3EUB2

Crystal structure of desulfo-xanthine oxidase with xanthine
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
164
structure length
164
Chain Sequence
TADELVFFVNGKKVVEKNADPETTLLAYLRRKLGLRGTKLGCGEGGCGACTVMLSKYDRLQDKIIHFSANACLAPICTLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGIVMSMYTLLRNQPEPTVEEIEDAFQGNLCRCTGYRPILQGFRTFAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Substrate Orientation and Catalysis at the Molybdenum Site in Xanthine Oxidase: CRYSTAL STRUCTURES IN COMPLEX WITH XANTHINE AND LUMAZINE.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Xanthine dehydrogenase/oxidase
total genus 37
structure length 164
sequence length 164
chains with identical sequence A, J, S
ec nomenclature ec 1.17.1.4: Xanthine dehydrogenase.
pdb deposition date 2008-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
2 PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
2 PF01799 Fer2_2 [2Fe-2S] binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.120 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 [2Fe-2S]-binding domain 3eub202
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 3eub201
1FRRA 1RWSA 5GXGB 1DGJA 3P4SB 4FXCA 3P4QB 1QLBB 1FM0D 4HROA 1EWYC 3FC4A 1PDXA 1PFDA 3PO0A 2E3TA 3NVZA 1FFVA 1J7CA 3P63A 1N5WA 3B9JA 1E9MA 3NVYA 1TKYA 3AE3B 1L6VA 4US9A 1TKEA 4YSZB 2M56B 1GAQB 5G5HA 4N6EB 2W55A 5EE9A 3AV8A 2JQRB 3HVZA 2QJLA 2G1EA 3NVVA 1T3QA 2FBWB 2MH7A 1SIJA 1RYJA 4JX1C 3LB8C 2K5PA 3B2GA 5EE0A 3P4RB 4C7ZA 1E6EB 2KMMA 1V8CA 3B2FA 2WDQB 5EE1A 4YSXB 2CJNA 1FFUA 1XLNA 1E7PB 3VRBB 3CIRB 1TKGA 4N58A 1FIQA 1NI3A 2AX5A 3AMZA 3CWIA 1FMAD 3FAHA 1JWAD 3NS1A 1FRDA 4US8A 1YQ3B 2PVOD 1RFKA 3AEEB 1YJJA 2MJ3A 1ZUD2 3ABVB 3AEDB 1QOGA 1I7HA 4N59A 4ZHOA 3L4PA 5AUKA 1OQRA 3AN1A 2EKIA 4USAA 1CJEA 3HUIA 1QF6A 2WLBA 4YTPB 5AUIA 3P4PB 5G5GA 5H8YE 3LXFA 4YXDB 1WGKA 2BT6A 3RPFC 1E0ZA 