3EUB2

Crystal structure of desulfo-xanthine oxidase with xanthine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 37
structure length 164
sequence length 164
chains with identical sequence A, J, S
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
2 PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3eub202
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3eub201
1L6VA 3AE6B 2W54A 1NVID 5C2TB 1YQ3B 2BS4B 1PFDA 1WXQA 2Y5CA 2OHFA 3AEAB 2JX5A 1FFUA 3W5VB 1FM0D 3B2FA 3ZYYX 3AEBB 4C7ZA 2WLBA 1T3QA 1KRHA 3NRZA 5C3JB 2WU5B 1FRDA 1WGKA 3AE7B 3ABVB 2MH7A 3AN1A 1N63A 1RWSA 1E6EB 2QIEB 1JW9D 2ACZB 5H8YE 1TKGA 3AE8B 1XO3A 3B9JA 3HVZA 3DWGC 5G5GA 1CJEA 1E7PB 1L5PA 2DBYA 3CWIA 1QF6A 5MPOA 2JQRB 4YXDB 2QJLA 1EWYC 1YQ4B 2WS3B 5GXGB 5AUKA 1CZPA 1NEKB 1N60A 2L52A 3EUB2 2MJ3A 2WDRB 4HROA 1KFYB 2Q5WD 1L6UA 5EE3A 3NVVA 1JROA 2BS3B 1FIQA 4YSYB 1FMAD 3KWLA 3P63A 2AX5A 1QOBA 4KX6B 3NVWA 1A70A 1OQRA 3HRDD 2PKOA 3P1MA 4USAA 1XLNA 2WP9B 2DWQA 1L0VB 2BS2B 4HRSA 3W9CB 1B9RA 2CJNA 1TYGB 3AE2B 1DOXA 1F0ZA 2PIAA 3P4SB 3AECB 3FC4A 2H88B 2N0SB 1FRRA 2HTME 2BT6A 2MJDA 5H92C 1N5WA 1GAQB 1RM6C 1N61A 1ZP0B 2WU2B 1N62A 3LB8C 3L4PA 3NVYA 3NVZA 1QOGA 2W3RA 4US8A 2PVOD 2WDVB 3AE5B 4YSZB 1NYQA 1TKYA 1FO4A 3P4RB 5EE1A 2MJEA 1VLBA 4ITKA 1WRIA 1GPXA 4N59A 1WWTA 1YJJA 4C80A 1J7BA 1ZUD2 1FXIA 1PDXA 1KF6B 4ZOHC 4WWMA 3ETRA 1SIJA 3PO0A 1WYGA 1TKEA 1QLBB 1XLOA 1I7HA 1OQQA 3AMZA 1YJIA 1XLQA 3NS1A 3B2GA 4WQMA 1E0ZA 1FFVA 2CU3A 3AM9A 1J7CA 2WQYB 4N6EB 2K22A 1VDVA 1ZOYB 1SB3C 1JWBD 3AE9B 4LTUA 3VR8B 4N58A 1N5XA 1UWMA 1SF0A 3VRBB 1TJEA 3VRAB 3P4QB 3AB5A 2E3TA 1AWDA 1RFKA 2KAJA 1DOIA 4YT0B 5EE9A 1OFFA 2M19A 1RYJA 3AEDB 4JX1C 5G5HA 4ZHPA 1E10A 3CIRB 1V97A 3AE4B 1FXAA 3VR9B 3RPFC 1NENB 3WCQA 1JALA 2W3SA 1NYRA 3SFDB 3AH7A 1E9MA 1V8CA 2CJOA 2H89B 2K9XA 1QT9A 2WDQB 4JWUC 5EE0A 4A9AA 1PUTA 2B76B 3BIID 5AUIA 1QOFA 1QOAA 4P6VF 1JRPA 3W5UB 1J7AA 4YSXB 1DOYA 2G1EA 3AEGB 4JWSC 4YTMB 3AE3B 1R7SA 3SFEB 3AEFB 1JQ4A 1XLPA 2M56B 1ZXIA 1NI3A 1ROEA 3AE1B 3HUIA 3AEEB 2W55A 3FAHA 3P4PB 4YTPB 2L83A 1JWAD 4US9A 2FBWB 2LEKA 1VJKA 3DWMA 4ZHOA 4FXCA 4IDIA 1DGJA 2KMMA 1AYFA 1IUEA 2PVGC 2K5PA 2EKIA 4C7YA 3LXFA 4YTNB 3SR6A 3AV8A
chains in the Genus database with same CATH superfamily
3AE6B 3T5KA 1WMHB 2HHVA 8ICGA 1COOA 1VJ5A 4FJVB 3X0WA 1UPHA 2JRHA 8ICJA 4KLIA 3M62B 2N7EA 4GOCA 1WM2A 2KWVB 4UB4A 4QIWF 4XA5A 2D3GA 1KRHA 1FCLA 1WGKA 2LMCA 2WXLA 4MHVA 4A20A 1SE4A 3KHGA 2JEFA 4HXDA 1IV8A 3H8MA 8ICLA 1STEA 4MELA 2HVHA 3RI7C 1VRAB 2HCFA 1QF6A 5J8YA 3C2KA 1FCCC 3TARA 1SGGA 1Z00B 4ECYA 1KFDA 2J6SA 4XUSA 4DK5A 1CZPA 1IG6A 3P2BA 3JYUA 2V4RA 5DPRA 1L6UA 2OH2A 3NVVA 3QU5A 4F50A 2EAOA 2KJHB 3BQ7A 3L54A 2XIDA 2AX5A 2K39A 3PRZA 1BPEA 3P1MA 3T5HA 5KTQA 2K4HA 2MA9B 2A1JA 3ML9A 4KV2A 3V6HA 4PHEA 1ACCA 3AEVA 1ZQPA 4ZRPA 2LM4A 3RTVA 2N9PC 4PT5A 3UQ0A 2K8CB 3G6YA 4C8OA 4RF0A 4URKA 3TEWA 2QILA 4NL9C 2C28A 3SD5A 4GC6A 7ICIA 4YSZB 5KG0A 3C23A 1QSSA 3RH5A 3R7QA 2GBKA 4A3PA 3A4SC 2BZFA 1WJ4A 3UM9A 2MJEA 3DBLB 4HCNB 1GPXA 5ALQA 3WK5A 2BGWA 1SKSA 2NTTA 1YJJA 2X8XX 3KZIU 4QZHA 2PW9A 5AKLA 4MFCA 3SZ2A 4C8MA 9ICEA 3HX0A 3F2DA 4TKNA 1Q46A 2FCMA 1TKEA 2W82A 5KFZA 3VQIA 4ED0A 1DK2A 1X6JA 4PGQA 1IM4A 2QKQA 1L8LA 1A76A 2RDJA 5ALSA 2IMWP 2DX5B 3I3TB 3SQIA 4RPXA 2JMGA 2KQ4X 3QEAZ 2KVZA 2PPHA 3HKZF 3J9CA 4DQOC 3UF8A 4F4KA 4YT0B 3W2DA 2R2QA 4DQQA 2KDMA 2KX0A 1V97A 2RDHA 1C7YA 1ZRMA 3KHRA 3DDCB 1QQ6A 3C1YA 5TISU 4IRDA 2CJOA 4ACOA 1D8YA 1NJXA 2FMSA 3AH7A 5AUIA 1K8RB 3EFCA 4YMNA 4DL6A 3H0LB 9ICWA 3NZSA 2EZZA 2WXGA 5J29A 2WF6A 1MVKA 3AE3B 1IBXB 2CS4A 2I9GA 3L13A 5KT2A 4EEKA 4JMUA 5BYRA 1ZJMA 2NO5A 3RH6A 2FNJB 3C21A 5T14A 1ZQSA 9ICRA 4ECZA 1QZEA 3B0YA 4P4MA 4ZHOA 1C4PA 2INDC 1L0XB 4UAUA 1Z3EB 2EANA 2DPJA 4K7WA 1C4CA 4YTNB 2INNE 1OXJA 1HTQA 4LNFA 4TQRA 4DXFA 1UUPA 5KT5A 3MHZA 5DB7A 2Q4TA 3Q8QB 3AU6A 4DSKA 1DGSA 2QCZA 3ONSA 2NRVA 3B2FA 5J8YC 4K4IA 4J6IA 4YXJA 3G6VA 3IT4B 1SWWA 3BQ1A 2N1WA 2LYAA 2OOBB 2LFIA 2PLPA 1OUQA 2WXIA 3BQTA 1RQLA 5D2MB 2QEJC 1E8WA 2KZZA 3C1ZA 3EWAA 1LM8B 4M0WA 2R18A 2FCNA 3V61A 5I4DA 2WXRA 3T3NA 1ZQYA 1NEKB 2ZZPB 5AUKA 5LLIA 1EO6A 4Q44A 4P2HA 2AHOB 2WF8A 1LFDA 1R4NI 1ZQEA 4F2SA 3MC8A 3VAWA 4EZJA 2ZJAA 3PHWB 2BBCA 4W9HA 1QOBA 1KTKA 3IG3A 4IWPA 4JUZA 1L0VB 2ASDA 3U26A 2PE9A 3RZWC 2KN4A 4EBEA 1RFAA 4MSMB 2DKXA 3HWTA 4FS2A 4UBBA 9ICFA 4RNAA 3V62A 1D5XC 2KTFA 2KFZA 8ICEA 5IKCM 5KL8B 1A77A 1URJA 2YQEA 1V5OA 2WX1A 2R8GA 3RJHA 3QJZA 4MGKE 4ARCA 2FDRA 3H6NA 2N1VA 2QHOA 3HILA 5IIOA 3GV7B 3A0HU 4W9JA 4RUCA 5KG6A 3ZGZA 2CN1A 5HR6A 3Q8CA 4ED1A 1J2NA 1HIWA 3ENEA 2E8NA 1J7BA 4BX9C 4M6WA 2DGZA 1R4NB 3SD7A 3BS5A 1XCTL 2E8PA 4UB2A 3RAQA 1YMHE 2K1FA 3ETLA 1SBBB 2KLCA 1V2YA 3DVNV 4J9OA 1XF5L 3O65B 1SV0A 3LWMA 2KX3A 3RJIA 3AE9B 1SB3C 1SJHD 3TL5A 3UQAA 4XWWA 1ZETA 1JMLA 2KLGA 1WR6E 2WFAA 3V3XA 7ICSA 4TMAB 1TGZB 4EENA 4O5KA 5IINA 3M63B 4K4GA 3WCQA 3G6XA 1ZJNA 2MCNB 5BYQA 1GJZA 1LXDA 2K6QA 4RT3A 1NBFC 2KDFB 2YVCA 4WWPA 5E6PA 5J2JA 5ALNA 2JU6X 4P6VF 4M04A 1AARA 2KJ6A 2HOIA 3SFEB 1KFTA 4MGIE 3NY5A 2OYYA 4K1RB 2JZ3B 4HPLB 3QYPA 4RH6A 2AQ3B 4Q43A 3V7LA 5DCNA 1S8OA 3BJYA 2L83A 4MDKE 1X66A 5KNIA 1ZQFA 4B9TA 4XYCA 2LEKA 1PUZA 9ICBA 1J8CA 1D8BA 2MWSB 3H1UA 2HBLA 2FAZA 3NG0A 4QWCA 8ICBA 3GB1A 2G07A 3C5FA 1DYQA 2JVCA 1U4BA 4DLGA 9ICOA 3H4BA 2CR5A 1QQRA 5TZVA 1YX6B 3IP4B 1AQ6A 4Y2TA 1X9SA 4CDGA 2E6XA 4KIKB 1K1SA 4RQ8A 1QILA 2HDEA 4AOFA 2B0CA 4OW0A 2WNMA 5ALGA 3KOOA 4DFDA 5J2AA 1QH9A 2ZNVC 8ICNA 1N63A 3W1SA 3UXPA 4NLNA 3OHBA 2DZIA 2KKVA 1TY0A 2L0TA 2KC1A 1EXNA 2K4PA 2BWFA 2NYVA 4DSIA 1YNTE 1ZQUA 5GXGB 5HMMA 4KKJA 2IOFK 3ZDBA 5DBAA 2B6GA 2WDRB 1XS9D 1Q3VA 3FILA 2GWSA 7ICJA 2MBOA 2I6XA 4MJSA 1HEZE 5JRTA 4II2B 2JY6A 1B1ZA 2PKOA 4HLEA 4QZEA 2AH5A 2BS2B 1ZQDA 5JHAA 4RGNA 1RG6A 3L3FX 3LVWA 4C4SA 1C3TA 2ASQA 1L7MA 4LNKA 4YD1A 4RT2A 3GIIA 3A9KB 3QCAA 3EECA 4EYHB 2FCQA 5FR3A 1B0XA 3PW7A 5EE1A 4KGRA 1DXSA 1TKDA 3PPAA 3T5JA 2KFJA 1XXGA 3U2SC 3SENA 1BNOA 1QLBB 1E90A 5KFBA 1E0ZA 3CNHA 4UAWA 3N7RC 4I29A 2P6RA 2RDBC 2HJ1A 2WF7A 2M0AA 5CJ7A 3L17A 1R4MB 2N9XA 3VRBB 3AU4A 4H2AA 2ZIVB 1F9JA 3AB5A 2E3TA 2OCEA 2AL3A 5IO9A 3WK9A 4RQ2A 2IBKA 1XSNA 3VH3B 3OPXA 4CF4A 3H7SA 5F9NA 3ECIA 5AK3A 2W9BA 4BKSD 2BYTA 3BINA 2VANA 2QDFA 4YMMA 3D32A 3RCZA 1SSNA 4WURA 3IHPC 2BCSA 4N9F4 4UQGA 1WI0A 2DENB 2ES6A 1S97A 1X9MA 1JRPA 2G09A 2MP2B 5E79U 4YP3A 2PI5A 2EMSA 4B9MA 1S0MA 4KN4A 4IQWA 1ZRNA 1UELA 4GXJA 2DYBA 4HJGE 1EUVB 2ZUBA 3K9OB 5FP0A 2I38A 2ZJDA 3PRMB 4S0RA 2G45B 1S1QB 4OJ6A 3ML8A 2LUEA 1KF6B 3AV8A 1L6VA 1NKCA 2WAQF 8ICFA 1H38A 5KT3A 3ZUNA 3MFHA 2A5UA 1QTMA 1XO0A 2OXOA 2OHFA 1V80A 2GB1A 1WG8A 2MEKA 4U7CA 2NCNA 9ICNA 4C7ZA 3QARA 2BHNA 1GOZA 1YOVB 2LGYA 3MDCA 5JHBA 2V4QA 3ZJTA 1C1YB 2NBUA 2L8JA 5CEHA 4KLJA 1XO3A 2VH1A 3RULA 4WJQA 4HVBA 2W11A 1WXSA 3WKDA 2QJLA 1JN3A 2BDUA 2ON8A 3GP7A 5J0RA 4JV2A 1KFYB 3C28A 3IG8A 5CHGA 2A3VA 2LYBA 4A3OA 3C5GA 2Y0SF 1XLNA 4ECTA 2CJNA 1ENFA 2IGGA 2XI9A 4L23A 3BVZA 2RDIA 2FLLA 5B5EU 3FC4A 3JPSA 2ONQA 1LGRA 5C5JA 3KQ4A 1ZQNA 2DQNB 5L95C 4C8NA 4K3CA 2I1QA 2AQ0A 9ICCA 1C79A 2B21A 2MRLA 3FDSA 4XC2A 3VTVA 2YY6A 4NQKE 5J0QA 1DOQA 2Y1JA 2IO2B 2WU2B 3L4PA 2W3RA 2UVVA 2WTFA 2V9HA 4ED6A 2LVQA 2WB1F 4CE6A 2ZUCA 3Q8PB 2K0PA 3H7IA 3A9JB 4ANUA 3DBHI 1B43A 1WGRA 3RNCC 1L6NA 1ESFA 5IN7A 2E8OA 2B3AA 1LKYA 5AZHA 5DPTA 4IR1A 5KFJA 1I7HA 4KLEA 4I2HA 3ZNGC 4QZIA 2HTHA 3WKEA 4C4VB 5JU5A 3TANA 1D9FA 1UH6A 5ALXA 2EH9A 4GIVA 2H3VA 2JUOA 2Y9UA 5AZGA 5CX3A 1XWLA 4DXGA 1RFKA 1E7UA 1YT3A 3DV9A 4EE2A 5HHDG 4JLCA 4BGDA 1SE9A 2KEYA 2R61A 7ICOA 4AP9A 3PSEB 5J2KA 3I9V1 3VUYA 3KUDB 5ALLA 2JGAA 3TUOA 3NUQA 4F92B 2IZVB 5HHIA 4ZYNA 2PMZC 2LGIA 4RQ7A 2M0XA 4KZ0A 3DBHB 4YSXB 4YL8A 3K1ZA 2HMXA 3AEGB 3A1QA 1TS2A 3EGRA 2DZKA 4IQTA 1XLPA 3A4RA 5KG7A 4ECVA 1MA7A 1GC7A 1NI3A 2D8CA 4ANWA 3H0MB 1T4GA 3LWLA 4KX3A 3P4PB 4MM3A 5K4LA 3SAHA 4NJCA 2ZIUA 3PW2A 3SV3A 4C8LA 4I2DA 2K89A 2CHWA 2WYQA 1ZD5A 5J18A 2KICA 4KLDA 2W9MA 3D2NA 3PV1A 4KITB 3QQ8B 1L7NA 4XZ4A 5C1ZA 5J0SA 3RNAC 4ICVA 1Q3UA 2C7NB 3T8MA 2XN9C 4C00A 3IG5A 3I76A 3WAOA 4RMAA 4OHJA 3PLVA 2Y1IA 1F2RC 3BZDB 1E6EB 3SU8X 3SAFA 3FKYA 5AZFA 3HVZA 8ICYA 3PX6A 2G4SA 2YMLA 3V6CB 2EZYA 2GOLA 1A5RA 5L1LA 2QARB 3U7DA 3HVDA 5HMLA 3PSTA 1PVRA 2HD5B 3QIJA 1COKA 2RGFA 5AI4A 1K53A 3E58A 1U4AA 2FPKA 5AI0A 4O0IA 1ET9A 1DOXA 2OM6A 1CEZA 3IN5A 1K5OA 1KEJA 2BQRA 1V81A 3NZUA 4KN7A 4G11A 3WKAA 5KAIU 2D5GA 3Q8EA 1MHXA 2FMQA 4MEMA 4J9RA 9ICGA 2AQ2B 2D3AA 2J0JA 5KFKA 2WXKA 4DSJA 7ICTA 2BQ3A 3V05A 2HBKA 3RJFA 2KKCA 4UB1A 4IWOA 3H9DA 3Q69A 2Y3AA 3KYDD 1WZ3A 5J2HA 2VJ4A 1WRIA 3TEYA 1JWSD 4YR2A 5JZEB 4IQVA 2PFOA 2FJ6A 1NK5A 4CO7A 2NRXA 3CSFA 1EF5A 3Q8MA 3DVGY 4GMVA 1YJIA 3UIOB 3NS1A 2XO7A 1WX9A 2I1JA 1K1QA 2JXJA 4WIPA 3OTQA 3AU2A 3CYMA 1JXLA 2E5SA 2JSVX 2JXXA 3HW8A 4OZBA 2KJ9A 5ALIA 4DHJD 3ZDAA 4HCPB 4WJOA 2P6UA 3I28A 2VJ5A 2DL0A 2H3FA 4WAFA 2HE7A 4F72A 4DLEA 4M47A 1RYJA 2GLEA 4I2CA 3KHHA 1FNVA 3QX1A 1V1PB 4M02A 1KQQA 5L83A 3RT3B 2DNFA 1OEYJ 4Y2JA 2G5IB 2ZIXB 5KFLA 4QW8A 3VH4B 5EE0A 4QZGA 1WE7A 4DFJA 2FLPA 3HT3A 4E0DA 3EC8A 3Q3OC 1YZ6A 