3EUB2

Crystal structure of desulfo-xanthine oxidase with xanthine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
b'TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Xanthine dehydrogenase/oxidase
molecule tags Oxidoreductase
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
total genus 37
structure length 164
sequence length 164
chains with identical sequence A, J, S
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
2 PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3eub202
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3eub201
1N60A 1N5WA 1J7BA 2WDRB 3AE6B 1YJJA 1TKYA 2H88B 4US8A 2K5PA 3AEBB 4HROA 4N6EB 1B9RA 3ZYYX 1ZXIA 1NYRA 1YJIA 1QOGA 3AE9B 3DWMA 3B9JA 1FXIA 1E6EB 1XLPA 2BS4B 1AWDA 1KRHA 3AE7B 1TYGB 3AECB 3LB8C 3P4PB 1PDXA 1IUEA 2ACZB 2JQRB 2M56B 1ZP0B 2QJLA 3AE1B 1NI3A 3RPFC 2DBYA 1SIJA 1VDVA 1J7CA 1F0ZA 4N59A 2Q5WD 2CJNA 3NVZA 2QIEB 1E7PB 1KF6B 1XLNA 5C3JB 1SF0A 1KFYB 1UWMA 1JALA 1A70A 2PVGC 1JRPA 2W3RA 3HVZA 3PO0A 2WQYB 5EE3A 1NYQA 4KX6B 2CJOA 2MJEA 1VLBA 2MH7A 1CZPA 1EWYC 1R7SA 3AE5B 4JWUC 1NENB 3SFDB 3VRBB 1FM0D 4YSXB 3FC4A 1RWSA 1JROA 2BT6A 2G1EA 1AYFA 3AEDB 3NRZA 1QOFA 5H8YE 1N5XA 1OFFA 1ROEA 1WGKA 2PIAA 4ITKA 5EE0A 3ABVB 2WU2B 5GXGB 1FFVA 4C7ZA 2MJ3A 1RYJA 1XLQA 2EKIA 2PVOD 2W3SA 3NVWA 3BIID 3KWLA 2OHFA 1YQ3B 5C2TB 4ZOHC 1DOXA 5MPOA 1JWBD 2BS3B 4ZHOA 2W54A 3B2GA 1PUTA 1WYGA 3P4RB 4YTNB 3EUB2 3VRAB 3ETRA 1L5PA 1OQQA 1TKEA 2B76B 3SFEB 4A9AA 5G5HA 4ZHPA 3AEEB 1L6UA 2W55A 3W5UB 1GPXA 4WWMA 1QLBB 1JW9D 1VJKA 3HUIA 4FXCA 3AE4B 4IDIA 1QT9A 2PKOA 1FRDA 1YQ4B 4YTPB 5AUIA 3VR9B 1V8CA 2HTME 4LTUA 1N63A 1QOAA 3L4PA 2N0SB 4USAA 3SR6A 1XLOA 1QF6A 3CIRB 1CJEA 1JQ4A 3P4QB 1DOIA 1OQRA 2K9XA 2L52A 4P6VF 2H89B 3VR8B 4US9A 1DOYA 1PFDA 1E10A 3AV8A 3AB5A 4N58A 1NVID 1XO3A 1N61A 3AEFB 3AE3B 1GAQB 5H92C 3B2FA 4YSZB 3HRDD 1J7AA 3CWIA 4YXDB 1ZUD2 2Y5CA 3AN1A 1FO4A 1V97A 2WP9B 2MJDA 3P63A 2DWQA 3W9CB 3FAHA 4YTMB 2WDVB 2BS2B 1SB3C 3AEAB 1TKGA 3AH7A 3AM9A 2KAJA 4JWSC 3W5VB 3P4SB 2CU3A 4C80A 3AMZA 1L6VA 2FBWB 2K22A 3AEGB 4YT0B 5G5GA 1ZOYB 3AE8B 2E3TA 3NS1A 1FMAD 4WQMA 1QOBA 3DWGC 4JX1C 3NVVA 1WRIA 1E0ZA 3P1MA 2AX5A 1DGJA 1RM6C 1JWAD 2WU5B 3AE2B 1RFKA 1FXAA 5EE9A 1FRRA 1I7HA 2WLBA 3LXFA 2WS3B 4HRSA 2M19A 1T3QA 4C7YA 2JX5A 5EE1A 2KMMA 3WCQA 1NEKB 1WWTA 2LEKA 1FIQA 1WXQA 1L0VB 1TJEA 2WDQB 2L83A 3NVYA 1N62A 4YSYB 1FFUA 5AUKA 1E9MA
chains in the Genus database with same CATH superfamily
1YJ1A 4PJ0U 1ZXHA 2HTHA 4MGZE 5AKXA 1PGBA 1TTNA 4CCHA 5J0UA 3MR3A 3ZYYX 3ZRFA 2DZJA 5BOMA 1AWDA 1CQVA 2HBJA 5AM0A 5ALHA 4WWPA 3JW0X 2BF8B 2JQRB 4HK2A 5ALKA 3PX6A 2V3NA 4O3MA 5AICA 2LBOA 2KDBA 4QJFB 2F1JA 4TSSA 4NM1A 1STEA 1A70A 4GOCA 1I4HA 3TAQA 2PVGC 4CDGA 4J9SA 3PZ8A 2AHOB 2NV3A 2W82A 2N9KA 3RFAA 4TV3A 3QWZB 3KHRA 2QHOA 2W43A 1XCQL 4GC7A 8ICSA 4B9MA 4BKSA 4DFDA 1Q1OA 3V6KA 4MF2A 1U49A 1RFAA 4KLSA 3N30A 4ED1A 4W9FA 1TT5B 3ALBA 2HHXA 5D3DA 2BCVA 2N1RA 2KOXA 4KLJA 3N32A 5HR7A 3KOOA 4HWIB 3VRAB 4A6QA 1ZQHA 5KG4A 7ICHA 1HA5A 1WXAA 4IC9A 2HOQA 3JSVA 2BKEA 1PK3A 4NAWB 4DSEA 4P1BC 4W9KA 3ZTDA 4I2IA 4RQ3A 3AEEB 4NM2A 3KYCD 1M94A 3MHZA 2KMDA 2ATLA 1QLBB 3RB6A 2VA3A 3DBSA 4F4YA 1B4FA 2NRXA 1KM7A 4I2HA 4TKNA 3TFSA 3C29A 7ICUA 4YXJA 1SV4A 1C4PA 3A9KB 2BB5A 3MFGA 2WF6A 5J0TA 3Q69A 3URYA 8ICYA 5J8YA 1OQYA 3AE3B 1WRDB 3RNGC 2KHWB 4MJSB 5ALDA 1DOQA 1C77A 4S17A 4UAWA 5J0OA 2RDGA 3MC1A 3NRWA 4DOBA 2WP9B 4B9KA 2INPE 1WZ3A 2I6XA 3DHHC 3KWVA 1C1YB 2DWQA 2WDTB 4AS1A 2WXMA 3TADA 2KJHB 4DQPA 1FEHA 3OJUA 4KLFA 1QCKA 3ZDMC 5GTIU 1AW7A 1ZJNA 1KLVA 3PS6A 2FBWB 4C8KA 2BGWA 3Q8CA 2KQSA 1D8YA 1E0ZA 2UU7A 4RZRA 1JWMD 2LD9A 1LKYA 2FCMA 4FJVB 2WS3B 3UI3A 3PR5B 3RYTA 2Y5PA 1S0MA 2NRVA 4FBTA 3RD2A 1ZQEA 2KJ5A 4DQRA 5J2DA 2QILA 5KFAA 1LGRA 1J7BA 3PZ7A 1SBBB 5T14A 4US8A 3HM6X 3O65B 4GSWA 2BCRA 1NYRA 3RJJA 3WIMA 4F5QA 4Z6FA 4E71A 1A0PA 2M17A 1H8CA 4BBNC 1ISNA 1ZP0B 2DBYA 2K3UA 2J52A 5CHFA 1P9DU 3HT3A 2AQ1B 4QZIA 2LI6A 2HDEA 3GP7A 4MACA 5BPCA 1X9SA 2FMSA 3NZ3A 1ZQMA 1GG3A 5KT4A 2Q4TA 2EAMA 4O3NA 1ZD3A 2NYVA 3QZ7A 3M9OB 2PXIA 4I2EA 4KVGB 4RGNA 4TMAB 5KT2A 2ZIWB 3RBDA 1KLNA 4MFAA 1X6JA 2V4LA 3ZQ4A 5KAFU 1S3SG 3MDAA 4GXJA 2ZUBA 4F93B 5TISU 1EM7A 4YSXB 2QLTA 2RSUA 5D46A 3QNMA 5J2IA 2WYQA 4CF4A 2V3PA 2GRIA 3MR6A 3KWLA 1TK8A 4IWQA 5JRTA 4ZRPA 1ET6A 2G08A 1I4QA 3MJ5A 7ICVA 2W54A 4UB3A 3TEWA 4YTNB 2K60A 2NBWB 2K0PA 3CMMB 3H40A 3D6JA 1PZNA 1Z1VA 5KFEA 3OPXA 3DHGC 3N20C 3A33B 1LFDA 2E1EA 2LWPA 1MFWA 1T3NA 2G3QB 2J0MA 2K6DB 3Q8KA 1FRDA 3IV6A 5AUIA 3C23A 4OCZA 3ML9A 2RQ5A 5AKIA 2PFOA 4PL2A 4NLKA 5FR3A 4KLEA 1UA1A 1RYUA 2QCZA 3M6KA 5ALPA 1SKRA 3CP8A 5J29A 3ETLA 4ED0A 4KSKC 1WCLA 2O6VB 2N7EA 3RUIB 2ONQA 5H92C 3GFKB 2RPQA 3BINA 4K3CA 4BUGA 1ZDVA 4DQIA 2IYDB 3OJSA 2K8BB 4MEXA 4YN4A 3I9V1 3TIXA 3OAWA 2KMCA 5ALGA 2LPEA 3Q3MC 1ZQDA 2E5SA 3AUOA 3R2TA 2BCUA 3OLMD 1A76A 1E5WA 1T0QC 3OWEB 4XE0A 3AH7A 4EZ6A 4QZAA 4JWSC 2MRLA 1SXEA 2OXOA 3C1YA 4ECTA 1NK5A 7ICOA 5JXVA 1NJWA 2DYMA 3SDLC 3AU6A 4LNKA 2KC2A 2JGAA 1V9PA 4XUSA 4HEA1 1D8BA 3C1ZA 3RFZB 1QLNA 1I7HA 4DXAB 2IY0B 2NRZA 4KTQA 3UIPB 1SSNA 3KW5B 2P66A 3Q8RB 4QZFA 5J2FA 1TJEA 3RJEA 1ZETA 4JL9A 2R8HA 1QKZA 3C5GA 2XGPA 1V81A 4DK5A 3T9LA 5KFTA 1ZQWA 3GU3A 1VD2A 1WXMA 4ECZA 1ZQOA 3WKBA 3TARA 1NK0A 3A1QB 5AI9A 5JHBA 4EEYA 1UPHA 2W03A 1IM4A 1WJ4A 1C4CA 3L10B 3PW0A 9ICLA 2YMQA 4FO6A 4C4SA 2JPHA 2PMVA 2FPKA 1C7YA 2JV3A 1SF0A 4I28A 2PI5A 5KFNA 2JEJA 4DL4A 1BPXA 3MR5A 5L9XA 2HHSA 2FIFA 1EF1A 2H3IA 5LLIA 4RQ7A 2WQYB 2W7PA 3MGHA 4NV0A 2JZ3B 3H7PA 1K1SA 2KTRA 3PNCA 1HEZE 2MH7A 2LZ6A 3DOWA 4ZYSA 3SFDB 1L4ZB 1CI4A 4GDKB 4WJPA 2G4SA 1CK1A 4N9F4 2ZUDA 3M9NB 1ROEA 2KZ3A 4DO9A 4P0QA 2JXXA 4QIWF 1LVHA 4KLQA 2WXQA 4F5RA 1JWSD 1JWBD 1KTKA 1UBQA 8ICEA 3ETRA 2JZPA 2FMQA 4A9AA 4MM3B 4IS7A 1L6UA 3W5UB 1RZTA 4IDIA 1VJKA 4BBNF 2PKOA 4KLTA 4IOIE 3OHBA 4Z6EA 4UAUA 1JRUA 4TQ0A 3DPDA 4C4RA 1XLOA 5KNIA 2NBUA 5IP4D 3H0MB 2L00B 4IQUA 3UM9A 3OJ3A 1L3SA 3BK1A 2LYBA 4LDTB 2ZIVB 4TURA 1WSPA 4FHJA 3ALRA 2BYFA 2F76X 3B2FA 2LYHA 1UNSA 1V1PA 2H3VA 2KACA 3PPAA 2KTQA 4RNNA 4EBDA 2I38A 1ZPSA 1FO4A 1V97A 2JH1A 4JV0A 3NOBA 2GBMA 2ZXIA 3HK0A 4JV2A 5ALWA 1KKXA 4YR0A 2Z0EB 1PVQA 2XK5A 2P35A 1R4MI 1XU4A 1IBXB 2DFLA 5BYSA 1P7FA 4UB8U 2E8PA 2WXKA 3PX4A 4PL1A 5DQIA 3QU7A 3AEGB 3PMNA 5J2RA 2VA2A 2AQ0A 3P1MA 4YCXA 1RFKA 1VZ8A 5DB9A 1FRRA 3M7DA 3SQIA 3W1YA 1WXVA 1DYQA 2WGSA 2XY5A 1XO1A 2JX5A 4K7UA 4ZRIA 2J6UA 4Y2UA 4W9JA 5DB8A 4BWJA 4G9BA 3RR8A 4M47A 5EDSA 3PMLA 1V86A 1E9MA 3GIMA 1ZD5A 2IGGA 1NI2A 2Y0SC 4MSQB 3KZXA 4GXIA 3BS7A 1WZ0A 1B9RA 3RF9A 3A9KA 4ZRKA 1PGXA 5C23A 5FK9C 3AE7B 5DQHA 3RH6A 2CHXA 2HHTA 4O5EA 4KX3A 1TZOA 3PSEB 1HUOA 2QIEB 4FULA 5KFXA 4DCCA 5AI6A 3KFUF 3JPOA 2KO3A 3R3MA 3WK9A 3PSIA 1BUIC 2EZXA 3QU9A 2BPGA 2LGDA 3AXCA 3V62A 2ZIXB 2W9AA 1QQ7A 1RLFA 3Q8LA 4TQSA 1SEBD 1GNUA 3B0AA 2JZBA 1NENB 1SGHA 4KSLC 4GU2A 4NL9C 1OGWA 1ED1A 3DHIC 4Y2QA 1XSLA 4KN4A 5IN7A 4YR3A 2WFAA 1T0YA 3SAGA 4Q45A 2CU1A 2ZCCA 5EE0A 1YNTE 3LWMA 4J03A 3RJFA 1MI0A 2AGOA 2RRDA 2N9LA 2D10A 4YG2A 1SL1A 5FKAC 5HMLA 1KOTA 4B6JA 2JR5A 3ZXRA 4DL2A 3UIOB 4E0DA 5J0SA 4HKQA 1PK1A 2OCEA 1C76A 2QARA 4DF8A 2K8HA 4W9EA 1Z4OA 4DFMA 3LWLA 9ICGA 4HKZE 3AE4B 3QEBZ 1XC9A 4W9GA 4M04A 5JHAA 2D8CA 1QOAA 2DKXA 4KX5A 1WR6E 3BYTB 4E74A 4RH6A 3WU2U 2LHEA 3APFA 4BJQA 2YQEA 1KFDA 4OHJA 3C2LA 2YX8A 2Y1IA 2F1HA 1FCLA 2B6GA 1WGHA 5JTIA 3M1YA 1SKSA 4MGIE 2FJ6A 2ZCBA 4MGKE 4C00A 3QJZA 2D2QA 2XIDA 4IL6U 4NWIA 1FXTB 2N4FA 3GV5B 3I28A 3VCBA 4M9LA 2D3CA 2K39A 1UHUA 1U45A 4O9MA 2MA1A 3KQ4A 4PK1A 2G9HD 2FCNA 5CR0A 4B9UA 4Y2JA 3RRGA 3U30A 5AM2A 4RF1A 2LUMA 4QWBA 1SWWA 4S0RA 1EWCA 1WR1A 2OJRA 7ICRA 2EMTA 3KUDB 5AK3A 3TACB 4MF8A 5EE9A 4QWEA 1FXAA 3PSFA 2LUEA 2LGIA 2JEFA 3P42A 2M0XA 3PT2B 5KFIA 4CF5A 1L3UA 1UD7A 1Y8RC 4F4KA 2MBBB 2MX2A 4GN1A 1NK9A 2C7HA 4KGRA 2DQNB 2F44A 2KVSA 3DVNV 1D8LA 3WK8A 1CEZA 3C21A 1ZXIA 2FLLA 4CQNA 2G0AA 4GGQA 1I35A 1QH9A 2ZNVB 2KKCA 4O3RA 2NTSA 4QZHA 2PJHA 4HROA 2X8XX 4LTUA 2ACZB 2ZJAA 4A90A 1X42A 2V4RA 4GIBA 4J9PA 3RJHA 3QK0A 1ZQUA 1Z3EB 3ZDAA 4JUZA 3QX1A 1V1OA 2LASA 4ACOA 5CWRA 5L1JA 7ICNA 3LK9A 1T0SC 1FD6A 3E56A 3QEAZ 2C2RA 4NPNA 4XDDA 4FHKA 3JPTA 4TQ1A 1NYQA 3F5AA 3SAHA 1VLBA 1HUZA 3N7PD 1PVPA 3AE5B 4ANVA 4J6IA 3F53A 3QU4A 2PFNA 4EELA 2DUYA 2IOFA 3FC4A 4OO1J 4EZKA 1ZQVA 4ELTA 5AM3A 1C20A 3IT4B 1L8LA 5DDMA 8ICPA 5J2KA 2EKIA 3CNHA 4DXFA 4XYCA 3JPRA 2VH1A 7ICPA 4PGYA 1PUTA 4A3OA 4Q8FA 3IN5A 3OHAA 1I42A 3ZDEA 1GUAB 4ZHPA 2WXOA 5AKKA 1T7PA 4OVVA 4CHKA 3NY5A 1JW9D 2IGHA 4ZDVA 5EWFA 4B0MA 1EO6A 4WAFA 4HVBA 4YTPB 1CMXB 2HTME 4A20A 3E9SA 5AK4A 1MJDA 1N63A 4HYKA 4BDPA 3CF6E 5GMVA 2O2VA 1XD3B 3X0WA 4GC6A 3ZLZA 2XI9A 3GZFA 3SYZA 3M8SA 2KNJA 3P4QB 2PFPA 4KZ0A 4P6VF 9ICCA 3Q8PB 2KYWA 3VUWA 4UB2A 4MEMA 3T8MA 5IKCM 1XO3A 4EYHB 1S0NA 1Q46A 4OZBA 4IWOA 5J2HA 2QSDA 2OEHA 1LV5A 5ALSA 1WJNA 2K8CA 3AN1A 1NKEA 1J0GA 3V7LA 2XCAA 3KH0A 2R18A 2ZIUB 5AKZA 5CA7A 3DEEA 3KZIU 3IXSA 3IM1A 5KFZA 3HX0A 1T8EA 2L0FA 5BMGA 3IDWA 2FCSA 1JX4A 5IA7A 2MA9B 2IHMA 3BVMA 3ZI4A 3L16A 7ICTA 3VC8A 2IJ0A 5D4BA 2A1AA 2Q0ZX 2JUOA 2N1WA 2AJQA 3OSNA 4R8UA 2NRTA 2KHQA 