ZTC A;  1F52 A;  4DWF A;  4B6J A;  8ICY A;  2JRI B;  3PTF C;  3ZDB A;  2ICI A;  1KQQ A;  2WNM A;  5AUK A;  5KFG A;  3DDH A;  2Q4T A;  2PPH A;  1FCC C;  5B5E U;  2BCR A;  1LM8 B;  2LHD A;  1ZQV A;  4OJO A;  3K9P B;  1IGC A;  4BOZ B;  3RJJ A;  2QIE B;  5L9X A;  2J6U A;  1MG8 A;  2Y9T A;  3UXP A;  3C2K A;  3AQF A;  5AKG A;  1T4G A;  2PMV A;  5AKE A;  2JT4 B;  2R18 A;  3A4R A;  2MSN A;  5CJ7 A;  4P4P A;  3N32 A;  3TKA A;  1MVK A;  3JYU A;  4HAI A;  4XDC A;  5I4D A;  2HHW A;  2AGP A;  3ICX A;  2M1M A;  4L2Y A;  3WAM A;  4EFO A;  2KKP A;  3T8M A;  5IIO A;  3UPQ A;  3EWA A;  3N7R C;  5CA7 A;  4J9R A;  5HP4 A;  3AEC B;  5EDS A;  3SAF A;  3F53 A;  5AIC A;  3T5J A;  2VZK D;  3VFK A;  2KSO B;  4BWJ A;  5KAF U;  4YTN B;  1QSY A;  5F3X B;  1RQL A;  3U30 A;  4N58 A;  4MGK E;  2KMC A;  3GZF A;  5BMG A;  3BVM A;  4AYB C;  1WRD B;  4ZRP A;  4EYI B;  2HBJ A;  3IP4 B;  5DBC A;  2D10 A;  2FPL A;  2NVU I;  4PL2 A;  3PVX A;  2FMP A;  2ZXH A;  1ZQD A;  2K25 A;  1VZ8 A;  1WUD A;  2LGI A;  3SD7 A;  2PVO D;  4RPY A;  4KGS A;  4M01 A;  5F9N A;  4QZF A;  1SWV A;  1X6J A;  3DHH C;  3M9O B;  1V80 A;  4F8C B;  4RM8 A;  1KFD A;  1YOV B;  2VH1 A;  2X8X X;  4P2H A;  5KG6 A;  5KL8 B;  4J9P A;  5DGA A;  1SV0 A;  5DCN A;  4JIO U;  1ZE3 D;  3ZDA A;  2LRU A;  3GIM A;  3PHX B;  5JU5 A;  1ACC A;  3EPG A;  3KFU F;  4HK2 A;  1ZJN A;  4QW8 A;  2IJ0 A;  3HUI A;  8ICW A;  1ZQP A;  1C4A A;  1Z19 A;  1T7P A;  2EZX A;  1I4H A;  2KKC A;  1V1O A;  4NAM A;  4DF4 A;  2KP7 A;  4EKU A;  2JZP A;  4LJP B;  4US8 A;  1KLG D;  5J0W A;  4NY8 A;  3VAW A;  4XC2 A;  5KFB A;  4JB3 A;  1WJU A;  4AP4 C;  2KJ6 A;  3A9J B;  3VUX A;  2ZTD A;  1QLN A;  4FAD A;  3ISB A;  3EYZ A;  1DYQ A;  4GIV A;  1TFR A;  4O3P A;  1C76 A;  5GMV A;  2AXT U;  4ASW C;  5J0S A;  3KQ4 A;  5FR6 A;  7ICK A;  2HVH A;  5D3D A;  1NJX A;  4AUQ C;  1QQ5 A;  1YQ4 B;  2XCA A;  2F8L A;  1F2R I;  2KJR A;  2NMQ A;  2KAN A;  4HRO A;  2AWT A;  4KLO A;  5IP4 D;  1WJ4 A;  1C79 A;  2Y0S C;  3B1L X;  4ED8 A;  4I6L B;  1IGD A;  2WF5 A;  1DGS A;  5J2E A;  3AQE A;  5IIJ A;  2FLN A;  4Y2X A;  2PE6 B;  4C0Z A;  1P98 A;  4MM3 A;  3NRW A;  4C56 C;  3UQ2 A;  4UB3 A;  3NGD A;  4YXD B;  2IO3 B;  4F92 B;  2INP E;  4W9H A;  3NG0 A;  5KFR A;  3QYP A;  3JPT A;  1X66 A;  3A9K B;  2MP2 B;  3TL5 A;  1MQ3 A;  1N6Z A;  2WXM A;  1HXY D;  3HM3 A;  3ZJT A;  2ASL A;  2AEH A;  3THV A;  3BQ7 A;  4M8M A;  1JWM D;  1HE8 A;  3VH3 B;  2LGY A;  2E8O A;  1IP9 A;  2ALZ A;  1BXT A;  3IAS 1;  3G6Y A;  2LKY A;  3N4M B;  4M0A A;  1ZDV A;  5ALI A;  3L08 A;  1YZ6 A;  4AYB F;  4GLS C;  4I2B A;  1MSW D;  5HI1 A;  2RDI A;  9ICM A;  1KF6 B;  3RNF C;  2ZTC A;  2YMP A;  3T79 A;  4Q43 A;  1S1Q B;  5CHV C;  5KT6 A;  1BPX A;  3T3F A;  2DZM A;  1Q10 A;  4CCH A;  3I63 C;  2YML A;  5HHI A;  3PV8 A;  1QKZ A;  1OUQ A;  2LAS A;  2MRL A;  5AI0 