8ICHA 4IQUA 3AEFB 1ZQRA 4KLUA 2W7OA 3N32A 1V86A 1U48A 9ICMA 4Q8FA 1JWAD 1L8OA 4QW9A 4GXBA 3RRGA 2JWZA 3DEEA 2WXNA 4PZOA 4IDIA 2KN5A 2KMMA 3WK8A 2JRIB 1V85A 4C7YA 4TV3A 4LNOA 2WXPA 4PS7A 1KBUA 4NLKA 1WWVA 3RBDA 5C2TB 9ICPA 4ECWA 5CHFA 1WXQA 3TEXA 3HIZA 4F1SA 2ZPYA 5CA7A 3ZI4A 3PSPA 2A1AA 2ALZA 2JX5A 5DDYA 1V49A 2XICA 4HKZE 3RNEC 3ZYYX 4NWIA 8ICZA 1JCKB 1WJUA 1EM7A 1Z19A 4F4WA 2KG5A 4C8KA 8ICSA 3E2EA 5F3XB 4RPYA 4XRHA 4D2KA 2G3QB 4MACA 4L1BA 4OZCA 2AXTU 4DQSA 1UWXA 1GB1A 1KW4A 2KVCA 4OJPA 5D49A 4F2RA 4MH8A 1JI7A 4FE3A 4PPXA 3D2QA 3MDAA 3L5KA 4GXIA 1SGHA 1RYRA 3TFRA 4I28A 3KVFB 4HROA 3ZDMC 3ZLZA 1PVQA 2IY1B 5D3DA 2LBOA 2C60A 1FMAD 3IDWA 4O3QA 5ALTA 1BPZA 2HHXA 3P63A 2KDEB 3H8SA 4RUAA 4NM1A 4DDID 4HEA1 5KFVA 1HA5A 4JB3A 3U30A 5EDSA 3IXSA 2RPQA 2XK5A 5E6JA 4CNQA 4IOIE 3JPRA 2L5YA 2R8JA 1P98A 4WAAA 3PW4A 4W9LA 2IHMA 1HZ6A 3IT6B 3O0FA 4XDCA 3MGIA 1ZP0B 2BPGA 5GMVA 3V7JA 5AKEA 2KTRB 3AE5B 3DCGA 4EBDA 5T8IA 2V1YA 1T5XD 2QLTA 4PGXA 3MABA 2EQYA 4X5VA 1SL2A 3L0WB 2F8KA 5AKGA 5JUMA 2ODGA 7ICRA 3N28A 1FXIA 4WWMA 2ZXIA 3LVVA 4RQ0A 4A8XC 1E8ZA 3AMZA 1XLQA 4ZRQA 8ICAA 1WCNA 1YD8U 4FADA 4TQ1A 3GS2A 1MJDA 2M9NA 4LNIA 3DBRI 4M9JA 4P1CC 1SF0A 3NHEB 1ZQAA 3EA6A 1MN8A 2XNAC 2BQQA 2RSUA 5DGAA 4JX1C 4R65A 1NJWA 5KFYA 2W9CB 4J9LA 1E5WA 3B08A 4KVGB 4ED7A 1QKZA 1P0RA 2HJ8A 2N1RA 1HUOA 1NENB 4W9DA 4HJKA 2N4FA 9ICTA 2B76B 1UNSA 5FK9C 4FZNA 2LKYA 2F2AB 1FXTB 2N7JA 3VCBA 3DHHC 4ZH4A 3PZ8A 5AM4A 4NLBA 5C0YA 1WF9A 1A6SA 3QZ8A 2F76X 3AULA 5J0UA 5IOIA 3DBRB 4QZBA 5L9XA 3WKCA 1TT5B 4J9SA 5ALOA 1XSPA 3PY8A 3KW5B 3IAM1 5E6NA 4GN1A 2K5PA 3SR6A 4I2IA 2G9HD 3UXNA 8ICKA 2R8HA 4AYBC 4ZRIA 3ISCA 3N1YC 2BS4B 1PZNA 1WZ0A 2IOFA 3L08A 5KG3A 2JF5A 3SI8A 1VCBA 4JV0A 4I6NB 1SZPA 3V60A 4PJ0U 1FFUA 1XCQL 4BWMA 4QWDA 3SHQA 2JWUA 4GLXA 2WLBA 4I6PA 3M3JA 3ABVB 5AM5A 4B9SA 3GIJA 2RQ5A 2KIVA 3EFUA 5EWEA 2RP5A 1GB4A 4RGMA 4UB6U 3MTNB 4MFAA 3ED5A 2YEPB 4EBCA 3PTFC 4YG2A 3HM3A 4RQMA 4C56C 4Y2PA 1N60A 2KACA 3H7PA 5ALYA 1S5LU 4TUQA 2LRWA 3CSTA 3UQBA 4J9KA 3EYZA 4FBTA 2LHEA 4UARA 1FIQA 1BPDA 4LLGM 2KQSA 8ICTA 2PMVA 1HTOA 3WALA 1UA1A 4QWAA 2AL6A 2K8HA 3MR3A 2BB5A 3CW2C 2LXAA 2KZRA 3NGDA 1PGAA 2N0SB 4GDKA 3ZDEA 2XBBC 2KVRA 2DF4B 2MHJA 4KDLB 4X57B 1TFRA 4KMOB 5BMIA 1RQNA 1WRDB 5LXIB 3NVYA 1QOGA 1FPYA 4US8A 5ALJA 3QA8A 3BZKA 3PVXA 1TV9A 1FO4A 4LZDA 4ELVA 1FNUA 4UASA 1KL9A 3BVGA 1J2MA 3HK0A 3TSSA 3X23A 4YWGG 3IV6A 3KLSX 4BBNF 2L3ZA 4C80A 2JEJA 2D11A 4LNNA 1FEHA 1E7VA 3ZXVA 2J7QB 1YX5B 9ICLA 1KLNA 2GO7A 2R2OA 2VZKD 2NPTA 5J2IA 1L3SA 2KFNA 1ZD4A 1GNUA 3M1YA 3QU4A 5H2FU 4DCCA 2CU1A 3PT2B 2WF9A 4DSLA 2HOFA 1S77D 5EE9A 2EDUA 1FNWA 5J0OA 4ED3A 5G5HA 5CTRC 3UINB 2MSED 5ALEA 2OEDA 4IWQA 4W9CA 2W8LA 2L05A 2QMTA 5G2NA 4DBGA 5CR0A 1TBEA 1T0YA 2K9XA 2O2VB 3DDHA 1T0SC 1S10A 4I2EA 5HKHA 3K4GA 2V9WA 4O3MA 4GU2A 3Q14C 3V6EB 3J81j 1XQQA 2BTEA 2BGFA 2LGDA 4M00A 2MBBB 1DRGA 3BWUD 4Y2SA 1PGBA 4DQRA 1Y56A 4E74A 4GDKB 3GE3C 2K4EA 3BVMA 4DEZA 3E0FA 2CXYA 5AKHA 1WX8A 2KNJA 4KX5A 4UB3A 2ISPA 3AI5A 4IC7B 4EOYA 1MC8A 3R66C 5KFNA 3AU5A 1A0PA 1UBIA 4G9BA 3PW0A 1YQ3B 3A9KA 4OCZA 4RF1A 5L1JA 1PK3A 2G0AA 3WK6A 4RQ3A 8ICCA 1XEEA 2VH2A 2YTUA 4TUSA 4Y2VA 1U45A 5C3JB 2Z8LA 3AE7B 1F77A 2KKPA 4NY8A 4NAMA 3TAQA 4B95A 2BPFA 2BYFA 1WCLA 1ZDXA 2WS3B 3MR6A 3NASA 1SXEA 3DVGX 1LO5D 3GIMA 1YQBA 4OO1J 2L52A 2PJHA 1E8XA 3GV5B 3ZW3A 2ZIVA 2J6TA 2MUTB 2N9KA 4ZRKA 1JROA 3CF6E 1HZ5A 1FEZA 4GDLA 4KLOA 2LD9A 2VA2A 4RQ6A 1T7PA 1WXAA 2LVPA 5AKZA 1BGXT 2DWQA 5DDMA 4EEYA 3ORYA 4IS7A 4M0WB 4IG7B 2PMZF 2FUHB 1NK4A 1CQVA 5AM3A 2W8KA 5EWFA 2ZNVB 3WAPA 4CRXA 1ZQLA 2YMQA 2KZ3A 2X38A 4QZ9A 1ZQJA 3T9LA 1ZD2P 2BR0A 2KIWA 2JZBA 2MP2A 1Z1BA 3R9KA 2JEGA 1L5UA 4K7SA 1N62A 3LB8C 3SV4A 1T3NA 2K8BA 1SV4A 3UGBB 2J42A 3OWEB 5DB9A 2F1JA 5KG4A 2GMIC 1ZQBA 3MC0B 4KLMA 2BF8B 3GZNI 1MHHE 4RGOS 4Q2JA 2GH1A 4Y2UA 2N7DA 3OJ3A 4TQSA 3B1LX 5KFUA 1WXVA 2WXQA 4OVUA 1V38A 1KKXA 3JPOA 4BDPA 4REZA 4LTUA 1JWBD 3ZDTA 1KM7A 3WK4A 1ZQMA 3B0AA 3ZJUA 1OQYA 1P9DU 1TJEA 1M6YA 4B9LA 4QWEA 1Q10A 1AWDA 4M6WB 2ZTCA 1F52A 1VZ6A 4P1BC 5KFXA 4ZHPA 1T0QC 2D6FC 5BMHA 4FULA 2HHTA 1OTRB 4FN2A 1PYWD 1KRPA 1KLUD 1MFWA 2VA8A 4RNMA 1VZ7A 4DOCA 3JSVB 3N1ZC 3GZNB 1S9FA 1S0OA 1J7AA 4E71A 4QZ8A 4PS3A 2YMPA 1UT8A 1L0YB 1WWUA 1LV5A 4WH4A 1ZXIA 4J9PA 3AE1B 3PR4A 2FIDA 3HP6A 4CF3A 9ICUA 2N9EB 2W55A 5AKIA 2O6VD 1F0MA 2Z0EB 1M4VA 7ICNA 2KSOB 1WJ6A 4QJFB 4US9A 2LZ6A 2YLMA 5J2DA 4J9NA 2EAMA 2G08A 5FKAC 4BOZB 2WWZA 5IP4D 2WGSA 5ALFA 3Q8SB 3RRHA 5KFHA 1XT9B 4NLCA 5KL1B 2ZIWA 4J3OD 4LDTB 4DHJB 3VUXA 4YMOA 1V6EA 2HHUA 2KDBA 3KHLA 3H8HA 2IA6A 3AEAB 4A55A 1JXEA 4BJQA 3A9JA 3NRZA 3JPNA 5J0PA 3KUZA 3DBSA 2MH7A 5L1MA 2LM1A 4ANXA 3PNCA 2D3BA 3AE8B 4R3DA 3IBEA 3H8WA 4O3PA 4DHZB 4DWFA 5DKWA 4AQ7A 4BBNC 3FM9A 2BCVA 3KTQA 2MJ3A 3EUB2 1XU4A 2XGQA 2J0KA 5ALHA 5EE3A 4MFFA 1CI4A 4IUMB 3ZXRA 2LHTA 3ZNHB 4ELTA 3UMGA 3HRDD 2XCPA 4B9NA 5AK5A 3RB6A 7ICPA 5JH5C 1X1MA 4JIOU 1TS4A 2PIAA 5KFIA 2F44A 2JV3A 1NK7A 5HFYA 3AQFA 4A6QA 8ICRA 2DAFA 5HHHA 1WFYA 3FILB 4LCDE 2DAJA 1QSLA 2JH1A 3PMNA 5J2GA 3OGUA 2AGOA 1JWMD 2KWUB 2VA3A 2NVUI 4MJSB 3RNBC 4G50A 4M8MA 3GFKB 2WDVB 1LQBA 3M8SA 4JV1A 4I27A 5ALMA 3VUWA 3QUTA 1WWTA 5KFTA 2A19A 4DSEA 2DUYA 2CHZA 3RB4A 1I35A 1XC9A 4ZOHC 1OGWA 4QZCA 3Q3NC 5E6OA 1SIJA 1WYGA 3D2SA 1L7YA 4B0MA 3TBLD 1CMXB 5DPSA 3W1YA 5KHQA 4FO6A 5HP4A 2CU3A 4B0EA 2AWTA 2F1HA 3L10B 3KBBA 3VR8B 2C9WB 8ICOA 3Q3FA 4J9MA 1M94A 3GZFA 3WAMA 4P0QA 1I4GA 4LJXA 1SE3A 2F77X 4EZ9A 7ICUA 2P66A 1YN3A 2WXMA 2KFKA 1TS3A 1TZOA 2EELA 2IBIB 1X9WA 4KGSA 2M8SA 4FLHA 4F8RA 3C2LA 2KD0A 2LI6A 4M0AA 1K50A 2QARA 5DBBA 5AKKA 1ZPSA 4JWSC 3H0RB 1MQ3A 1D6EC 1R7SA 3V7KA 1UF0A 1U9LA 3NOBA 2E1FA 3QXGA 3BYTB 4XE0A 4ELUA 2ZW1A 4JE3B 3Q2AC 3N4MB 2TSSA 4IM0A 1QQ7A 2KVSA 1UGMA 8ICVA 2BYEA 4F91B 4I6LB 3OSPA 1CRXA 1S3SG 2FBWB 1ZQKA 2BPCA 4IL6U 4DQPA 1V9JA 3RYTA 3NTUA 1NK8A 1NKEA 2WDTB 1FD6A 4RNNA 4B9KA 4MF8A 1PFDA 4GB9A 2MRPA 5CHWA 1L3UA 3ZD9A 5J2BA 2KP7A 3RMKC 3TEZA 2YB4A 4NPNA 1F2RI 5DG8A 9ICKA 2FE9A 5KFSA 4PGYA 7ICMA 3RB0A 3SDLC 4W9GA 2ATLA 1JW9D 3I1YA 4R8UA 2ACZB 2KNBA 3DWGC 1CJEA 1E7PB 1O08A 2BKFA 2DBYA 2N9LA 5IA7A 5F9LA 1S76D 2RDGA 4F4YA 4KGTA 5CWRA 4S17A 3ZQ4A 1I4HA 2NO4A 1JWUD 2MU2A 4RNOA 5CB1A 3KWLA 2RPVA 1UCVA 4KX6B 2ZVOA 1A70A 4KLTA 4CYEA 3W9CB 1PK1B 2R8KA 1ZOLA 1WGDA 3GIKA 2Y5BB 4KMUA 4CHKA 4LZGA 3AECB 4OVZA 5HR7A 4XWTA 4PHAA 2H88B 1IIPA 3M7DA 5DQIA 1BNPA 3RR8A 3DHIC 3CRXA 4OZAA 4K7UA 2LPEA 1JIHA 1TVAA 1Z5SB 2Q0ZX 4P0PA 1WYWB 2F1IA 3IM1A 2XVTA 4YCXA 4ECRA 1D5ZC 3ZJVA 2PFQA 5TR5A 1CK1A 2Z0DB 3GU3A 3RB3A 2M17A 4EELA 1VLBA 4NAWB 2WHEA 1LVHA 3R2TA 2F3NA 5AICA 8ICIA 1PQSA 1ISNA 3RBEA 3M6KA 4AYBF 4BKTA 1SKWA 2HI0A 2KMDA 1SXTA 1FFVA 1WX7A 5ALUA 3AM9A 4MH0E 4QAYA 1T6BX 4M8NA 2INPE 4OVVA 5BO4B 5L1KA 5HNKA 4P4OA 9ICJA 2L0FA 4ECXA 2AGQA 1S0NA 1B22A 1NOMA 2M19A 4UB8U 4PK1A 1LKYB 1KJTA 1KLVA 4BXOA 5J0YA 4F7ZA 3OJUA 2EAPA 1NYRA 2L32A 4M9HA 1T8EA 1XSLA 4XQ8A 3HHMA 1YZ7A 5L1IA 1MG4A 2J0MA 2GOWA 7ICFA 4ZYSA 4RZRA 4NJ7A 2P35A 4WWOA 2MW5A 3T3FA 1Z1VA 5KFQA 2E1EA 4KSLC 1JQ4A 3Q8BA 2JR5A 1WMHA 5KT4A 2QSDA 5KFDA 3MC9A 1L3VA 5AK4A 1EWCA 3L16A 2MAXA 4B9VA 4Z6DA 3OJ4B 2BCRA 4LDTD 5LNK1 2W04A 2VZKB 3EPGA 1RRBA 4KLGA 1SJED 4CGZA 9ICIA 1TE2A 3HPOA 3T5LA 2VRRB 5CHVC 3TI0A 2ISOA 4MM3B 1ECWA 5HI1A 2F8LA 1D3ZA 4HYKA 5KFCA 1Z00A 3QUBA 3RR7A 4O3NA 2O6KA 4NM2A 1KH0A 4KLLA 4XDDA 1T3QA 1NZBA 5EOZA 1L4ZB 3PX4A 1D4BA 2GBNA 2ZPNA 4DL7A 1RWSA 2QIEB 5H8YE 1BUIC 5G5GA 1C9FA 3CWIA 5AM1A 2YN4A 4FJYA 4II3B 4B6WA 3FYHA 4OJOA 1EU4A 2L76A 3SYZA 3QU7A 2HSZA 3NRWA 1V9PA 2JZPA 3GILA 4EZKA 1UBQA 4ECQA 2BS3B 2K8CA 4YR3A 2BWES 3TADA 1TK0A 3RF9A 4NZLB 2YB1A 2W9CA 4YR0A 3JPTA 1PVPA 1ZW7A 4YN4A 3THVA 4ARIA 4FZLA 8ICPA 4Y2QA 2ESEA 5J0WA 3EW9A 4QNLA 1BMLC 2FPLA 2HHQA 1C20A 3TIXA 1KN5A 1N5WA 1GAQB 2IGDA 1RM6C 2V0GA 2LASA 1ZKHA 4PH5A 2A4ZA 5IIMA 1NYQA 4BVUC 2BW2A 3PSFA 2NMQA 4ITKA 1X42A 1NK9A 2AJQA 3IRUA 4MGYE 3ZNID 3QAQA 3U7ZA 3ZDCA 3RN9C 2QB0B 3LDAA 3NS8A 1D5MC 3OLMD 4FA6A 2L1AA 3QZ7A 2IDYA 2W9NA 2G4DB 3K9PB 4N6EB 2ASLA 1C76A 8ICWA 2WHIA 3UI3A 3ISBA 3V6JA 3VTWA 1WIAA 3E56A 2MX2A 4QZFA 2J4XA 1NDDA 2JXTA 4BKSA 3RJJA 1SXDA 1HJPA 2KAJA 1TK5A 3AEDB 1IBXA 3LK9A 4IKGA 1E10A 3SEBA 1AN8A 4FHKA 4BAXA 1D9DA 3KKAA 1EF1A 3Q3JA 3F53A 3IHQB 2WDQB 2AGPA 2ZCCA 4ECSA 4AS1A 1QOFA 2W9AA 3QE9Y 1KLGD 4P16A 2PTLA 5ALPA 4AJWA 2W43A 2FMPA 1ZQTA 4Z6EA 4W9KA 3ZNZB 4O3OA 1ZYQA 3EHVA 3K75D 1N6ZA 4ICAA 2M1MA 1VD2A 3TMPB 1OW5A 2NBVB 1ZXHA 2KJ8A 4MF2A 3C0RB 3DBLI 4FXCA 4LK0M 2PVGC 1IYFA 4EYIB 5BYSA 3M6ZA 3R3MA 4RM9A 4ZRJA 4J9QA 1TY2A 1NVID 2MBEA 4UAYA 4EZLA 2JYEA 2PE6B 3C8YA 4BKGA 4G3XB 3WU2U 3KH0A 3JVZX 3M8RA 1U47A 4NJ6A 5IIJA 5KG1A 4RQ1A 2KJRA 4XX5A 4IM2A 2EMTA 2D3CA 4K4HA 1N2XA 2V3PA 3URYA 3LYYA 5AI9A 3AXCA 1MI0A 4OJLA 4MEXA 4JQWC 5J2EA 4IC9A 2D2QA 2W03A 1MSWD 2JQRB 3TADC 1BPBA 1ED1A 4FZMA 4B6JA 3TQ1A 4F5QA 3PSIA 1EU3A 2O6VB 2Q5WD 3ZKJC 3AUOA 5J0TA 2L00B 2FUG1 3QC8B 3A33B 1X2IA 1Y8RC 3Q8FA 3IAS1 2HBMA 1IXRA 1C4AA 2IO1B 4NLGA 3P4SB 2BPSA 2O2VA 3ZDDA 1J97A 1P3QU 4O1NA 2BT6A 3MFGA 3RNGC 5DBCA 4ICUA 3ZD8A 4HK2A 2JYTA 