4EBCA 2C2EA 1FMAD 4RGOS 3PW5A 4WQMA 3MP9A 1UZXB 1RXWA 2WF9A 2KVZA 3RNAC 4X5VA 2ZPNA 3SEBA 4WJNA 7ICKA 2KD0A 2RDJA 2KZZA 1X9MA 3C19A 1KJTA 2AXTU 5KFQA 5CB1A 3ZJUA 5KFFA 2R8IA 3TAPA 3KUCB 4XZ4A 1N5WA 2WDRB 3AE6B 4H2AA 4WJOA 2LYAA 4YWGG 2I9GA 3AEBB 4ANXA 2FUHB 4FA6A 4D2KA 1UBIA 4NLBA 3E0FA 3AE9B 1Q0WB 1S10A 1JCKB 2GOLA 4LDTD 9ICVA 3Q8EA 2PE6B 4I6PA 3P4PB 3LB8C 2F1IA 2ZIVA 3MABA 1RRBA 3AE1B 4ED7A 4ZRJA 5D6JB 5DPWA 3AU5A 3FILB 5C0YA 2ZEQA 3ZXVA 4UASA 3IAS1 2KJ8A 1BGXT 4XDCA 3PVXA 3RNFC 2YMLA 2V1YA 2WXIA 9ICPA 3K75D 4KV2A 2IPKD 3VTVA 2RPVA 1TGZB 1B1ZA 2XK5B 2W9BB 2AGPA 5HG2A 2YTUA 3I5JC 1SWVA 1CZPA 4DBGA 1R7SA 5F9NA 2PI4A 4CO7A 3IHPC 5E6PA 1QSSA 3WK4A 2SAKA 4GB9A 1AYFA 4M9HA 1WGKA 1X2IA 4AYBF 2C60A 4GLSC 3ABVB 3PLUA 1RYJA 2KWDA 2LXAA 4RFBA 3H8MA 4UATA 3ZNID 5J18A 1F2RC 3M9MB 8ICQA 1YN3A 2MCNB 2F3NA 3EUB2 4KITB 4NY0A 3Q8MA 2LVOA 2XCPA 4JPSA 2B76B 2OYYA 1MQ3A 2OH2A 1KH0A 5TZVA 1GO3F 4HDOA 4O1NA 1AROP 3G6YA 2ISPA 5C5JA 3RN9C 2N0SB 4C0ZA 1VR9A 4USAA 3TI0A 2KSOA 3N1XC 2BDUA 1HEKA 4P7IA 1CJEA 4K7SA 2XC9A 4NJ6A 3TANA 4QW8A 2BPSA 2VANA 4X57B 1K51A 2J4XA 2UVWA 3B0YA 4G3IA 5ALFA 2OJWA 4GMVA 2FMPA 4RM8A 1RQLA 4RQNA 2EZYA 4CE6A 4KLIA 3OG5A 3M62B 4EZLA 5ALEA 1WE7A 5BMIA 2QMTA 5KG5A 1ZQBA 4BXOA 3QHTA 4F4ZA 2JZBB 2KFZA 2CKHB 4RQ5A 3SV3A 1M4VA 5KTQA 9ICJA 2JRHA 5JH5C 1YIWA 3GV8B 1KFSA 3AM9A 1D9FA 2JH7A 4EUTA 1MN8A 1WWVA 2YN4A 2KIWA 3IHQB 2MEKA 3WK5A 2D3AA 1N56A 4F1SA 1HXYD 4ARCA 4DL5A 3PZDA 2KKVA 2BCQA 1MHXA 5AM1A 4IQTA 1FPYA 3RB0A 3R2IA 2W9CA 2YVCA 1HQRD 2JWZA 4NZLB 2KMMA 5HHDG 2N9PC 4BOSC 2LEKA 5AM4A 2WAQC 5KFYA 3BVZA 1DOYA 1N62A 5D7GA 4NQLB 3EW9A 2R8KA 4NJCA 1XSNA 4RF0A 1E8ZA 3R66C 3UQ2A 4DFJA 9ICBA 2MP2B 4NLZA 2ZPYA 1MG4A 1E6EB 1N2XA 1QQ6A 4LJPB 5HNKA 8ICFA 2RDIA 1X9WA 2BVCA 3DCGA 3R7RA 2MU2A 1L7YA 1ZQXA 2LFIA 3GOEA 5HP4A 3BZKA 5AKEA 4PPXA 1J7CA 2HSZA 1WIAA 3BJYA 2GB1A 3QARA 1F0MA 3AEVA 3WKAA 1XLNA 3EGRA 1SE2A 1TY0A 1JALA 4TUPA 3HP6A 2W3RA 4MSMB 3N7SC 4C4VA 1N48A 7ICEA 3SMVA 3QE9Y 2GO7A 4JK1A 2HW3A 4FN2A 1NKCA 1GJZA 4DF4A 4ECXA 4F92B 5IIMA 3IBEA 2G1EA 3UMGA 4RQ2A 4F5PA 1WX7A 5HKHA 4F4XA 1X66A 2LM4A 5ALLA 2F2AB 4DQQA 2QKQA 1BNPA 3EECA 1FNVA 2VH2A 1Z19A 2EDUA 3PREA 1IPGA 3BZDB 3JPSA 2KXJA 1K50A 4ZRQA 4M6WB 2DZKA 2R2OA 4REZA 4NXZA 1WGGA 4ED3A 4JE3B 4F7ZA 2M9NA 3JVZX 5KFRA 1S97A 3IVFA 1PYWD 1KW4A 4LNOA 1X40A 1GB4A 1P7EA 1OTRB 5CJ7A 2ZXHA 8ICJA 4XGAB 3KHLA 3NASA 1UUPA 3PX0A 4I29A 4DXGA 3U2SC 2HD5B 4KLGA 2KWVB 4PS8A 3MDCA 4F5NA 2L52A 1K1QA 1Z1BA 3RI7C 3VR8B 3WA0A 2QB0B 3K9PB 5EOZA 4UAYA 1PQSA 2HJ8A 5DBBA 4N58A 1TS4A 3MC8A 3Q2AC 1XS9D 3EA6A 2WXHA 2IO3B 1ZUD2 2DYOA 2WXRA 3ICXA 2C22A 3CW2C 2ESEA 2JRIB 1VZ7A 4J3OD 5DG7A 4TUSA 2YEPB 2FLPA 4ZYNA 1KSPA 1RPLA 4NAMA 3RNCC 3RZFA 3NHEB 1TAQA 2Z7JA 5AK6A 5H2FU 4KLDA 3W5VB 1BVSA 2HMXA 3H7IA 2PEAA 1R4MB 4ASWC 4K4GA 3ZD9A 2GH1A 4MEYA 4JB3A 4IM3A 1QOBA 2BB6A 2G45B 5DLGA 4LNFA 5C1ZA 2WU5B 2L32A 4DHZB 1QZEA 2JEGA 1JMLA 4QW9A 1ZD4A 3HIZA 4KN7A 3W1SA 2ZJ5A 1SXDA 1L8OA 2EKEC 4OJOA 5DBCA 1DRGA 3U7ZA 1WM2A 5G2NA 5AKYA 3KTQA 2NPTA 3GS2A 5ALJA 4M0AA 2Z0DB 1X6IA 1QOGA 1UQVA 2KD1A 5DB6A 3B9JA 1WMHB 3DWMA 4AOFA 3BS5B 3AECB 4EZ9A 5J0QA 1IIPA 5KT6A 1VDVA 4WIPA 1F0ZA 5AZHA 3DVGY 1F2RI 4UB1A 2IMWP 3AU4A 4ANUA 3IG8A 3T3OA 1MPEA 3RNBC 1NJYA 2AYOB 1P1AA 5T8IA 4YXMA 2HOFA 5AEKB 5BMHA 3L54A 4ECSA 3PW2A 1JRPA 1SGGA 2IOFK 2KFNA 2R8JA 1S77D 8ICCA 4KX6B 5ALIA 9ICQA 8ICLA 4DSJA 2V9HA 1XQQA 5DPRA 1FNUA 2LMCA 4DHJD 5L95C 3LDAA 2KKPA 7ICJA 2KFKA 2WHIA 3ZD8A 3WAMA 1TV9A 8ICTA 1FM0D 1RWSA 5HHHA 1D5ZC 3C2MA 4I6NB 4ARIA 2GLEA 3QA8A 4A8XC 5H8YE 1SZPA 4GXBA 3E2EA 9ICKA 5J0XA 2GBNA 2N7JA 4B95A 2JYTA 3X23A 4DFPA 1ZQAA 3NZSA 2UVRA 2FCQA 4WWOA 1VZ6A 4MM3A 4UB4A 2KICA 3H8JA 8ICIA 2KJ6A 3Q3OC 5ALRA 4QZGA 5DDYA 2YEPF 1Z4NA 1PVRA 5B5EU 2AEHA 3L08A 5JU5A 1V9JA 4IWPA 4YVZA 2KHVA 4I2AA 4RUCA 3ZDDA 4QAYA 3F2DA 1D5XC 1BPDA 3U52E 4NAWA 5AI0A 4IM0A 3VAWA 4WJQA 1PUZA 1T5XD 3WANA 2DAJA 1SZHA 2Y1JA 1WJUA 3BQ2A 4R64A 2KN7A 2JYEA 3RTVA 3N3KB 2VKQA 3FILA 1P3QU 3GV7B 4C8LA 1PFDA 4JV1A 2C28A 5TR5A 3SD7A 2FLNA 2HVIA 8ICZA 3DBLI 4Y2PA 2C9WB 3ISDA 3UQ0A 1G6JA 2CHZA 2L1AA 3MR2A 9ICNA 2JWUA 1WJ6A 4BKTA 1S5LU 5AKGA 1KDHA 2W9BA 9ICUA 4FZNA 2MJDA 2V9WA 2ZIWA 1ET9A 4J9KA 3SAFA 5L1LA 3WK6A 2O6KA 1MHHE 2EAOA 5KAIU 3MBYA 3QXGA 5DGBA 2NBVB 5FP0A 2WDVB 2BS2B 4NJ7A 4B0EA 3MGVA 4YFKA 3EZ5A 3NGDA 2XVTA 3A4RA 1WWUA 3DBRI 5KHQA 2K22A 3GZNI 5G5GA 1QQRA 1IP9A 3DWGC 3VXWA 2N7DA 2IHNA 1RM6C 3QUTA 2EH9A 4CRXA 1XF5L 2OOBB 5EE1A 3QX7A 3V7JA 1E8YA 2WDQB 4YMOA 2L83A 2M1MA 4YXDB 2CJOA 1A77A 4DDID 4QIWC 2W9NA 1TAUA 4IRDA 3D2QA 4WQOB 4N6EB 3IT6B 4B9LA 3H0LB 1UGJA 2WXGA 3HPOA 1XT9B 2DNFA 3V6EB 4ICAA 2UVUA 4RCOA 5KFSA 3WAPA 9ICIA 1VJ5A 1YD8U 8ICOA 2JXJA 2BZFA 4Q8EA 1J2MA 3TBLD 1NOMA 4KMOB 2Q5WD 3W2DA 3R9KA 1OUQA 5C3JB 1WH3A 1ZQJA 1UWMA 5J0WA 2I1QA 4HPPA 2KJRA 3RJKA 4RPYA 4FS2A 3I57A 1ZQIA 4EENA 1S76D 1XWLA 5DG9A 4YMNA 1JROA 4DSKA 1IGDA 3QU2A 1VCBA 7ICSA 1D9DA 5IIKA 1TK0A 4FJZA 2PIAA 4YD2A 4FJYA 4A55A 4QWAA 1HJPA 4C7ZA 3OSPA 1YMHE 3VVWB 2PVOD 2OHFA 2BDPA 2DX5B 4LZDA 2C2DA 2K25A 5DKWA 4LZGA 3ZDTA 4QWDA 2WF8A 5A0LA 5EWEA 4NNJB 1ZQFA 2CHWA 2AWTA 2LGXA 3ISBA 2K89A 4DLGA 2O6VD 2FUG1 4M9NA 4IC7B 3MTNB 2NO4A 2E8OA 4AP4C 4BZAA 3VR9B 3PSTA 2FI1A 5LXIB 4WJ3B 2XBBC 2HBLA 2V3SA 2REXA 3KHGA 2XNAC 9ICSA 3B1LX 3PRZA 4OJPA 2K9XA 1WGYA 2KFJA 3J9CA 3AV8A 4LCDE 3EWAA 2DZMA 3B0XA 2KT7A 3BZCA 3TADC 1F44A 3BQ7A 3Q3JA 4BX9C 5KFJA 3RBEA 1ZW7A 2N1VA 2AL6A 1L7OA 5ALMA 4ELVA 3F2BA 3Q8FA 8ICMA 4NY8A 2A1JA 4DS4A 3C0RB 2MSNA 2Z8LA 4AWJA 4EOYA 3VHTC 1XEEA 3KBBA 2KVRA 3V6JA 3Q3NC 3AEAB 1V49A 1DXSA 3VH4B 2K6QA 1FEZA 4ED2A 1I4RA 3U8ZA 5IINA 1Z5SB 3QUQA 3NS1A 3AU2A 2KDIA 3NVVA 2M4NA 1WRIA 1NK7A 4HJKA 4BAXA 1NK4A 3MHSD 5E79U 3TEXA 1T0RC 1ZQRA 1L7NA 3ZJVA 2B21A 1Y56A 1WG8A 4LK0M 5AZGA 1JWUD 2DL0A 4M9GA 4GFJA 3A0BU 1COOA 4KZCA 3N7RC 5BYRA 5DCNA 3N28A 3PO4A 2BCSA 2WXPA 2C7MB 3ZVVA 1ENFA 2J7QB 3HWTA 4J9MA 2QC8A 3BY4B 4KLMA 3RB3A 2MWSB 1KQQA 1WFYA 2PFQA 5IIOA 5HR6A 3GIKA 4QZ9A 4FBJB 5D49A 2A19A 1TYGB 2LJIA 1PDXA 2M56B 4M01A 4LJXA 4KMUA 3KLSX 1SIJA 8ICGA 5ALUA 3PW7A 1BPZA 1S9FA 2FIDA 4RM9A 2IO0B 5KG6A 4DWIA 3PO0A 2YY6A 1U4BA 4PZOA 4O3OA 1K5OA 4Y2VA 4KDLB 3HJEA 2INDC 2WB1F 3HILA 5CP2A 3VQIA 1U9LA 2ON8A 3NRZA 1L0YB 2KQ7A 3PHWB 4M8NA 5ALTA 3LVVA 2KTRB 3BK2A 5GTHU 4ITKA 2E1FA 2CRXA 2LI5A 2WU2B 2QEJC 3BYYB 4EEWA 4OVZA 3SEIA 1ZQTA 1YQ3B 3SD5A 3S6JA 2AU0A 1ZDXA 4I2DA 4ZHOA 3P4RB 5J8YC 2DENB 1WM3A 5KFCA 4PGXA 5KHOA 1Q3VA 2BTEA 4P4OA 1TKEA 3KD3A 2QDFA 5DB7A 1MC8A 5KG3A 2J0JA 4W9IA 3SHQA 3TQ1A 2W55A 1GPXA 4EYIB 4ELUA 2XICA 4YQWA 1UWXA 4P4MA 3VUXA 2KZMA 2Y9TA 1NK8A 3UINB 4C8MA 5AHXA 4Z6CA 1SE4A 1L7PA 2H5XA 3RH5A 3ZKJC 4P16A 2VA8A 4RU9A 4KLHA 1WGDA 3SZ2A 5ALXA 3R8BA 2XGQA 2W8LA 1A5RA 2ZW0A 1E10A 2KLCA 3VTUA 3NTUA 3EYZA 5KFWA 7ICIA 4AQ7A 3GIJA 4WAAA 4FADA 1T4GA 2JRZA 2CXYA 4ACFA 3HRDD 1TKDA 1B22A 2J53A 9ICHA 2XN9C 1X9XA 2DPJA 3M6ZA 2JXTA 2IZVB 3THVA 2ZIXA 3Q6BA 2ZUCA 2AQ4A 2NCNA 2VZKB 4QWCA 4KKJA 3V3XA 1LXDA 4BGDA 3QQ8B 4G3XB 2KDMA 4ECYA 2NRWA 2I1JA 1CRXA 2MLBA 4AJYB 4OZAA 1HTQA 2HVHA 8ICVA 2EAPA 5ALOA 4PHEA 1E8WA 2L05A 2AX5A 1LB2B 1V80A 3GB1A 1QILA 3V6HA 4NL9A 2GLSA 1PK1B 4DQOC 3QUCA 2KN4A 4NLGA 3DVNU 4A3PA 2MSED 1S1QB 1WWTA 2MW5A 3WALA 3HHMA 2PTLA 3NVYA 5JUMA 9ICMA 1A6SA 4YSYB 3TMPB 4DWFA 1BMLC 3O13A 3K9OB 4UB5A 3CSFA 3R7QA 5F9LA 1TS2A 2ZTDA 4QZEA 5E6NA 2J0KA 2Y0SF 1WE6A 1TAMA 2JT4B 3GE3C 2XO7A 1SL2A 3ZUNA 2ZW1A 1RAXA 2K4PA 5AKJA 4F4WA 3H8WA 2D3GA 2KQ4X 2B0CA 4EZJA 2CJNA 2KJ9A 4FZLA 4ZH4A 5ALZA 1LO5D 2EELA 2ZTEA 2HHVA 2KNBA 3EPIA 2MJEA 3PRPB 4B9VA 1GOZA 3WK7A 1SV0A 5J0RA 1GC6A 1ZGUB 4FE3A 2PPHA 1N5XA 1IGCA 1YQBA 1XSPA 1RQNA 4NLNA 1EUVB 2HOIA 4WH4A 2FPLA 2NVUI 2KOBA 1UA0A 2P6RA 3C5FA 3LYYA 2IO1B 1L7MA 4F5OA 1WXSA 2BR0A 2OM6A 1OQQA 2LGSA 2F77X 2H3FA 2HCFA 5KG2A 2LVQA 2ICIA 5G5HA 4DSLA 4PHDA 1Z00A 5AKHA 1Q8KA 3IG3A 2IO2B 2RD0A 3RZWC 2V0GA 1V8CA 4IW0A 3I63C 8ICRA 4UB6U 1K53A 2D3BA 4E3CA 3SR6A 4F2SA 2WAQF 3OJ4B 4UBBA 1XO0A 3K1RB 4F2RA 3H8HA 2Z59B 2D5GA 4DL6A 1FNWA 4WURA 1HE8A 3AQEA 2F8KA 3M3JA 1N61A 4I6LB 2MBEA 3ED5A 2YMPA 4BWMA 1SIFA 3V60A 3S2AA 4GDLA 1E90A 2Y5CA 5DG8A 1XCTL 4QZDA 2R8GA 3NS8A 4HXDA 1MSWD 1OXJA 1L3TA 3K1ZA 2ASJA 2UWQA 2RGFA 1DK2A 3C2KA 4J9NA 1OEYJ 4M0WA 1SB3C 2MHJA 1LQBA 2YLMA 3A4SC 4PH5A 3J81j 1P0RA 3UQAA 1ECWA 2NTTA 4OJLA 2W9CB 2J6TA 3IFWB 1TIFA 4JX1C 1YN5A 4W9LA 5KG7A 4PYZA 4OVUA 2RMMA 5J2GA 1NEKB 2YB4A 2OEDA 2KN5A 3DDCB 5E6OA 5BO4B 3TCAA 5KT5A 2BWES 2BKRB 4JIOU 1YOVB 1TKYA 1ZQZA 4B9NA 1WGRA 4HDQA 2BBCA 4AUQC 2L5YA 1L3VA 1V6EA 1TE2A 3UPQA 3AI5A 2HBKA 5I4DA 4DSFA 1BNOA 1ACCA 2ZJDA 2EANA 5D94A 1NI3A 3RPFC 3TEZA 1E7VA 1SL0A 3HM3A 2QB1A 1SE3A 4N59A 1HTOA 2HDOA 4DSIA 1KF6B 3H6NA 2DKZA 2ZIUA 5J17A 1QTMA 4GDKA 3V7KA 4MDKE 3V61A 4LVSA 2PKEA 4RQ6A 2W8KA 2FAZA 2K8BA 4C4TA 1SE9A 4KGTA 4J9LA 4K1RB 3GZNB 3GILA 2ALZA 4KDIC 4EKUA 3JPPA 4OW0A 2W04A 5AIAA 1C4AA 2KEYA 3IRUA 3F2CA 3T3NA 5L1KA 4I2FA 3PTFC 5KG0A 2BYVE 3BQ1A 2EMSA 3VH3B 2DPIA 2BW2A 3NVWA 4I2BA 5DGAA 4ZOHC 5MPOA 4M00A 3A0HU 2BS3B 1WYGA 2PLPA 1WI0A 2WXLA 3BDPA 4Y2YA 2Y9UA 1S0OA 