A;  9ICW A;  1V97 A;  4OJ5 A;  1F9J A;  2IMW P;  3IAM 1;  1UH6 A;  3MFG A;  2BKR B;  5AI6 A;  9ICK A;  4KN7 A;  3E2E A;  2FIF A;  3C5F A;  3OJS A;  5D49 A;  3Q3F A;  3DDC B;  3RD2 A;  2FE8 A;  1BPE A;  2XCP A;  3V6K A;  2JEI A;  1SE3 A;  1PGA A;  1YJI A;  4YXJ A;  2G3Q B;  1OW5 A;  2FPM A;  2JF5 A;  1P7F A;  3AUO A;  3IG8 A;  3C2L A;  2N9P C;  2ZJ8 A;  8ICM A;  1ZXH A;  4K4I A;  2JRH A;  2PEA A;  4P1B C;  2FDR A;  3FM9 A;  1LV5 A;  4XDD A;  2EMT A;  3N20 C;  1L3S A;  2AJQ A;  8ICZ A;  8ICI A;  2K8C A;  4DS4 A;  3PX0 A;  4Q8E A;  2WXP A;  4UAV A;  4QWE A;  4HPP A;  4ZOH C;  1ZQ1 C;  4W9E A;  4KX6 B;  3AE5 B;  2VJ5 A;  2ISP A;  4DHJ D;  4RGN A;  1K51 A;  4YR0 A;  1G6J A;  4DQI A;  4OO1 J;  4WJP A;  4PHA A;  4Y2Y A;  3HJE A;  3WKD A;  4TUS A;  2G4S A;  1Q1O A;  1R4N I;  1ZOL A;  3JPS A;  1KFT A;  1S3S G;  1KEJ A;  1J2N A;  3M7D A;  5AKL A;  1KJT A;  2RMM A;  2YB1 A;  2F77 X;  1HJP A;  4RQ0 A;  1SXD A;  4FUL A;  1WWV A;  4KLG A;  2EKE C;  4K3C A;  4O0I A;  2V4I B;  4FS1 A;  4XYC A;  2ZIW A;  4RF1 A;  4B9T A;  9ICJ A;  1SIF A;  2ZIW B;  3BZC A;  2W54 A;  2CRX A;  2AH5 A;  3IV6 A;  4DCC A;  2CJO A;  3NUQ A;  4Z6E A;  2MBO A;  4F4X A;  2R2O A;  1U4B A;  4A55 A;  5JHB A;  7ICR A;  2RR9 A;  4LDT D;  3H0M B;  3SEB A;  1L0V B;  2KX3 A;  4DSF A;  3Q8P B;  2MCN B;  5BYQ A;  3M6Z A;  4RPX A;  2GO7 A;  2KK0 A;  4R66 A;  1NEN B;  2G1E A;  2YY6 A;  2E5S A;  1SL1 A;  5AM5 A;  3JPP A;  4YN4 A;  5AZH A;  3PSE B;  4PHE A;  3V7L A;  2HDO A;  4J9L A;  8ICR A;  1STE A;  3QWZ B;  4W9G A;  3WIM A;  3C19 A;  5L1M A;  4G0N B;  5HMM A;  2N9L A;  4JPS A;  3QX1 A;  2KHW B;  4N9F 4;  3AE7 B;  4BAX A;  5KFX A;  2MJ3 A;  1IV8 A;  1HUO A;  3N1Y C;  5L1I A;  1L2N A;  2D5G A;  2H3V A;  3A9J A;  2IHN A;  2WB1 C;  1DGJ A;  4FA6 A;  3EW9 A;  2I1J A;  4M47 A;  3RI7 C;  5KFN A;  4HDO A;  1T0S C;  3BK2 A;  1Q8K A;  2WQY B;  8ICL A;  4LDT B;  2O6V A;  3HW8 A;  2RPQ A;  2AYO B;  3RB4 A;  2B0C A;  4K81 A;  2M56 B;  4F4Y A;  4FS2 A;  5FP0 A;  4FZN A;  1XXG A;  3Q8K A;  2NBU A;  2K22 A;  2E1F A;  4S0R A;  2FID A;  5KFA A;  1FRD A;  4DOA A;  1T3N A;  4B0M A;  3KLS X;  2OH2 A;  1EU3 A;  3CSF A;  3TFS A;  4CF3 A;  7ICS A;  1EM7 A;  1JML A;  1AWD A;  5J2I A;  2W7P A;  1YIW A;  2UVR A;  5J8Y A;  1ZD3 A;  2H3I A;  4F4W A;  3ZUN A;  3IG5 A;  4R63 A;  1ZQC A;  1KTK A;  3U7D A;  3ZO5 B;  5HKH A;  4TV3 A;  2JYT A;  2LXA A;  3CIR B;  4IRK A;  4HKZ E;  2IOF A;  1LXD A;  3IG3 A;  2ZIV B;  1WJ6 A;  2RP5 A;  4NL9 C;  1XNS A;  3PSI A;  2MQJ A;  1KOT A;  2SAK A;  3H4B A;  3V6J A;  5ALU A;  1U47 A;  4IL6 U;  3JW0 X;  3H8M A;  4N59 A;  4HYK A;  4E0D A;  3PLU A;  2J0M A;  1V38 A;  3VCB A;  1UNS A;  4MEX A;  1WI0 A;  4KKJ A;  4GDL A;  2LI5 A;  2LPE A;  4AS1 A;  2LJI A;  2JUO A;  4LJX A;  1DRG A;  2FCN A;  3EGR A;  5KFE A;  4W9L A;  4CF4 A;  2KFN A;  