4KZCA 4UDUC 2NRWA 2KHQA 2KQ7A 3KYCD 5DB6A 3RJGA 3Q8RB 1X6IA 2BDPA 2KK0A 1ZQCA 4KLQA 7ICEA 2PVOD 4KKIA 4A90A 2XY6A 1TKYA 2H5XA 2XK5B 2DFLA 5ALWA 4JK1A 4GGQA 4O3RA 5DB8A 4F71A 4UBCA 8ICUA 2WF5A 5AI8A 5B66U 2PXIA 1XLOA 2K60A 2H3IA 2WQYB 1J7CA 5DQGA 1KTQA 3VDZA 4ZDVA 1NZPA 2Z59B 4DDGD 1KOTA 1N5XA 2E8MA 4M9NA 1WY8A 3TFSA 4DFPA 4HPPA 1UD7A 3MC1A 2ZJ8A 3KKAC 2V3SA 3K1RB 5BOMA 3UPQA 1AROP 3TKAA 1OFFA 1WUDA 2Z7JA 1C77A 1N56A 4HDOA 2A1JB 5A0LA 1WGHA 1JALA 4U6PA 2KZMA 7ICGA 2FE8A 2ZW0A 4YD2A 4A9AA 2RHFA 8ICQA 2K8AA 2XY5A 1T94A 2CHXA 2NV3A 5AIAA 2UVRA 4JGHB 5KFRA 2L7RA 4AJYB 4M9GA 2MUTA 7ICLA 2GRIA 2KJ5A 4I2AA 2PFNA 4UATA 4DQIA 2ZTDA 2C7HA 3QUCA 2EKEC 3SMVA 3NUHB 5GTHU 4AUQC 2IO3B 2C2EA 4DSFA 1TTNA 4KIKA 2LVOA 5J2RA 1ZD3A 2FIFA 1IUEA 3M9NB 3LXFA 4I2BA 1Q5WB 4EKUA 1L7OA 1WGYA 9ICHA 3DVNU 3OHAA 4C4TA 3QNMA 2LGSA 3BQ0A 2GBMA 3NZ3A 3RNFC 1IGDA 4IR9A 2MSNA 3GQCA 3MFIA 4Y2RA 1UT5A 1X40A 3PRPB 2BKEA 3B9JA 1IP9A 1J0GA 1P1AA 3PO4A 5D4BA 4YXDB 5AI6A 3PZDA 4M2YA 5DLGA 3PREA 5JXVA 1H8CA 3ZTDA 5ALKA 4MT5A 4I2GA 5CP2A 3B0XA 7ICHA 3PMLA 1IPGA 3UXOA 4DFMA 3VFKA 1I4XA 3KZXA 2KN7A 1RLFA 1SZHA 5KFGA 4M9LA 4FS1A 3QU9A 3LDZE 5IIIA 3H4DA 3Q8KA 3RFZB 3BQ2A 2M4NA 5KFAA 3JSVA 3A0BU 5D46A 3H7PB 1FRRA 1SIFA 1BPYA 2MJDA 1NKBA 3I63C 5DG7A 2HDOA 1WE6A 2C2RA 1SL0A 4O5EA 2LUMA 2JH7A 5D94A 9ICVA 3QEBZ 2YMMA 1WXMA 4KLFA 4F4XA 5AM2A 3T79A 3P4RB 1CUKA 2KSOA 4N59A 2MLBA 4EFOA 5IILA 1ZUD2 4QIWC 1HQRD 1PDXA 4HPMB 3N1XC 3ETRA 5LXHA 3ONNA 1VZ8A 1UZXB 4HAIA 3RD2A 4CQNA 8ICMA 2YX8A 2KO3A 2RLTA 1F1HA 3E9SA 3PS6A 3R7RA 1BXTA 4IM3A 4N58A 4DXAB 1BVSA 1L2NA 1UWMA 2PKEA 2KV2A 2LJIA 3VRAB 2SAKA 5J17A 4F93B 2LI5A 2IOHA 2DHZA 3P42A 7ICKA 2MBHA 4G0NB 3QX7A 2LMRA 2BVCA 3VHTC 2NPTB 3APFA 3SFDB 3O13A 5BMGA 2KT7A 2H89B 1QT9A 4J03A 5HG2A 2AU0A 1DOYA 2QC8A 2EZXA 1J19A 4YVZA 1UHUA 2CPRA 4UAVA 1ZQXA 3PLUA 4TUUA 4LVSA 4HWIB 1ROEA 3HUIA 2G5HB 1B4FA 2WXOA 4RM8A 1ZQQA 2KMCA 2KANA 2V4LA 3MP9A 3V6KA 4NLZA 3ALRA 2OWOA 3DWMA 3ZO5B 5KT7A 3BS5B 4GXKA 3ZIMA 2G06A 3T3OA 3TAPA 1ZGUB 3MR2A 2SEBD 4FHJA 3MGVA 2IO0B 2JPHA 2DPIA 4KLSA 1UGJA 1ZE3D 2GLSA 2C22A 3WKBA 3C19A 3EPIA 4DF8A 3BK2A 3GOEA 2XCAA 3W5VB 1R4MI 3AEBB 2HBJA 3U4EG 1AW7A 4O9MA 2OJRA 3HKZC 3KFUF 5ALDA 1FRDA 2LHDA 3ZRFA 3PHXB 1KSPA 1TKGA 3TJPA 2H3ZA 5C23A 4CF5A 4Q8EA 2LJ5A 3I57A 4M01A 5MPOA 4PYUA 1I4QA 4QWBA 1SV0C 2D3DA 2VKQA 2DKZA 4OD0A 4C4RA 9ICAA 2IGHA 4O5CA 2WXHA 1SE2A 2XC9A 4DHZE 1F44A 3BS7A 4OJ5A 4AP4C 5ALZA 2RD0A 3JW0X 4HRSA 2WP9B 3MJWA 3CMMB 2PFPA 5G55A 2DZMA 2KWDA 3RFAA 2RR9A 4NXZA 4JPSA 4PS8A 3MJ5A 5AKJA 4L2YA 1TK8A 1MG8A 3N7SC 2Y9TA 1N61A 4GDLB 3ISDA 4HDQA 3NVZA 4C4VA 5J0XA 1L3TA 5J2CA 2ZXHA 2C2DA 3WA0A 2KWCA 2JZBB 1HE8A 4E3CA 2JT4B 1RDFA 3B2GA 4NNJB 1T0RC 4EX7A 4F5PA 3Q3MC 5KFFA 2K8BB 1NJZA 1I4PA 1JUDA 1RPLA 4XGAB 3VVWB 3P4QB 2ZJ5A 4O3SA 2KTQA 2NBWB 4RPZA 1ZQHA 3QK0A 2UVUA 5D3IB 3BK1A 1L7PA 1LB2B 1FXAA 2K25A 3VR9B 5KFPA 2DYMA 2KDIA 4A8EA 2AQ4A 3DPDA 4JWUC 1Z2MA 2D10A 3W1SC 3BY4B 1QCKA 2NRTA 1WH3A 1I42A 2KYWA 4PHDA 1HXYD 4EUTA 1ZDVA 1ZQWA 3SEIA 4FBJB 5D6JB 4K3BA 1NNLA 1NK0A 2BCQA 2V3NA 2ICIA 1PK1A 2FCSA 3QU2A 5AEKB 4G3IA 1ZQOA 5DGBA 1AYFA 2J53A 3I5JC 4JWNA 2PI4A 2J6UA 1QLNA 1K52A 3F5AA 4IRKA 3IFWB 4RQ5A 2KOBA 2W54A 3HM6X 3JPQA 2BQUA 1E8YA 2C7MB 4ANVA 2Y5CA 1MPEA 4KLHA 3OG5A 3C2MA 4W9EA 3AQEA 3F2BA 4Y2XA 5AKXA 1V5TA 3OSNA 4F3OA 1SEBD 4LJPB 2KOXA 4NAWA 1C78A 4MEYA 2LRUA 7ICQA 2WU5B 3QUQA 2HVIA 1MQ2A 4I2FA 2KD1A 1RZTA 2GI9A 2W9BB 5J2FA 3AN1A 2ZIWB 1YN5A 4PL2A 2PEAA 1WM3A 5KFMA 5KFOA 1V1OA 2XEWA 1WGGA 1RYUA 5JTIA 1L5PA 4F5RA 3WIMA 4GFJA 4MSQB 4EEWA 4GIBA 2I5HA 1KDHA 1EWYC 1YQ4B 4TQ0A 2XY7A 4GC7A 1P7EA 3EZ5A 1ZQZA 3BZCA 4RU9A 2ZUDA 1TIFA 3DHGC 3PGEA 1K51A 1Q1OA 4YFKA 4YSYB 2JZZA 5KFEA 3ZTCA 1QQ5A 2JRZA 3OJSA 4DL4A 1OQRA 5IAAC 2ASJA 4USAA 4MGZE 4PYZA 4F4ZA 1B9RA 4DFKA 9ICXA 3AE2B 1TYGB 1F0ZA 1U49A 2RRDA 1UQVA 1UA0A 2HOQA 2KMAA 1YIWA 4AWJA 3MR5A 4F5NA 4BWJA 3GDXA 5BOLA 1XNSA 2IHNA 4W9IA 1XO1A 4FJZA 4IW0A 1KFSA 5BPCA 3TACB 3QWZB 4FFDA 4RFBA 3TCAA 1HUZA 2IJ0A 4KDIC 3N97B 2NS5A 1SL1A 2UU7A 3U52E 3D6JA 4EZ6A 1SKRA 4NJ8A 4ACFA 3NJTA 3AL0B 1GC6A 1JRUA 1H4RA 1OQQA 1V1PA 1NK6A 1ZQVA 2K22A 2ZIXA 3KD3A 3F2CA 1IGCA 5D7GA 1L4DB 3ZRCA 3VTUA 3GE8C 3H8JA 4LJOB 4TURA 1ZQIA 2ZEQA 3N30A 2JHDA 1N48A 2KHWB 3HJEA 3RH4A 1VR9A 3Q6BA 2LYHA 5AM0A 3CIRB 3RJKA 3VXWA 5AHXA 4UW9A 3RPFC 2KK8A 4KSKC 2HHSA 2W3SA 4K81A 3WK7A 3H40A 3WANA 5TSSA 1E9MA 3KUCB 1PUTA 3Q8AA 3BIID 4RGTA 2ZVNA 2KHVA 3M95A 1TAUA 4P0QB 4Z6CA 2G1EA 3IVFA 3MHSD 4YTMB 2K4IA 3VC8A 2RMMA 2KFKB 4DOAA 8ICXA 3N20C 3N7PD 1QSYA 1Q0WB 1PGXA 3RAXA 1WJNA 3PV8A 2C5LC 3UIPB 4RQ4A 2KC2A 9ICSA 4GSWA 2UWQA 3PZPA 1WSPA 1DGJA 2CRXA 2ZG6A 5AK6A 5GTIU 4BZAA 2LXCA 4NQLB 1S0VA 4P4PA 2KE7A 2I1KA 3QHTA 4W9FA 1X9XA 3SAGA 7ICVA 1WR1A 4WJNA 2IPKD 2FPMA 1I4RA 3PX0A 2UYZB 4YXMA 4CCHA 3BYYB 3JPPA 2OEHA 3N9YC 5CRXA 4UAZA 4TUPA 3RUIB 4IRCA 1FM0D 2NTSA 1TAQA 2W7PA 5IIKA 4RCOA 3C29A 3ICXA 4Q45A 1TAMA 1TZ1A 1OEYA 2ZCBA 4HKQA 2DLBA 1DK3A 5AKYA 2QB0A 2BKRB 1TS5A 4ED8A 5DPWA 2IY0B 3DQVA 4TSSA 3V72A 3PO5A 3A1QB 2FI1A 4B9UA 4C0ZA 2YEPF 4RQNA 4DL3A 1Q8KA 2QB1A 3S6JA 2FLNA 2MQJA 2R8IA 3NVWA 4R8UB 9ICQA 1ET6A 3UMBA 2DYOA 2ZIUB 2GBRA 2KTRA 3F5EA 2AQ1B 1Z4NA 2JEIA 4EX6A 3PZ7A 1GUAB 2K3UA 5KHOA 2H3QA 4DL2A 1JX4A 2HTME 5H92C 2Y5PA 1G6JA 2HW3A 5KG2A 2XGPA 4JWMA 3OAWA 2WAQC 3BDPA 1NJYA 2J52A 4KTQA 2IYDB 3PVLA 5KG5A 4BOSC 2OJWA 2M0NA 5AIBA 2AYOB 3CP8A 3APDA 4I2JA 4DOBA 4NL9A 4WJ3B 3ALBA 1GO3F 4P7IA 4DF4A 2MA1A 2LWPA 1Z4OA 1BPXA 3APCA 2WX0A 2GBJA 2K6DB 4QZAA 2UVWA 4DWIA 4P0PB 1YN4A 3PO0A 3UQ2A 5DQHA 5ALVA 4WJPA 4WQMA 3KWVA 3R8BA 1P7FA 3M9MB 4PL1A 4WQOB 4NV0A 5KT6A 1VDVA 1XD3B 1YJ1A 1ZOYB 2WXJA 2WXFA 1ZQ1C 1JMSA 5DLFA 5KFWA 3RJEA 2D07B 1DOIA 4PHPA 2ZTEA 2BB6A 3ZVVA 1RXWA 1RXVA 3PR5B 4GLSC 4DS4A 3LJ3A 1HEKA 2BYVE 2KXJA 4DL5A 1Y88A 5AI5A 3AE4B 4YQWA 1NI2A 3RZFA 2NRZA 2Y0SC 4Z6FA 1RAXA 3N3KB 2VIXA 4PZNA 1SWVA 1V8CA 1O03A 1BT0A 3M9OB 4R64A 3MBYA 2V4IB 4JL9A 3U8ZA 1QOAA 2CKHB 4F8CB 2REXA 3MGHA 3UMCA 3DOWA 3W5UB 4DS5A 1P7DA 2NR2A 2O6VA 5DG9A 2INCC 5KAFU 2HHWA 2M56B 3PW5A 5EWGA 4BXOB 4UB5A 4DO9A 2DZJA 4BFRA 4FBUA 3FAHA 3AEEB 4ECUA 4NY0A 4YTPB 4R63A 1GG3A 4R66A 1ZQGA 4QZDA 2AEHA 4Y2YA 5ALRA 2WB1C 4WWNA 1F5SA 3S2AA 2BCUA 3LYSA 1VJKA 2I2YA 3GV8B 5FR6A 4ASWC 1RYSA 4BUGA 3Q8LA 2EKIA 3R2IA 4F5OA 1D8LA 2MBQA 2LGXA 4ED2A
chains in the Genus database with same CATH topology
3AE6B 4J3OD 3H8HA 3AEAB 2XN9C 3NZ3A 1IGDA 4A55A 1FCLA 1KRHA 3NRZA 1WGKA 2LMCA 2WXLA 4OHJA 2MH7A 1SE4A 1F2RC 3BZDB 1E6EB 3AE8B 1STEA 3B9JA 3HVZA 1VRAB 4R3DA 1QF6A 1FCCC 4YXDB 4AQ7A 1CZPA 2MJ3A 3EUB2 5JXVA 3HVDA 4MT5A 1L6UA 5EE3A 3NVVA 1K53A 2AX5A 1I4XA 3HRDD 1ET9A 3P1MA 1DOXA 1TS4A 2PIAA 1ACCA 3RFZB 5HFYA 4A6QA 4ZRPA 3FILB 1FRRA 2D5GA 2MJDA 3Q8EA 4PT5A 1MHXA 1JWMD 2AQ2B 2LUMA 4RF0A 3TEWA 2QILA 2WXKA 4YSZB 2WDVB 3V05A 3Q69A 2Y3AA 3P4RB 2MJEA 1WRIA 3TEYA 2NTTA 1JWSD 4N59A 1WWTA 1GPXA 1YJJA 2PW9A 1ZUD2 1PDXA 1HQRD 4ZOHC 3ETRA 1SIJA 1WYGA 1TKEA 2W82A 1VZ8A 4B0MA 3VQIA 1YJIA 3NS1A 4WIPA 2CU3A 4B0EA 4CQNA 3E9SA 3VR8B 1BXTA 2JSVX 4N58A 1UWMA 4OZBA 2KQ4X 2LJIA 3VRAB 2SAKA 4WAFA 1I4GA 3J9CA 4DQOC 1SE3A 4YT0B 2WXMA 1YN3A 1RYJA 3P42A 3W2DA 1FNVA 1TS3A 1TZOA 1V1PB 2KDMA 1V97A 2EELA 4KGSA 2RDHA 3SFDB 3O13A 3AH7A 2CJOA 5BMGA 2H89B 1QT9A 5EE0A 1K50A 5AUIA 5HG2A 1DOYA 1ZPSA 4JWSC 1D6EC 2WXGA 3AE3B 1MVKA 1R7SA 1IBXB 3AEFB 3BYTB 1ROEA 3HUIA 4XE0A 2WXOA 2ZW1A 4JE3B 5BYRA 2TSSA 1JWAD 3MP9A 2FBWB 2WXNA 3DWMA 4ZHOA 1C4PA 4IDIA 1L0XB 2KMMA 3T3OA 1C4CA 4C7YA 4YTNB 2SEBD 2WXPA 2INNE 1FD6A 5C2TB 1UGJA 1PFDA 1ZE3D 1WXQA 4DXFA 3TEXA 1UUPA 3MHZA 3TEZA 3BK2A 2JX5A 4HKZE 3W5VB 1F2RI 3B2FA 3ZYYX 3AEBB 3U4EG 1JCKB 1AW7A 1EM7A 1FRDA 2LHDA 3IT4B 2PLPA 1JW9D 2ACZB 2LFIA 1TKGA 2WXIA 3DWGC 1CJEA 1E7PB 2N9LA 2QEJC 2DBYA 4D2KA 4MACA 4L1BA 3I57A 4M0WA 4OZCA 5MPOA 1UWXA 2RDGA 1GB1A 4KGTA 4MH8A 5I4DA 2WXRA 3T3NA 1I4QA 1NEKB 5AUKA 4HROA 3ZQ4A 1I4HA 2IGHA 1JWUD 2WXHA 1SE2A 5D3DA 1FMAD 3KWLA 2BBCA 2RPVA 3P63A 1QOBA 4KX6B 1A70A 1KTKA 4HRSA 2WP9B 4HEA1 1L0VB 3W9CB 1HA5A 2KN4A 3IXSA 3AECB 4OVZA 5E6JA 4IOIE 4XWTA 2KWDA 4RNAA 1D5XC 2H88B 4JPSA 4OZAA 1HZ6A 3MJ5A 4L2YA 4ARCA 3IT6B 1D5ZC 3ZJVA 4GDLB 1N61A 4XDCA 1ZP0B 3NVZA 3AE5B 1CK1A 3ZGZA 5T8IA 1VLBA 4NAWB 3Q8CA 3R2TA 1T5XD 1J7BA 1FXIA 4WWMA 1XCTL 1YMHE 4A8XC 1SBBB 3AMZA 1XF5L 1XLQA 3B2GA 4ZRQA 1SXTA 1FFVA 3AM9A 1I4PA 4TQ1A 3AE9B 1SB3C 1SJHD 3GS2A 1T6BX 4XWWA 2INPE 1SF0A 1JMLA 3P4QB 3EA6A 2XNAC 3V3XA 4TMAB 4JX1C 2M19A 5D3IB 3BK1A 1QKZA 1FXAA 3VR9B 1NENB 2DYMA 1NYRA 2L32A 3WCQA 4JWUC 5BYQA 2B76B 4ZYSA 1UNSA 5FK9C 2JU6X 4P6VF 1HXYD 1ZDVA 3SFEB 2N7JA 1JQ4A 3Q8BA 3PZ8A 2QSDA 4RH6A 1EWCA 2AQ3B 2V3NA 2ICIA 2L83A 5LNK1 2VZKB 2LEKA 1SJED 1AYFA 2J53A 3IAM1 2K5PA 3SR6A 1K52A 3GB1A 2G9HD 2W54A 1DYQA 2BS4B 4MM3B 5HI1A 1QQRA 2Y5CA 1MPEA 1XCQL 1FFUA 2E6XA 1KH0A 1SEBD 1QILA 2HDEA 1C78A 2JWUA 4XDDA 2WLBA 1T3QA 2WU5B 4OW0A 2WNMA 1L4ZB 3ABVB 2GI9A 1D4BA 3AN1A 3W1SA 1N63A 1RWSA 1YN5A 2QIEB 5H8YE 1GB4A 1BUIC 1V1OA 4RGMA 5G5GA 1C9FA 1L5PA 1TY0A 3CWIA 2YEPB 1EWYC 1YQ4B 1EU4A 1YNTE 4TQ0A 