2JF5A 4W9DA 2KANA 3TL5A 3ZIMA 2KIVA 3G6VA 1BT0A 1GB1A 2ZVNA 3O0FA 1K8RB 1ZQYA 3L0WB 4W9CA 1Q10A 4KKIA 1NK6A 4IM2A 4RUAA 2J42A 1TY2A 4II2B 4KLLA 1UELA 2YMMA 1VRAB 2PMZC 1C78A 4O5CA 1KLUD 4P0PA 5HMMA 2FDRA 5KL8B 1OQRA 5F3XB 4YR2A 2H89B 4LLGM 1JI7A 1WYWB 4F50A 3D32A 5CHVC 9ICOA 3UQBA 2J6SA 3PY8A 3PLVA 3PO5A 3TEYA 4CYEA 4LNIA 3QU5A 5AZFA 4IG7B 5J0YA 4I27A 4DL7A 4DHZE 4G50A 1C3TA 4MJSA 3LVWA 1GC7A 3MC0B 4KGSA 2LHTA 2LMRA 3DV9A 2GOWA 3H7PB 1ZRNA 1AN8A 3Q14C 4JGHB 2IBKA 4MELA 4IR1A 3Q8BA 4FZMA 4ECQA 4IQWA 2CU3A 4C80A 3UXOA 4RPZA 4RPXA 4JQWC 4URKA 3G6XA 3DDHA 3PW4A 4JLCA 1BPEA 4R3DA 4UBCA 3H9DA 4EE2A 1C9FA 1JIHA 8ICAA 2N9EB 1SJED 4NJ8A 5AI4A 4L2YA 1R4NB 3WKDA 5G55A 1X1MA 5KFBA 2KDFB 8ICKA 3ENEA 2XY6A 2KLGA 3LXFA 3FDSA 1KRPA 5B66U 5J0PA 4CGZA 4KIKB 4XA5A 3BS5A 4P4PA 3NUHB 4J9RA 1LKYB 2BQUA 4ECUA 3DVGX 9ICEA 1YJJA 5DQGA 2ZVOA 2KSOB 4XRHA 3H4DA 9ICRA 4JMUA 1K52A 2ZJ8A 2A4ZA 2Y3AA 1WF9A 2ASQA 4UAVA 3GIIA 4J9OA 2BS4B 4J9QA 4UAZA 3RJGA 5CRXA 1WX9A 1AQ6A 4OD0A 4F3OA 4UQGA 4O5KA 4C8NA 3UXPA 3VFKA 2LKYA 2PW9A 1O08A 1E8XA 2DGZA 1AARA 3RRHA 9ICWA 3HVZA 4TUQA 1ZQQA 3LYSA 2BYEA 1C79A 4IKGA 3RR7A 7ICGA 3MJWA 4MH0E 5IOIA 7ICQA 3T3FA 1H4RA 3L13A 2AL3A 4F8CB 1PGAA 3RJIA 2RDBC 5ALYA 2BT6A 2DHZA 3AEDB 4P1CC 1WUDA 3H7SA 5BYQA 3MFHA 3C28A 4DEZA 1OFFA 2NO5A 3W1SC 1NJXA 1MA7A 3EPGA 1F52A 1SJHD 4JWMA 4NLCA 3NG0A 5DPSA 1DGSA 2BPCA 4AYBC 2DLBA 5KFDA 2W7OA 1QSLA 4FBUA 1L5PA 3CYMA 1BXTA 2BHNA 1L5UA 4HPMB 4XQ8A 5DPTA 2JY6A 3H4BA 2C5LC 4I2CA 1QQ5A 2WB1C 3ZDCA 4I2JA 1BPYA 4FXCA 3D2NA 9ICTA 4RT3A 2MP2A 5IAAC 2M0AA 1YQ4B 4YP3A 1ZQ1C 3ONSA 3ZO5B 2CS4A 3GE8C 4OZCA 3H0RB 3GDXA 1QF6A 1YX6B 2VZKD 5HFYA 1QSYA 3D2SA 1JQ4A 4F71A 2JEIA 2AH5A 2WXJA 4IUMB 4LNNA 4NQKE 2G5IB 1NBFC 1CUKA 3EFUA 1V85A 1TZ1A 5AIBA 2GBJA 3CWIA 3U4EG 2ASLA 5J2EA 3PV1A 4PZNA 4Y2SA 5J2JA 2O6VA 2BQRA 4M02A 2JMGA 2MUTB 5AM5A 4U6PA 1D3ZA 4YMMA 1KFTA 1V5TA 5KL1B 3CRXA 4YTMB 2R2QA 2WHEA 3VUYA 1HZ5A 2EZZA 1YX5B 4RQMA 2NS5A 8ICHA 5CTRC 4EX6A 4WWNA 2WF7A 4BKSD 5LNK1 1ZQPA 2LXCA 3QCAA 1UF0A 3AL0B 2L76A 5KT7A 4EBEA 2E3TA 1U47A 2JZZA 2FPMA 2DYBA 4F8RA 1DGJA 4XC2A 1JWAD 2KVCA 2E8MA 2KE7A 4DLEA 2KWCA 3JYUA 1XNSA 1T3QA 3ZW3A 2CPRA 3JPNA 1YN4A 4QNLA 4F91B 3BVGA 1FFUA 2CN1A 4O3PA 4QZ8A 1L2NA 2K5PA 3T5HA 2INCC 4DDGD 2G07A 2KG5A 5KFLA 1RYSA 4UW9A 2ISOA 3C8YA 1XLPA 4LJOB 1UT8A 1D4BA 4YT0B 2BKFA 3EC8A 2QJLA 3M8RA 4M2YA 2TSSA 2VJ4A 3T5KA 3DBHB 2HHQA 2R61A 1KBUA 3A9JB 3KKAA 4HCPB 4GDLB 2B3AA 2WNMA 1TK5A 3PR4A 4ECVA 3A1QA 3QC8B 2VJ5A 2GBKA 3L3FX 3M63B 1ZOLA 8ICUA 4Q2JA 2IGDA 5EE3A 3PZPA 3UMBA 1RDFA 1COKA 3DBLB 4M0WB 2I1KA 5L1IA 5TSSA 4G0NB 1YT3A 2K1FA 4RT2A 7ICMA 1ZJMA 4L23A 4FS1A 5KG1A 3PV8A 3KYDD 1QOFA 5KFUA 4EEKA 1NJZA 1ZQSA 1P98A 4MT5A 4DOAA 1R4NI 1S8OA 1DOXA 3ZNZB 3T5JA 3PRMB 3B2GA 5D3IB 3UF8A 4P0QB 5DLFA 4RQ4A 4DL3A 4DFKA 4P2HA 2KK8A 4G11A 2LGYA 4BKGA 1M6YA 1T6BX 2WX1A 1NZPA 2ES6A 2K4IA 4UARA 1EU3A 3IG5A 3N1ZC 3QZ8A 3BWUD 1V38A 1RXVA 4GIVA 2MQJA 4CNQA 3TSSA 1S0VA 1O03A 3CIRB 4ANWA 4RMAA 1Q3UA 4XWWA 3APDA 2K8CB 2UYZB 1F9JA 2KMAA 3AB5A 2G4DB 4KLUA 3LDZE 3WKCA 5IO9A 3BQTA 2A1JB 1J7AA 1HZ6A 5JZEB 1BPBA 2RHFA 2BYTA 2NR2A 2F8LA 1JUDA 2GBRA 4K7WA 3ZNGC 1JXLA 4Y2XA 4AJWA 1SXTA 5HHIA 1V1PB 2D3DA 5CHWA 2PE9A 5IIIA 3P63A 4XX5A 3FAHA 2WTFA 3U26A 1Z2MA 4B9TA 1JN3A 2ASDA 2C7NB 1KL9A 2SEBD 3P4SB 2KC1A 5AI8A 1MG8A 3AMZA 3T5LA 1L6VA 3FKYA 1WY8A 1ZE3D 3AE8B 3UGBB 1ZRMA 1NNLA 2WX0A 1IBXA 3HVDA 2JHDA 4CF3A 4HPLB 4KLOA 4R65A 3QIJA 2D11A 1J8CA 3WAOA 2WLBA 2L8JA 3N97B 4RNOA 2KV2A 5AKLA 3FM9A 2LRUA 4F72A 3JSVB 3WCQA 1HIWA 2IOHA 4K3BA 5J2AA 4MFCA 2X38A 2BPFA 2D6FC 2ODGA 5CEHA 2E8NA 1N60A 7ICLA 4QZBA 4C8OA 1B43A 2DAFA 2H88B 3QYPA 4TQRA 4P0PB 3GQCA 4MHVA 1ZQKA 1U4AA 1YJIA 2AQ3B 4ECRA 3DQVA 1IXRA 1MVKA 4YL8A 2O2VB 3IP4B 1V5OA 2H3ZA 3I76A 5AI5A 1URJA 4IR9A 4K4IA 2LHDA 3V6CB 5L1MA 3JPQA 1RYRA 2BQQA 3LJ3A 4O3QA 3H8SA 3BQ0A 1XXGA 1F1HA 3RMKC 3NVZA 2GI9A 3SI8A 1F77A 3TFRA 4FFDA 5KFVA 1FCCC 4Q43A 1J19A 3Q8QB 2PMZF 5KFMA 1ZYQA 3OTQA 9ICAA 4GLXA 2LRWA 1P7DA 1ZD2P 1T94A 2N9XA 2KK0A 3ECIA 2OWOA 2K4EA 4AP9A 1IG6A 2Y5BB 4Y2TA 4JWUC 3VRBB 4RGTA 1Y88A 4ED8A 1B0XA 5FR6A 5CX3A 1N6ZA 3RH4A 4U7CA 3FYHA 4R63A 3ISCA 3IAM1 1FFVA 2MJ3A 1KEJA 1XLQA 2KFKB 3BIID 2W3SA 3Q3FA 2G5HB 2W9MA 1TS5A 5K4LA 1ZQNA 1WX8A 1H38A 3AULA 3ZRCA 4W9HA 2P6UA 2FE8A 4KIKA 1NZBA 1DK3A 3HKZC 2BGFA 2KX0A 4IRCA 3RAXA 1IYFA 9ICXA 4WWMA 3HUIA 4PGQA 1YZ7A 5LXHA 5KFOA 2WWZA 2A3VA 2MRPA 2HHUA 2KX3A 2QARB 3RCZA 2I2YA 4O0IA 2IY1B 3N9YC 1EF5A 3EFCA 3P2BA 4L1BA 4K4HA 3K4GA 2AGQA 8ICBA 5ALVA 1DOIA 4OJ6A 3DBHI 5E6JA 4K81A 4BXOB 4UDUC 4PHPA 1NVID 1F5SA 4EFOA 2MBQA 1GAQB 2DF4B 5J2CA 1NKBA 3VTWA 3ZTCA 2K4HA 2HI0A 3TUOA 3U7DA 1L6NA 2D07B 2ZNVC 1WCNA 2KP7A 2V4QA 5EWGA 3KHHA 8ICXA 3L5KA 4FLHA 2I5HA 4A8EA 1L0XB 2YB1A 7ICFA 3MFIA 3Q8SB 2IA6A 2HHWA 3W9CB 5KT3A 1I4PA 1JMSA 5ALQA 2INNE 1TKGA 2KAJA 4RQ8A 4ICUA 3RT3B 4YD1A 1I4GA 2LVPA 2E6XA 5BOLA 4RNMA 4XWTA 1ZOYB 4R66A 1MQ2A 2H3QA 2DZIA 4Q44A 4EX7A 2M0NA 3V72A 4DQSA 4HRSA 4C7YA 2JVCA 1IV8A 3RULA 3ZDBA 4TUUA 1WXQA 1L4DB 3NZUA 3HW8A 5AUKA 4GXKA 5DBAA 3EHVA 3ZJTA 4DHJB 1OEYA 2MBOA 3MGIA 4PS3A 2K8AA 3SENA 3CSTA 1FXIA 4II3B 3RNEC 4RQ1A 1KRHA 2KTFA 1YZ6A 2G06A 3PSPA 1IUEA 3RAQA 2G09A 5J2BA 2CR5A 3T79A 1ZQGA 4ECWA 4OJ5A 3E58A 4C4VB 3L17A 4ICVA 3KKAC 3M95A 1E7PB 3VDZA 3Q8AA 3KVFB 2MAXA 1OW5A 1KFYB 5ALNA 3PVLA 1D6EC 2MUTA 2KDEB 2HBMA 1E7UA 3NJTA 2WF5A 2WXFA 2IBIB 3PGEA 2JU6X 2W11A 4Y2RA 2L3ZA 3RB4A 1SKWA 4HCNB 1EWYC 2VRRB 4PT5A 4RQ0A 2MBHA 4DOCA 1JXEA 1ZQCA 3PHXB 4M9JA 8ICNA 5HI1A 1U48A 3F5EA 2BQ3A 1EU4A 5GXGB 4M6WA 2ZZPB 5C2TB 2L7RA 2AQ2B 5KFKA 5L83A 1Z00B 3V05A 4Z6DA 4I2GA 1UT5A 2LM1A 1ZKHA 5CHGA 3SFEB 1EXNA 4QZCA 4BFRA 1TS3A 2NMQA 3B08A 3NUQA 1NDDA 4BVUC 2RDHA 5KFGA 1J2NA 3UXNA 3UMCA 5KFPA 1UGMA 4B6WA 1QT9A 1KN5A 2HJ1A 2RP5A 1ESFA 3N1YC 2QB0A 4RGMA 1J97A 3SU8X 9ICFA 3L4PA 4B9SA 4JWNA 4MH8A 4O3SA 3TJPA 2ZTCA 4IQVA 4MGYE 3I3TB 1KLGD 4C56C 3ORYA 3A9JA 1UH6A 4US9A 2ZG6A 2XY7A 2IDYA 5IILA 4IRKA 5D2MB 2KWUB 3AEFB 4RNAA 1SV0C 1TVAA 1TFRA 4YSZB 3AQFA 1UCVA 1Q5WB 3ZNHB 2RLTA 2BWFA 2A5UA 2L0TA 4HJGE 1RG6A 2M8SA 2GMIC 2UVVA 3ML8A 2WXNA 2XEWA 4PS7A 3QUBA 4HAIA 2RR9A 2LJ5A 3DBRB 4ED6A 1I4XA 5AK5A 2KZRA 3TKAA 5KFHA 2GWSA 4DS5A 1V2YA 3KUZA 3SV4A 1ZQLA 3ONNA 3HKZF 1KTQA 4MFFA 1TBEA 2HE7A 3I1YA 4PHAA 3WKEA 3H1UA 3APCA 2V4IB 4M8MA 4PYUA 3OGUA 4BOZB 8ICWA 3AE2B 3ZGZA 3QAQA 1LM8B 5IIJA 2EQYA 2M19A 1D5MC 4R8UB 2NPTB 4HLEA 1FIQA 2FE9A 2FNJB 1L0VB 1WMHA 2VIXA 2JSVX 3MC9A 3N4MB
chains in the Genus database with same CATH topology
1ZXHA 1YJJA 1PGBA 4N6EB 3ZYYX 1ZXIA 1K52A 3IT6B 2Y3AA 4CQNA 1UGJA 2WXGA 2NTSA 1CQVA 1AWDA 2BS4B 4HROA 4LTUA 2ACZB 2JQRB 4RCOA 4A90A 2V3NA 2Q5WD 4TSSA 3W2DA 2PW9A 5C3JB 1V1OA 1UWMA 1STEA 1A70A 1I4HA 1FD6A 2PVGC 3HVZA 3PZ8A 3E56A 4XDDA 2W82A 2N9KA 4TQ1A 1NYQA 1C79A 1XCQL 4IKGA 3I57A 1VLBA 3AE5B 1PGAA 3FC4A 1JROA 1IGDA 2BT6A 3AEDB 5BYQA 1OFFA 4A55A 2PIAA 3IT4B 5D3DA 1SJHD 4C7ZA 1YMHE 2EKIA 2PVOD 2OHFA 2DLBA 4DXFA 3VRAB 4A6QA 1PUTA 1HA5A 4NAWB 1L5PA 1BXTA 4ZHPA 3AEEB 2WXOA 3MHZA 1QLBB 1JW9D 2FUG1 2IGHA 4FXCA 4B0MA 4WAFA 2M0AA 1YQ4B 4YTPB 3VR9B 2HTME 3E9SA 1N63A 4OZCA 1QF6A 2XNAC 1C4PA 2VZKD 5HFYA 1JQ4A 2BB5A 3MFGA 3P4QB 4P6VF 2K9XA 2WXJA 3Q69A 3J9CA 3URYA 3AV8A 1XO3A 3AE3B 4OZBA 2QSDA 3CWIA 1C77A 3U4EG 2RDGA 3AN1A 3Q8FA 2WP9B 2INPE 3IXSA 3KWVA 5BMGA 2DWQA 2Z8LA 2WXMA 4AS1A 3BVMA 1XEEA 4YTMB 3AEAB 1HZ5A 2IJ0A 1FEHA 1AW7A 5LNK1 1I4RA 2FBWB 3Q8CA 2E3TA 3NS1A 1FMAD 4RGOS 4WQMA 3NVVA 1WRIA 3MP9A 1E0ZA 1DGJA 1JWMD 1JWAD 2WS3B 1T3QA 3SEBA 3UI3A 3TEXA 2Y5PA 3ZJVA 1Y56A 1YN4A 3ZJUA 4LK0M 1JWUD 3BVGA 1FFUA 2QILA 5BYRA 1N5WA 2WDRB 1J7BA 3AE6B 3PZ7A 1SBBB 4H2AA 4YWGG 3AEBB 2WXPA 4US8A 2K5PA 1ENFA 4D2KA 1NYRA 3AE9B 1JCKB 3C8YA 3Q8EA 1XLPA 3P4PB 1D4BA 1TYGB 2LJIA 3LB8C 4YT0B 1PDXA 2QJLA 2M56B 2TSSA 1ZP0B 3AE1B 3KLSX 2DBYA 2K3UA 2J52A 1SIJA 2AQ1B 2R61A 3FILB 4GDLB 2HDEA 3GP7A 2WNMA 3IAS1 4MACA 4XDCA 3NZ3A 2WXIA 2IPKD 4RGNA 3PO0A 4Q2JA 4TMAB 2IGDA 5EE3A 2RPVA 1B1ZA 5HG2A 5TSSA 1CZPA 3ZQ4A 1R7SA 1EM7A 4L23A 4YSXB 2SAKA 3VQIA 1AYFA 2ON8A 3NRZA 1L0YB 1QOFA 1WGKA 3BK2A 4GLSC 4ITKA 3ABVB 2WU2B 2QEJC 3BYYB 2V3PA 2GRIA 4MT5A 4OVZA 1RYJA 2KWDA 3KWLA 4RFBA 4ZRPA 1YQ3B 1ET6A 1I4QA 3MJ5A 1F2RC 1DOXA 1ZDXA 4ZHOA 2W54A 1YN3A 3B2GA 3P4RB 4YTNB 3TEWA 3EUB2 5D3IB 2K0PA 2BTEA 4JPSA 1TKEA 2B76B 1T6BX 1KH0A 2W55A 1GPXA 1EU3A 1UWXA 4O1NA 1FRDA 5AUIA 3BWUD 5FR3A 1SE4A 2N0SB 3TSSA 1VR9A 4USAA 4P16A 3CIRB 1CJEA 4XWWA 3R8BA 2ZW0A 1E10A 1K51A 2J4XA 4AQ7A 3AB5A 2ONQA 5H92C 3HRDD 1J7AA 2J53A 2XN9C 1HZ6A 5BMIA 2QMTA 2BYTA 2JXTA 1ZDVA 3I9V1 2VZKB 4KKJA 1SXTA 3V3XA 1V1PB 2KDMA 3P63A 1M4VA 3R2TA 3FAHA 3OWEB 4XE0A 3AH7A 3AM9A 2SEBD 4JWSC 3P4SB 3AMZA 1L6VA 4OZAA 1ZE3D 3AE8B 5JXVA 2DYMA 2MEKA 1IBXA 3HVDA 1HXYD 2AX5A 4ARCA 4HEA1 3GB1A 1MHXA 1QILA 3RFZB 1I7HA 2WLBA 4DQOC 3R2IA 1HQRD 2KN4A 4NZLB 2KMMA 5HHDG 1SSNA 3WCQA 1WWTA 2LEKA 1TJEA 2PTLA 3NVYA 1N62A 3BVZA 4YSYB 5D7GA 2X38A 1DOYA 1N60A 4NJCA 1BMLC 1QKZA 2H88B 4RF0A 3O13A 1TS2A 1YJIA 2AQ3B 1E6EB 1MVKA 2ZW1A 2LHDA 2LFIA 1C4CA 1J7CA 2KQ4X 1XXGA 2GB1A 2CJNA 