1AQ6 A;  5KG5 A;  2ONQ A;  3DVN U;  2BWF A;  3AE2 B;  2G07 A;  4CNQ A;  3HM6 X;  1IIP A;  7ICG A;  1EWY C;  2JX5 A;  3SR6 A;  4QWD A;  1S76 D;  3DCG A;  3TEY A;  4NJC A;  1N63 A;  2FPK A;  1S0M A;  4XX5 A;  4DL4 A;  5IIK A;  4MH8 A;  2OHF A;  4QAY A;  4MGI E;  4W9I A;  2KQ4 X;  1BUI C;  2B6G A;  1C4C A;  2JQR B;  3RBD A;  2ZZP B;  5EE1 A;  5CEH A;  3R3M A;  4CF5 A;  3ISD A;  3SI8 A;  1MG4 A;  4KX5 A;  2F1J A;  4YMO A;  4ZRI A;  1RM6 C;  2G06 A;  4UAR A;  2ASJ A;  3U26 A;  8ICA A;  1WIA A;  5ALP A;  3E58 A;  2DL0 A;  5JRT A;  2QCZ A;  4HLE A;  3HK0 A;  3J9C A;  3AB5 A;  3DBS A;  3MAB A;  1EO6 A;  5ALT A;  1A6S A;  4IWP A;  3AU4 A;  3EFC A;  3V7K A;  2W55 A;  1LKY A;  3AI5 A;  3R7Q A;  2G45 B;  1ZQA A;  4I2G A;  3HVZ A;  4ZHO A;  2A1A A;  2MEK A;  1BML C;  1KTQ A;  1D6E C;  5LXH A;  4MHV A;  4KLT A;  2JWU A;  4EX6 A;  2LM1 A;  2W43 A;  3F5E A;  2YMQ A;  1JUD A;  1COK A;  2R8K A;  4EEK A;  3N7S C;  4FBT A;  3WKC A;  9ICX A;  3V6H A;  3A0H U;  4FN2 A;  2YX8 A;  4I29 A;  1JRU A;  2KSO A;  3OHB A;  2GWS A;  2F1H A;  4H2A A;  1L6U A;  3ZNI D;  1SXE A;  2FE9 A;  3I28 A;  1TBE A;  2JY6 A;  2NRX A;  2OYY A;  1I4X A;  2NBW B;  4NLZ A;  2BT6 A;  1IYF A;  4PPX A;  2XBB C;  4NXZ A;  4PGQ A;  2N1V A;  3CYM A;  2N4F A;  2REX A;  3D2N A;  4IC9 A;  1ESF A;  2J6T A;  1J2M A;  2JXJ A;  2JSV X;  1XSL A;  2PI4 A;  2KTR B;  2INN E;  3KH0 A;  1ZQI A;  3H40 A;  2YLM A;  3ZDT A;  3VUY A;  9ICU A;  2F2A B;  5HNK A;  4M00 A;  2Y5P A;  3M8S A;  3ZD9 A;  2JZ3 B;  3KW5 B;  1FXI A;  1H38 A;  4P0P B;  1TKY A;  3WK8 A;  4NM2 A;  2W9C B;  2EAN A;  2HHQ A;  1T5X D;  1TKE A;  1UGJ A;  2OOB B;  2Q5W D;  3R2T A;  3RJH A;  5ALL A;  2RDJ A;  3NY5 A;  1E7U A;  4X57 B;  3W9C B;  4F4Z A;  3HT3 A;  2AU0 A;  3Q8Q B;  2NRZ A;  2IY0 B;  4JUZ A;  2QEJ C;  4ED0 A;  2WXQ A;  3LVW A;  3UIN B;  5KFF A;  2E6X A;  2K5P A;  2K0P A;  2KFK A;  2L3Z A;  4RQ8 A;  2LHE A;  1L7N A;  1PUZ A;  2KJ8 A;  3D2Q A;  1OXJ A;  3MFH A;  5L1K A;  1ZKH A;  5KHQ A;  7ICO A;  4EYH B;  4DO9 A;  5DPW A;  4ED1 A;  3Q8M A;  2O6V B;  3Q3O C;  2CJN A;  2YEP B;  3KOO A;  4PS3 A;  2KIC A;  2ZIU A;  4P0Q B;  3ZNZ B;  2RQ5 A;  1UBQ A;  3M95 A;  4CO7 A;  1QTM A;  1R4N B;  1TS4 A;  4KLF A;  3C23 A;  4LLG M;  5CP2 A;  4I2I A;  5C1Z A;  2G9H D;  1PFD A;  3BK1 A;  4B95 A;  4P1C C;  3ETL A;  2Y1J A;  7ICE A;  5ALK A;  2L7R A;  3FIL A;  3ML9 A;  5C23 A;  4WUR A;  5TSS A;  5J2J A;  4IG7 B;  3D32 A;  1YN4 A;  3ED5 A;  2KWD A;  4RQ5 A;  4GDK A;  1AYF A;  1GG3 A;  4G11 A;  1WYG A;  3W1Y A;  4CQN A;  2E8P A;  3SDL C;  4IM2 A;  4ZYN A;  4WWP A;  4PJ0 U;  4KLL A;  2XN9 C;  3BWU D;  5ALV A;  5GTI U;  2V0G A;  2BQQ A;  3CP8 A;  2WDQ B;  5L95 C;  3HKZ F;  5KFH A;  2A1J A;  3DPD A;  4DL6 A;  2R2Q A;  2WU5 B;  4WWN A;  2AX5 A;  4DK5 A;  3V72 A;  1UHU A;  3ZDD A;  1WGR A;  4QZC A;  3RUL A;  