5GXGB 4KKJA 4C56C 1P7EA 1N60A 2KACA 2WDRB 3FILA 2JZPA 1K51A 2LHEA 2BS3B 1FIQA 1HEZE 4YSYB 4LLGM 2PMVA 4NZLB 1B1ZA 1OQRA 2PKOA 4USAA 2BS2B 1F0ZA 1B9RA 3AE2B 1TYGB 2BB5A 4ARIA 4RGNA 1PGAA 2N0SB 1BMLC 1N5WA 1GAQB 2IGDA 5BMIA 1RM6C 2V0GA 3NVYA 1QOGA 5FR3A 4US8A 1NYQA 4RFBA 1FO4A 1FNUA 3BVGA 5EE1A 2BW2A 2IJ0A 2NMQA 4ITKA 4KGRA 3TSSA 4YWGG 3U52E 3KLSX 4C80A 1XXGA 3U7ZA 1FEHA 3U2SC 1QLBB 1OQQA 1V1PA 1E0ZA 1D5MC 2VZKD 2L1AA 2IDYA 4N6EB 2K22A 1C76A 1IGCA 2M0AA 3UI3A 5D7GA 1L4DB 3VRBB 3E56A 4H2AA 2J4XA 3AB5A 2JXTA 2E3TA 2KAJA 1FNWA 5EE9A 3AEDB 1IBXA 4IKGA 5G5HA 1VR9A 1E10A 3SEBA 3CIRB 1AN8A 2BYTA 2OEDA 3RPFC 2W3SA 2QMTA 1SSNA 4WURA 1E9MA 2WDQB 5TSSA 2K9XA 1PUTA 3Q8AA 3BIID 4RGTA 4AS1A 1QOFA 4P16A 1KLGD 2PTLA 1JRPA 2G1EA 4YTMB 2RMMA 2BTEA 3BWUD 1PGBA 1PGXA 1Y56A 4HJGE 4GDKB 3BVMA 2I38A 1ZXHA 1WSPA 4FXCA 1DGJA 4LK0M 2PVGC 5BYSA 1KF6B 3AV8A 1L6VA 1TY2A 1NVID 1YQ3B 2JYEA 4RF1A 3C8YA 2IPKD 1I4RA 3BYYB 1XEEA 2OHFA 2GB1A 2MEKA 3N9YC 2NTSA 1FM0D 4C7ZA 5C3JB 2Z8LA 3AE7B 1F77A 1GOZA 4RCOA 2V3PA 4NAMA 3LYYA 3URYA 3ZJTA 1MI0A 4HKQA 2DLBA 1XO3A 1TS5A 1ZDXA 2JQRB 2QJLA 2WS3B 2ON8A 4TSSA 3GP7A 1LO5D 2L52A 1EU3A 1KFYB 2Q5WD 2N9KA 2YEPF 1JROA 2FUG1 1HZ5A 3NVWA 1ET6A 1XLNA 2DYOA 3Q8FA 2DWQA 3IAS1 2AQ1B 2CJNA 1ENFA 2IGGA 1C4AA 4L23A 3BVZA 3P4SB 3PZ7A 1CQVA 2K3UA 3FC4A 2ONQA 3KQ4A 4O1NA 2X38A 2HTME 2BT6A 5H92C 2Y5PA 3MFGA 4UDUC 2JYTA 1C79A 2WU2B 1N62A 3LB8C 3L4PA 2J52A 4A90A 2W3RA 2J42A 2PVOD 3OWEB 4KKIA 1TKYA 3MC0B 2K0PA 1MHHE 4RGOS 4Q2JA 1ESFA 3PO0A 1YN4A 1XLOA 1I7HA 3R8BA 4WQMA 3KWVA 1P7FA 2WXQA 2WQYB 1J7CA 1VDVA 2WXJA 1ZOYB 1JWBD 4LTUA 4REZA 2WXFA 1N5XA 3ZJUA 1TJEA 1Q10A 4DXGA 1AWDA 1RFKA 1DOIA 2BB6A 1OFFA 4EE2A 5HHDG 1VZ6A 4GLSC 1C77A 4ZHPA 2R61A 5BMHA 3AE4B 3I9V1 1PYWD 1VZ7A 1KLUD 1JALA 2ZW0A 3TUOA 2FE8A 1V8CA 4A9AA 2LGIA 2V4IB 1QOAA 3W5UB 4YSXB 1J7AA 3AEGB 3EGRA 1L0YB 1TS2A 1XLPA 2GRIA 2M56B 4WH4A 1ZXIA 1NI3A 3AE1B 3AEEB 2W55A 3FAHA 3P4PB 4YTPB 3NUHB 4NJCA 1M4VA 4US9A 1VJKA 5FKAC 2I2YA 1IUEA 2EKIA 3R2IA 3LXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L6V A;  3AE6 B;  2W54 A;  1NVI D;  5C2T B;  1YQ3 B;  2BS4 B;  1PFD A;  1WXQ A;  2Y5C A;  2OHF A;  3AEA B;  2JX5 A;  1FFU A;  3W5V B;  1FM0 D;  3B2F A;  3ZYY X;  3AEB B;  4C7Z A;  2WLB A;  1T3Q A;  1KRH A;  3NRZ A;  5C3J B;  2WU5 B;  1FRD A;  1WGK A;  3AE7 B;  3ABV B;  2MH7 A;  3AN1 A;  1N63 A;  1RWS A;  1E6E B;  2QIE B;  1JW9 D;  2ACZ B;  5H8Y E;  1TKG A;  3AE8 B;  1XO3 A;  3B9J A;  3HVZ A;  3DWG C;  5G5G A;  1CJE A;  1E7P B;  1L5P A;  2DBY A;  3CWI A;  1QF6 A;  5MPO A;  2JQR B;  4YXD B;  2QJL A;  1EWY C;  1YQ4 B;  2WS3 B;  5GXG B;  5AUK A;  1CZP A;  1NEK B;  1N60 A;  2L52 A;  3EUB 2;  2MJ3 A;  2WDR B;  4HRO A;  1KFY B;  2Q5W D;  1L6U A;  5EE3 A;  3NVV A;  1JRO A;  2BS3 B;  1FIQ A;  4YSY B;  1FMA D;  3KWL A;  3P63 A;  2AX5 A;  1QOB A;  4KX6 B;  3NVW A;  1A70 A;  1OQR A;  3HRD D;  2PKO A;  3P1M A;  4USA A;  1XLN A;  2WP9 B;  2DWQ A;  1L0V B;  2BS2 B;  4HRS A;  3W9C B;  1B9R A;  2CJN A;  1TYG B;  3AE2 B;  1DOX A;  1F0Z A;  2PIA A;  3P4S B;  3AEC B;  3FC4 A;  2H88 B;  2N0S B;  1FRR A;  2HTM E;  2BT6 A;  2MJD A;  5H92 C;  1N5W A;  1GAQ B;  1RM6 C;  1N61 A;  1ZP0 B;  2WU2 B;  1N62 A;  3LB8 C;  3L4P A;  3NVY A;  3NVZ A;  1QOG A;  2W3R A;  4US8 A;  2PVO D;  2WDV B;  3AE5 B;  4YSZ B;  1NYQ A;  1TKY A;  1FO4 A;  3P4R B;  5EE1 A;  2MJE A;  1VLB A;  4ITK A;  1WRI A;  1GPX A;  4N59 A;  1WWT A;  1YJJ A;  4C80 A;  1J7B A;  1ZUD 2;  1FXI A;  1PDX A;  1KF6 B;  4ZOH C;  4WWM A;  3ETR A;  1SIJ A;  3PO0 A;  1WYG A;  1TKE A;  1QLB B;  1XLO A;  1I7H A;  1OQQ A;  3AMZ A;  1YJI A;  1XLQ A;  3NS1 A;  3B2G A;  4WQM A;  1E0Z A;  1FFV A;  2CU3 A;  3AM9 A;  1J7C A;  2WQY B;  4N6E B;  2K22 A;  1VDV A;  1ZOY B;  1SB3 C;  1JWB D;  3AE9 B;  4LTU A;  3VR8 B;  4N58 A;  1N5X A;  1UWM A;  1SF0 A;  3VRB B;  1TJE A;  3VRA B;  3P4Q B;  3AB5 A;  2E3T A;  1AWD A;  1RFK A;  2KAJ A;  1DOI A;  4YT0 B;  5EE9 A;  1OFF A;  2M19 A;  1RYJ A;  3AED B;  4JX1 C;  5G5H A;  4ZHP A;  1E10 A;  3CIR B;  1V97 A;  3AE4 B;  1FXA A;  3VR9 B;  3RPF C;  1NEN B;  3WCQ A;  1JAL A;  2W3S A;  1NYR A;  3SFD B;  3AH7 A;  1E9M A;  1V8C A;  2CJO A;  2H89 B;  2K9X A;  1QT9 A;  2WDQ B;  4JWU C;  5EE0 A;  4A9A A;  1PUT A;  2B76 B;  3BII D;  5AUI A;  1QOF A;  1QOA A;  4P6V F;  1JRP A;  3W5U B;  1J7A A;  4YSX B;  1DOY A;  2G1E A;  3AEG B;  4JWS C;  4YTM B;  3AE3 B;  1R7S A;  3SFE B;  3AEF B;  1JQ4 A;  1XLP A;  2M56 B;  1ZXI A;  1NI3 A;  1ROE A;  3AE1 B;  3HUI A;  3AEE B;  2W55 A;  3FAH A;  3P4P B;  4YTP B;  2L83 A;  1JWA D;  4US9 A;  2FBW B;  2LEK A;  1VJK A;  3DWM A;  4ZHO A;  4FXC A;  4IDI A;  1DGJ A;  2KMM A;  1AYF A;  1IUE A;  2PVG C;  2K5P A;  2EKI A;  4C7Y A;  3LXF A;  4YTN B;  3SR6 A;  3AV8 A; 
#chains in the Genus database with same CATH topology
 3AE6 B;  3T5K A;  1WMH B;  2HHV A;  8ICG A;  1COO A;  1VJ5 A;  4FJV B;  3X0W A;  1UPH A;  2JRH A;  8ICJ A;  4KLI A;  3M62 B;  2N7E A;  4GOC A;  1WM2 A;  2KWV B;  4UB4 A;  4QIW F;  4XA5 A;  2D3G A;  1KRH A;  1FCL A;  1WGK A;  2LMC A;  2WXL A;  4MHV A;  4A20 A;  1SE4 A;  3KHG A;  2JEF A;  4HXD A;  1IV8 A;  3H8M A;  8ICL A;  1STE A;  4MEL A;  2HVH A;  3RI7 C;  1VRA B;  2HCF A;  1QF6 A;  5J8Y A;  3C2K A;  1FCC C;  3TAR A;  1SGG A;  1Z00 B;  4ECY A;  1KFD A;  2J6S A;  4XUS A;  4DK5 A;  1CZP A;  1IG6 A;  3P2B A;  3JYU A;  2V4R A;  5DPR A;  1L6U A;  2OH2 A;  3NVV A;  3QU5 A;  4F50 A;  2EAO A;  2KJH B;  3BQ7 A;  3L54 A;  2XID A;  2AX5 A;  2K39 A;  3PRZ A;  1BPE A;  3P1M A;  3T5H A;  5KTQ A;  2K4H A;  2MA9 B;  2A1J A;  3ML9 A;  4KV2 A;  3V6H A;  4PHE A;  1ACC A;  3AEV A;  1ZQP A;  4ZRP A;  2LM4 A;  3RTV A;  2N9P C;  4PT5 A;  3UQ0 A;  2K8C B;  3G6Y A;  4C8O A;  4RF0 A;  4URK A;  3TEW A;  2QIL A;  4NL9 C;  2C28 A;  3SD5 A;  4GC6 A;  7ICI A;  4YSZ B;  5KG0 A;  3C23 A;  1QSS A;  3RH5 A;  3R7Q A;  2GBK A;  4A3P A;  3A4S C;  2BZF A;  1WJ4 A;  3UM9 A;  2MJE A;  3DBL B;  4HCN B;  1GPX A;  5ALQ A;  3WK5 A;  2BGW A;  1SKS A;  2NTT A;  1YJJ A;  2X8X X;  3KZI U;  4QZH A;  2PW9 A;  5AKL A;  4MFC A;  3SZ2 A;  4C8M A;  9ICE A;  3HX0 A;  3F2D A;  4TKN A;  1Q46 A;  2FCM A;  1TKE A;  2W82 A;  5KFZ A;  3VQI A;  4ED0 A;  1DK2 A;  1X6J A;  4PGQ A;  1IM4 A;  2QKQ A;  1L8L A;  1A76 A;  2RDJ A;  5ALS A;  2IMW P;  2DX5 B;  3I3T B;  3SQI A;  4RPX A;  2JMG A;  2KQ4 X;  3QEA Z;  2KVZ A;  2PPH A;  3HKZ F;  3J9C A;  4DQO C;  3UF8 A;  4F4K A;  4YT0 B;  3W2D A;  2R2Q A;  4DQQ A;  2KDM A;  2KX0 A;  1V97 A;  2RDH A;  1C7Y A;  1ZRM A;  3KHR A;  3DDC B;  1QQ6 A;  3C1Y A;  5TIS U;  4IRD A;  2CJO A;  4ACO A;  1D8Y A;  1NJX A;  2FMS A;  3AH7 A;  5AUI A;  1K8R B;  3EFC A;  4YMN A;  4DL6 A;  3H0L B;  9ICW A;  3NZS A;  2EZZ A;  2WXG A;  5J29 A;  2WF6 A;  1MVK A;  3AE3 B;  1IBX B;  2CS4 A;  2I9G A;  3L13 A;  5KT2 A;  4EEK A;  4JMU A;  5BYR A;  1ZJM A;  2NO5 A;  3RH6 A;  2FNJ B;  3C21 A;  5T14 A;  1ZQS A;  9ICR A;  4ECZ A;  1QZE A;  3B0Y A;  4P4M A;  4ZHO A;  1C4P A;  2IND C;  1L0X B;  4UAU A;  1Z3E B;  2EAN A;  2DPJ A;  4K7W A;  1C4C A;  4YTN B;  2INN E;  1OXJ A;  1HTQ A;  4LNF A;  4TQR A;  4DXF A;  1UUP A;  5KT5 A;  3MHZ A;  5DB7 A;  2Q4T A;  3Q8Q B;  3AU6 A;  4DSK A;  1DGS A;  2QCZ A;  3ONS A;  2NRV A;  3B2F A;  5J8Y C;  4K4I A;  4J6I A;  4YXJ A;  3G6V A;  3IT4 B;  1SWW A;  3BQ1 A;  2N1W A;  2LYA A;  2OOB B;  2LFI A;  2PLP A;  1OUQ A;  2WXI A;  3BQT A;  1RQL A;  5D2M B;  2QEJ C;  1E8W A;  2KZZ A;  3C1Z A;  3EWA A;  1LM8 B;  4M0W A;  2R18 A;  2FCN A;  3V61 A;  5I4D A;  2WXR A;  3T3N A;  1ZQY A;  1NEK B;  2ZZP B;  5AUK A;  5LLI A;  1EO6 A;  4Q44 A;  4P2H A;  2AHO B;  2WF8 A;  1LFD A;  1R4N I;  1ZQE A;  4F2S A;  3MC8 A;  3VAW A;  4EZJ A;  2ZJA A;  3PHW B;  2BBC A;  4W9H A;  1QOB A;  1KTK A;  3IG3 A;  4IWP A;  4JUZ A;  1L0V B;  2ASD A;  3U26 A;  2PE9 A;  3RZW C;  2KN4 A;  4EBE A;  1RFA A;  4MSM B;  2DKX A;  3HWT A;  4FS2 A;  4UBB A;  9ICF A;  4RNA A;  3V62 A;  1D5X C;  2KTF A;  2KFZ A;  8ICE A;  5IKC M;  5KL8 B;  1A77 A;  1URJ A;  2YQE A;  1V5O A;  2WX1 A;  2R8G A;  3RJH A;  3QJZ A;  4MGK E;  4ARC A;  2FDR A;  3H6N A;  2N1V A;  2QHO A;  3HIL A;  5IIO A;  3GV7 B;  3A0H U;  4W9J A;  4RUC A;  5KG6 A;  3ZGZ A;  2CN1 A;  5HR6 A;  3Q8C A;  4ED1 A;  1J2N A;  1HIW A;  3ENE A;  2E8N A;  1J7B A;  4BX9 C;  4M6W A;  2DGZ A;  1R4N B;  3SD7 A;  3BS5 A;  1XCT L;  2E8P A;  4UB2 A;  3RAQ A;  1YMH E;  2K1F A;  3ETL A;  1SBB B;  2KLC A;  1V2Y A;  3DVN V;  4J9O A;  1XF5 L;  3O65 B;  1SV0 A;  3LWM A;  2KX3 A;  3RJI A;  3AE9 B;  1SB3 C;  1SJH D;  3TL5 A;  3UQA A;  4XWW A;  1ZET A;  1JML A;  2KLG A;  1WR6 E;  2WFA A;  3V3X A;  7ICS A;  4TMA B;  1TGZ B;  4EEN A;  4O5K A;  5IIN A;  3M63 B;  4K4G A;  3WCQ A;  3G6X A;  1ZJN A;  2MCN B;  5BYQ A;  1GJZ A;  1LXD A;  2K6Q A;  4RT3 A;  1NBF C;  2KDF B;  2YVC A;  4WWP A;  5E6P A;  5J2J A;  5ALN A;  2JU6 X;  4P6V F;  4M04 A;  1AAR A;  2KJ6 A;  2HOI A;  3SFE B;  1KFT A;  4MGI E;  3NY5 A;  2OYY A;  4K1R B;  2JZ3 