3NVZA 2GI9A 1XLNA 2PMVA 1F77A 3EGRA 1SF0A 1SE2A 1TY0A 1JALA 1FCCC 2EELA 1LO5D 2W3RA 2WQYB 2MJEA 1HEZE 2MH7A 1GOZA 4JWUC 3SFDB 4ZYSA 1L4ZB 4GDKB 3VRBB 4RGTA 2G1EA 1CK1A 1N5XA 1ROEA 1IGCA 3IAM1 1FFVA 2MJ3A 4WH4A 1XLQA 1FNVA 2WXQA 2W3SA 3BIID 1JWSD 1TS5A 3LYYA 1JWBD 1KTKA 3ETRA 3BZDB 2FE8A 2JZPA 1K50A 1OQQA 4ZRQA 2ICIA 4REZA 4A9AA 4MM3B 5G5HA 1L6UA 4JE3B 3W5UB 4WWMA 4IDIA 1VJKA 3HUIA 1PYWD 2PKOA 4IOIE 1P7EA 1GB4A 2V0GA 1V8CA 4TQ0A 1K53A 2I2YA 1UUPA 3N9YC 3SR6A 1XLOA 4L1BA 4DXGA 3U2SC 5E6JA 1DOIA 2L52A 3BK1A 3H8HA 3VR8B 2D5GA 4WURA 1FNWA 4N58A 1NVID 1WSPA 1TS4A 4UDUC 1N61A 1GAQB 3B2FA 1V1PA 1UNSA 2KACA 3EA6A 2WXHA 3TUOA 1ZUD2 2I38A 2DYOA 2Y5CA 2WXRA 1XCTL 1ZPSA 1FO4A 1V97A 1VZ7A 4J3OD 1L0XB 2YEPB 3W9CB 1I4PA 4NAMA 4M0WA 1SB3C 1IBXB 2INNE 1TKGA 5BYSA 1P7FA 2KAJA 3W5VB 2WXKA 1I4GA 2E6XA 3AEGB 4XWTA 2NTTA 1ZOYB 1QOBA 2BB6A 4JX1C 1YN5A 3P1MA 2WU5B 1RFKA 1VZ8A 2L32A 1FRRA 4HRSA 1DYQA 1JMLA 4C7YA 2JX5A 2RMMA 1NEKB 2OEDA 3W1SA 1WXQA 1L4DB 5AUKA 1E9MA 3U7ZA 2IGGA 3GS2A 1TKYA 3ZJTA 1B9RA 2BBCA 1QOGA 3DWMA 3B9JA 1FXIA 1PGXA 5FK9C 3AE7B 3AECB 1KRHA 5I4DA 1IUEA 3RPFC 1ACCA 1NI3A 1TZOA 3TEZA 1VDVA 4WIPA 1F0ZA 1F2RI 1SE3A 4N59A 2QIEB 1E7PB 1KF6B 3T3OA 3Q8AA 1MPEA 1KFYB 5T8IA 1D6EC 5BMHA 1JRPA 1BUIC 2WXFA 2JU6X 4KX6B 4KGTA 1FNUA 2LMCA 1EWYC 1SEBD 4PT5A 1NENB 1FM0D 1RWSA 1D5ZC 4OW0A 4ARIA 4A8XC 1C4AA 5H8YE 5HI1A 2N7JA 3T3NA 2JYTA 5EE0A 1EU4A 1YNTE 5GXGB 1MI0A 1VZ6A 2BW2A 5C2TB 3NVWA 2AQ2B 4ZOHC 5MPOA 2N9LA 2BS3B 1WYGA 2YEPF 5FKAC 2PLPA 2WXLA 3V05A 3SFEB 1TS3A 4HKQA 2NMQA 1C76A 1GB1A 2RDHA 1D5XC 3U52E 4HKZE 1Q10A 3AE4B 4KKIA 1QT9A 2J42A 1TY2A 1ESFA 4RGMA 1T5XD 1QOAA 3L4PA 1VRAB 3BYTB 1C78A 4MH8A 1KLUD 4RH6A 1KLGD 2LHEA 4C56C 2JYEA 1OQRA 3FILA 2H89B 4OHJA 4US9A 4LLGM 1PFDA 2IDYA 1FCLA 3AEFB 4RNAA 4YSZB 2L1AA 3TEYA 2JWUA 4HJGE 2MJDA 1ET9A 1MHHE 2WXNA 3MC0B 4KGSA 3KQ4A 1AN8A 2WDVB 2BS2B 2G9HD 4B0EA 3Q8BA 1I4XA 2CU3A 4C80A 4RF1A 2K22A 5G5GA 2LUMA 1QQRA 4EE2A 4R3DA 1C9FA 2V4IB 3DWGC 1SJED 1EWCA 1RM6C 3AE2B 1FXAA 5EE9A 3ZGZA 3LXFA 1XF5L 2M19A 1D5MC 2LGIA 5EE1A 3P42A 4L2YA 1FIQA 4KGRA 1L0VB 2WDQB 2JSVX 2L83A 4YXDB 3NUHB 2CJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1N60 A;  1N5W A;  1J7B A;  2WDR B;  3AE6 B;  1YJJ A;  1TKY A;  2H88 B;  4US8 A;  2K5P A;  3AEB B;  4HRO A;  4N6E B;  1B9R A;  3ZYY X;  1ZXI A;  1NYR A;  1YJI A;  1QOG A;  3AE9 B;  3DWM A;  3B9J A;  1FXI A;  1E6E B;  1XLP A;  2BS4 B;  1AWD A;  1KRH A;  3AE7 B;  1TYG B;  3AEC B;  3LB8 C;  3P4P B;  1PDX A;  1IUE A;  2ACZ B;  2JQR B;  2M56 B;  1ZP0 B;  2QJL A;  3AE1 B;  1NI3 A;  3RPF C;  2DBY A;  1SIJ A;  1VDV A;  1J7C A;  1F0Z A;  4N59 A;  2Q5W D;  2CJN A;  3NVZ A;  2QIE B;  1E7P B;  1KF6 B;  1XLN A;  5C3J B;  1SF0 A;  1KFY B;  1UWM A;  1JAL A;  1A70 A;  2PVG C;  1JRP A;  2W3R A;  3HVZ A;  3PO0 A;  2WQY B;  5EE3 A;  1NYQ A;  4KX6 B;  2CJO A;  2MJE A;  1VLB A;  2MH7 A;  1CZP A;  1EWY C;  1R7S A;  3AE5 B;  4JWU C;  1NEN B;  3SFD B;  3VRB B;  1FM0 D;  4YSX B;  3FC4 A;  1RWS A;  1JRO A;  2BT6 A;  2G1E A;  1AYF A;  3AED B;  3NRZ A;  1QOF A;  5H8Y E;  1N5X A;  1OFF A;  1ROE A;  1WGK A;  2PIA A;  4ITK A;  5EE0 A;  3ABV B;  2WU2 B;  5GXG B;  1FFV A;  4C7Z A;  2MJ3 A;  1RYJ A;  1XLQ A;  2EKI A;  2PVO D;  2W3S A;  3NVW A;  3BII D;  3KWL A;  2OHF A;  1YQ3 B;  5C2T B;  4ZOH C;  1DOX A;  5MPO A;  1JWB D;  2BS3 B;  4ZHO A;  2W54 A;  3B2G A;  1PUT A;  1WYG A;  3P4R B;  4YTN B;  3EUB 2;  3VRA B;  3ETR A;  1L5P A;  1OQQ A;  1TKE A;  2B76 B;  3SFE B;  4A9A A;  5G5H A;  4ZHP A;  3AEE B;  1L6U A;  2W55 A;  3W5U B;  1GPX A;  4WWM A;  1QLB B;  1JW9 D;  1VJK A;  3HUI A;  4FXC A;  3AE4 B;  4IDI A;  1QT9 A;  2PKO A;  1FRD A;  1YQ4 B;  4YTP B;  5AUI A;  3VR9 B;  1V8C A;  2HTM E;  4LTU A;  1N63 A;  1QOA A;  3L4P A;  2N0S B;  4USA A;  3SR6 A;  1XLO A;  1QF6 A;  3CIR B;  1CJE A;  1JQ4 A;  3P4Q B;  1DOI A;  1OQR A;  2K9X A;  2L52 A;  4P6V F;  2H89 B;  3VR8 B;  4US9 A;  1DOY A;  1PFD A;  1E10 A;  3AV8 A;  3AB5 A;  4N58 A;  1NVI D;  1XO3 A;  1N61 A;  3AEF B;  3AE3 B;  1GAQ B;  5H92 C;  3B2F A;  4YSZ B;  3HRD D;  1J7A A;  3CWI A;  4YXD B;  1ZUD 2;  2Y5C A;  3AN1 A;  1FO4 A;  1V97 A;  2WP9 B;  2MJD A;  3P63 A;  2DWQ A;  3W9C B;  3FAH A;  4YTM B;  2WDV B;  2BS2 B;  1SB3 C;  3AEA B;  1TKG A;  3AH7 A;  3AM9 A;  2KAJ A;  4JWS C;  3W5V B;  3P4S B;  2CU3 A;  4C80 A;  3AMZ A;  1L6V A;  2FBW B;  2K22 A;  3AEG B;  4YT0 B;  5G5G A;  1ZOY B;  3AE8 B;  2E3T A;  3NS1 A;  1FMA D;  4WQM A;  1QOB A;  3DWG C;  4JX1 C;  3NVV A;  1WRI A;  1E0Z A;  3P1M A;  2AX5 A;  1DGJ A;  1RM6 C;  1JWA D;  2WU5 B;  3AE2 B;  1RFK A;  1FXA A;  5EE9 A;  1FRR A;  1I7H A;  2WLB A;  3LXF A;  2WS3 B;  4HRS A;  2M19 A;  1T3Q A;  4C7Y A;  2JX5 A;  5EE1 A;  2KMM A;  3WCQ A;  1NEK B;  1WWT A;  2LEK A;  1FIQ A;  1WXQ A;  1L0V B;  1TJE A;  2WDQ B;  2L83 A;  3NVY A;  1N62 A;  4YSY B;  1FFU A;  5AUK A;  1E9M A; 
#chains in the Genus database with same CATH topology
 1YJ1 A;  4PJ0 U;  1ZXH A;  2HTH A;  4MGZ E;  5AKX A;  1PGB A;  1TTN A;  4CCH A;  5J0U A;  3MR3 A;  3ZYY X;  3ZRF A;  2DZJ A;  5BOM A;  1AWD A;  1CQV A;  2HBJ A;  5AM0 A;  5ALH A;  4WWP A;  3JW0 X;  2BF8 B;  2JQR B;  4HK2 A;  5ALK A;  3PX6 A;  2V3N A;  4O3M A;  5AIC A;  2LBO A;  2KDB A;  4QJF B;  2F1J A;  4TSS A;  4NM1 A;  1STE A;  1A70 A;  4GOC A;  1I4H A;  3TAQ A;  2PVG C;  4CDG A;  4J9S A;  3PZ8 A;  2AHO B;  2NV3 A;  2W82 A;  2N9K A;  3RFA A;  4TV3 A;  3QWZ B;  3KHR A;  2QHO A;  2W43 A;  1XCQ L;  4GC7 A;  8ICS A;  4B9M A;  4BKS A;  4DFD A;  1Q1O A;  3V6K A;  4MF2 A;  1U49 A;  1RFA A;  4KLS A;  3N30 A;  4ED1 A;  4W9F A;  1TT5 B;  3ALB A;  2HHX A;  5D3D A;  2BCV A;  2N1R A;  2KOX A;  4KLJ A;  3N32 A;  5HR7 A;  3KOO A;  4HWI B;  3VRA B;  4A6Q A;  1ZQH A;  5KG4 A;  7ICH A;  1HA5 A;  1WXA A;  4IC9 A;  2HOQ A;  3JSV A;  2BKE A;  1PK3 A;  4NAW B;  4DSE A;  4P1B C;  4W9K A;  3ZTD A;  4I2I A;  4RQ3 A;  3AEE B;  4NM2 A;  3KYC D;  1M94 A;  3MHZ A;  2KMD A;  2ATL A;  1QLB B;  3RB6 A;  2VA3 A;  3DBS A;  4F4Y A;  1B4F A;  2NRX A;  1KM7 A;  4I2H A;  4TKN A;  3TFS A;  3C29 A;  7ICU A;  4YXJ A;  1SV4 A;  1C4P A;  3A9K B;  2BB5 A;  3MFG A;  2WF6 A;  5J0T A;  3Q69 A;  3URY A;  8ICY A;  5J8Y A;  1OQY A;  3AE3 B;  1WRD B;  3RNG C;  2KHW B;  4MJS B;  5ALD A;  1DOQ A;  1C77 A;  4S17 A;  4UAW A;  5J0O A;  2RDG A;  3MC1 A;  3NRW A;  4DOB A;  2WP9 B;  4B9K A;  2INP E;  1WZ3 A;  2I6X A;  3DHH C;  3KWV A;  1C1Y B;  2DWQ A;  2WDT B;  4AS1 A;  2WXM A;  3TAD A;  2KJH B;  4DQP A;  1FEH A;  3OJU A;  4KLF A;  1QCK A;  3ZDM C;  5GTI U;  1AW7 A;  1ZJN A;  1KLV A;  3PS6 A;  2FBW B;  4C8K A;  2BGW A;  3Q8C A;  2KQS A;  1D8Y A;  1E0Z A;  2UU7 A;  4RZR A;  1JWM D;  2LD9 A;  1LKY A;  2FCM A;  4FJV B;  2WS3 B;  3UI3 A;  3PR5 B;  3RYT A;  2Y5P A;  1S0M A;  2NRV A;  4FBT A;  3RD2 A;  1ZQE A;  2KJ5 A;  4DQR A;  5J2D A;  2QIL A;  5KFA A;  1LGR A;  1J7B A;  3PZ7 A;  1SBB B;  5T14 A;  4US8 A;  3HM6 X;  3O65 B;  4GSW A;  2BCR A;  1NYR A;  3RJJ A;  3WIM A;  4F5Q A;  4Z6F A;  4E71 A;  1A0P A;  2M17 A;  1H8C A;  4BBN C;  1ISN A;  1ZP0 B;  2DBY A;  2K3U A;  2J52 A;  5CHF A;  1P9D U;  3HT3 A;  2AQ1 B;  4QZI A;  2LI6 A;  2HDE A;  3GP7 A;  4MAC A;  5BPC A;  1X9S A;  2FMS A;  3NZ3 A;  1ZQM A;  1GG3 A;  5KT4 A;  2Q4T A;  2EAM A;  4O3N A;  1ZD3 A;  2NYV A;  3QZ7 A;  3M9O B;  2PXI A;  4I2E A;  4KVG B;  4RGN A;  4TMA B;  5KT2 A;  2ZIW B;  3RBD A;  1KLN A;  4MFA A;  1X6J A;  2V4L A;  3ZQ4 A;  5KAF U;  1S3S G;  3MDA A;  4GXJ A;  2ZUB A;  4F93 B;  5TIS U;  1EM7 A;  4YSX B;  2QLT A;  2RSU A;  5D46 A;  3QNM A;  5J2I A;  2WYQ A;  4CF4 A;  2V3P A;  2GRI A;  3MR6 A;  3KWL A;  1TK8 A;  4IWQ A;  5JRT A;  4ZRP A;  1ET6 A;  2G08 A;  1I4Q A;  3MJ5 A;  7ICV A;  2W54 A;  4UB3 A;  3TEW A;  4YTN B;  2K60 A;  2NBW B;  2K0P A;  3CMM B;  3H40 A;  3D6J A;  1PZN A;  1Z1V A;  5KFE A;  3OPX A;  3DHG C;  3N20 C;  3A33 B;  1LFD A;  2E1E A;  2LWP A;  1MFW A;  1T3N A;  2G3Q B;  2J0M A;  2K6D B;  3Q8K A;  1FRD A;  3IV6 A;  5AUI A;  3C23 A;  4OCZ A;  3ML9 A;  2RQ5 A;  5AKI A;  2PFO A;  4PL2 A;  4NLK A;  5FR3 A;  4KLE A;  1UA1 A;  1RYU A;  2QCZ A;  3M6K A;  5ALP A;  1SKR A;  3CP8 A;  5J29 A;  3ETL A;  4ED0 A;  4KSK C;  1WCL A;  2O6V B;  2N7E A;  3RUI B;  2ONQ A;  5H92 C;  3GFK B;  2RPQ A;  3BIN A;  4K3C A;  4BUG A;  1ZDV A;  4DQI A;  2IYD B;  3OJS A;  2K8B B;  4MEX A;  4YN4 A;  3I9V 1;  3TIX A;  3OAW A;  2KMC A;  5ALG A;  2LPE A;  3Q3M C;  1ZQD A;  2E5S A;  3AUO A;  3R2T A;  2BCU A;  3OLM D;  1A76 A;  1E5W A;  1T0Q C;  3OWE B;  4XE0 A;  3AH7 A;  4EZ6 A;  4QZA A;  4JWS C;  2MRL A;  1SXE A;  2OXO A;  3C1Y A;  4ECT A;  1NK5 A;  7ICO A;  5JXV A;  1NJW A;  2DYM A;  3SDL C;  3AU6 A;  4LNK A;  2KC2 A;  2JGA A;  1V9P A;  4XUS A;  4HEA 1;  1D8B A;  3C1Z A;  3RFZ B;  1QLN A;  1I7H A;  4DXA B;  2IY0 B;  2NRZ A;  4KTQ A;  3UIP B;  1SSN A;  3KW5 B;  2P66 A;  3Q8R B;  4QZF A;  5J2F A;  1TJE A;  3RJE A;  1ZET A;  4JL9 A;  2R8H A;  1QKZ A;  3C5G A;  2XGP A;  1V81 A;  4DK5 A;  3T9L A;  5KFT