3M8R A;  2WXO A;  1E8X A;  4CYE A;  4M9H A;  3TSS A;  2GLE A;  3UMB A;  1D5X C;  3EHV A;  5AM3 A;  1U45 A;  3MJW A;  1YMH E;  5AM2 A;  2BB5 A;  4G50 A;  4LCD E;  4RF0 A;  4KLE A;  2W9A A;  1D9D A;  3PPA A;  1BPY A;  3C2M A;  2D3A A;  3NOB A;  3RCZ A;  2LYA A;  1Z4N A;  4EZL A;  4J03 A;  3DVG X;  2ZNV C;  3N1X C;  4EE2 A;  4MEY A;  2D11 A;  4K7S A;  3W2D A;  4GDL B;  1E7P B;  3VH4 B;  3DQV A;  3ZRF A;  3WAL A;  1WXQ A;  3EA6 A;  3WAN A;  4BXO B;  3QCA A;  2CU3 A;  4GN1 A;  2WXF A;  3U2S C;  2YVC A;  4ZDV A;  1RWS A;  2JV3 A;  4QZE A;  1RXV A;  3MC9 A;  4B9K A;  2WDR B;  1RXW A;  4NLK A;  4MDK E;  2KO3 A;  1V6E A;  3IFW B;  3OTQ A;  3ONN A;  4YMM A;  3ZTD A;  2LEK A;  1DOQ A;  3QZ7 A;  5MPO A;  3NVW A;  4YWG G;  1T0R C;  1VJ5 A;  2JXT A;  3L4P A;  4OZA A;  5J0T A;  2KKV A;  3MP9 A;  5J2D A;  2NR2 A;  1UWM A;  3K1R B;  3F5A A;  1LKY B;  2NTS A;  3RJI A;  8ICO A;  3GIL A;  1ENF A;  2JZB A;  1KLN A;  4NLB A;  3AE8 B;  2LVQ A;  4IM0 A;  2C9W B;  4KKI A;  4PS8 A;  3O65 B;  2NBV B;  4OCZ A;  2L8J A;  3NAS A;  2ZW0 A;  4B0E A;  2E3T A;  5CWR A;  4MF8 A;  3VVW B;  3W1S A;  3SEI A;  3LK9 A;  2BPG A;  1LFD A;  2C7N B;  4OW0 A;  2MBH A;  2O2V A;  3LDZ E;  3I76 A;  4FFD A;  5EWF A;  3OSP A;  2KMA A;  1U49 A;  1ZQU A;  2WHE A;  5AHX A;  2F3N A;  5AKJ A;  2KD1 A;  2R8J A;  2KZZ A;  2E8M A;  5HML A;  2HOQ A;  5KG3 A;  2GOW A;  3LWM A;  1NKE A;  4DSK A;  3H4D A;  4RZR A;  1YQ3 B;  1SV4 A;  8ICN A;  1XLO A;  2BYT A;  5AKH A;  1FFU A;  2J6S A;  3KWL A;  2KG5 A;  1X9X A;  3V6C B;  2C5L C;  2LZ6 A;  3T3N A;  3SU8 X;  5CR0 A;  5J0Y A;  3KHR A;  4ZYS A;  4GMV A;  9ICO A;  1WZ3 A;  1FXA A;  1F5S A;  3DBL I;  2DYB A;  2VKQ A;  1XEE A;  2KVR A;  5J17 A;  3B2F A;  2MU2 A;  4MF2 A;  1KBU A;  2PMZ F;  1N62 A;  1Y8R C;  2LVP A;  3WKA A;  4KLS A;  3QAR A;  4FJY A;  1VD2 A;  4NQL B;  5KT5 A;  1WXV A;  1ZW7 A;  2IA6 A;  3AED B;  4B9S A;  1OQQ A;  1MN8 A;  3PW4 A;  1H4R A;  1KRH A;  1WWT A;  4QZI A;  4QWB A;  4DQO C;  1SGG A;  4ICA A;  3TJP A;  3TAD A;  3PLV A;  3AU2 A;  3GQC A;  4GIB A;  4UAY A;  4C4V A;  1X40 A;  2QAR A;  4IWQ A;  2D8C A;  3MDC A;  2KYW A;  2K4P A;  4ACF A;  3C28 A;  4KSL C;  1ZQH A;  4YL8 A;  2X38 A;  1VR9 A;  3ZKJ C;  5E6O A;  2NPT B;  3MHS D;  2JWZ A;  4MEM A;  4BKG A;  9ICL A;  3KUZ A;  5KG0 A;  2ZW1 A;  2W3R A;  2KHQ A;  4IRC A;  4ECY A;  3NRZ A;  3PRP B;  5H8Y E;  3VUW A;  5ALJ A;  4I2H A;  2KNB A;  1F77 A;  4XQ8 A;  2BGF A;  3KD3 A;  4IKG A;  1BPB A;  3AE4 B;  2BYV E;  4DQR A;  3LB8 C;  3VR9 B;  1P3Q U;  5LNK 1;  4LTU A;  1ZQG A;  5KTQ A;  1QZE A;  1MA7 A;  3H7S A;  2TSS A;  4RGT A;  4ANW A;  5DDM A;  2ZJD A;  4KV2 A;  4F7Z A;  4KDL B;  4J9K A;  3UF8 A;  1QSL A;  3ZW3 A;  3BS5 A;  1FFV A;  4JWM A;  1SBB B;  3QAQ A;  2GRI A;  4ANU A;  2K6D B;  4IS7 A;  1XS9 D;  2OM6 A;  4NY0 A;  2MLB A;  1BVS