B;  4HPL B;  3QYP A;  4RH6 A;  2AQ3 B;  4Q43 A;  3V7L A;  5DCN A;  1S8O A;  3BJY A;  2L83 A;  4MDK E;  1X66 A;  5KNI A;  1ZQF A;  4B9T A;  4XYC A;  2LEK A;  1PUZ A;  9ICB A;  1J8C A;  1D8B A;  2MWS B;  3H1U A;  2HBL A;  2FAZ A;  3NG0 A;  4QWC A;  8ICB A;  3GB1 A;  2G07 A;  3C5F A;  1DYQ A;  2JVC A;  1U4B A;  4DLG A;  9ICO A;  3H4B A;  2CR5 A;  1QQR A;  5TZV A;  1YX6 B;  3IP4 B;  1AQ6 A;  4Y2T A;  1X9S A;  4CDG A;  2E6X A;  4KIK B;  1K1S A;  4RQ8 A;  1QIL A;  2HDE A;  4AOF A;  2B0C A;  4OW0 A;  2WNM A;  5ALG A;  3KOO A;  4DFD A;  5J2A A;  1QH9 A;  2ZNV C;  8ICN A;  1N63 A;  3W1S A;  3UXP A;  4NLN A;  3OHB A;  2DZI A;  2KKV A;  1TY0 A;  2L0T A;  2KC1 A;  1EXN A;  2K4P A;  2BWF A;  2NYV A;  4DSI A;  1YNT E;  1ZQU A;  5GXG B;  5HMM A;  4KKJ A;  2IOF K;  3ZDB A;  5DBA A;  2B6G A;  2WDR B;  1XS9 D;  1Q3V A;  3FIL A;  2GWS A;  7ICJ A;  2MBO A;  2I6X A;  4MJS A;  1HEZ E;  5JRT A;  4II2 B;  2JY6 A;  1B1Z A;  2PKO A;  4HLE A;  4QZE A;  2AH5 A;  2BS2 B;  1ZQD A;  5JHA A;  4RGN A;  1RG6 A;  3L3F X;  3LVW A;  4C4S A;  1C3T A;  2ASQ A;  1L7M A;  4LNK A;  4YD1 A;  4RT2 A;  3GII A;  3A9K B;  3QCA A;  3EEC A;  4EYH B;  2FCQ A;  5FR3 A;  1B0X A;  3PW7 A;  5EE1 A;  4KGR A;  1DXS A;  1TKD A;  3PPA A;  3T5J A;  2KFJ A;  1XXG A;  3U2S C;  3SEN A;  1BNO A;  1QLB B;  1E90 A;  5KFB A;  1E0Z A;  3CNH A;  4UAW A;  3N7R C;  4I29 A;  2P6R A;  2RDB C;  2HJ1 A;  2WF7 A;  2M0A A;  5CJ7 A;  3L17 A;  1R4M B;  2N9X A;  3VRB B;  3AU4 A;  4H2A A;  2ZIV B;  1F9J A;  3AB5 A;  2E3T A;  2OCE A;  2AL3 A;  5IO9 A;  3WK9 A;  4RQ2 A;  2IBK A;  1XSN A;  3VH3 B;  3OPX A;  4CF4 A;  3H7S A;  5F9N A;  3ECI A;  5AK3 A;  2W9B A;  4BKS D;  2BYT A;  3BIN A;  2VAN A;  2QDF A;  4YMM A;  3D32 A;  3RCZ A;  1SSN A;  4WUR A;  3IHP C;  2BCS A;  4N9F 4;  4UQG A;  1WI0 A;  2DEN B;  2ES6 A;  1S97 A;  1X9M A;  1JRP A;  2G09 A;  2MP2 B;  5E79 U;  4YP3 A;  2PI5 A;  2EMS A;  4B9M A;  1S0M A;  4KN4 A;  4IQW A;  1ZRN A;  1UEL A;  4GXJ A;  2DYB A;  4HJG E;  1EUV B;  2ZUB A;  3K9O B;  5FP0 A;  2I38 A;  2ZJD A;  3PRM B;  4S0R A;  2G45 B;  1S1Q B;  4OJ6 A;  3ML8 A;  2LUE A;  1KF6 B;  3AV8 A;  1L6V A;  1NKC A;  2WAQ F;  8ICF A;  1H38 A;  5KT3 A;  3ZUN A;  3MFH A;  2A5U A;  1QTM A;  1XO0 A;  2OXO A;  2OHF A;  1V80 A;  2GB1 A;  1WG8 A;  2MEK A;  4U7C A;  2NCN A;  9ICN A;  4C7Z A;  3QAR A;  2BHN A;  1GOZ A;  1YOV B;  2LGY A;  3MDC A;  5JHB A;  2V4Q A;  3ZJT A;  1C1Y B;  2NBU A;  2L8J A;  5CEH A;  4KLJ A;  1XO3 A;  2VH1 A;  3RUL A;  4WJQ A;  4HVB A;  2W11 A;  1WXS A;  3WKD A;  2QJL A;  1JN3 A;  2BDU A;  2ON8 A;  3GP7 A;  5J0R A;  4JV2 A;  1KFY B;  3C28 A;  3IG8 A;  5CHG A;  2A3V A;  2LYB A;  4A3O A;  3C5G A;  2Y0S F;  1XLN A;  4ECT A;  2CJN A;  1ENF A;  2IGG A;  2XI9 A;  4L23 A;  3BVZ A;  2RDI A;  2FLL A;  5B5E U;  3FC4 A;  3JPS A;  2ONQ A;  1LGR A;  5C5J A;  3KQ4 A;  1ZQN A;  2DQN B;  5L95 C;  4C8N A;  4K3C A;  2I1Q A;  2AQ0 A;  9ICC A;  1C79 A;  2B21 A;  2MRL A;  3FDS A;  4XC2 A;  3VTV A;  2YY6 A;  4NQK E;  5J0Q A;  1DOQ A;  2Y1J A;  2IO2 B;  2WU2 B;  3L4P A;  2W3R A;  2UVV A;  2WTF A;  2V9H A;  4ED6 A;  2LVQ A;  2WB1 F;  4CE6 A;  2ZUC A;  3Q8P B;  2K0P A;  3H7I A;  3A9J B;  4ANU A;  3DBH I;  1B43 A;  1WGR A;  3RNC C;  1L6N A;  1ESF A;  5IN7 A;  2E8O A;  2B3A A;  1LKY A;  5AZH A;  5DPT A;  4IR1 A;  5KFJ A;  1I7H A;  4KLE A;  4I2H A;  3ZNG C;  4QZI A;  2HTH A;  3WKE A;  4C4V B;  5JU5 A;  3TAN A;  1D9F A;  1UH6 A;  5ALX A;  2EH9 A;  4GIV A;  2H3V A;  2JUO A;  2Y9U A;  5AZG A;  5CX3 A;  1XWL A;  4DXG A;  1RFK A;  1E7U A;  1YT3 A;  3DV9 A;  4EE2 A;  5HHD G;  4JLC A;  4BGD A;  1SE9 A;  2KEY A;  2R61 A;  7ICO A;  4AP9 A;  3PSE B;  5J2K A;  3I9V 1;  3VUY A;  3KUD B;  5ALL A;  2JGA A;  3TUO A;  3NUQ A;  4F92 B;  2IZV B;  5HHI A;  4ZYN A;  2PMZ C;  2LGI A;  4RQ7 A;  2M0X A;  4KZ0 A;  3DBH B;  4YSX B;  4YL8 A;  3K1Z A;  2HMX A;  3AEG B;  3A1Q A;  1TS2 A;  3EGR A;  2DZK A;  4IQT A;  1XLP A;  3A4R A;  5KG7 A;  4ECV A;  1MA7 A;  1GC7 A;  1NI3 A;  2D8C A;  4ANW A;  3H0M B;  1T4G A;  3LWL A;  4KX3 A;  3P4P B;  4MM3 A;  5K4L A;  3SAH A;  4NJC A;  2ZIU A;  3PW2 A;  3SV3 A;  4C8L A;  4I2D A;  2K89 A;  2CHW A;  2WYQ A;  1ZD5 A;  5J18 A;  2KIC A;  4KLD A;  2W9M A;  3D2N A;  3PV1 A;  4KIT B;  3QQ8 B;  1L7N A;  4XZ4 A;  5C1Z A;  5J0S A;  3RNA C;  4ICV A;  1Q3U A;  2C7N B;  3T8M A;  2XN9 C;  4C00 A;  3IG5 A;  3I76 A;  3WAO A;  4RMA A;  4OHJ A;  3PLV A;  2Y1I A;  1F2R C;  3BZD B;  1E6E B;  3SU8 X;  3SAF A;  3FKY A;  5AZF A;  3HVZ A;  8ICY A;  3PX6 A;  2G4S A;  2YML A;  3V6C B;  2EZY A;  2GOL A;  1A5R A;  5L1L A;  2QAR B;  3U7D A;  3HVD A;  5HML A;  3PST A;  1PVR A;  2HD5 B;  3QIJ A;  1COK A;  2RGF A;  5AI4 A;  1K53 A;  3E58 A;  1U4A A;  2FPK A;  5AI0 A;  4O0I A;  1ET9 A;  1DOX A;  2OM6 A;  1CEZ A;  3IN5 A;  1K5O A;  1KEJ A;  2BQR A;  1V81 A;  3NZU A;  4KN7 A;  4G11 A;  3WKA A;  5KAI U;  2D5G A;  3Q8E A;  1MHX A;  2FMQ A;  4MEM A;  4J9R A;  9ICG A;  2AQ2 B;  2D3A A;  2J0J A;  5KFK A;  2WXK A;  4DSJ A;  7ICT A;  2BQ3 A;  3V05 A;  2HBK A;  3RJF A;  2KKC A;  4UB1 A;  4IWO A;  3H9D A;  3Q69 A;  2Y3A A;  3KYD D;  1WZ3 A;  5J2H A;  2VJ4 A;  1WRI A;  3TEY A;  1JWS D;  4YR2 A;  5JZE B;  4IQV A;  2PFO A;  2FJ6 A;  1NK5 A;  4CO7 A;  2NRX A;  3CSF A;  1EF5 A;  3Q8M A;  3DVG Y;  4GMV A;  1YJI A;  3UIO B;  3NS1 A;  2XO7 A;  1WX9 A;  2I1J A;  1K1Q A;  2JXJ A;  4WIP A;  3OTQ A;  3AU2 A;  3CYM A;  1JXL A;  2E5S A;  2JSV X;  2JXX A;  3HW8 A;  4OZB A;  2KJ9 A;  5ALI A;  4DHJ D;  3ZDA A;  4HCP B;  4WJO A;  2P6U A;  3I28 A;  2VJ5 A;  2DL0 A;  2H3F A;  4WAF A;  2HE7 A;  4F72 A;  4DLE A;  4M47 A;  1RYJ A;  2GLE A;  4I2C A;  3KHH A;  1FNV A;  3QX1 A;  1V1P B;  4M02 A;  1KQQ A;  5L83 A;  3RT3 B;  2DNF A;  1OEY J;  4Y2J A;  2G5I B;  2ZIX B;  5KFL A;  4QW8 A;  3VH4 B;  5EE0 A;  4QZG A;  1WE7 A;  4DFJ A;  2FLP A;  3HT3 A;  4E0D A;  3EC8 A;  3Q3O C;  1YZ6 A;  8ICH A;  4IQU A;  3AEF B;  1ZQR A;  4KLU A;  2W7O A;  3N32 A;  1V86 A;  1U48 A;  9ICM A;  4Q8F A;  1JWA D;  1L8O A;  4QW9 A;  4GXB A;  3RRG A;  2JWZ A;  3DEE A;  2WXN A;  4PZO A;  4IDI A;  2KN5 A;  2KMM A;  3WK8 A;  2JRI B;  1V85 A;  4C7Y A;  4TV3 A;  4LNO A;  2WXP A;  4PS7 A;  1KBU A;  4NLK A;  1WWV A;  3RBD A;  5C2T B;  9ICP A;  4ECW A;  5CHF A;  1WXQ A;  3TEX A;  3HIZ A;  4F1S A;  2ZPY A;  5CA7 A;  3ZI4 A;  3PSP A;  2A1A A;  2ALZ A;  2JX5 A;  5DDY A;  1V49 A;  2XIC A;  4HKZ E;  3RNE C;  3ZYY X;  4NWI A;  8ICZ A;  1JCK B;  1WJU A;  1EM7 A;  1Z19 A;  4F4W A;  2KG5 A;  4C8K A;  8ICS A;  3E2E A;  5F3X B;  4RPY A;  4XRH A;  4D2K A;  2G3Q B;  4MAC A;  4L1B A;  4OZC A;  2AXT U;  4DQS A;  1UWX A;  1GB1 A;  1KW4 A;  2KVC A;  4OJP A;  5D49 A;  4F2R A;  4MH8 A;  1JI7 A;  4FE3 A;  4PPX A;  3D2Q A;  3MDA A;  3L5K A;  4GXI A;  1SGH A;  1RYR A;  3TFR A;  4I28 A;  3KVF B;  4HRO A;  3ZDM C;  3ZLZ A;  1PVQ A;  2IY1 B;  5D3D A;  2LBO A;  2C60 A;  1FMA D;  3IDW A;  4O3Q A;  5ALT A;  1BPZ A;  2HHX A;  3P63 A;  2KDE B;  3H8S A;  4RUA A;  4NM1 A;  4DDI D;  4HEA 1;  5KFV A;  1HA5 A;  4JB3 A;  3U30 A;  5EDS A;  3IXS A;  2RPQ A;  2XK5 A;  5E6J A;  4CNQ A;  4IOI E;  3JPR A;  2L5Y A;  2R8J A;  1P98 A;  4WAA A;  3PW4 A;  4W9L A;  2IHM A;  1HZ6 A;  3IT6 B;  3O0F A;  4XDC A;  3MGI A;  1ZP0 B;  2BPG A;  5GMV A;  3V7J A;  5AKE A;  2KTR B;  3AE5 B;  3DCG A;  4EBD A;  5T8I A;  2V1Y A;  1T5X D;  2QLT A;  4PGX A;  3MAB A;  2EQY A;  4X5V A;  1SL2 A;  3L0W B;  2F8K A;  5AKG A;  5JUM A;  2ODG A;  7ICR A;  3N28 A;  1FXI A;  4WWM A;  2ZXI A;  3LVV A;  4RQ0 A;  4A8X C;  1E8Z A;  3AMZ A;  1XLQ A;  4ZRQ A;  8ICA A;  1WCN A;  1YD8 U;  4FAD A;  4TQ1 A;  3GS2 A;  1MJD A;  2M9N A;  4LNI A;  3DBR I;  4M9J A;  4P1C C;  1SF0 A;  3NHE B;  1ZQA A;  3EA6 A;  1MN8 A;  2XNA C;  2BQQ A;  2RSU A;  5DGA A;  4JX1 C;  4R65 A;  1NJW A;  5KFY A;  2W9C B;  4J9L A;  1E5W A;  3B08 A;  4KVG B;  4ED7 A;  1QKZ A;  1P0R A;  2HJ8 A;  2N1R A;  1HUO A;  1NEN B;  4W9D A;  4HJK A;  2N4F A;  9ICT A;  2B76 B;  1UNS A;  5FK9 C;  4FZN A;  2LKY A;  2F2A B;  1FXT B;  2N7J A;  3VCB A;  3DHH C;  4ZH4 A;  3PZ8 A;  5AM4 A;  4NLB A;  5C0Y A;  1WF9 A;  1A6S A;  3QZ8 A;  2F76 X;  3AUL A;  5J0U A;  5IOI A;  3DBR B;  4QZB A;  5L9X A;  3WKC A;  1TT5 B;  4J9S A;  5ALO A;  1XSP A;  3PY8 A;  3KW5 B;  3IAM 1;  5E6N A;  4GN1 A;  2K5P A;  3SR6 A;  4I2I A;  2G9H D;  3UXN A;  8ICK A;  2R8H A;  4AYB C;  4ZRI A;  3ISC A;  3N1Y C;  2BS4 B;  1PZN A;  1WZ0 A;  2IOF A;  3L08 A;  5KG3 A;  2JF5 A;  3SI8 A;  1VCB A;  4JV0 A;  4I6N B;  1SZP A;  3V60 A;  4PJ0 U;  1FFU A;  1XCQ L;  4BWM A;  4QWD A;  3SHQ A;  2JWU A;  4GLX A;  2WLB A;  4I6P A;  3M3J A;  3ABV B;  5AM5 A;  4B9S A;  3GIJ A;  2RQ5 A;  2KIV A;  3EFU A;  5EWE A;  2RP5 A;  1GB4 A;  4RGM A;  4UB6 U;  3MTN B;  4MFA A;  3ED5 A;  2YEP B;  4EBC A;  3PTF C;  4YG2 A;  3HM3 A;  4RQM A;  4C56 C;  4Y2P A;  1N60 A;  2KAC A;  3H7P A;  5ALY A;  1S5L U;  4TUQ A;  2LRW A;  3CST A;  3UQB A;  4J9K A;  3EYZ A;  4FBT A;  