1XLOA 4IDIA 2OHFA 3AEFB 4WWMA 1DOIA 1J7AA 4ZOHC 3HRDD 5MPOA 1PUTA 1DOYA 1SF0A 3AEGB 3DWMA 1JRPA 3AH7A 1XLPA 2DWQA 4KX6B 1JWBD 2Y5CA 4C80A 2CU3A 1A70A 1ZXIA 2LEKA 3AE9B 3DWGC 1V97A 1NVID 4LTUA 3AE7B 2W3RA 1QOAA 4ITKA 1WXQA 1KF6B 3P1MA 1DOXA 1RM6C 1NEKB 3KWLA 4C7YA 2B76B 1FXAA 1L5PA 2WP9B 1AWDA 3SFEB 1F0ZA 5EE3A 1OFFA 1R7SA 2WU2B 1FXIA 3AECB 1VDVA 4YTNB 2H89B 2K22A 3VRAB 4YSYB 3VR9B 4HRSA 2BS2B 1JROA 3AM9A 1N60A 4JWUC 1KRHA 1N62A 2MJEA 1CZPA 2M19A 2PKOA 3NRZA 2WDRB 1WRIA 1XO3A 1WYGA 3ETRA 3AE8B 3W5VB 1JW9D 1NYQA 1VJKA 1YJIA 3W9CB 2QIEB 1YQ4B 4P6VF 1QOFA 2Q5WD 3SR6A 1FO4A 1GPXA 1TYGB 3AEAB 1L0VB 2ACZB 1L6UA 4WQMA 2W3SA 2BS3B 2L83A 1J7BA 1ROEA 1B9RA 3AE1B 2WQYB 2WU5B 3AEBB 3BIID 1QT9A 1IUEA 1E10A 1TJEA 3WCQA 4ZHPA 4YTMB 3AE6B 1QOBA 1VLBA 3AE4B 3AB5A 1N61A 1UWMA 1KFYB 3AE2B 4YT0B 1OQQA 2HTME 2JX5A 5H92C 5C2TB 4A9AA 3ZYYX 2L52A 1NENB 1NYRA 2WDVB 1ZOYB 1N5XA 3SFDB 1XLQA 3W5UB 1N63A 2PVGC 2W54A 2MJDA 1WWTA 2K9XA 1ZP0B 2N0SB 2BS4B 2PIAA 3NVWA 1AYFA 3AE5B 2CJOA 2H88B 3EUB2 3VR8B 2WS3B 1SB3C 2DBYA 1JALA 2KAJA 4JWSC 5C3JB 1JQ4A
chains in the Genus database with same CATH superfamily
3RBEA 4M6WB 5CA7A 3TBLD 5DDYA 2DGZA 2MUTA 1Z4OA 1UBIA 4JPSA 2FI1A 3APFA 3P63A 1JMSA 5J2KA 4YSZB 2KJHB 4US9A 2JMGA 3L3FX 5ALYA 2IA6A 2MU2A 2N7JA 2KMCA 4JB3A 1D9DA 5EE9A 2HBKA 2KT7A 4G50A 1LM8B 3W1SC 1SXTA 1LO5D 4KIKB 2FBWB 3ZJTA 4HJKA 4B6WA 3PRMB 2N9XA 1MN8A 4IW0A 3MC0B 1P0RA 3HKZF 5DGAA 3T5LA 8ICSA 5KHOA 3CIRB 1TKGA 1YX6B 1DGSA 1SE4A 2F8KA 9ICHA 3OHBA 3E56A 3M3JA 5EOZA 4J9LA 2MJ3A 2V4QA 4ZHOA 3I9V1 2VRRB 4DHJB 1ZQTA 3K9PB 2NVUI 3EPGA 4UB1A 1V1PA 2LI6A 2GBJA 3RB3A 3LXFA 1XEEA 4FULA 1YJ1A 5EWFA 4EZLA 3GZNI 3AEFB 2FMSA 4UAYA 4Y2SA 2WNMA 3CMMB 5D4BA 4XA5A 1NKEA 1ZQVA 2CPRA 3HM6X 3B0XA 5KFCA 1NK4A 4A3OA 1A0PA 2PMZC 4J9NA 1L7NA 3U7DA 1NVID 1ZRNA 4DSKA 1XNSA 4ITKA 4B9LA 3LYSA 4UASA 4NLGA 4FS1A 1ACCA 1WXQA 2H3FA 1UF0A 3LJ3A 2DZIA 