A;  3NUH B;  1QCK A;  3FIL B;  1HEK A;  4JWU C;  2FMS A;  4DFD A;  2I9G A;  3OHA A;  5H92 C;  5IAA C;  2ON8 A;  3T9L A;  3ECI A;  1BPD A;  1S77 D;  1NJY A;  2KT7 A;  2YB4 A;  3N97 B;  3EEC A;  1C20 A;  1OQY A;  2A1J B;  4O3R A;  2BS3 B;  4PYZ A;  5BO4 B;  4CHK A;  2V4Q A;  1PK1 A;  3MC1 A;  1A77 A;  3UI3 A;  3B2G A;  3Q8F A;  2HTH A;  3C21 A;  1SJE D;  1KLV A;  3MR5 A;  3HPO A;  2QIL A;  2BTE A;  5D94 A;  4EBC A;  3DHG C;  2QB0 A;  5ALZ A;  2ZIV A;  2WXG A;  1WCN A;  1Y56 A;  2WXN A;  3R7R A;  5AI8 A;  4O3O A;  5DPT A;  1GAQ B;  3GB1 A;  1IG6 A;  1NBF C;  5G5G A;  1NKB A;  4I28 A;  4FHK A;  2F76 X;  5AK4 A;  7ICJ A;  4RQ4 A;  2EAO A;  5H2F U;  4BJQ A;  1WGG A;  4RCO A;  4M6W A;  4GXI A;  5HR7 A;  4G3I A;  4OZB A;  3LWL A;  5J8Y C;  3P4P B;  3AUL A;  3A9K A;  1RFK A;  2YMM A;  4RMA A;  1NK9 A;  1D5Z C;  1RZT A;  4TUQ A;  3APC A;  4QWA A;  3M6K A;  4NQK E;  1D8B A;  9ICI A;  1Z3E B;  3UXN A;  2WX0 A;  1L7P A;  1L5U A;  1SKR A;  3RFZ B;  4DQS A;  1YN5 A;  4WIP A;  4R8U B;  5IA7 A;  2HHT A;  1AW7 A;  3DOW A;  3LVV A;  1BT0 A;  1TJE A;  3UQA A;  2CR5 A;  3F2C A;  3UXO A;  3ZJU A;  3QEA Z;  5DG9 A;  3ML8 A;  4J6I A;  2WTF A;  2KHV A;  5HHH A;  3EFU A;  2BW2 A;  3AXC A;  3PSF A;  4ZRQ A;  2MHJ A;  1K1S A;  3MGH A;  1HZ6 A;  2EDU A;  2C2E A;  2ASD A;  4K4G A;  2RGF A;  1KW4 A;  3IN5 A;  3PX6 A;  1ARO P;  2L0T A;  1X2I A;  3GIK A;  1EWC A;  4DWI A;  3DBL B;  4PS7 A;  3ZLZ A;  5EWE A;  2O2V B;  1CUK A;  4ITK A;  1C1Y B;  4W9J A;  1OEY A;  1QLB B;  8ICJ A;  1XSP A;  1IBX B;  3NTU A;  2GBM A;  3C1Z A;  2I6X A;  1F2R C;  4RQN A;  3GIJ A;  1ZDX A;  4DFP A;  5J2F A;  1N2X A;  4BOS C;  3RRG A;  3CW2 C;  1SGH A;  2BQ3 A;  4DSL A;  1VCB A;  4JWS C;  3P1M A;  9ICQ A;  4J9Q A;  4P7I A;  5KFM A;  1NJZ A;  2Z59 B;  5AM4 A;  4ECS A;  1V9J A;  1UQV A;  3RRH A;  2KTQ A;  1ZUD 2;  2KZR A;  3AE1 B;  4PT5 A;  2K9X A;  1MQ2 A;  4ECW A;  4JLC A;  4O3S A;  3E56 A;  4IW0 A;  2HOI A;  3OJU A;  1E8Z A;  1HTO A;  4NJ7 A;  2KV2 A;  1WX7 A;  4ECZ A;  1NI2 A;  4PL1 A;  3K4G A;  5T8I A;  4PH5 A;  3SFE B;  2FJ6 A;  2JHD A;  3D6J A;  3RAQ A;  1NYR A;  3QE9 Y;  4KLH A;  2KXJ A;  2WYQ A;  2PFO A;  2KDB A;  2LVO A;  4DFJ A;  4Y2R A;  4C4V B;  2PE9 A;  5JXV A;  1UZX B;  4M9G A;  1R7S A;  1V5O A;  3HIZ A;  2ACZ B;  2F44 A;  2BQU A;  5AEK B;  3SD5 A;  1JXE A;  3MGI A;  1ZXI A;  4BGD A;  2MUT A;  1X9M A;  1TVA A;  1IXR A;  1P7D A;  3BQ0 A;  1YJ1 A;  2AHO B;  2LHT A;  2CS4 A;  5ALD A;  5DG7 A;  5J18 A;  3ZDM C;  1NK8 A;  3B0X A;  2XY6 A;  1K8R B;  1IUE A;  1YD8 U;  2C2D A;  1WWU A;  2ZUC A;  3QXG A;  1BNP A;  3ZXR A;  2PJH A;  5ALX A;  3QU5 A;  1XO0 A;  1RLF A;  5ALY A;  4GC7 A;  3PS6 A;  3FKY A;  1NKC A;  3PSP A;  2C60 A;  1CMX B;  2CKH B;  3RT3 B;  4YR3 A;  3PX4 A;  2K39 A;  1XT9 B;  1PDX A;  4GB9 A;  3F2B A;  3H7I A;  1KM7 A;  