2LHE A;  4UAR A;  1FIQ A;  1BPD A;  4LLG M;  2KQS A;  8ICT A;  2PMV A;  1HTO A;  3WAL A;  1UA1 A;  4QWA A;  2AL6 A;  2K8H A;  3MR3 A;  2BB5 A;  3CW2 C;  2LXA A;  2KZR A;  3NGD A;  1PGA A;  2N0S B;  4GDK A;  3ZDE A;  2XBB C;  2KVR A;  2DF4 B;  2MHJ A;  4KDL B;  4X57 B;  1TFR A;  4KMO B;  5BMI A;  1RQN A;  1WRD B;  5LXI B;  3NVY A;  1QOG A;  1FPY A;  4US8 A;  5ALJ A;  3QA8 A;  3BZK A;  3PVX A;  1TV9 A;  1FO4 A;  4LZD A;  4ELV A;  1FNU A;  4UAS A;  1KL9 A;  3BVG A;  1J2M A;  3HK0 A;  3TSS A;  3X23 A;  4YWG G;  3IV6 A;  3KLS X;  4BBN F;  2L3Z A;  4C80 A;  2JEJ A;  2D11 A;  4LNN A;  1FEH A;  1E7V A;  3ZXV A;  2J7Q B;  1YX5 B;  9ICL A;  1KLN A;  2GO7 A;  2R2O A;  2VZK D;  2NPT A;  5J2I A;  1L3S A;  2KFN A;  1ZD4 A;  1GNU A;  3M1Y A;  3QU4 A;  5H2F U;  4DCC A;  2CU1 A;  3PT2 B;  2WF9 A;  4DSL A;  2HOF A;  1S77 D;  5EE9 A;  2EDU A;  1FNW A;  5J0O A;  4ED3 A;  5G5H A;  5CTR C;  3UIN B;  2MSE D;  5ALE A;  2OED A;  4IWQ A;  4W9C A;  2W8L A;  2L05 A;  2QMT A;  5G2N A;  4DBG A;  5CR0 A;  1TBE A;  1T0Y A;  2K9X A;  2O2V B;  3DDH A;  1T0S C;  1S10 A;  4I2E A;  5HKH A;  3K4G A;  2V9W A;  4O3M A;  4GU2 A;  3Q14 C;  3V6E B;  3J81 j;  1XQQ A;  2BTE A;  2BGF A;  2LGD A;  4M00 A;  2MBB B;  1DRG A;  3BWU D;  4Y2S A;  1PGB A;  4DQR A;  1Y56 A;  4E74 A;  4GDK B;  3GE3 C;  2K4E A;  3BVM A;  4DEZ A;  3E0F A;  2CXY A;  5AKH A;  1WX8 A;  2KNJ A;  4KX5 A;  4UB3 A;  2ISP A;  3AI5 A;  4IC7 B;  4EOY A;  1MC8 A;  3R66 C;  5KFN A;  3AU5 A;  1A0P A;  1UBI A;  4G9B A;  3PW0 A;  1YQ3 B;  3A9K A;  4OCZ A;  4RF1 A;  5L1J A;  1PK3 A;  2G0A A;  3WK6 A;  4RQ3 A;  8ICC A;  1XEE A;  2VH2 A;  2YTU A;  4TUS A;  4Y2V A;  1U45 A;  5C3J B;  2Z8L A;  3AE7 B;  1F77 A;  2KKP A;  4NY8 A;  4NAM A;  3TAQ A;  4B95 A;  2BPF A;  2BYF A;  1WCL A;  1ZDX A;  2WS3 B;  3MR6 A;  3NAS A;  1SXE A;  3DVG X;  1LO5 D;  3GIM A;  1YQB A;  4OO1 J;  2L52 A;  2PJH A;  1E8X A;  3GV5 B;  3ZW3 A;  2ZIV A;  2J6T A;  2MUT B;  2N9K A;  4ZRK A;  1JRO A;  3CF6 E;  1HZ5 A;  1FEZ A;  4GDL A;  4KLO A;  2LD9 A;  2VA2 A;  4RQ6 A;  1T7P A;  1WXA A;  2LVP A;  5AKZ A;  1BGX T;  2DWQ A;  5DDM A;  4EEY A;  3ORY A;  4IS7 A;  4M0W B;  4IG7 B;  2PMZ F;  2FUH B;  1NK4 A;  1CQV A;  5AM3 A;  2W8K A;  5EWF A;  2ZNV B;  3WAP A;  4CRX A;  1ZQL A;  2YMQ A;  2KZ3 A;  2X38 A;  4QZ9 A;  1ZQJ A;  3T9L A;  1ZD2 P;  2BR0 A;  2KIW A;  2JZB A;  2MP2 A;  1Z1B A;  3R9K A;  2JEG A;  1L5U A;  4K7S A;  1N62 A;  3LB8 C;  3SV4 A;  1T3N A;  2K8B A;  1SV4 A;  3UGB B;  2J42 A;  3OWE B;  5DB9 A;  2F1J A;  5KG4 A;  2GMI C;  1ZQB A;  3MC0 B;  4KLM A;  2BF8 B;  3GZN I;  1MHH E;  4RGO S;  4Q2J A;  2GH1 A;  4Y2U A;  2N7D A;  3OJ3 A;  4TQS A;  3B1L X;  5KFU A;  1WXV A;  2WXQ A;  4OVU A;  1V38 A;  1KKX A;  3JPO A;  4BDP A;  4REZ A;  4LTU A;  1JWB D;  3ZDT A;  1KM7 A;  3WK4 A;  1ZQM A;  3B0A A;  3ZJU A;  1OQY A;  1P9D U;  1TJE A;  1M6Y A;  4B9L A;  4QWE A;  1Q10 A;  1AWD A;  4M6W B;  2ZTC A;  1F52 A;  1VZ6 A;  4P1B C;  5KFX A;  4ZHP A;  1T0Q C;  2D6F C;  5BMH A;  4FUL A;  2HHT A;  1OTR B;  4FN2 A;  1PYW D;  1KRP A;  1KLU D;  1MFW A;  2VA8 A;  4RNM A;  1VZ7 A;  4DOC A;  3JSV B;  3N1Z C;  3GZN B;  1S9F A;  1S0O A;  1J7A A;  4E71 A;  4QZ8 A;  4PS3 A;  2YMP A;  1UT8 A;  1L0Y B;  1WWU A;  1LV5 A;  4WH4 A;  1ZXI A;  4J9P A;  3AE1 B;  3PR4 A;  2FID A;  3HP6 A;  4CF3 A;  9ICU A;  2N9E B;  2W55 A;  5AKI A;  2O6V D;  1F0M A;  2Z0E B;  1M4V A;  7ICN A;  2KSO B;  1WJ6 A;  4QJF B;  4US9 A;  2LZ6 A;  2YLM A;  5J2D A;  4J9N A;  2EAM A;  2G08 A;  5FKA C;  4BOZ B;  2WWZ A;  5IP4 D;  2WGS A;  5ALF A;  3Q8S B;  3RRH A;  5KFH A;  1XT9 B;  4NLC A;  5KL1 B;  2ZIW A;  4J3O D;  4LDT B;  4DHJ B;  3VUX A;  4YMO A;  1V6E A;  2HHU A;  2KDB A;  3KHL A;  3H8H A;  2IA6 A;  3AEA B;  4A55 A;  1JXE A;  4BJQ A;  3A9J A;  3NRZ A;  3JPN A;  5J0P A;  3KUZ A;  3DBS A;  2MH7 A;  5L1M A;  2LM1 A;  4ANX A;  3PNC A;  2D3B A;  3AE8 B;  4R3D A;  3IBE A;  3H8W A;  4O3P A;  4DHZ B;  4DWF A;  5DKW A;  4AQ7 A;  4BBN C;  3FM9 A;  2BCV A;  3KTQ A;  2MJ3 A;  3EUB 2;  1XU4 A;  2XGQ A;  2J0K A;  5ALH A;  5EE3 A;  4MFF A;  1CI4 A;  4IUM B;  3ZXR A;  2LHT A;  3ZNH B;  4ELT A;  3UMG A;  3HRD D;  2XCP A;  4B9N A;  5AK5 A;  3RB6 A;  7ICP A;  5JH5 C;  1X1M A;  4JIO U;  1TS4 A;  2PIA A;  5KFI A;  2F44 A;  2JV3 A;  1NK7 A;  5HFY A;  3AQF A;  4A6Q A;  8ICR A;  2DAF A;  5HHH A;  1WFY A;  3FIL B;  4LCD E;  2DAJ A;  1QSL A;  2JH1 A;  3PMN A;  5J2G A;  3OGU A;  2AGO A;  1JWM D;  2KWU B;  2VA3 A;  2NVU I;  4MJS B;  3RNB C;  4G50 A;  4M8M A;  3GFK B;  2WDV B;  1LQB A;  3M8S A;  4JV1 A;  4I27 A;  5ALM A;  3VUW A;  3QUT A;  1WWT A;  5KFT A;  2A19 A;  4DSE A;  2DUY A;  2CHZ A;  3RB4 A;  1I35 A;  1XC9 A;  4ZOH C;  1OGW A;  4QZC A;  3Q3N C;  5E6O A;  1SIJ A;  1WYG A;  3D2S A;  1L7Y A;  4B0M A;  3TBL D;  1CMX B;  5DPS A;  3W1Y A;  5KHQ A;  4FO6 A;  5HP4 A;  2CU3 A;  4B0E A;  2AWT A;  2F1H A;  3L10 B;  3KBB A;  3VR8 B;  2C9W B;  8ICO A;  3Q3F A;  4J9M A;  1M94 A;  3GZF A;  3WAM A;  4P0Q A;  1I4G A;  4LJX A;  1SE3 A;  2F77 X;  4EZ9 A;  7ICU A;  2P66 A;  1YN3 A;  2WXM A;  2KFK A;  1TS3 A;  1TZO A;  2EEL A;  2IBI B;  1X9W A;  4KGS A;  2M8S A;  4FLH A;  4F8R A;  3C2L A;  2KD0 A;  2LI6 A;  4M0A A;  1K50 A;  2QAR A;  5DBB A;  5AKK A;  1ZPS A;  4JWS C;  3H0R B;  1MQ3 A;  1D6E C;  1R7S A;  3V7K A;  1UF0 A;  1U9L A;  3NOB A;  2E1F A;  3QXG A;  3BYT B;  4XE0 A;  4ELU A;  2ZW1 A;  4JE3 B;  3Q2A C;  3N4M B;  2TSS A;  4IM0 A;  1QQ7 A;  2KVS A;  1UGM A;  8ICV A;  2BYE A;  4F91 B;  4I6L B;  3OSP A;  1CRX A;  1S3S G;  2FBW B;  1ZQK A;  2BPC A;  4IL6 U;  4DQP A;  1V9J A;  3RYT A;  3NTU A;  1NK8 A;  1NKE A;  2WDT B;  1FD6 A;  4RNN A;  4B9K A;  4MF8 A;  1PFD A;  4GB9 A;  2MRP A;  5CHW A;  1L3U A;  3ZD9 A;  5J2B A;  2KP7 A;  3RMK C;  3TEZ A;  2YB4 A;  4NPN A;  1F2R I;  5DG8 A;  9ICK A;  2FE9 A;  5KFS A;  4PGY A;  7ICM A;  3RB0 A;  3SDL C;  4W9G A;  2ATL A;  1JW9 D;  3I1Y A;  4R8U A;  2ACZ B;  2KNB A;  3DWG C;  1CJE A;  1E7P B;  1O08 A;  2BKF A;  2DBY A;  2N9L A;  5IA7 A;  5F9L A;  1S76 D;  2RDG A;  4F4Y A;  4KGT A;  5CWR A;  4S17 A;  3ZQ4 A;  1I4H A;  2NO4 A;  1JWU D;  2MU2 A;  4RNO A;  5CB1 A;  3KWL A;  2RPV A;  1UCV A;  4KX6 B;  2ZVO A;  1A70 A;  4KLT A;  4CYE A;  3W9C B;  1PK1 B;  2R8K A;  1ZOL A;  1WGD A;  3GIK A;  2Y5B B;  4KMU A;  4CHK A;  4LZG A;  3AEC B;  4OVZ A;  5HR7 A;  4XWT A;  4PHA A;  2H88 B;  1IIP A;  3M7D A;  5DQI A;  1BNP A;  3RR8 A;  3DHI C;  3CRX A;  4OZA A;  4K7U A;  2LPE A;  1JIH A;  1TVA A;  1Z5S B;  2Q0Z X;  4P0P A;  1WYW B;  2F1I A;  3IM1 A;  2XVT A;  4YCX A;  4ECR A;  1D5Z C;  3ZJV A;  2PFQ A;  5TR5 A;  1CK1 A;  2Z0D B;  3GU3 A;  3RB3 A;  2M17 A;  4EEL A;  1VLB A;  4NAW B;  2WHE A;  1LVH A;  3R2T A;  2F3N A;  5AIC A;  8ICI A;  1PQS A;  1ISN A;  3RBE A;  3M6K A;  4AYB F;  4BKT A;  1SKW A;  2HI0 A;  2KMD A;  1SXT A;  1FFV A;  1WX7 A;  5ALU A;  3AM9 A;  4MH0 E;  4QAY A;  1T6B X;  4M8N A;  2INP E;  4OVV A;  5BO4 B;  5L1K A;  5HNK A;  4P4O A;  9ICJ A;  2L0F A;  4ECX A;  2AGQ A;  1S0N A;  1B22 A;  1NOM A;  2M19 A;  4UB8 U;  4PK1 A;  1LKY B;  1KJT A;  1KLV A;  4BXO A;  5J0Y A;  4F7Z A;  3OJU A;  2EAP A;  1NYR A;  2L32 A;  4M9H A;  1T8E A;  1XSL A;  4XQ8 A;  3HHM A;  1YZ7 A;  5L1I A;  1MG4 A;  2J0M A;  2GOW A;  7ICF A;  4ZYS A;  4RZR A;  4NJ7 A;  2P35 A;  4WWO A;  2MW5 A;  3T3F A;  1Z1V A;  5KFQ A;  2E1E A;  4KSL C;  1JQ4 A;  3Q8B A;  2JR5 A;  1WMH A;  5KT4 A;  2QSD A;  5KFD A;  3MC9 A;  1L3V A;  5AK4 A;  1EWC A;  3L16 A;  2MAX A;  4B9V A;  4Z6D A;  3OJ4 B;  2BCR A;  4LDT D;  5LNK 1;  2W04 A;  2VZK B;  3EPG A;  1RRB A;  4KLG A;  1SJE D;  4CGZ A;  9ICI A;  1TE2 A;  3HPO A;  3T5L A;  2VRR B;  5CHV C;  3TI0 A;  2ISO A;  4MM3 B;  1ECW A;  5HI1 A;  2F8L A;  1D3Z A;  4HYK A;  5KFC A;  1Z00 A;  3QUB A;  3RR7 A;  4O3N A;  2O6K A;  4NM2 A;  1KH0 A;  4KLL A;  4XDD A;  1T3Q A;  1NZB A;  5EOZ A;  1L4Z B;  3PX4 A;  1D4B A;  2GBN A;  2ZPN A;  4DL7 A;  1RWS A;  2QIE B;  5H8Y E;  1BUI C;  5G5G A;  1C9F A;  3CWI A;  5AM1 A;  2YN4 A;  4FJY A;  4II3 B;  4B6W A;  3FYH A;  4OJO A;  1EU4 A;  2L76 A;  3SYZ A;  3QU7 A;  2HSZ A;  3NRW A;  1V9P A;  2JZP A;  3GIL A;  4EZK A;  1UBQ A;  4ECQ A;  2BS3 B;  2K8C A;  4YR3 A;  2BWE S;  3TAD A;  1TK0 A;  3RF9 A;  4NZL B;  2YB1 A;  2W9C A;  4YR0 A;  3JPT A;  1PVP A;  1ZW7 A;  4YN4 A;  3THV A;  4ARI A;  4FZL A;  8ICP A;  4Y2Q A;  2ESE A;  5J0W A;  3EW9 A;  4QNL A;  1BML C;  2FPL A;  2HHQ A;  1C20 A;  3TIX A;  1KN5 A;  1N5W A;  1GAQ B;  2IGD A;  1RM6 C;  2V0G A;  2LAS A;  1ZKH A;  4PH5 A;  2A4Z A;  5IIM A;  1NYQ A;  4BVU C;  2BW2 A;  3PSF A;  2NMQ A;  4ITK A;  1X42 A;  1NK9 A;  2AJQ A;  3IRU A;  4MGY E;  3ZNI D;  3QAQ A;  3U7Z A;  3ZDC A;  3RN9 C;  2QB0 B;  3LDA A;  3NS8 A;  1D5M C;  3OLM D;  4FA6 A;  2L1A A;  3QZ7 A;  2IDY A;  2W9N A;  2G4D B;  3K9P B;  4N6E B;  2ASL A;  1C76 A;  8ICW A;  2WHI A;  3UI3 A;  3ISB A;  3V6J A;  3VTW A;  1WIA A;  3E56 A;  2MX2 A;  4QZF A;  2J4X