A;  1ZQW A;  3GU3 A;  1VD2 A;  1WXM A;  4ECZ A;  1ZQO A;  3WKB A;  3TAR A;  1NK0 A;  3A1Q B;  5AI9 A;  5JHB A;  4EEY A;  1UPH A;  2W03 A;  1IM4 A;  1WJ4 A;  1C4C A;  3L10 B;  3PW0 A;  9ICL A;  2YMQ A;  4FO6 A;  4C4S A;  2JPH A;  2PMV A;  2FPK A;  1C7Y A;  2JV3 A;  1SF0 A;  4I28 A;  2PI5 A;  5KFN A;  2JEJ A;  4DL4 A;  1BPX A;  3MR5 A;  5L9X A;  2HHS A;  2FIF A;  1EF1 A;  2H3I A;  5LLI A;  4RQ7 A;  2WQY B;  2W7P A;  3MGH A;  4NV0 A;  2JZ3 B;  3H7P A;  1K1S A;  2KTR A;  3PNC A;  1HEZ E;  2MH7 A;  2LZ6 A;  3DOW A;  4ZYS A;  3SFD B;  1L4Z B;  1CI4 A;  4GDK B;  4WJP A;  2G4S A;  1CK1 A;  4N9F 4;  2ZUD A;  3M9N B;  1ROE A;  2KZ3 A;  4DO9 A;  4P0Q A;  2JXX A;  4QIW F;  1LVH A;  4KLQ A;  2WXQ A;  4F5R A;  1JWS D;  1JWB D;  1KTK A;  1UBQ A;  8ICE A;  3ETR A;  2JZP A;  2FMQ A;  4A9A A;  4MM3 B;  4IS7 A;  1L6U A;  3W5U B;  1RZT A;  4IDI A;  1VJK A;  4BBN F;  2PKO A;  4KLT A;  4IOI E;  3OHB A;  4Z6E A;  4UAU A;  1JRU A;  4TQ0 A;  3DPD A;  4C4R A;  1XLO A;  5KNI A;  2NBU A;  5IP4 D;  3H0M B;  2L00 B;  4IQU A;  3UM9 A;  3OJ3 A;  1L3S A;  3BK1 A;  2LYB A;  4LDT B;  2ZIV B;  4TUR A;  1WSP A;  4FHJ A;  3ALR A;  2BYF A;  2F76 X;  3B2F A;  2LYH A;  1UNS A;  1V1P A;  2H3V A;  2KAC A;  3PPA A;  2KTQ A;  4RNN A;  4EBD A;  2I38 A;  1ZPS A;  1FO4 A;  1V97 A;  2JH1 A;  4JV0 A;  3NOB A;  2GBM A;  2ZXI A;  3HK0 A;  4JV2 A;  5ALW A;  1KKX A;  4YR0 A;  2Z0E B;  1PVQ A;  2XK5 A;  2P35 A;  1R4M I;  1XU4 A;  1IBX B;  2DFL A;  5BYS A;  1P7F A;  4UB8 U;  2E8P A;  2WXK A;  3PX4 A;  4PL1 A;  5DQI A;  3QU7 A;  3AEG B;  3PMN A;  5J2R A;  2VA2 A;  2AQ0 A;  3P1M A;  4YCX A;  1RFK A;  1VZ8 A;  5DB9 A;  1FRR A;  3M7D A;  3SQI A;  3W1Y A;  1WXV A;  1DYQ A;  2WGS A;  2XY5 A;  1XO1 A;  2JX5 A;  4K7U A;  4ZRI A;  2J6U A;  4Y2U A;  4W9J A;  5DB8 A;  4BWJ A;  4G9B A;  3RR8 A;  4M47 A;  5EDS A;  3PML A;  1V86 A;  1E9M A;  3GIM A;  1ZD5 A;  2IGG A;  1NI2 A;  2Y0S C;  4MSQ B;  3KZX A;  4GXI A;  3BS7 A;  1WZ0 A;  1B9R A;  3RF9 A;  3A9K A;  4ZRK A;  1PGX A;  5C23 A;  5FK9 C;  3AE7 B;  5DQH A;  3RH6 A;  2CHX A;  2HHT A;  4O5E A;  4KX3 A;  1TZO A;  3PSE B;  1HUO A;  2QIE B;  4FUL A;  5KFX A;  4DCC A;  5AI6 A;  3KFU F;  3JPO A;  2KO3 A;  3R3M A;  3WK9 A;  3PSI A;  1BUI C;  2EZX A;  3QU9 A;  2BPG A;  2LGD A;  3AXC A;  3V62 A;  2ZIX B;  2W9A A;  1QQ7 A;  1RLF A;  3Q8L A;  4TQS A;  1SEB D;  1GNU A;  3B0A A;  2JZB A;  1NEN B;  1SGH A;  4KSL C;  4GU2 A;  4NL9 C;  1OGW A;  1ED1 A;  3DHI C;  4Y2Q A;  1XSL A;  4KN4 A;  5IN7 A;  4YR3 A;  2WFA A;  1T0Y A;  3SAG A;  4Q45 A;  2CU1 A;  2ZCC A;  5EE0 A;  1YNT E;  3LWM A;  4J03 A;  3RJF A;  1MI0 A;  2AGO A;  2RRD A;  2N9L A;  2D10 A;  4YG2 A;  1SL1 A;  5FKA C;  5HML A;  1KOT A;  4B6J A;  2JR5 A;  3ZXR A;  4DL2 A;  3UIO B;  4E0D A;  5J0S A;  4HKQ A;  1PK1 A;  2OCE A;  1C76 A;  2QAR A;  4DF8 A;  2K8H A;  4W9E A;  1Z4O A;  4DFM A;  3LWL A;  9ICG A;  4HKZ E;  3AE4 B;  3QEB Z;  1XC9 A;  4W9G A;  4M04 A;  5JHA A;  2D8C A;  1QOA A;  2DKX A;  4KX5 A;  1WR6 E;  3BYT B;  4E74 A;  4RH6 A;  3WU2 U;  2LHE A;  3APF A;  4BJQ A;  2YQE A;  1KFD A;  4OHJ A;  3C2L A;  2YX8 A;  2Y1I A;  2F1H A;  1FCL A;  2B6G A;  1WGH A;  5JTI A;  3M1Y A;  1SKS A;  4MGI E;  2FJ6 A;  2ZCB A;  4MGK E;  4C00 A;  3QJZ A;  2D2Q A;  2XID A;  4IL6 U;  4NWI A;  1FXT B;  2N4F A;  3GV5 B;  3I28 A;  3VCB A;  4M9L A;  2D3C A;  2K39 A;  1UHU A;  1U45 A;  4O9M A;  2MA1 A;  3KQ4 A;  4PK1 A;  2G9H D;  2FCN A;  5CR0 A;  4B9U A;  4Y2J A;  3RRG A;  3U30 A;  5AM2 A;  4RF1 A;  2LUM A;  4QWB A;  1SWW A;  4S0R A;  1EWC A;  1WR1 A;  2OJR A;  7ICR A;  2EMT A;  3KUD B;  5AK3 A;  3TAC B;  4MF8 A;  5EE9 A;  4QWE A;  1FXA A;  3PSF A;  2LUE A;  2LGI A;  2JEF A;  3P42 A;  2M0X A;  3PT2 B;  5KFI A;  4CF5 A;  1L3U A;  1UD7 A;  1Y8R C;  4F4K A;  2MBB B;  2MX2 A;  4GN1 A;  1NK9 A;  2C7H A;  4KGR A;  2DQN B;  2F44 A;  2KVS A;  3DVN V;  1D8L A;  3WK8 A;  1CEZ A;  3C21 A;  1ZXI A;  2FLL A;  4CQN A;  2G0A A;  4GGQ A;  1I35 A;  1QH9 A;  2ZNV B;  2KKC A;  4O3R A;  2NTS A;  4QZH A;  2PJH A;  4HRO A;  2X8X X;  4LTU A;  2ACZ B;  2ZJA A;  4A90 A;  1X42 A;  2V4R A;  4GIB A;  4J9P A;  3RJH A;  3QK0 A;  1ZQU A;  1Z3E B;  3ZDA A;  4JUZ A;  3QX1 A;  1V1O A;  2LAS A;  4ACO A;  5CWR A;  5L1J A;  7ICN A;  3LK9 A;  1T0S C;  1FD6 A;  3E56 A;  3QEA Z;  2C2R A;  4NPN A;  4XDD A;  4FHK A;  3JPT A;  4TQ1 A;  1NYQ A;  3F5A A;  3SAH A;  1VLB A;  1HUZ A;  3N7P D;  1PVP A;  3AE5 B;  4ANV A;  4J6I A;  3F53 A;  3QU4 A;  2PFN A;  4EEL A;  2DUY A;  2IOF A;  3FC4 A;  4OO1 J;  4EZK A;  1ZQV A;  4ELT A;  5AM3 A;  1C20 A;  3IT4 B;  1L8L A;  5DDM A;  8ICP A;  5J2K A;  2EKI A;  3CNH A;  4DXF A;  4XYC A;  3JPR A;  2VH1 A;  7ICP A;  4PGY A;  1PUT A;  4A3O A;  4Q8F A;  3IN5 A;  3OHA A;  1I42 A;  3ZDE A;  1GUA B;  4ZHP A;  2WXO A;  5AKK A;  1T7P A;  4OVV A;  4CHK A;  3NY5 A;  1JW9 D;  2IGH A;  4ZDV A;  5EWF A;  4B0M A;  1EO6 A;  4WAF A;  4HVB A;  4YTP B;  1CMX B;  2HTM E;  4A20 A;  3E9S A;  5AK4 A;  1MJD A;  1N63 A;  4HYK A;  4BDP A;  3CF6 E;  5GMV A;  2O2V A;  1XD3 B;  3X0W A;  4GC6 A;  3ZLZ A;  2XI9 A;  3GZF A;  3SYZ A;  3M8S A;  2KNJ A;  3P4Q B;  2PFP A;  4KZ0 A;  4P6V F;  9ICC A;  3Q8P B;  2KYW A;  3VUW A;  4UB2 A;  4MEM A;  3T8M A;  5IKC M;  1XO3 A;  4EYH B;  1S0N A;  1Q46 A;  4OZB A;  4IWO A;  5J2H A;  2QSD A;  2OEH A;  1LV5 A;  5ALS A;  1WJN A;  2K8C A;  3AN1 A;  1NKE A;  1J0G A;  3V7L A;  2XCA A;  3KH0 A;  2R18 A;  2ZIU B;  5AKZ A;  5CA7 A;  3DEE A;  3KZI U;  3IXS A;  3IM1 A;  5KFZ A;  3HX0 A;  1T8E A;  2L0F A;  5BMG A;  3IDW A;  2FCS A;  1JX4 A;  5IA7 A;  2MA9 B;  2IHM A;  3BVM A;  3ZI4 A;  3L16 A;  7ICT A;  3VC8 A;  2IJ0 A;  5D4B A;  2A1A A;  2Q0Z X;  2JUO A;  2N1W A;  2AJQ A;  3OSN A;  4R8U A;  2NRT A;  2KHQ A;  4EBC A;  2C2E A;  1FMA D;  4RGO S;  3PW5 A;  4WQM A;  3MP9 A;  1UZX B;  1RXW A;  2WF9 A;  2KVZ A;  3RNA C;  4X5V A;  2ZPN A;  3SEB A;  4WJN A;  7ICK A;  2KD0 A;  2RDJ A;  2KZZ A;  1X9M A;  3C19 A;  1KJT A;  2AXT U;  5KFQ A;  5CB1 A;  3ZJU A;  5KFF A;  2R8I A;  3TAP A;  3KUC B;  4XZ4 A;  1N5W A;  2WDR B;  3AE6 B;  4H2A A;  4WJO A;  2LYA A;  4YWG G;  2I9G A;  3AEB B;  4ANX A;  2FUH B;  4FA6 A;  4D2K A;  1UBI A;  4NLB A;  3E0F A;  3AE9 B;  1Q0W B;  1S10 A;  1JCK B;  2GOL A;  4LDT D;  9ICV A;  3Q8E A;  2PE6 B;  4I6P A;  3P4P B;  3LB8 C;  2F1I A;  2ZIV A;  3MAB A;  1RRB A;  3AE1 B;  4ED7 A;  4ZRJ A;  5D6J B;  5DPW A;  3AU5 A;  3FIL B;  5C0Y A;  2ZEQ A;  3ZXV A;  4UAS A;  3IAS 1;  2KJ8 A;  1BGX T;  4XDC A;  3PVX A;  3RNF C;  2YML A;  2V1Y A;  2WXI A;  9ICP A;  3K75 D;  4KV2 A;  2IPK D;  3VTV A;  2RPV A;  1TGZ B;  1B1Z A;  2XK5 B;  2W9B B;  2AGP A;  5HG2 A;  2YTU A;  3I5J C;  1SWV A;  1CZP A;  4DBG A;  1R7S A;  5F9N A;  2PI4 A;  4CO7 A;  3IHP C;  5E6P A;  1QSS A;  3WK4 A;  2SAK A;  4GB9 A;  1AYF A;  4M9H A;  1WGK A;  1X2I A;  4AYB F;  2C60 A;  4GLS C;  3ABV B;  3PLU A;  1RYJ A;  2KWD A;  2LXA A;  4RFB A;  3H8M A;  4UAT A;  3ZNI D;  5J18 A;  1F2R C;  3M9M B;  8ICQ A;  1YN3 A;  2MCN B;  2F3N A;  3EUB 2;  4KIT B;  4NY0 A;  3Q8M A;  2LVO A;  2XCP A;  4JPS A;  2B76 B;  2OYY A;  1MQ3 A;  2OH2 A;  1KH0 A;  5TZV A;  1GO3 F;  4HDO A;  4O1N A;  1ARO P;  3G6Y A;  2ISP A;  5C5J A;  3RN9 C;  2N0S B;  4C0Z A;  1VR9 A;  4USA A;  3TI0 A;  2KSO A;  3N1X C;  2BDU A;  1HEK A;  4P7I A;  1CJE A;  4K7S A;  2XC9 A;  4NJ6 A;  3TAN A;  4QW8 A;  2BPS A;  2VAN A;  4X57 B;  1K51 A;  2J4X A;  2UVW A;  3B0Y A;  4G3I A;  5ALF A;  2OJW A;  4GMV A;  2FMP A;  4RM8 A;  1RQL A;  4RQN A;  2EZY A;  4CE6 A;  4KLI A;  3OG5 A;  3M62 B;  4EZL A;  5ALE A;  1WE7 A;  5BMI A;  2QMT A;  5KG5 A;  1ZQB A;  4BXO A;  3QHT A;  4F4Z A;  2JZB B;  2KFZ A;  2CKH B;  4RQ5 A;  3SV3 A;  1M4V A;  5KTQ A;  9ICJ A;  2JRH A;  5JH5 C;  1YIW A;  3GV8 B;  1KFS A;  3AM9 A;  1D9F A;  2JH7 A;  4EUT A;  1MN8 A;  1WWV A;  2YN4 A;  2KIW A;  3IHQ B;  2MEK A;  3WK5 A;  2D3A A;  1N56 A;  4F1S A;  1HXY D;  4ARC A;  4DL5 A;  3PZD A;  2KKV A;  2BCQ A;  1MHX A;  5AM1 A;  4IQT A;  1FPY A;  3RB0 A;  3R2I A;  2W9C A;  2YVC A;  1HQR D;  2JWZ A;  4NZL B;  2KMM A;  5HHD G;  2N9P C;  4BOS C;  2LEK A;  5AM4 A;  2WAQ C;  5KFY A;  3BVZ A;  1DOY A;  1N62 A;  5D7G A;  4NQL B;  3EW9 A;  2R8K A;  4NJC A;  1XSN A;  4RF0 A;  1E8Z A;  3R66 C;  3UQ2 A;  4DFJ A;  9ICB A;  2MP2 B;  4NLZ A;  2ZPY A;  1MG4 A;  1E6E B;  1N2X A;  1QQ6 A;  4LJP B;  5HNK A;  8ICF A;  2RDI A;  1X9W A;  2BVC A;  3DCG A;  3R7R A;  2MU2 A;  1L7Y A;  1ZQX A;  2LFI A;  3GOE A;  5HP4 A;  3BZK A;  5AKE A;  4PPX A;  1J7C A;  2HSZ A;  1WIA A;  3BJY A;  2GB1 A;  3QAR A;  1F0M A;  3AEV A;  3WKA A;  1XLN A;  3EGR A;  1SE2 A;  1TY0 A;  1JAL A;  4TUP A;  3HP6 A;  2W3R A;  4MSM B;  3N7S C;  4C4V A;  1N48 A;  7ICE A;  3SMV A;  3QE9 Y;  2GO7 A;  4JK1 A;  2HW3 A;  4FN2 A;  1NKC A;  1GJZ A;  4DF4 A;  4ECX A;  4F92 B;  5IIM A;  3IBE A;  2G1E A;  3UMG A;  4RQ2 A;  4F5P A;  1WX7 A;  5HKH A;  4F4X A;  1X66 A;  2LM4 A;  5ALL A;  2F2A B;  4DQQ A;  2QKQ A;  1BNP A;  3EEC