1E90 A;  3D2S A;  1AAR A;  2GLS A;  1XCQ L;  3BIN A;  3WK7 A;  4XWT A;  4Y2V A;  3QK0 A;  1D5M C;  3GE3 C;  5J0U A;  2F8K A;  4DXF A;  4BBN F;  4QZG A;  2W8K A;  3SEN A;  1FO4 A;  4FE3 A;  1CEZ A;  2JH1 A;  3NVY A;  4RT2 A;  4US9 A;  1YX6 B;  4WJO A;  5KFJ A;  2WWZ A;  2KQS A;  1Z1V A;  4CE6 A;  3ZRC A;  5GTH U;  3GV8 B;  4A20 A;  3MR3 A;  1O03 A;  2PXI A;  5KL1 B;  2CHZ A;  4C4R A;  4CRX A;  2NRT A;  4NLN A;  2DYO A;  4ECX A;  3QA8 A;  2EZY A;  5DB7 A;  3DBR B;  5AK3 A;  4JV1 A;  3G6V A;  3QNM A;  5IOI A;  5G5H A;  3M9N B;  2ZIX B;  4JV2 A;  1TAU A;  2SEB D;  5JUM A;  1SE2 A;  1RYR A;  3AEV A;  4A9A A;  4JQW C;  1FM0 D;  3ISC A;  1GB4 A;  1I4G A;  5KFU A;  5DB9 A;  4DEZ A;  3SYZ A;  3GZN B;  3H1U A;  2MJE A;  3ZD8 A;  2R61 A;  3PST A;  5KFP A;  5ALN A;  3ZXV A;  4Y2T A;  2HHU A;  4LNI A;  2PTL A;  4YT0 B;  4YD1 A;  3MBY A;  4ZH4 A;  1K5O A;  3GV7 B;  3KHL A;  1OQR A;  5JHA A;  3AEE B;  3KHH A;  1N48 A;  2PIA A;  2FCM A;  3TAR A;  5DQI A;  5DB8 A;  4R8U A;  3PO0 A;  4TUP A;  2QSD A;  4LZD A;  1XCT L;  2VA2 A;  4ANX A;  1D8Y A;  2HVI A;  2KD0 A;  4P0Q A;  4MH0 E;  1EU4 A;  2AQ0 A;  5CRX A;  2J52 A;  1WR1 A;  2HDE A;  2KQ7 A;  1E7V A;  2AQ2 B;  1K53 A;  2D3B A;  3IHQ B;  4YCX A;  9ICH A;  1CQV A;  2IO2 B;  3APD A;  4LJO B;  4O3N A;  2DZK A;  4F1S A;  2HBL A;  4ARI A;  1L4Z B;  2OED A;  3MTN B;  2WU2 B;  4F5R A;  2HW3 A;  4RU9 A;  1RYJ A;  2XIC A;  4DQP A;  2ZNV B;  3TMP B;  4A8E A;  1ZQK A;  1Z4O A;  2XK5 B;  3MHZ A;  3EZ5 A; 
#chains in the Genus database with same CATH homology
 3V3X A;  2KAJ A;  2K3U A;  1FCL A;  3O13 A;  3SFD B;  1VLB A;  1HEZ E;  1ZP0 B;  2CJN A;  2YEP B;  1N5X A;  1SF0 A;  1SJH D;  3U52 E;  1L0X B;  3P63 A;  1LO5 D;  1TS4 A;  1C9F A;  1E9M A;  4IDI A;  4RH6 A;  2L1A A;  2L83 A;  4LLG M;  2MH7 A;  4P6V F;  2G9H D;  1PFD A;  2HTM E;  3BK1 A;  4L23 A;  4A8X C;  1JW9 D;  4WWM A;  5TSS A;  3FIL A;  4WUR A;  1QOF A;  1N60 A;  1YN4 A;  2KWD A;  2B76 B;  1VRA B;  1AYF A;  3Q8A A;  1JQ4 A;  1WYG A;  4C7Y A;  4NAW B;  2N0S B;  4CQN A;  1SSN A;  1WSP A;  3AV8 A;  4O1N A;  2AQ3 B;  4NZL B;  2ICI A;  2XN9 C;  2W82 A;  3BWU D;  2V0G A;  2WNM A;  5AUK A;  1QQR A;  3P4Q B;  1WGK A;  1I4P A;  2WDQ B;  1OFF A;  4MT5 A;  3BVZ A;  1FCC C;  2LHD A;  2WU5 B;  2AX5 A;  1IGC A;  2QIE B;  2LFI A;  2MJD A;  1P7E A;  2WXO A;  2PMV A;  1DOI A;  1FIQ A;  1WRI A;  3TSS A;  1D5X C;  1MVK A;  2XNA C;  4ZHP A;  1YMH E;  4GDK B;  4XDC A;  2BB5 A;  5I4D A;  4RF0 A;  4L2Y A;  2GI9 A;  5HFY A;  4EE2 A;  5HG2 A;  3AEC B;  3RPF C;  3W2D A;  5BMH A;  4GDL B;  1E7P B;  2VZK D;  2Y5C A;  4HKQ A;  4YTN B;  1L6V A;  1WXQ A;  3EA6 A;  2WXK A;  3BII D;  2CU3 A;  2WXF A;  4N58 A;  3U2S C;  1GB1 A;  3AEA B;  1HQR D;  1RWS A;  3AEB B;  5BMG A;  1IBX A;  3PZ7 A;  3BVM A;  2WDR B;  2H88 B;  4ZRP A;  3NVV A;  2PW9 