A;  1NDD A;  2JXT A;  4BKS A;  3RJJ A;  1SXD A;  1HJP A;  2KAJ A;  1TK5 A;  3AED B;  1IBX A;  3LK9 A;  4IKG A;  1E10 A;  3SEB A;  1AN8 A;  4FHK A;  4BAX A;  1D9D A;  3KKA A;  1EF1 A;  3Q3J A;  3F53 A;  3IHQ B;  2WDQ B;  2AGP A;  2ZCC A;  4ECS A;  4AS1 A;  1QOF A;  2W9A A;  3QE9 Y;  1KLG D;  4P16 A;  2PTL A;  5ALP A;  4AJW A;  2W43 A;  2FMP A;  1ZQT A;  4Z6E A;  4W9K A;  3ZNZ B;  4O3O A;  1ZYQ A;  3EHV A;  3K75 D;  1N6Z A;  4ICA A;  2M1M A;  1VD2 A;  3TMP B;  1OW5 A;  2NBV B;  1ZXH A;  2KJ8 A;  4MF2 A;  3C0R B;  3DBL I;  4FXC A;  4LK0 M;  2PVG C;  1IYF A;  4EYI B;  5BYS A;  3M6Z A;  3R3M A;  4RM9 A;  4ZRJ A;  4J9Q A;  1TY2 A;  1NVI D;  2MBE A;  4UAY A;  4EZL A;  2JYE A;  2PE6 B;  3C8Y A;  4BKG A;  4G3X B;  3WU2 U;  3KH0 A;  3JVZ X;  3M8R A;  1U47 A;  4NJ6 A;  5IIJ A;  5KG1 A;  4RQ1 A;  2KJR A;  4XX5 A;  4IM2 A;  2EMT A;  2D3C A;  4K4H A;  1N2X A;  2V3P A;  3URY A;  3LYY A;  5AI9 A;  3AXC A;  1MI0 A;  4OJL A;  4MEX A;  4JQW C;  5J2E A;  4IC9 A;  2D2Q A;  2W03 A;  1MSW D;  2JQR B;  3TAD C;  1BPB A;  1ED1 A;  4FZM A;  4B6J A;  3TQ1 A;  4F5Q A;  3PSI A;  1EU3 A;  2O6V B;  2Q5W D;  3ZKJ C;  3AUO A;  5J0T A;  2L00 B;  2FUG 1;  3QC8 B;  3A33 B;  1X2I A;  1Y8R C;  3Q8F A;  3IAS 1;  2HBM A;  1IXR A;  1C4A A;  2IO1 B;  4NLG A;  3P4S B;  2BPS A;  2O2V A;  3ZDD A;  1J97 A;  1P3Q U;  4O1N A;  2BT6 A;  3MFG A;  3RNG C;  5DBC A;  4ICU A;  3ZD8 A;  4HK2 A;  2JYT A;  4KZC A;  4UDU C;  2NRW A;  2KHQ A;  2KQ7 A;  3KYC D;  5DB6 A;  3RJG A;  3Q8R B;  1X6I A;  2BDP A;  2KK0 A;  1ZQC A;  4KLQ A;  7ICE A;  2PVO D;  4KKI A;  4A90 A;  2XY6 A;  1TKY A;  2H5X A;  2XK5 B;  2DFL A;  5ALW A;  4JK1 A;  4GGQ A;  4O3R A;  5DB8 A;  4F71 A;  4UBC A;  8ICU A;  2WF5 A;  5AI8 A;  5B66 U;  2PXI A;  1XLO A;  2K60 A;  2H3I A;  2WQY B;  1J7C A;  5DQG A;  1KTQ A;  3VDZ A;  4ZDV A;  1NZP A;  2Z59 B;  4DDG D;  1KOT A;  1N5X A;  2E8M A;  4M9N A;  1WY8 A;  3TFS A;  4DFP A;  4HPP A;  1UD7 A;  3MC1 A;  2ZJ8 A;  3KKA C;  2V3S A;  3K1R B;  5BOM A;  3UPQ A;  1ARO P;  3TKA A;  1OFF A;  1WUD A;  2Z7J A;  1C77 A;  1N56 A;  4HDO A;  2A1J B;  5A0L A;  1WGH A;  1JAL A;  4U6P A;  2KZM A;  7ICG A;  2FE8 A;  2ZW0 A;  4YD2 A;  4A9A A;  2RHF A;  8ICQ A;  2K8A A;  2XY5 A;  1T94 A;  2CHX A;  2NV3 A;  5AIA A;  2UVR A;  4JGH B;  5KFR A;  2L7R A;  4AJY B;  4M9G A;  2MUT A;  7ICL A;  2GRI A;  2KJ5 A;  4I2A A;  2PFN A;  4UAT A;  4DQI A;  2ZTD A;  2C7H A;  3QUC A;  2EKE C;  3SMV A;  3NUH B;  5GTH U;  4AUQ C;  2IO3 B;  2C2E A;  4DSF A;  1TTN A;  4KIK A;  2LVO A;  5J2R A;  1ZD3 A;  2FIF A;  1IUE A;  3M9N B;  3LXF A;  4I2B A;  1Q5W B;  4EKU A;  1L7O A;  1WGY A;  9ICH A;  3DVN U;  3OHA A;  4C4T A;  3QNM A;  2LGS A;  3BQ0 A;  2GBM A;  3NZ3 A;  3RNF C;  1IGD A;  4IR9 A;  2MSN A;  3GQC A;  3MFI A;  4Y2R A;  1UT5 A;  1X40 A;  3PRP B;  2BKE A;  3B9J A;  1IP9 A;  1J0G A;  1P1A A;  3PO4 A;  5D4B A;  4YXD B;  5AI6 A;  3PZD A;  4M2Y A;  5DLG A;  3PRE A;  5JXV A;  1H8C A;  3ZTD A;  5ALK A;  4MT5 A;  4I2G A;  5CP2 A;  3B0X A;  7ICH A;  3PML A;  1IPG A;  3UXO A;  4DFM A;  3VFK A;  1I4X A;  3KZX A;  2KN7 A;  1RLF A;  1SZH A;  5KFG A;  4M9L A;  4FS1 A;  3QU9 A;  3LDZ E;  5III A;  3H4D A;  3Q8K A;  3RFZ B;  3BQ2 A;  2M4N A;  5KFA A;  3JSV A;  3A0B U;  5D46 A;  3H7P B;  1FRR A;  1SIF A;  1BPY A;  2MJD A;  1NKB A;  3I63 C;  5DG7 A;  2HDO A;  1WE6 A;  2C2R A;  1SL0 A;  4O5E A;  2LUM A;  2JH7 A;  5D94 A;  9ICV A;  3QEB Z;  2YMM A;  1WXM A;  4KLF A;  4F4X A;  5AM2 A;  3T79 A;  3P4R B;  1CUK A;  2KSO A;  4N59 A;  2MLB A;  4EFO A;  5IIL A;  1ZUD 2;  4QIW C;  1HQR D;  1PDX A;  4HPM B;  3N1X C;  3ETR A;  5LXH A;  3ONN A;  1VZ8 A;  1UZX B;  4HAI A;  3RD2 A;  4CQN A;  8ICM A;  2YX8 A;  2KO3 A;  2RLT A;  1F1H A;  3E9S A;  3PS6 A;  3R7R A;  1BXT A;  4IM3 A;  4N58 A;  4DXA B;  1BVS A;  1L2N A;  1UWM A;  2PKE A;  2KV2 A;  2LJI A;  3VRA B;  2SAK A;  5J17 A;  4F93 B;  2LI5 A;  2IOH A;  2DHZ A;  3P42 A;  7ICK A;  2MBH A;  4G0N B;  3QX7 A;  2LMR A;  2BVC A;  3VHT C;  2NPT B;  3APF A;  3SFD B;  3O13 A;  5BMG A;  2KT7 A;  2H89 B;  1QT9 A;  4J03 A;  5HG2 A;  2AU0 A;  1DOY A;  2QC8 A;  2EZX A;  1J19 A;  4YVZ A;  1UHU A;  2CPR A;  4UAV A;  1ZQX A;  3PLU A;  4TUU A;  4LVS A;  4HWI B;  1ROE A;  3HUI A;  2G5H B;  1B4F A;  2WXO A;  4RM8 A;  1ZQQ A;  2KMC A;  2KAN A;  2V4L A;  3MP9 A;  3V6K A;  4NLZ A;  3ALR A;  2OWO A;  3DWM A;  3ZO5 B;  5KT7 A;  3BS5 B;  4GXK A;  3ZIM A;  2G06 A;  3T3O A;  3TAP A;  1ZGU B;  3MR2 A;  2SEB D;  4FHJ A;  3MGV A;  2IO0 B;  2JPH A;  2DPI A;  4KLS A;  1UGJ A;  1ZE3 D;  2GLS A;  2C22 A;  3WKB A;  3C19 A;  3EPI A;  4DF8 A;  3BK2 A;  3GOE A;  2XCA A;  3W5V B;  1R4M I;  3AEB B;  2HBJ A;  3U4E G;  1AW7 A;  4O9M A;  2OJR A;  3HKZ C;  3KFU F;  5ALD A;  1FRD A;  2LHD A;  3ZRF A;  3PHX B;  1KSP A;  1TKG A;  3TJP A;  2H3Z A;  5C23 A;  4CF5 A;  4Q8E A;  2LJ5 A;  3I57 A;  4M01 A;  5MPO A;  4PYU A;  1I4Q A;  4QWB A;  1SV0 C;  2D3D A;  2VKQ A;  2DKZ A;  4OD0 A;  4C4R A;  9ICA A;  2IGH A;  4O5C A;  2WXH A;  1SE2 A;  2XC9 A;  4DHZ E;  1F44 A;  3BS7 A;  4OJ5 A;  4AP4 C;  5ALZ A;  2RD0 A;  3JW0 X;  4HRS A;  2WP9 B;  3MJW A;  3CMM B;  2PFP A;  5G55 A;  2DZM A;  2KWD A;  3RFA A;  2RR9 A;  4NXZ A;  4JPS A;  4PS8 A;  3MJ5 A;  5AKJ A;  4L2Y A;  1TK8 A;  1MG8 A;  3N7S C;  2Y9T A;  1N61 A;  4GDL B;  3ISD A;  4HDQ A;  3NVZ A;  4C4V A;  5J0X A;  1L3T A;  5J2C A;  2ZXH A;  2C2D A;  3WA0 A;  2KWC A;  2JZB B;  1HE8 A;  4E3C A;  2JT4 B;  1RDF A;  3B2G A;  4NNJ B;  1T0R C;  4EX7 A;  4F5P A;  3Q3M C;  5KFF A;  2K8B B;  1NJZ A;  1I4P A;  1JUD A;  1RPL A;  4XGA B;  3VVW B;  3P4Q B;  2ZJ5 A;  4O3S A;  2KTQ A;  2NBW B;  4RPZ A;  1ZQH A;  3QK0 A;  2UVU A;  5D3I B;  3BK1 A;  1L7P A;  1LB2 B;  1FXA A;  2K25 A;  3VR9 B;  5KFP A;  2DYM A;  2KDI A;  4A8E A;  2AQ4 A;  3DPD A;  4JWU C;  1Z2M A;  2D10 A;  3W1S C;  3BY4 B;  1QCK A;  2NRT A;  1WH3 A;  1I42 A;  2KYW A;  4PHD A;  1HXY D;  4EUT A;  1ZDV A;  1ZQW A;  3SEI A;  4FBJ B;  5D6J B;  4K3B A;  1NNL A;  1NK0 A;  2BCQ A;  2V3N A;  2ICI A;  1PK1 A;  2FCS A;  3QU2 A;  5AEK B;  4G3I A;  1ZQO A;  5DGB A;  1AYF A;  2J53 A;  3I5J C;  4JWN A;  2PI4 A;  2J6U A;  1QLN A;  1K52 A;  3F5A A;  4IRK A;  3IFW B;  4RQ5 A;  2KOB A;  2W54 A;  3HM6 X;  3JPQ A;  2BQU A;  1E8Y A;  2C7M B;  4ANV A;  2Y5C A;  1MPE A;  4KLH A;  3OG5 A;  3C2M A;  4W9E A;  3AQE A;  3F2B A;  4Y2X A;  5AKX A;  1V5T A;  3OSN A;  4F3O A;  1SEB D;  4LJP B;  2KOX A;  4NAW A;  1C78 A;  4MEY A;  2LRU A;  7ICQ A;  2WU5 B;  3QUQ A;  2HVI A;  1MQ2 A;  4I2F A;  2KD1 A;  1RZT A;  2GI9 A;  2W9B B;  5J2F A;  3AN1 A;  2ZIW B;  1YN5 A;  4PL2 A;  2PEA A;  1WM3 A;  5KFM A;  5KFO A;  1V1O A;  2XEW A;  1WGG A;  1RYU A;  5JTI A;  1L5P A;  4F5R A;  3WIM A;  4GFJ A;  4MSQ B;  4EEW A;  4GIB A;  2I5H A;  1KDH A;  1EWY C;  1YQ4 B;  4TQ0 A;  2XY7 A;  4GC7 A;  1P7E A;  3EZ5 A;  1ZQZ A;  3BZC A;  4RU9 A;  2ZUD A;  1TIF A;  3DHG C;  3PGE A;  1K51 A;  1Q1O A;  4YFK A;  4YSY B;  2JZZ A;  5KFE A;  3ZTC A;  1QQ5 A;  2JRZ A;  3OJS A;  4DL4 A;  1OQR A;  5IAA C;  2ASJ A;  4USA A;  4MGZ E;  4PYZ A;  4F4Z A;  1B9R A;  4DFK A;  9ICX A;  3AE2 B;  1TYG B;  1F0Z A;  1U49 A;  2RRD A;  1UQV A;  1UA0 A;  2HOQ A;  2KMA A;  1YIW A;  4AWJ A;  3MR5 A;  4F5N A;  4BWJ A;  3GDX A;  5BOL A;  1XNS A;  2IHN A;  4W9I A;  1XO1 A;  4FJZ A;  4IW0 A;  1KFS A;  5BPC A;  3TAC B;  3QWZ B;  4FFD A;  4RFB A;  3TCA A;  1HUZ A;  2IJ0 A;  4KDI C;  3N97 B;  2NS5 A;  1SL1 A;  2UU7 A;  3U52 E;  3D6J A;  4EZ6 A;  1SKR A;  4NJ8 A;  4ACF A;  3NJT A;  3AL0 B;  1GC6 A;  1JRU A;  1H4R A;  1OQQ A;  1V1P A;  1NK6 A;  1ZQV A;  2K22 A;  2ZIX A;  3KD3 A;  3F2C A;  1IGC A;  5D7G A;  1L4D B;  3ZRC A;  3VTU A;  3GE8 C;  3H8J A;  4LJO B;  4TUR A;  1ZQI A;  2ZEQ A;  3N30 A;  2JHD A;  1N48 A;  2KHW B;  3HJE A;  3RH4 A;  1VR9 A;  3Q6B A;  2LYH A;  5AM0 A;  3CIR B;  3RJK A;  3VXW A;  5AHX A;  4UW9 A;  3RPF C;  2KK8 A;  4KSK C;  2HHS A;  2W3S A;  4K81 A;  3WK7 A;  3H40 A;  3WAN A;  5TSS A;  1E9M A;  3KUC B;  1PUT A;  3Q8A A;  3BII D;  4RGT A;  2ZVN A;  2KHV A;  3M95 A;  1TAU A;  4P0Q B;  4Z6C A;  2G1E A;  3IVF A;  3MHS D;  4YTM B;  2K4I A;  3VC8 A;  2RMM A;  2KFK B;  4DOA A;  8ICX A;  3N20 C;  3N7P D;  1QSY A;  1Q0W B;  1PGX A;  3RAX A;  1WJN A;  3PV8 A;  2C5L C;  3UIP B;  4RQ4 A;  2KC2 A;  9ICS A;  4GSW A;  2UWQ A;  3PZP A;  1WSP A;  1DGJ A;  2CRX A;  2ZG6 A;  5AK6 A;  5GTI U;  4BZA A;  2LXC A;  4NQL B;  1S0V A;  4P4P A;  2KE7 A;  2I1K A;  3QHT A;  4W9F A;  1X9X A;  3SAG A;  7ICV A;  1WR1 A;  4WJN A;  2IPK D;  2FPM A;  1I4R A;  3PX0 A;  2UYZ B;  4YXM A;  4CCH A;  3BYY B;  3JPP A;  2OEH A;  3N9Y C;  5CRX A;  4UAZ A;  4TUP A;  3RUI B;  4IRC A;  1FM0 D;  2NTS A;  1TAQ A;  2W7P A;  5IIK A;  4RCO A;  3C29 A;  3ICX A;  4Q45 A;  1TAM A;  1TZ1 A;  1OEY A;  2ZCB A;  4HKQ A;  2DLB A;  1DK3 A;  5AKY A;  2QB0 A;  2BKR B;  1TS5 A;  4ED8 A;  5DPW A;  2IY0 B;  3DQV A;  4TSS A;  3V72 A;  3PO5 A;  3A1Q B;  2FI1 A;  