A;  1FNV A;  2VH2 A;  1Z19 A;  2EDU A;  3PRE A;  1IPG A;  3BZD B;  3JPS A;  2KXJ A;  1K50 A;  4ZRQ A;  4M6W B;  2DZK A;  2R2O A;  4REZ A;  4NXZ A;  1WGG A;  4ED3 A;  4JE3 B;  4F7Z A;  2M9N A;  3JVZ X;  5KFR A;  1S97 A;  3IVF A;  1PYW D;  1KW4 A;  4LNO A;  1X40 A;  1GB4 A;  1P7E A;  1OTR B;  5CJ7 A;  2ZXH A;  8ICJ A;  4XGA B;  3KHL A;  3NAS A;  1UUP A;  3PX0 A;  4I29 A;  4DXG A;  3U2S C;  2HD5 B;  4KLG A;  2KWV B;  4PS8 A;  3MDC A;  4F5N A;  2L52 A;  1K1Q A;  1Z1B A;  3RI7 C;  3VR8 B;  3WA0 A;  2QB0 B;  3K9P B;  5EOZ A;  4UAY A;  1PQS A;  2HJ8 A;  5DBB A;  4N58 A;  1TS4 A;  3MC8 A;  3Q2A C;  1XS9 D;  3EA6 A;  2WXH A;  2IO3 B;  1ZUD 2;  2DYO A;  2WXR A;  3ICX A;  2C22 A;  3CW2 C;  2ESE A;  2JRI B;  1VZ7 A;  4J3O D;  5DG7 A;  4TUS A;  2YEP B;  2FLP A;  4ZYN A;  1KSP A;  1RPL A;  4NAM A;  3RNC C;  3RZF A;  3NHE B;  1TAQ A;  2Z7J A;  5AK6 A;  5H2F U;  4KLD A;  3W5V B;  1BVS A;  2HMX A;  3H7I A;  2PEA A;  1R4M B;  4ASW C;  4K4G A;  3ZD9 A;  2GH1 A;  4MEY A;  4JB3 A;  4IM3 A;  1QOB A;  2BB6 A;  2G45 B;  5DLG A;  4LNF A;  5C1Z A;  2WU5 B;  2L32 A;  4DHZ B;  1QZE A;  2JEG A;  1JML A;  4QW9 A;  1ZD4 A;  3HIZ A;  4KN7 A;  3W1S A;  2ZJ5 A;  1SXD A;  1L8O A;  2EKE C;  4OJO A;  5DBC A;  1DRG A;  3U7Z A;  1WM2 A;  5G2N A;  5AKY A;  3KTQ A;  2NPT A;  3GS2 A;  5ALJ A;  4M0A A;  2Z0D B;  1X6I A;  1QOG A;  1UQV A;  2KD1 A;  5DB6 A;  3B9J A;  1WMH B;  3DWM A;  4AOF A;  3BS5 B;  3AEC B;  4EZ9 A;  5J0Q A;  1IIP A;  5KT6 A;  1VDV A;  4WIP A;  1F0Z A;  5AZH A;  3DVG Y;  1F2R I;  4UB1 A;  2IMW P;  3AU4 A;  4ANU A;  3IG8 A;  3T3O A;  1MPE A;  3RNB C;  1NJY A;  2AYO B;  1P1A A;  5T8I A;  4YXM A;  2HOF A;  5AEK B;  5BMH A;  3L54 A;  4ECS A;  3PW2 A;  1JRP A;  1SGG A;  2IOF K;  2KFN A;  2R8J A;  1S77 D;  8ICC A;  4KX6 B;  5ALI A;  9ICQ A;  8ICL A;  4DSJ A;  2V9H A;  1XQQ A;  5DPR A;  1FNU A;  2LMC A;  4DHJ D;  5L95 C;  3LDA A;  2KKP A;  7ICJ A;  2KFK A;  2WHI A;  3ZD8 A;  3WAM A;  1TV9 A;  8ICT A;  1FM0 D;  1RWS A;  5HHH A;  1D5Z C;  3C2M A;  4I6N B;  4ARI A;  2GLE A;  3QA8 A;  4A8X C;  5H8Y E;  1SZP A;  4GXB A;  3E2E A;  9ICK A;  5J0X A;  2GBN A;  2N7J A;  4B95 A;  2JYT A;  3X23 A;  4DFP A;  1ZQA A;  3NZS A;  2UVR A;  2FCQ A;  4WWO A;  1VZ6 A;  4MM3 A;  4UB4 A;  2KIC A;  3H8J A;  8ICI A;  2KJ6 A;  3Q3O C;  5ALR A;  4QZG A;  5DDY A;  2YEP F;  1Z4N A;  1PVR A;  5B5E U;  2AEH A;  3L08 A;  5JU5 A;  1V9J A;  4IWP A;  4YVZ A;  2KHV A;  4I2A A;  4RUC A;  3ZDD A;  4QAY A;  3F2D A;  1D5X C;  1BPD A;  3U52 E;  4NAW A;  5AI0 A;  4IM0 A;  3VAW A;  4WJQ A;  1PUZ A;  1T5X D;  3WAN A;  2DAJ A;  1SZH A;  2Y1J A;  1WJU A;  3BQ2 A;  4R64 A;  2KN7 A;  2JYE A;  3RTV A;  3N3K B;  2VKQ A;  3FIL A;  1P3Q U;  3GV7 B;  4C8L A;  1PFD A;  4JV1 A;  2C28 A;  5TR5 A;  3SD7 A;  2FLN A;  2HVI A;  8ICZ A;  3DBL I;  4Y2P A;  2C9W B;  3ISD A;  3UQ0 A;  1G6J A;  2CHZ A;  2L1A A;  3MR2 A;  9ICN A;  2JWU A;  1WJ6 A;  4BKT A;  1S5L U;  5AKG A;  1KDH A;  2W9B A;  9ICU A;  4FZN A;  2MJD A;  2V9W A;  2ZIW A;  1ET9 A;  4J9K A;  3SAF A;  5L1L A;  3WK6 A;  2O6K A;  1MHH E;  2EAO A;  5KAI U;  3MBY A;  3QXG A;  5DGB A;  2NBV B;  5FP0 A;  2WDV B;  2BS2 B;  4NJ7 A;  4B0E A;  3MGV A;  4YFK A;  3EZ5 A;  3NGD A;  2XVT A;  3A4R A;  1WWU A;  3DBR I;  5KHQ A;  2K22 A;  3GZN I;  5G5G A;  1QQR A;  1IP9 A;  3DWG C;  3VXW A;  2N7D A;  2IHN A;  1RM6 C;  3QUT A;  2EH9 A;  4CRX A;  1XF5 L;  2OOB B;  5EE1 A;  3QX7 A;  3V7J A;  1E8Y A;  2WDQ B;  4YMO A;  2L83 A;  2M1M A;  4YXD B;  2CJO A;  1A77 A;  4DDI D;  4QIW C;  2W9N A;  1TAU A;  4IRD A;  3D2Q A;  4WQO B;  4N6E B;  3IT6 B;  4B9L A;  3H0L B;  1UGJ A;  2WXG A;  3HPO A;  1XT9 B;  2DNF A;  3V6E B;  4ICA A;  2UVU A;  4RCO A;  5KFS A;  3WAP A;  9ICI A;  1VJ5 A;  1YD8 U;  8ICO A;  2JXJ A;  2BZF A;  4Q8E A;  1J2M A;  3TBL D;  1NOM A;  4KMO B;  2Q5W D;  3W2D A;  3R9K A;  1OUQ A;  5C3J B;  1WH3 A;  1ZQJ A;  1UWM A;  5J0W A;  2I1Q A;  4HPP A;  2KJR A;  3RJK A;  4RPY A;  4FS2 A;  3I57 A;  1ZQI A;  4EEN A;  1S76 D;  1XWL A;  5DG9 A;  4YMN A;  1JRO A;  4DSK A;  1IGD A;  3QU2 A;  1VCB A;  7ICS A;  1D9D A;  5IIK A;  1TK0 A;  4FJZ A;  2PIA A;  4YD2 A;  4FJY A;  4A55 A;  4QWA A;  1HJP A;  4C7Z A;  3OSP A;  1YMH E;  3VVW B;  2PVO D;  2OHF A;  2BDP A;  2DX5 B;  4LZD A;  2C2D A;  2K25 A;  5DKW A;  4LZG A;  3ZDT A;  4QWD A;  2WF8 A;  5A0L A;  5EWE A;  4NNJ B;  1ZQF A;  2CHW A;  2AWT A;  2LGX A;  3ISB A;  2K89 A;  4DLG A;  2O6V D;  2FUG 1;  4M9N A;  4IC7 B;  3MTN B;  2NO4 A;  2E8O A;  4AP4 C;  4BZA A;  3VR9 B;  3PST A;  2FI1 A;  5LXI B;  4WJ3 B;  2XBB C;  2HBL A;  2V3S A;  2REX A;  3KHG A;  2XNA C;  9ICS A;  3B1L X;  3PRZ A;  4OJP A;  2K9X A;  1WGY A;  2KFJ A;  3J9C A;  3AV8 A;  4LCD E;  3EWA A;  2DZM A;  3B0X A;  2KT7 A;  3BZC A;  3TAD C;  1F44 A;  3BQ7 A;  3Q3J A;  4BX9 C;  5KFJ A;  3RBE A;  1ZW7 A;  2N1V A;  2AL6 A;  1L7O A;  5ALM A;  4ELV A;  3F2B A;  3Q8F A;  8ICM A;  4NY8 A;  2A1J A;  4DS4 A;  3C0R B;  2MSN A;  2Z8L A;  4AWJ A;  4EOY A;  3VHT C;  1XEE A;  3KBB A;  2KVR A;  3V6J A;  3Q3N C;  3AEA B;  1V49 A;  1DXS A;  3VH4 B;  2K6Q A;  1FEZ A;  4ED2 A;  1I4R A;  3U8Z A;  5IIN A;  1Z5S B;  3QUQ A;  3NS1 A;  3AU2 A;  2KDI A;  3NVV A;  2M4N A;  1WRI A;  1NK7 A;  4HJK A;  4BAX A;  1NK4 A;  3MHS D;  5E79 U;  3TEX A;  1T0R C;  1ZQR A;  1L7N A;  3ZJV A;  2B21 A;  1Y56 A;  1WG8 A;  4LK0 M;  5AZG A;  1JWU D;  2DL0 A;  4M9G A;  4GFJ A;  3A0B U;  1COO A;  4KZC A;  3N7R C;  5BYR A;  5DCN A;  3N28 A;  3PO4 A;  2BCS A;  2WXP A;  2C7M B;  3ZVV A;  1ENF A;  2J7Q B;  3HWT A;  4J9M A;  2QC8 A;  3BY4 B;  4KLM A;  3RB3 A;  2MWS B;  1KQQ A;  1WFY A;  2PFQ A;  5IIO A;  5HR6 A;  3GIK A;  4QZ9 A;  4FBJ B;  5D49 A;  2A19 A;  1TYG B;  2LJI A;  1PDX A;  2M56 B;  4M01 A;  4LJX A;  4KMU A;  3KLS X;  1SIJ A;  8ICG A;  5ALU A;  3PW7 A;  1BPZ A;  1S9F A;  2FID A;  4RM9 A;  2IO0 B;  5KG6 A;  4DWI A;  3PO0 A;  2YY6 A;  1U4B A;  4PZO A;  4O3O A;  1K5O A;  4Y2V A;  4KDL B;  3HJE A;  2IND C;  2WB1 F;  3HIL A;  5CP2 A;  3VQI A;  1U9L A;  2ON8 A;  3NRZ A;  1L0Y B;  2KQ7 A;  3PHW B;  4M8N A;  5ALT A;  3LVV A;  2KTR B;  3BK2 A;  5GTH U;  4ITK A;  2E1F A;  2CRX A;  2LI5 A;  2WU2 B;  2QEJ C;  3BYY B;  4EEW A;  4OVZ A;  3SEI A;  1ZQT A;  1YQ3 B;  3SD5 A;  3S6J A;  2AU0 A;  1ZDX A;  4I2D A;  4ZHO A;  3P4R B;  5J8Y C;  2DEN B;  1WM3 A;  5KFC A;  4PGX A;  5KHO A;  1Q3V A;  2BTE A;  4P4O A;  1TKE A;  3KD3 A;  2QDF A;  5DB7 A;  1MC8 A;  5KG3 A;  2J0J A;  4W9I A;  3SHQ A;  3TQ1 A;  2W55 A;  1GPX A;  4EYI B;  4ELU A;  2XIC A;  4YQW A;  1UWX A;  4P4M A;  3VUX A;  2KZM A;  2Y9T A;  1NK8 A;  3UIN B;  4C8M A;  5AHX A;  4Z6C A;  1SE4 A;  1L7P A;  2H5X A;  3RH5 A;  3ZKJ C;  4P16 A;  2VA8 A;  4RU9 A;  4KLH A;  1WGD A;  3SZ2 A;  5ALX A;  3R8B A;  2XGQ A;  2W8L A;  1A5R A;  2ZW0 A;  1E10 A;  2KLC A;  3VTU A;  3NTU A;  3EYZ A;  5KFW A;  7ICI A;  4AQ7 A;  3GIJ A;  4WAA A;  4FAD A;  1T4G A;  2JRZ A;  2CXY A;  4ACF A;  3HRD D;  1TKD A;  1B22 A;  2J53 A;  9ICH A;  2XN9 C;  1X9X A;  2DPJ A;  3M6Z A;  2JXT A;  2IZV B;  3THV A;  2ZIX A;  3Q6B A;  2ZUC A;  2AQ4 A;  2NCN A;  2VZK B;  4QWC A;  4KKJ A;  3V3X A;  1LXD A;  4BGD A;  3QQ8 B;  4G3X B;  2KDM A;  4ECY A;  2NRW A;  2I1J A;  1CRX A;  2MLB A;  4AJY B;  4OZA A;  1HTQ A;  2HVH A;  8ICV A;  2EAP A;  5ALO A;  4PHE A;  1E8W A;  2L05 A;  2AX5 A;  1LB2 B;  1V80 A;  3GB1 A;  1QIL A;  3V6H A;  4NL9 A;  2GLS A;  1PK1 B;  4DQO C;  3QUC A;  2KN4 A;  4NLG A;  3DVN U;  4A3P A;  2MSE D;  1S1Q B;  1WWT A;  2MW5 A;  3WAL A;  3HHM A;  2PTL A;  3NVY A;  5JUM A;  9ICM A;  1A6S A;  4YSY B;  3TMP B;  4DWF A;  1BML C;  3O13 A;  3K9O B;  4UB5 A;  3CSF A;  3R7Q A;  5F9L A;  1TS2 A;  2ZTD A;  4QZE A;  5E6N A;  2J0K A;  2Y0S F;  1WE6 A;  1TAM A;  2JT4 B;  3GE3 C;  2XO7 A;  1SL2 A;  3ZUN A;  2ZW1 A;  1RAX A;  2K4P A;  5AKJ A;  4F4W A;  3H8W A;  2D3G A;  2KQ4 X;  2B0C A;  4EZJ A;  2CJN A;  2KJ9 A;  4FZL A;  4ZH4 A;  5ALZ A;  1LO5 D;  2EEL A;  2ZTE A;  2HHV A;  2KNB A;  3EPI A;  2MJE A;  3PRP B;  4B9V A;  1GOZ A;  3WK7 A;  1SV0 A;  5J0R A;  1GC6 A;  1ZGU B;  4FE3 A;  2PPH A;  1N5X A;  1IGC A;  1YQB A;  1XSP A;  1RQN A;  4NLN A;  1EUV B;  2HOI A;  4WH4 A;  2FPL A;  2NVU I;  2KOB A;  1UA0 A;  2P6R A;  3C5F A;  3LYY A;  2IO1 B;  1L7M A;  4F5O A;  1WXS A;  2BR0 A;  2OM6 A;  1OQQ A;  2LGS A;  2F77 X;  2H3F A;  2HCF A;  5KG2 A;  2LVQ A;  2ICI A;  5G5H A;  4DSL A;  4PHD A;  1Z00 A;  5AKH A;  1Q8K A;  3IG3 A;  2IO2 B;  2RD0 A;  3RZW C;  2V0G A;  1V8C A;  4IW0 A;  3I63 C;  8ICR A;  4UB6 U;  1K53 A;  2D3B A;  4E3C A;  3SR6 A;  4F2S A;  2WAQ F;  3OJ4 B;  4UBB A;  1XO0 A;  3K1R B;  4F2R A;  3H8H A;  2Z59 B;  2D5G A;  4DL6 A;  1FNW A;  4WUR A;  1HE8 A;  3AQE A;  2F8K A;  3M3J A;  1N61 A;  4I6L B;  2MBE A;  3ED5 A;  2YMP A;  4BWM A;  1SIF A;  3V60 A;  3S2A A;  4GDL A;  1E90 A;  2Y5C A;  5DG8 A;  1XCT L;  4QZD A;  2R8G A;  3NS8 A;  4HXD A;  1MSW D;  1OXJ A;  1L3T A;  3K1Z A;  2ASJ A;  2UWQ A;  2RGF A;  1DK2 A;  3C2K