A;  1VZ8 A;  1TYG B;  2LGI A;  3N9Y C;  2PVO D;  2PKO A;  4R3D A;  4KGS A;  1I4R A;  2BB6 A;  2RDG A;  3NZ3 A;  2LEK A;  5MPO A;  3NVW A;  1J7A A;  3MJ5 A;  2JXT A;  3L4P A;  3KWV A;  4OZA A;  3MP9 A;  1ZE3 D;  1UWM A;  1B1Z A;  2J42 A;  2NTS A;  1ACC A;  1CJE A;  3VR8 B;  1ENF A;  2IJ0 A;  3HUI A;  4AQ7 A;  1FNV A;  1C4A A;  3AE8 B;  2DWQ A;  2WXL A;  4HJG E;  3C8Y A;  4KKI A;  3PZ8 A;  1C4P A;  1ZPS A;  4YSZ B;  1I4H A;  2ZW0 A;  4B0E A;  1V1O A;  2E3T A;  4IOI E;  4NAM A;  3W1S A;  2FUG 1;  2JZP A;  4US8 A;  3W5U B;  1KLG D;  4OW0 A;  4YTP B;  1D4B A;  3ZGZ A;  4OZC A;  3BYT B;  1E0Z A;  3FAH A;  2AQ1 B;  5C3J B;  1DYQ A;  1FNW A;  3BYY B;  3W5V B;  2H89 B;  5BYR A;  1C76 A;  2J53 A;  2DYM A;  3KQ4 A;  2BS4 B;  5D3D A;  1YQ3 B;  1YQ4 B;  3MC0 B;  1F2R I;  1XLO A;  2BYT A;  2BS2 B;  2NMQ A;  1FFU A;  3KWL A;  4HRO A;  3LYY A;  3T3N A;  2WS3 B;  2Z8L A;  4ZYS A;  1QF6 A;  2IGG A;  3Q8B A;  2I2Y A;  1C79 A;  1FXA A;  1XEE A;  1IGD A;  4OVZ A;  3B2F A;  3URY A;  1N62 A;  4P16 A;  1TY0 A;  3AED B;  1JWS D;  1OQQ A;  4C56 C;  1E6E B;  1KRH A;  1WWT A;  4DQO C;  4YXD B;  2PVG C;  3AM9 A;  2INP E;  1J7B A;  4A6Q A;  1JRO A;  1K50 A;  2VZK B;  2WXM A;  1HXY D;  3ZJT A;  3P42 A;  1SXT A;  1FMA D;  1JWM D;  4OHJ A;  3E9S A;  2X38 A;  1VR9 A;  1C77 A;  1BXT A;  3IAS 1;  2V3N A;  1FEH A;  2ZW1 A;  1ZDV A;  3CWI A;  2W3R A;  5H8Y E;  4GLS C;  3NRZ A;  2IGD A;  2NTT A;  2V3P A;  3NVZ A;  4TMA B;  5HHD G;  3I9V 1;  1TS2 A;  5HI1 A;  4MAC A;  1F77 A;  2RPV A;  3R8B A;  1KF6 B;  1PYW D;  4IKG A;  3AE4 B;  4LK0 M;  2DBY A;  3LB8 C;  1NEK B;  3U4E G;  3VR9 B;  2Y3A A;  4TQ0 A;  1HA5 A;  3GS2 A;  4LTU A;  5LNK 1;  4ARC A;  1V1P A;  1Q10 A;  1B9R A;  2TSS A;  1TKG A;  2WP9 B;  1AN8 A;  1ZOY B;  4RGT A;  2W3S A;  3IT6 B;  1QKZ A;  3Q69 A;  1QIL A;  3VRA B;  1FFV A;  1SBB B;  5D7G A;  2GRI A;  1V97 A;  2WXI A;  3IAM 1;  3MFG A;  1KFY B;  3H8H A;  4TQ1 A;  3NUH B;  4YSX B;  3FIL B;  4JWU C;  3V05 A;  5E6J A;  5H92 C;  2ON8 A;  2FE8 A;  1SE3 A;  4KGT A;  1PGA A;  1YJI A;  2N7J A;  2BS3 B;  3Q8C A;  1P7F A;  3NS1 A;  5BMI A;  3UI3 A;  3B2G A;  3Q8F A;  1SJE D;  1DOY A;  3TEZ A;  1JCK B;  2QIL A;  2BTE A;  5EE0 A;  4XWW A;  1ZXH A;  4HRS A;  4J3O D;  3VRB B;  3TUO A;  2WXG A;  1Y56 A;  2WXN A;  2IPK D;  4XDD A;  5AUI A;  1GAQ B;  3GB1 A;  2WXP A;  5G5G A;  2QMT A;  4ZOH C;  2M19 A;  4KX6 B;  3AE5 B;  5GXG B;  1XLN A;  4RGN A;  1K51 A;  4RCO A;  3R2I A;  4OZB A;  3P4P B;  4USA A;  3ZYY X;  3TEW A;  4C7Z A;  1NI3 A;  1RFK A;  1GOZ A;  1SIJ A;  4KGR A;  4TSS A;  1D5Z C;  4HEA 1;  2J4X A;  3GP7 A;  2RMM A;  3DWM A;  5FKA C;  2WXR A;  2KMM A;  1XLQ A;  2V4I B;  1JWB D;  1MHH E;  3RFZ B;  4RF1 A;  1K52 A;  1YN5 A;  4WIP A;  3ZJV A;  1V8C A;  4XE0 A;  1V1P B;  2W54 A;  3AN1 A;  3OWE B;  1SEB D;  2CJO A;  1AW7 A;  