4B9U A;  4C0Z A;  2YEP F;  4RQN A;  4DL3 A;  1Q8K A;  2QB1 A;  3S6J A;  2FLN A;  2MQJ A;  2R8I A;  3NVW A;  4R8U B;  9ICQ A;  1ET6 A;  3UMB A;  2DYO A;  2ZIU B;  2GBR A;  2KTR A;  3F5E A;  2AQ1 B;  1Z4N A;  2JEI A;  4EX6 A;  3PZ7 A;  1GUA B;  2K3U A;  5KHO A;  2H3Q A;  4DL2 A;  1JX4 A;  2HTM E;  5H92 C;  2Y5P A;  1G6J A;  2HW3 A;  5KG2 A;  2XGP A;  4JWM A;  3OAW A;  2WAQ C;  3BDP A;  1NJY A;  2J52 A;  4KTQ A;  2IYD B;  3PVL A;  5KG5 A;  4BOS C;  2OJW A;  2M0N A;  5AIB A;  2AYO B;  3CP8 A;  3APD A;  4I2J A;  4DOB A;  4NL9 A;  4WJ3 B;  3ALB A;  1GO3 F;  4P7I A;  4DF4 A;  2MA1 A;  2LWP A;  1Z4O A;  1BPX A;  3APC A;  2WX0 A;  2GBJ A;  2K6D B;  4QZA A;  2UVW A;  4DWI A;  4P0P B;  1YN4 A;  3PO0 A;  3UQ2 A;  5DQH A;  5ALV A;  4WJP A;  4WQM A;  3KWV A;  3R8B A;  1P7F A;  3M9M B;  4PL1 A;  4WQO B;  4NV0 A;  5KT6 A;  1VDV A;  1XD3 B;  1YJ1 A;  1ZOY B;  2WXJ A;  2WXF A;  1ZQ1 C;  1JMS A;  5DLF A;  5KFW A;  3RJE A;  2D07 B;  1DOI A;  4PHP A;  2ZTE A;  2BB6 A;  3ZVV A;  1RXW A;  1RXV A;  3PR5 B;  4GLS C;  4DS4 A;  3LJ3 A;  1HEK A;  2BYV E;  2KXJ A;  4DL5 A;  1Y88 A;  5AI5 A;  3AE4 B;  4YQW A;  1NI2 A;  3RZF A;  2NRZ A;  2Y0S C;  4Z6F A;  1RAX A;  3N3K B;  2VIX A;  4PZN A;  1SWV A;  1V8C A;  1O03 A;  1BT0 A;  3M9O B;  4R64 A;  3MBY A;  2V4I B;  4JL9 A;  3U8Z A;  1QOA A;  2CKH B;  4F8C B;  2REX A;  3MGH A;  3UMC A;  3DOW A;  3W5U B;  4DS5 A;  1P7D A;  2NR2 A;  2O6V A;  5DG9 A;  2INC C;  5KAF U;  2HHW A;  2M56 B;  3PW5 A;  5EWG A;  4BXO B;  4UB5 A;  4DO9 A;  2DZJ A;  4BFR A;  4FBU A;  3FAH A;  3AEE B;  4ECU A;  4NY0 A;  4YTP B;  4R63 A;  1GG3 A;  4R66 A;  1ZQG A;  4QZD A;  2AEH A;  4Y2Y A;  5ALR A;  2WB1 C;  4WWN A;  1F5S A;  3S2A A;  2BCU A;  3LYS A;  1VJK A;  2I2Y A;  3GV8 B;  5FR6 A;  4ASW C;  1RYS A;  4BUG A;  3Q8L A;  2EKI A;  3R2I A;  4F5O A;  1D8L A;  2MBQ A;  2LGX A;  4ED2 A; 
#chains in the Genus database with same CATH homology
 3AE6 B;  4J3O D;  3H8H A;  3AEA B;  2XN9 C;  3NZ3 A;  1IGD A;  4A55 A;  1FCL A;  1KRH A;  3NRZ A;  1WGK A;  2LMC A;  2WXL A;  4OHJ A;  2MH7 A;  1SE4 A;  1F2R C;  3BZD B;  1E6E B;  3AE8 B;  1STE A;  3B9J A;  3HVZ A;  1VRA B;  4R3D A;  1QF6 A;  1FCC C;  4YXD B;  4AQ7 A;  1CZP A;  2MJ3 A;  3EUB 2;  5JXV A;  3HVD A;  4MT5 A;  1L6U A;  5EE3 A;  3NVV A;  1K53 A;  2AX5 A;  1I4X A;  3HRD D;  1ET9 A;  3P1M A;  1DOX A;  1TS4 A;  2PIA A;  1ACC A;  3RFZ B;  5HFY A;  4A6Q A;  4ZRP A;  3FIL B;  1FRR A;  2D5G A;  2MJD A;  3Q8E A;  4PT5 A;  1MHX A;  1JWM D;  2AQ2 B;  2LUM A;  4RF0 A;  3TEW A;  2QIL A;  2WXK A;  4YSZ B;  2WDV B;  3V05 A;  3Q69 A;  2Y3A A;  3P4R B;  2MJE A;  1WRI A;  3TEY A;  2NTT A;  1JWS D;  4N59 A;  1WWT A;  1GPX A;  1YJJ A;  2PW9 A;  1ZUD 2;  1PDX A;  1HQR D;  4ZOH C;  3ETR A;  1SIJ A;  1WYG A;  1TKE A;  2W82 A;  1VZ8 A;  4B0M A;  3VQI A;  1YJI A;  3NS1 A;  4WIP A;  2CU3 A;  4B0E A;  4CQN A;  3E9S A;  3VR8 B;  1BXT A;  2JSV X;  4N58 A;  1UWM A;  4OZB A;  2KQ4 X;  2LJI A;  3VRA B;  2SAK A;  4WAF A;  1I4G A;  3J9C A;  4DQO C;  1SE3 A;  4YT0 B;  2WXM A;  1YN3 A;  1RYJ A;  3P42 A;  3W2D A;  1FNV A;  1TS3 A;  1TZO A;  1V1P B;  2KDM A;  1V97 A;  2EEL A;  4KGS A;  2RDH A;  3SFD B;  3O13 A;  3AH7 A;  2CJO A;  5BMG A;  2H89 B;  1QT9 A;  5EE0 A;  1K50 A;  5AUI A;  5HG2 A;  1DOY A;  1ZPS A;  4JWS C;  1D6E C;  2WXG A;  3AE3 B;  1MVK A;  1R7S A;  1IBX B;  3AEF B;  3BYT B;  1ROE A;  3HUI A;  4XE0 A;  2WXO A;  2ZW1 A;  4JE3 B;  5BYR A;  2TSS A;  1JWA D;  3MP9 A;  2FBW B;  2WXN A;  3DWM A;  4ZHO A;  1C4P A;  4IDI A;  1L0X B;  2KMM A;  3T3O A;  1C4C A;  4C7Y A;  4YTN B;  2SEB D;  2WXP A;  2INN E;  1FD6 A;  5C2T B;  1UGJ A;  1PFD A;  1ZE3 D;  1WXQ A;  4DXF A;  3TEX A;  1UUP A;  3MHZ A;  3TEZ A;  3BK2 A;  2JX5 A;  4HKZ E;  3W5V B;  1F2R I;  3B2F A;  3ZYY X;  3AEB B;  3U4E G;  1JCK B;  1AW7 A;  1EM7 A;  1FRD A;  2LHD A;  3IT4 B;  2PLP A;  1JW9 D;  2ACZ B;  2LFI A;  1TKG A;  2WXI A;  3DWG C;  1CJE A;  1E7P B;  2N9L A;  2QEJ C;  2DBY A;  4D2K A;  4MAC A;  4L1B A;  3I57 A;  4M0W A;  4OZC A;  5MPO A;  1UWX A;  2RDG A;  1GB1 A;  4KGT A;  4MH8 A;  5I4D A;  2WXR A;  3T3N A;  1I4Q A;  1NEK B;  5AUK A;  4HRO A;  3ZQ4 A;  1I4H A;  2IGH A;  1JWU D;  2WXH A;  1SE2 A;  5D3D A;  1FMA D;  3KWL A;  2BBC A;  2RPV A;  3P63 A;  1QOB A;  4KX6 B;  1A70 A;  1KTK A;  4HRS A;  2WP9 B;  4HEA 1;  1L0V B;  3W9C B;  1HA5 A;  2KN4 A;  3IXS A;  3AEC B;  4OVZ A;  5E6J A;  4IOI E;  4XWT A;  2KWD A;  4RNA A;  1D5X C;  2H88 B;  4JPS A;  4OZA A;  1HZ6 A;  3MJ5 A;  4L2Y A;  4ARC A;  3IT6 B;  1D5Z C;  3ZJV A;  4GDL B;  1N61 A;  4XDC A;  1ZP0 B;  3NVZ A;  3AE5 B;  1CK1 A;  3ZGZ A;  5T8I A;  1VLB A;  4NAW B;  3Q8C A;  3R2T A;  1T5X D;  1J7B A;  1FXI A;  4WWM A;  1XCT L;  1YMH E;  4A8X C;  1SBB B;  3AMZ A;  1XF5 L;  1XLQ A;  3B2G A;  4ZRQ A;  1SXT A;  1FFV A;  3AM9 A;  1I4P A;  4TQ1 A;  3AE9 B;  1SB3 C;  1SJH D;  3GS2 A;  1T6B X;  4XWW A;  2INP E;  1SF0 A;  1JML A;  3P4Q B;  3EA6 A;  2XNA C;  3V3X A;  4TMA B;  4JX1 C;  2M19 A;  5D3I B;  3BK1 A;  1QKZ A;  1FXA A;  3VR9 B;  1NEN B;  2DYM A;  1NYR A;  2L32 A;  3WCQ A;  4JWU C;  5BYQ A;  2B76 B;  4ZYS A;  1UNS A;  5FK9 C;  2JU6 X;  4P6V F;  1HXY D;  1ZDV A;  3SFE B;  2N7J A;  1JQ4 A;  3Q8B A;  3PZ8 A;  2QSD A;  4RH6 A;  1EWC A;  2AQ3 B;  2V3N A;  2ICI A;  2L83 A;  5LNK 1;  2VZK B;  2LEK A;  1SJE D;  1AYF A;  2J53 A;  3IAM 1;  2K5P A;  3SR6 A;  1K52 A;  3GB1 A;  2G9H D;  2W54 A;  1DYQ A;  2BS4 B;  4MM3 B;  5HI1 A;  1QQR A;  2Y5C A;  1MPE A;  1XCQ L;  1FFU A;  2E6X A;  1KH0 A;  1SEB D;  1QIL A;  2HDE A;  1C78 A;  2JWU A;  4XDD A;  2WLB A;  1T3Q A;  2WU5 B;  4OW0 A;  2WNM A;  1L4Z B;  3ABV B;  2GI9 A;  1D4B A;  3AN1 A;  3W1S A;  1N63 A;  1RWS A;  1YN5 A;  2QIE B;  5H8Y E;  1GB4 A;  1BUI C;  1V1O A;  4RGM A;  5G5G A;  1C9F A;  1L5P A;  1TY0 A;  3CWI A;  2YEP B;  1EWY C;  1YQ4 B;  1EU4 A;  1YNT E;  4TQ0 A;  5GXG B;  4KKJ A;  4C56 C;  1P7E A;  1N60 A;  2KAC A;  2WDR B;  3FIL A;  2JZP A;  1K51 A;  2LHE A;  2BS3 B;  1FIQ A;  1HEZ E;  4YSY B;  4LLG M;  2PMV A;  4NZL B;  1B1Z A;  1OQR A;  2PKO A;  4USA A;  2BS2 B;  1F0Z A;  1B9R A;  3AE2 B;  1TYG B;  2BB5 A;  4ARI A;  4RGN A;  1PGA A;  2N0S B;  1BML C;  1N5W A;  1GAQ B;  2IGD A;  5BMI A;  1RM6 C;  2V0G A;  3NVY A;  1QOG A;  5FR3 A;  4US8 A;  1NYQ A;  4RFB A;  1FO4 A;  1FNU A;  3BVG A;  5EE1 A;  2BW2 A;  2IJ0 A;  2NMQ A;  4ITK A;  4KGR A;  3TSS A;  4YWG G;  3U52 E;  3KLS X;  4C80 A;  1XXG A;  3U7Z A;  1FEH A;  3U2S C;  1QLB B;  1OQQ A;  1V1P A;  1E0Z A;  1D5M C;  2VZK D;  2L1A A;  2IDY A;  4N6E B;  2K22 A;  1C76 A;  1IGC A;  2M0A A;  3UI3 A;  5D7G A;  1L4D B;  3VRB B;  3E56 A;  4H2A A;  2J4X A;  3AB5 A;  2JXT A;  2E3T A;  2KAJ A;  1FNW A;  5EE9 A;  3AED B;  1IBX A;  4IKG A;  5G5H A;  1VR9 A;  1E10 A;  3SEB A;  3CIR B;  1AN8 A;  2BYT A;  2OED A;  3RPF C;  2W3S A;  2QMT A;  1SSN A;  4WUR A;  1E9M A;  2WDQ B;  5TSS A;  2K9X A;  1PUT A;  3Q8A A;  3BII D;  4RGT A;  4AS1 A;  1QOF A;  4P16 A;  1KLG D;  2PTL A;  1JRP A;  2G1E A;  4YTM B;  2RMM A;  2BTE A;  3BWU D;  1PGB A;  1PGX A;  1Y56 A;  4HJG E;  4GDK B;  3BVM A;  2I38 A;  1ZXH A;  1WSP A;  4FXC A;  1DGJ A;  4LK0 M;  2PVG C;  5BYS A;  1KF6 B;  3AV8 A;  1L6V A;  1TY2 A;  1NVI D;  1YQ3 B;  2JYE A;  4RF1 A;  3C8Y A;  2IPK D;  1I4R A;  3BYY B;  1XEE A;  2OHF A;  2GB1 A;  2MEK A;  3N9Y C;  2NTS A;  1FM0 D;  4C7Z A;  5C3J B;  2Z8L A;  3AE7 B;  1F77 A;  1GOZ A;  4RCO A;  2V3P A;  4NAM A;  3LYY A;  3URY A;  3ZJT A;  1MI0 A;  4HKQ A;  2DLB A;  1XO3 A;  1TS5 A;  1ZDX A;  2JQR B;  2QJL A;  2WS3 B;  2ON8 A;  4TSS A;  3GP7 A;  1LO5 D;  2L52 A;  1EU3 A;  1KFY B;  2Q5W D;  2N9K A;  2YEP F;  1JRO A;  2FUG 1;  1HZ5 A;  3NVW A;  1ET6 A;  1XLN A;  2DYO A;  3Q8F A;  2DWQ A;  3IAS 1;  2AQ1 B;  2CJN A;  1ENF A;  2IGG A;  1C4A A;  4L23 A;  3BVZ A;  3P4S B;  3PZ7 A;  1CQV A;  2K3U A;  3FC4 A;  2ONQ A;  3KQ4 A;  4O1N A;  2X38 A;  2HTM E;  2BT6 A;  5H92 C;  2Y5P A;  3MFG A;  4UDU C;  2JYT A;  1C79 A;  2WU2 B;  1N62 A;  3LB8 C;  3L4P A;  2J52 A;  4A90 A;  2W3R A;  2J42 A;  2PVO D;  3OWE B;  4KKI A;  1TKY A;  3MC0 B;  2K0P A;  1MHH E;  4RGO S;  4Q2J A;  1ESF A;  3PO0 A;  1YN4 A;  1XLO A;  1I7H A;  3R8B A;  4WQM A;  3KWV A;  1P7F A;  2WXQ A;  2WQY B;  1J7C A;  1VDV A;  2WXJ A;  1ZOY B;  1JWB D;  4LTU A;  4REZ A;  2WXF A;  1N5X A;  3ZJU A;  1TJE A;  1Q10 A;  4DXG A;  1AWD A;  1RFK A;  1DOI A;  2BB6 A;  1OFF A;  4EE2 A;  5HHD G;  1VZ6 A;  4GLS C;  1C77 A;  4ZHP A;  2R61 A;  5BMH A;  3AE4 B;  3I9V 1;  1PYW D;  1VZ7 A;  1KLU D;  1JAL A;  2ZW0 A;  3TUO A;  2FE8 A;  1V8C A;  4A9A A;  2LGI A;  2V4I B;  1QOA A;  3W5U B;  4YSX B;  1J7A A;  3AEG B;  3EGR A;  1L0Y B;  1TS2 A;  1XLP A;  2GRI A;  2M56 B;  4WH4 A;  1ZXI A;  1NI3 A;  3AE1 B;  3AEE B;  2W55 A;  3FAH A;  3P4P B;  4YTP B;  3NUH B;  4NJC A;  1M4V A;  4US9 A;  1VJK A;  5FKA C;  2I2Y A;  1IUE A;  2EKI A;  3R2I A;  3LXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...