A;  4J9N A;  1OEY J;  4M0W A;  1SB3 C;  2MHJ A;  1LQB A;  2YLM A;  3A4S C;  4PH5 A;  3J81 j;  1P0R A;  3UQA A;  1ECW A;  2NTT A;  4OJL A;  2W9C B;  2J6T A;  3IFW B;  1TIF A;  4JX1 C;  1YN5 A;  4W9L A;  5KG7 A;  4PYZ A;  4OVU A;  2RMM A;  5J2G A;  1NEK B;  2YB4 A;  2OED A;  2KN5 A;  3DDC B;  5E6O A;  5BO4 B;  3TCA A;  5KT5 A;  2BWE S;  2BKR B;  4JIO U;  1YOV B;  1TKY A;  1ZQZ A;  4B9N A;  1WGR A;  4HDQ A;  2BBC A;  4AUQ C;  2L5Y A;  1L3V A;  1V6E A;  1TE2 A;  3UPQ A;  3AI5 A;  2HBK A;  5I4D A;  4DSF A;  1BNO A;  1ACC A;  2ZJD A;  2EAN A;  5D94 A;  1NI3 A;  3RPF C;  3TEZ A;  1E7V A;  1SL0 A;  3HM3 A;  2QB1 A;  1SE3 A;  4N59 A;  1HTO A;  2HDO A;  4DSI A;  1KF6 B;  3H6N A;  2DKZ A;  2ZIU A;  5J17 A;  1QTM A;  4GDK A;  3V7K A;  4MDK E;  3V61 A;  4LVS A;  2PKE A;  4RQ6 A;  2W8K A;  2FAZ A;  2K8B A;  4C4T A;  1SE9 A;  4KGT A;  4J9L A;  4K1R B;  3GZN B;  3GIL A;  2ALZ A;  4KDI C;  4EKU A;  3JPP A;  4OW0 A;  2W04 A;  5AIA A;  1C4A A;  2KEY A;  3IRU A;  3F2C A;  3T3N A;  5L1K A;  4I2F A;  3PTF C;  5KG0 A;  2BYV E;  3BQ1 A;  2EMS A;  3VH3 B;  2DPI A;  2BW2 A;  3NVW A;  4I2B A;  5DGA A;  4ZOH C;  5MPO A;  4M00 A;  3A0H U;  2BS3 B;  1WYG A;  2PLP A;  1WI0 A;  2WXL A;  3BDP A;  4Y2Y A;  2Y9U A;  1S0O A;  2JF5 A;  4W9D A;  2KAN A;  3TL5 A;  3ZIM A;  2KIV A;  3G6V A;  1BT0 A;  1GB1 A;  2ZVN A;  3O0F A;  1K8R B;  1ZQY A;  3L0W B;  4W9C A;  1Q10 A;  4KKI A;  1NK6 A;  4IM2 A;  4RUA A;  2J42 A;  1TY2 A;  4II2 B;  4KLL A;  1UEL A;  2YMM A;  1VRA B;  2PMZ C;  1C78 A;  4O5C A;  1KLU D;  4P0P A;  5HMM A;  2FDR A;  5KL8 B;  1OQR A;  5F3X B;  4YR2 A;  2H89 B;  4LLG M;  1JI7 A;  1WYW B;  4F50 A;  3D32 A;  5CHV C;  9ICO A;  3UQB A;  2J6S A;  3PY8 A;  3PLV A;  3PO5 A;  3TEY A;  4CYE A;  4LNI A;  3QU5 A;  5AZF A;  4IG7 B;  5J0Y A;  4I27 A;  4DL7 A;  4DHZ E;  4G50 A;  1C3T A;  4MJS A;  3LVW A;  1GC7 A;  3MC0 B;  4KGS A;  2LHT A;  2LMR A;  3DV9 A;  2GOW A;  3H7P B;  1ZRN A;  1AN8 A;  3Q14 C;  4JGH B;  2IBK A;  4MEL A;  4IR1 A;  3Q8B A;  4FZM A;  4ECQ A;  4IQW A;  2CU3 A;  4C80 A;  3UXO A;  4RPZ A;  4RPX A;  4JQW C;  4URK A;  3G6X A;  3DDH A;  3PW4 A;  4JLC A;  1BPE A;  4R3D A;  4UBC A;  3H9D A;  4EE2 A;  1C9F A;  1JIH A;  8ICA A;  2N9E B;  1SJE D;  4NJ8 A;  5AI4 A;  4L2Y A;  1R4N B;  3WKD A;  5G55 A;  1X1M A;  5KFB A;  2KDF B;  8ICK A;  3ENE A;  2XY6 A;  2KLG A;  3LXF A;  3FDS A;  1KRP A;  5B66 U;  5J0P A;  4CGZ A;  4KIK B;  4XA5 A;  3BS5 A;  4P4P A;  3NUH B;  4J9R A;  1LKY B;  2BQU A;  4ECU A;  3DVG X;  9ICE A;  1YJJ A;  5DQG A;  2ZVO A;  2KSO B;  4XRH A;  3H4D A;  9ICR A;  4JMU A;  1K52 A;  2ZJ8 A;  2A4Z A;  2Y3A A;  1WF9 A;  2ASQ A;  4UAV A;  3GII A;  4J9O A;  2BS4 B;  4J9Q A;  4UAZ A;  3RJG A;  5CRX A;  1WX9 A;  1AQ6 A;  4OD0 A;  4F3O A;  4UQG A;  4O5K A;  4C8N A;  3UXP A;  3VFK A;  2LKY A;  2PW9 A;  1O08 A;  1E8X A;  2DGZ A;  1AAR A;  3RRH A;  9ICW A;  3HVZ A;  4TUQ A;  1ZQQ A;  3LYS A;  2BYE A;  1C79 A;  4IKG A;  3RR7 A;  7ICG A;  3MJW A;  4MH0 E;  5IOI A;  7ICQ A;  3T3F A;  1H4R A;  3L13 A;  2AL3 A;  4F8C B;  1PGA A;  3RJI A;  2RDB C;  5ALY A;  2BT6 A;  2DHZ A;  3AED B;  4P1C C;  1WUD A;  3H7S A;  5BYQ A;  3MFH A;  3C28 A;  4DEZ A;  1OFF A;  2NO5 A;  3W1S C;  1NJX A;  1MA7 A;  3EPG A;  1F52 A;  1SJH D;  4JWM A;  4NLC A;  3NG0 A;  5DPS A;  1DGS A;  2BPC A;  4AYB C;  2DLB A;  5KFD A;  2W7O A;  1QSL A;  4FBU A;  1L5P A;  3CYM A;  1BXT A;  2BHN A;  1L5U A;  4HPM B;  4XQ8 A;  5DPT A;  2JY6 A;  3H4B A;  2C5L C;  4I2C A;  1QQ5 A;  2WB1 C;  3ZDC A;  4I2J A;  1BPY A;  4FXC A;  3D2N A;  9ICT A;  4RT3 A;  2MP2 A;  5IAA C;  2M0A A;  1YQ4 B;  4YP3 A;  1ZQ1 C;  3ONS A;  3ZO5 B;  2CS4 A;  3GE8 C;  4OZC A;  3H0R B;  3GDX A;  1QF6 A;  1YX6 B;  2VZK D;  5HFY A;  1QSY A;  3D2S A;  1JQ4 A;  4F71 A;  2JEI A;  2AH5 A;  2WXJ A;  4IUM B;  4LNN A;  4NQK E;  2G5I B;  1NBF C;  1CUK A;  3EFU A;  1V85 A;  1TZ1 A;  5AIB A;  2GBJ A;  3CWI A;  3U4E G;  2ASL A;  5J2E A;  3PV1 A;  4PZN A;  4Y2S A;  5J2J A;  2O6V A;  2BQR A;  4M02 A;  2JMG A;  2MUT B;  5AM5 A;  4U6P A;  1D3Z A;  4YMM A;  1KFT A;  1V5T A;  5KL1 B;  3CRX A;  4YTM B;  2R2Q A;  2WHE A;  3VUY A;  1HZ5 A;  2EZZ A;  1YX5 B;  4RQM A;  2NS5 A;  8ICH A;  5CTR C;  4EX6 A;  4WWN A;  2WF7 A;  4BKS D;  5LNK 1;  1ZQP A;  2LXC A;  3QCA A;  1UF0 A;  3AL0 B;  2L76 A;  5KT7 A;  4EBE A;  2E3T A;  1U47 A;  2JZZ A;  2FPM A;  2DYB A;  4F8R A;  1DGJ A;  4XC2 A;  1JWA D;  2KVC A;  2E8M A;  2KE7 A;  4DLE A;  2KWC A;  3JYU A;  1XNS A;  1T3Q A;  3ZW3 A;  2CPR A;  3JPN A;  1YN4 A;  4QNL A;  4F91 B;  3BVG A;  1FFU A;  2CN1 A;  4O3P A;  4QZ8 A;  1L2N A;  2K5P A;  3T5H A;  2INC C;  4DDG D;  2G07 A;  2KG5 A;  5KFL A;  1RYS A;  4UW9 A;  2ISO A;  3C8Y A;  1XLP A;  4LJO B;  1UT8 A;  1D4B A;  4YT0 B;  2BKF A;  3EC8 A;  2QJL A;  3M8R A;  4M2Y A;  2TSS A;  2VJ4 A;  3T5K A;  3DBH B;  2HHQ A;  2R61 A;  1KBU A;  3A9J B;  3KKA A;  4HCP B;  4GDL B;  2B3A A;  2WNM A;  1TK5 A;  3PR4 A;  4ECV A;  3A1Q A;  3QC8 B;  2VJ5 A;  2GBK A;  3L3F X;  3M63 B;  1ZOL A;  8ICU A;  4Q2J A;  2IGD A;  5EE3 A;  3PZP A;  3UMB A;  1RDF A;  1COK A;  3DBL B;  4M0W B;  2I1K A;  5L1I A;  5TSS A;  4G0N B;  1YT3 A;  2K1F A;  4RT2 A;  7ICM A;  1ZJM A;  4L23 A;  4FS1 A;  5KG1 A;  3PV8 A;  3KYD D;  1QOF A;  5KFU A;  4EEK A;  1NJZ A;  1ZQS A;  1P98 A;  4MT5 A;  4DOA A;  1R4N I;  1S8O A;  1DOX A;  3ZNZ B;  3T5J A;  3PRM B;  3B2G A;  5D3I B;  3UF8 A;  4P0Q B;  5DLF A;  4RQ4 A;  4DL3 A;  4DFK A;  4P2H A;  2KK8 A;  4G11 A;  2LGY A;  4BKG A;  1M6Y A;  1T6B X;  2WX1 A;  1NZP A;  2ES6 A;  2K4I A;  4UAR A;  1EU3 A;  3IG5 A;  3N1Z C;  3QZ8 A;  3BWU D;  1V38 A;  1RXV A;  4GIV A;  2MQJ A;  4CNQ A;  3TSS A;  1S0V A;  1O03 A;  3CIR B;  4ANW A;  4RMA A;  1Q3U A;  4XWW A;  3APD A;  2K8C B;  2UYZ B;  1F9J A;  2KMA A;  3AB5 A;  2G4D B;  4KLU A;  3LDZ E;  3WKC A;  5IO9 A;  3BQT A;  2A1J B;  1J7A A;  1HZ6 A;  5JZE B;  1BPB A;  2RHF A;  2BYT A;  2NR2 A;  2F8L A;  1JUD A;  2GBR A;  4K7W A;  3ZNG C;  1JXL A;  4Y2X A;  4AJW A;  1SXT A;  5HHI A;  1V1P B;  2D3D A;  5CHW A;  2PE9 A;  5III A;  3P63 A;  4XX5 A;  3FAH A;  2WTF A;  3U26 A;  1Z2M A;  4B9T A;  1JN3 A;  2ASD A;  2C7N B;  1KL9 A;  2SEB D;  3P4S B;  2KC1 A;  5AI8 A;  1MG8 A;  3AMZ A;  3T5L A;  1L6V A;  3FKY A;  1WY8 A;  1ZE3 D;  3AE8 B;  3UGB B;  1ZRM A;  1NNL A;  2WX0 A;  1IBX A;  3HVD A;  2JHD A;  4CF3 A;  4HPL B;  4KLO A;  4R65 A;  3QIJ A;  2D11 A;  1J8C A;  3WAO A;  2WLB A;  2L8J A;  3N97 B;  4RNO A;  2KV2 A;  5AKL A;  3FM9 A;  2LRU A;  4F72 A;  3JSV B;  3WCQ A;  1HIW A;  2IOH A;  4K3B A;  5J2A A;  4MFC A;  2X38 A;  2BPF A;  2D6F C;  2ODG A;  5CEH A;  2E8N A;  1N60 A;  7ICL A;  4QZB A;  4C8O A;  1B43 A;  2DAF A;  2H88 B;  3QYP A;  4TQR A;  4P0P B;  3GQC A;  4MHV A;  1ZQK A;  1U4A A;  1YJI A;  2AQ3 B;  4ECR A;  3DQV A;  1IXR A;  1MVK A;  4YL8 A;  2O2V B;  3IP4 B;  1V5O A;  2H3Z A;  3I76 A;  5AI5 A;  1URJ A;  4IR9 A;  4K4I A;  2LHD A;  3V6C B;  5L1M A;  3JPQ A;  1RYR A;  2BQQ A;  3LJ3 A;  4O3Q A;  3H8S A;  3BQ0 A;  1XXG A;  1F1H A;  3RMK C;  3NVZ A;  2GI9 A;  3SI8 A;  1F77 A;  3TFR A;  4FFD A;  5KFV A;  1FCC C;  4Q43 A;  1J19 A;  3Q8Q B;  2PMZ F;  5KFM A;  1ZYQ A;  3OTQ A;  9ICA A;  4GLX A;  2LRW A;  1P7D A;  1ZD2 P;  1T94 A;  2N9X A;  2KK0 A;  3ECI A;  2OWO A;  2K4E A;  4AP9 A;  1IG6 A;  2Y5B B;  4Y2T A;  4JWU C;  3VRB B;  4RGT A;  1Y88 A;  4ED8 A;  1B0X A;  5FR6 A;  5CX3 A;  1N6Z A;  3RH4 A;  4U7C A;  3FYH A;  4R63 A;  3ISC A;  3IAM 1;  1FFV A;  2MJ3 A;  1KEJ A;  1XLQ A;  2KFK B;  3BII D;  2W3S A;  3Q3F A;  2G5H B;  2W9M A;  1TS5 A;  5K4L A;  1ZQN A;  1WX8 A;  1H38 A;  3AUL A;  3ZRC A;  4W9H A;  2P6U A;  2FE8 A;  4KIK A;  1NZB A;  1DK3 A;  3HKZ C;  2BGF A;  2KX0 A;  4IRC A;  3RAX A;  1IYF A;  9ICX A;  4WWM A;  3HUI A;  4PGQ A;  1YZ7 A;  5LXH A;  5KFO A;  2WWZ A;  2A3V A;  2MRP A;  2HHU A;  2KX3 A;  2QAR B;  3RCZ A;  2I2Y A;  4O0I A;  2IY1 B;  3N9Y C;  1EF5 A;  3EFC A;  3P2B A;  4L1B A;  4K4H A;  3K4G A;  2AGQ A;  8ICB A;  5ALV A;  1DOI A;  4OJ6 A;  3DBH I;  5E6J A;  4K81 A;  4BXO B;  4UDU C;  4PHP A;  1NVI D;  1F5S A;  4EFO A;  2MBQ A;  1GAQ B;  2DF4 B;  5J2C A;  1NKB A;  3VTW A;  3ZTC A;  2K4H A;  2HI0 A;  3TUO A;  3U7D A;  1L6N A;  2D07 B;  2ZNV C;  1WCN A;  2KP7 A;  2V4Q A;  5EWG A;  3KHH A;  8ICX A;  3L5K A;  4FLH A;  2I5H A;  4A8E A;  1L0X B;  2YB1 A;  7ICF A;  3MFI A;  3Q8S B;  2IA6 A;  2HHW A;  3W9C B;  5KT3 A;  1I4P A;  1JMS A;  5ALQ A;  2INN E;  1TKG A;  2KAJ A;  4RQ8 A;  4ICU A;  3RT3 B;  4YD1 A;  1I4G A;  2LVP A;  2E6X A;  5BOL A;  4RNM A;  4XWT A;  1ZOY B;  4R66 A;  1MQ2 A;  2H3Q A;  2DZI A;  4Q44 A;  4EX7 A;  2M0N A;  3V72 A;  4DQS A;  4HRS A;  4C7Y A;  2JVC A;  1IV8 A;  3RUL A;  3ZDB A;  4TUU A;  1WXQ A;  1L4D B;  3NZU A;  3HW8 A;  5AUK A;  4GXK A;  5DBA A;  3EHV A;  3ZJT A;  4DHJ B;  1OEY A;  2MBO A;  3MGI A;  4PS3 A;  2K8A A;  3SEN A;  3CST A;  1FXI A;  4II3 B;  3RNE C;  4RQ1 A;  1KRH A;  2KTF A;  1YZ6 A;  2G06 A;  3PSP