2KN4 A;  4MM3 B;  1TJE A;  4RNA A;  3AE3 B;  4A55 A;  3ZJU A;  1CZP A;  3SEB A;  1ROE A;  1QOG A;  1L0V B;  3BZD B;  2BW2 A;  2WLB A;  5BYQ A;  4ZRQ A;  5D3I B;  1NEN B;  1HZ6 A;  2G1E A;  4WH4 A;  3B9J A;  1STE A;  2DLB A;  1EWC A;  3AE6 B;  2N9L A;  4JPS A;  1I7H A;  3AE7 B;  2MJ3 A;  4ITK A;  4JE3 B;  1QLB B;  2D5G A;  1IBX B;  1DGJ A;  1JRP A;  1XLP A;  2QJL A;  1TZO A;  4C80 A;  2FBW B;  1F2R C;  3BK2 A;  1NYQ A;  3P4S B;  3VQI A;  4RGM A;  1ZDX A;  2WQY B;  1QT9 A;  2GB1 A;  2LMC A;  2PLP A;  1MI0 A;  1F0Z A;  2M56 B;  4JWS C;  1XXG A;  3P1M A;  2K22 A;  1I4Q A;  1TS3 A;  3I57 A;  1VJK A;  3ETR A;  1ZUD 2;  1N5W A;  1FRD A;  2IGH A;  3AE1 B;  4PT5 A;  2K9X A;  3KLS X;  4B0M A;  1TY2 A;  1EU3 A;  1VZ7 A;  2L52 A;  1EM7 A;  1JML A;  3E56 A;  1AWD A;  2JU6 X;  5FR3 A;  2WXJ A;  1JAL A;  4YTM B;  5T8I A;  1ET9 A;  3SFE B;  1QOB A;  1KTK A;  1NYR A;  2JYT A;  3CIR B;  4HKZ E;  3HVD A;  4REZ A;  3AH7 A;  5JXV A;  1YJJ A;  1R7S A;  2SAK A;  3AEF B;  2ACZ B;  3EUB 2;  1FNU A;  4N59 A;  4Q2J A;  1ZXI A;  1UNS A;  1L5P A;  4KKJ A;  3T3O A;  2RDH A;  1JWU D;  4AS1 A;  2LJI A;  1PUT A;  1J7C A;  3EGR A;  1M4V A;  1MPE A;  5EE3 A;  1KH0 A;  1IUE A;  3BVG A;  2ONQ A;  3LXF A;  3AE2 B;  5EE9 A;  1EWY C;  2JX5 A;  3SR6 A;  2LUM A;  3TEY A;  2I38 A;  1N63 A;  4NJC A;  1XO3 A;  4D2K A;  2M0A A;  4MH8 A;  3FC4 A;  2OHF A;  2KQ4 X;  1BUI C;  1C4C A;  2JQR B;  1PDX A;  1SB3 C;  3IXS A;  4JX1 C;  5EE1 A;  4FXC A;  1VZ6 A;  3DWG C;  1XCQ L;  4WAF A;  4XWT A;  1D5M C;  5C2T B;  1QOA A;  1RM6 C;  1PGX A;  4DXF A;  1FO4 A;  1N61 A;  3J9C A;  1L0Y B;  3AB5 A;  1SE4 A;  3NVY A;  2N9K A;  4US9 A;  3IT4 B;  2JYE A;  3P4R B;  3ABV B;  1DOX A;  2EEL A;  2YEP F;  1L4D B;  2W55 A;  3HVZ A;  4ZHO A;  4WQM A;  1YNT E;  2MEK A;  2WXH A;  1BML C;  1D6E C;  2DYO A;  2EKI A;  3ZQ4 A;  1T6B X;  2JWU A;  5G5H A;  2SEB D;  4L1B A;  1SE2 A;  4DXG A;  4A9A A;  1FM0 D;  1GB4 A;  1I4G A;  2WDV B;  3AMZ A;  1C78 A;  1PGB A;  1KLU D;  2MJE A;  5BYS A;  2KDM A;  1HZ5 A;  2R61 A;  1L6U A;  4H2A A;  2KAC A;  1JWA D;  1UWX A;  1TS5 A;  1I4X A;  2L32 A;  2PTL A;  4YT0 B;  1VDV A;  1OQR A;  2BT6 A;  2IDY A;  4YSY B;  3AEE B;  2PIA A;  3U7Z A;  1YN3 A;  1UUP A;  4RFB A;  1FD6 A;  1ESF A;  4N6E B;  2JSV X;  3Q8E A;  3PO0 A;  3HRD D;  1XF5 L;  2QSD A;  2INN E;  2BBC A;  1XCT L;  1MHX A;  3WCQ A;  2Y5P A;  4UDU C;  1ET6 A;  5FK9 C;  1EU4 A;  2J52 A;  1FXI A;  1E10 A;  2HDE A;  1FRR A;  1TKY A;  1K53 A;  2AQ2 B;  4YWG G;  1CQV A;  1T5X D;  3R2T A;  1TKE A;  1UGJ A;  2Q5W D;  1GPX A;  4ARI A;  1L4Z B;  1A70 A;  3AE9 B;  2OED A;  4M0W A;  3AEG B;  3W9C B;  4RGO S;  2WU2 B;  3TEX A;  1T3Q A;  1RYJ A;  2QEJ C;  2WXQ A;  1NVI D;  4A90 A;  1CK1 A;  2E6X A;  2K5P A;  2K0P A;  3MHZ A;  2LHE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...