A;  1IUE A;  3RAQ A;  2G09 A;  5J2B A;  2CR5 A;  3T79 A;  1ZQG A;  4ECW A;  4OJ5 A;  3E58 A;  4C4V B;  3L17 A;  4ICV A;  3KKA C;  3M95 A;  1E7P B;  3VDZ A;  3Q8A A;  3KVF B;  2MAX A;  1OW5 A;  1KFY B;  5ALN A;  3PVL A;  1D6E C;  2MUT A;  2KDE B;  2HBM A;  1E7U A;  3NJT A;  2WF5 A;  2WXF A;  2IBI B;  3PGE A;  2JU6 X;  2W11 A;  4Y2R A;  2L3Z A;  3RB4 A;  1SKW A;  4HCN B;  1EWY C;  2VRR B;  4PT5 A;  4RQ0 A;  2MBH A;  4DOC A;  1JXE A;  1ZQC A;  3PHX B;  4M9J A;  8ICN A;  5HI1 A;  1U48 A;  3F5E A;  2BQ3 A;  1EU4 A;  5GXG B;  4M6W A;  2ZZP B;  5C2T B;  2L7R A;  2AQ2 B;  5KFK A;  5L83 A;  1Z00 B;  3V05 A;  4Z6D A;  4I2G A;  1UT5 A;  2LM1 A;  1ZKH A;  5CHG A;  3SFE B;  1EXN A;  4QZC A;  4BFR A;  1TS3 A;  2NMQ A;  3B08 A;  3NUQ A;  1NDD A;  4BVU C;  2RDH A;  5KFG A;  1J2N A;  3UXN A;  3UMC A;  5KFP A;  1UGM A;  4B6W A;  1QT9 A;  1KN5 A;  2HJ1 A;  2RP5 A;  1ESF A;  3N1Y C;  2QB0 A;  4RGM A;  1J97 A;  3SU8 X;  9ICF A;  3L4P A;  4B9S A;  4JWN A;  4MH8 A;  4O3S A;  3TJP A;  2ZTC A;  4IQV A;  4MGY E;  3I3T B;  1KLG D;  4C56 C;  3ORY A;  3A9J A;  1UH6 A;  4US9 A;  2ZG6 A;  2XY7 A;  2IDY A;  5IIL A;  4IRK A;  5D2M B;  2KWU B;  3AEF B;  4RNA A;  1SV0 C;  1TVA A;  1TFR A;  4YSZ B;  3AQF A;  1UCV A;  1Q5W B;  3ZNH B;  2RLT A;  2BWF A;  2A5U A;  2L0T A;  4HJG E;  1RG6 A;  2M8S A;  2GMI C;  2UVV A;  3ML8 A;  2WXN A;  2XEW A;  4PS7 A;  3QUB A;  4HAI A;  2RR9 A;  2LJ5 A;  3DBR B;  4ED6 A;  1I4X A;  5AK5 A;  2KZR A;  3TKA A;  5KFH A;  2GWS A;  4DS5 A;  1V2Y A;  3KUZ A;  3SV4 A;  1ZQL A;  3ONN A;  3HKZ F;  1KTQ A;  4MFF A;  1TBE A;  2HE7 A;  3I1Y A;  4PHA A;  3WKE A;  3H1U A;  3APC A;  2V4I B;  4M8M A;  4PYU A;  3OGU A;  4BOZ B;  8ICW A;  3AE2 B;  3ZGZ A;  3QAQ A;  1LM8 B;  5IIJ A;  2EQY A;  2M19 A;  1D5M C;  4R8U B;  2NPT B;  4HLE A;  1FIQ A;  2FE9 A;  2FNJ B;  1L0V B;  1WMH A;  2VIX A;  2JSV X;  3MC9 A;  3N4M B; 
#chains in the Genus database with same CATH homology
 1ZXH A;  1YJJ A;  1PGB A;  4N6E B;  3ZYY X;  1ZXI A;  1K52 A;  3IT6 B;  2Y3A A;  4CQN A;  1UGJ A;  2WXG A;  2NTS A;  1CQV A;  1AWD A;  2BS4 B;  4HRO A;  4LTU A;  2ACZ B;  2JQR B;  4RCO A;  4A90 A;  2V3N A;  2Q5W D;  4TSS A;  3W2D A;  2PW9 A;  5C3J B;  1V1O A;  1UWM A;  1STE A;  1A70 A;  1I4H A;  1FD6 A;  2PVG C;  3HVZ A;  3PZ8 A;  3E56 A;  4XDD A;  2W82 A;  2N9K A;  4TQ1 A;  1NYQ A;  1C79 A;  1XCQ L;  4IKG A;  3I57 A;  1VLB A;  3AE5 B;  1PGA A;  3FC4 A;  1JRO A;  1IGD A;  2BT6 A;  3AED B;  5BYQ A;  1OFF A;  4A55 A;  2PIA A;  3IT4 B;  5D3D A;  1SJH D;  4C7Z A;  1YMH E;  2EKI A;  2PVO D;  2OHF A;  2DLB A;  4DXF A;  3VRA B;  4A6Q A;  1PUT A;  1HA5 A;  4NAW B;  1L5P A;  1BXT A;  4ZHP A;  3AEE B;  2WXO A;  3MHZ A;  1QLB B;  1JW9 D;  2FUG 1;  2IGH A;  4FXC A;  4B0M A;  4WAF A;  2M0A A;  1YQ4 B;  4YTP B;  3VR9 B;  2HTM E;  3E9S A;  1N63 A;  4OZC A;  1QF6 A;  2XNA C;  1C4P A;  2VZK D;  5HFY A;  1JQ4 A;  2BB5 A;  3MFG A;  3P4Q B;  4P6V F;  2K9X A;  2WXJ A;  3Q69 A;  3J9C A;  3URY A;  3AV8 A;  1XO3 A;  3AE3 B;  4OZB A;  2QSD A;  3CWI A;  1C77 A;  3U4E G;  2RDG A;  3AN1 A;  3Q8F A;  2WP9 B;  2INP E;  3IXS A;  3KWV A;  5BMG A;  2DWQ A;  2Z8L A;  2WXM A;  4AS1 A;  3BVM A;  1XEE A;  4YTM B;  3AEA B;  1HZ5 A;  2IJ0 A;  1FEH A;  1AW7 A;  5LNK 1;  1I4R A;  2FBW B;  3Q8C A;  2E3T A;  3NS1 A;  1FMA D;  4RGO S;  4WQM A;  3NVV A;  1WRI A;  3MP9 A;  1E0Z A;  1DGJ A;  1JWM D;  1JWA D;  2WS3 B;  1T3Q A;  3SEB A;  3UI3 A;  3TEX A;  2Y5P A;  3ZJV A;  1Y56 A;  1YN4 A;  3ZJU A;  4LK0 M;  1JWU D;  3BVG A;  1FFU A;  2QIL A;  5BYR A;  1N5W A;  2WDR B;  1J7B A;  3AE6 B;  3PZ7 A;  1SBB B;  4H2A A;  4YWG G;  3AEB B;  2WXP A;  4US8 A;  2K5P A;  1ENF A;  4D2K A;  1NYR A;  3AE9 B;  1JCK B;  3C8Y A;  3Q8E A;  1XLP A;  3P4P B;  1D4B A;  1TYG B;  2LJI A;  3LB8 C;  4YT0 B;  1PDX A;  2QJL A;  2M56 B;  2TSS A;  1ZP0 B;  3AE1 B;  3KLS X;  2DBY A;  2K3U A;  2J52 A;  1SIJ A;  2AQ1 B;  2R61 A;  3FIL B;  4GDL B;  2HDE A;  3GP7 A;  2WNM A;  3IAS 1;  4MAC A;  4XDC A;  3NZ3 A;  2WXI A;  2IPK D;  4RGN A;  3PO0 A;  4Q2J A;  4TMA B;  2IGD A;  5EE3 A;  2RPV A;  1B1Z A;  5HG2 A;  5TSS A;  1CZP A;  3ZQ4 A;  1R7S A;  1EM7 A;  4L23 A;  4YSX B;  2SAK A;  3VQI A;  1AYF A;  2ON8 A;  3NRZ A;  1L0Y B;  1QOF A;  1WGK A;  3BK2 A;  4GLS C;  4ITK A;  3ABV B;  2WU2 B;  2QEJ C;  3BYY B;  2V3P A;  2GRI A;  4MT5 A;  4OVZ A;  1RYJ A;  2KWD A;  3KWL A;  4RFB A;  4ZRP A;  1YQ3 B;  1ET6 A;  1I4Q A;  3MJ5 A;  1F2R C;  1DOX A;  1ZDX A;  4ZHO A;  2W54 A;  1YN3 A;  3B2G A;  3P4R B;  4YTN B;  3TEW A;  3EUB 2;  5D3I B;  2K0P A;  2BTE A;  4JPS A;  1TKE A;  2B76 B;  1T6B X;  1KH0 A;  2W55 A;  1GPX A;  1EU3 A;  1UWX A;  4O1N A;  1FRD A;  5AUI A;  3BWU D;  5FR3 A;  1SE4 A;  2N0S B;  3TSS A;  1VR9 A;  4USA A;  4P16 A;  3CIR B;  1CJE A;  4XWW A;  3R8B A;  2ZW0 A;  1E10 A;  1K51 A;  2J4X A;  4AQ7 A;  3AB5 A;  2ONQ A;  5H92 C;  3HRD D;  1J7A A;  2J53 A;  2XN9 C;  1HZ6 A;  5BMI A;  2QMT A;  2BYT A;  2JXT A;  1ZDV A;  3I9V 1;  2VZK B;  4KKJ A;  1SXT A;  3V3X A;  1V1P B;  2KDM A;  3P63 A;  1M4V A;  3R2T A;  3FAH A;  3OWE B;  4XE0 A;  3AH7 A;  3AM9 A;  2SEB D;  4JWS C;  3P4S B;  3AMZ A;  1L6V A;  4OZA A;  1ZE3 D;  3AE8 B;  5JXV A;  2DYM A;  2MEK A;  1IBX A;  3HVD A;  1HXY D;  2AX5 A;  4ARC A;  4HEA 1;  3GB1 A;  1MHX A;  1QIL A;  3RFZ B;  1I7H A;  2WLB A;  4DQO C;  3R2I A;  1HQR D;  2KN4 A;  4NZL B;  2KMM A;  5HHD G;  1SSN A;  3WCQ A;  1WWT A;  2LEK A;  1TJE A;  2PTL A;  3NVY A;  1N62 A;  3BVZ A;  4YSY B;  5D7G A;  2X38 A;  1DOY A;  1N60 A;  4NJC A;  1BML C;  1QKZ A;  2H88 B;  4RF0 A;  3O13 A;  1TS2 A;  1YJI A;  2AQ3 B;  1E6E B;  1MVK A;  2ZW1 A;  2LHD A;  2LFI A;  1C4C A;  1J7C A;  2KQ4 X;  1XXG A;  2GB1 A;  2CJN A;  3NVZ A;  2GI9 A;  1XLN A;  2PMV A;  1F77 A;  3EGR A;  1SF0 A;  1SE2 A;  1TY0 A;  1JAL A;  1FCC C;  2EEL A;  1LO5 D;  2W3R A;  2WQY B;  2MJE A;  1HEZ E;  2MH7 A;  1GOZ A;  4JWU C;  3SFD B;  4ZYS A;  1L4Z B;  4GDK B;  3VRB B;  4RGT A;  2G1E A;  1CK1 A;  1N5X A;  1ROE A;  1IGC A;  3IAM 1;  1FFV A;  2MJ3 A;  4WH4 A;  1XLQ A;  1FNV A;  2WXQ A;  2W3S A;  3BII D;  1JWS D;  1TS5 A;  3LYY A;  1JWB D;  1KTK A;  3ETR A;  3BZD B;  2FE8 A;  2JZP A;  1K50 A;  1OQQ A;  4ZRQ A;  2ICI A;  4REZ A;  4A9A A;  4MM3 B;  5G5H A;  1L6U A;  4JE3 B;  3W5U B;  4WWM A;  4IDI A;  1VJK A;  3HUI A;  1PYW D;  2PKO A;  4IOI E;  1P7E A;  1GB4 A;  2V0G A;  1V8C A;  4TQ0 A;  1K53 A;  2I2Y A;  1UUP A;  3N9Y C;  3SR6 A;  1XLO A;  4L1B A;  4DXG A;  3U2S C;  5E6J A;  1DOI A;  2L52 A;  3BK1 A;  3H8H A;  3VR8 B;  2D5G A;  4WUR A;  1FNW A;  4N58 A;  1NVI D;  1WSP A;  1TS4 A;  4UDU C;  1N61 A;  1GAQ B;  3B2F A;  1V1P A;  1UNS A;  2KAC A;  3EA6 A;  2WXH A;  3TUO A;  1ZUD 2;  2I38 A;  2DYO A;  2Y5C A;  2WXR A;  1XCT L;  1ZPS A;  1FO4 A;  1V97 A;  1VZ7 A;  4J3O D;  1L0X B;  2YEP B;  3W9C B;  1I4P A;  4NAM A;  4M0W A;  1SB3 C;  1IBX B;  2INN E;  1TKG A;  5BYS A;  1P7F A;  2KAJ A;  3W5V B;  2WXK A;  1I4G A;  2E6X A;  3AEG B;  4XWT A;  2NTT A;  1ZOY B;  1QOB A;  2BB6 A;  4JX1 C;  1YN5 A;  3P1M A;  2WU5 B;  1RFK A;  1VZ8 A;  2L32 A;  1FRR A;  4HRS A;  1DYQ A;  1JML A;  4C7Y A;  2JX5 A;  2RMM A;  1NEK B;  2OED A;  3W1S A;  1WXQ A;  1L4D B;  5AUK A;  1E9M A;  3U7Z A;  2IGG A;  3GS2 A;  1TKY A;  3ZJT A;  1B9R A;  2BBC A;  1QOG A;  3DWM A;  3B9J A;  1FXI A;  1PGX A;  5FK9 C;  3AE7 B;  3AEC B;  1KRH A;  5I4D A;  1IUE A;  3RPF C;  1ACC A;  1NI3 A;  1TZO A;  3TEZ A;  1VDV A;  4WIP A;  1F0Z A;  1F2R I;  1SE3 A;  4N59 A;  2QIE B;  1E7P B;  1KF6 B;  3T3O A;  3Q8A A;  1MPE A;  1KFY B;  5T8I A;  1D6E C;  5BMH A;  1JRP A;  1BUI C;  2WXF A;  2JU6 X;  4KX6 B;  4KGT A;  1FNU A;  2LMC A;  1EWY C;  1SEB D;  4PT5 A;  1NEN B;  1FM0 D;  1RWS A;  1D5Z C;  4OW0 A;  4ARI A;  4A8X C;  1C4A A;  5H8Y E;  5HI1 A;  2N7J A;  3T3N A;  2JYT A;  5EE0 A;  1EU4 A;  1YNT E;  5GXG B;  1MI0 A;  1VZ6 A;  2BW2 A;  5C2T B;  3NVW A;  2AQ2 B;  4ZOH C;  5MPO A;  2N9L A;  2BS3 B;  1WYG A;  2YEP F;  5FKA C;  2PLP A;  2WXL A;  3V05 A;  3SFE B;  1TS3 A;  4HKQ A;  2NMQ A;  1C76 A;  1GB1 A;  2RDH A;  1D5X C;  3U52 E;  4HKZ E;  1Q10 A;  3AE4 B;  4KKI A;  1QT9 A;  2J42 A;  1TY2 A;  1ESF A;  4RGM A;  1T5X D;  1QOA A;  3L4P A;  1VRA B;  3BYT B;  1C78 A;  4MH8 A;  1KLU D;  4RH6 A;  1KLG D;  2LHE A;  4C56 C;  2JYE A;  1OQR A;  3FIL A;  2H89 B;  4OHJ A;  4US9 A;  4LLG M;  1PFD A;  2IDY A;  1FCL A;  3AEF B;  4RNA A;  4YSZ B;  2L1A A;  3TEY A;  2JWU A;  4HJG E;  2MJD A;  1ET9 A;  1MHH E;  2WXN A;  3MC0 B;  4KGS A;  3KQ4 A;  1AN8 A;  2WDV B;  2BS2 B;  2G9H D;  4B0E A;  3Q8B A;  1I4X A;  2CU3 A;  4C80 A;  4RF1 A;  2K22 A;  5G5G A;  2LUM A;  1QQR A;  4EE2 A;  4R3D A;  1C9F A;  2V4I B;  3DWG C;  1SJE D;  1EWC A;  1RM6 C;  3AE2 B;  1FXA A;  5EE9 A;  3ZGZ A;  3LXF A;  1XF5 L;  2M19 A;  1D5M C;  2LGI A;  5EE1 A;  3P42 A;  4L2Y A;  1FIQ A;  4KGR A;  1L0V B;  2WDQ B;  2JSV X;  2L83 A;  4YXD B;  3NUH B;  2CJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...