3JSVA 5AKYA 4B9VA 2EAPA 4LJOB 7ICJA 4QNLA 3RJHA 1V86A 3PW5A 2HE7A 4J6IA 3WK8A 2RPVA 2D5GA 4QZFA 1SV4A 2M0NA 4DL4A 2C7HA 2WDRB 3Q8KA 1CI4A 3T3OA 5KFPA 4HLEA 1AW7A 4Y2XA 5IAAC 2QB0B 8ICLA 4HXDA 3DV9A 4RNAA 4GXKA 4RPXA 2BYVE 3Q8FA 1P7FA 4IC9A 2ZJ5A 4QZCA 2Q5WD 1FO4A 2TSSA 5IP4D 3WU2U 2HCFA 2ASDA 3Q8LA 2ZXIA 3QA8A 4DQSA 3AQFA 4HK2A 3ZDTA 2BHNA 2W8LA 1WMHA 5B5EU 2JEJA 3VH4B 5BOMA 3J9CA 2WXRA 3EC8A 3I63C 3M95A 4B9UA 4ECQA 3QUCA 4A9AA 1XSNA 1NJZA 1XCTL 4DXFA 1ZQPA 3EFCA 2NS5A 2XI9A 1E8WA 2LJIA 3HWTA 1YX5B 4HPPA 1TKDA 1PK3A 1PZNA 1RXWA 3L08A 1AYFA 1RFAA 3L13A 3TKAA 1TS5A 2KAJA 2J6TA 1OUQA 4IRDA 1JWSD 1FD6A 2H3IA 1FRRA 3KUZA 4AP4C 2A4ZA 4FXCA 1NOMA 3P4QB 1IG6A 5ALPA 2A5UA 2LUMA 1TZOA 4JQWC 4RQ0A 1PGAA 5J0TA 2DNFA 3M7DA 4NY8A 2D3CA 2LVQA 3HW8A 2LRUA 2WYQA 2AH5A 2M56B 1J19A 4MSQB 4FHKA 1UHUA 4JWMA 2YQEA 4OJLA 3SAHA 4DL5A 3PNCA 1BMLC 2CHZA 2KWUB 1YD8U 1SGGA 2J53A 2SEBD 2HHWA 1QSLA 2Y0SF 1L3SA 3IG8A 5ALNA 2RDJA 1O08A 2ZIWA 4QWAA 1YNTE 4KSKC 2I1JA 1DOQA 2QC8A 1E7PB 4P0PA 4KLFA 4BWMA 1JIHA 1URJA 4LNIA 3IHQB 4WJPA 1UBQA 2HHVA 3MR5A 4IQUA 2KHWB 3QUBA 3V6JA 3PO4A 1ZE3D 2IO2B 3OLMD 1MI0A 4AJYB 5L9XA 4DQQA 2XC9A 4ECSA 2GBKA 3R7RA 2I6XA 2FDRA 1ED1A 3BJYA 3QXGA 2INPE 2KXJA 5D2MB 3H40A 2WLBA 1NDDA 2BPCA 4F5NA 3A1QA 3DVGY 4I27A 3EHVA 4C4RA 5FKAC 2BCVA 2BB5A 2KC1A 4DL6A 1H4RA 3HRDD 4DL2A 1RQNA 2W04A 2V0GA 2F1HA 3DWMA 1V2YA 1ET6A 2H3QA 4AWJA 4RUCA 4GMVA 3N7SC 4PZNA 5CWRA 2EANA 3QEAZ 1XXGA 4FE3A 2EELA 2D3GA 2AQ0A 3RRHA 5KL1B 3Q2AC 2OOBB 5C2TB 3DDHA 3RCZA 4PS8A 1FXAA 2G5HB 1L5PA 2FAZA 2JRIB 3SFEB 3TQ1A 1UCVA 4OJ5A 1YZ6A 3IAM1 1WG8A 4FHJA 4ANXA 5DBAA 1C3TA 4ED8A 4L1BA 2L76A 1XQQA 1N62A 3QU2A 1XCQL 3B08A 4JWNA 2KC2A 3RJJA 2WXNA 1LKYA 3TUOA 2JVCA 2K8HA 1OW5A 4YWGG 5AI5A 3TANA 1Q1OA 3BVZA 2QDFA 9ICRA 1ZQNA 5GTIU 4I2BA 1WJ4A 1B9RA 8ICYA 1IUEA 1ISNA 2NMQA 5E6JA 2DYOA 2KFNA 3ALBA 1BVSA 1OTRB 4AYBC 2JUOA 2BKEA 2RRDA 1OQYA 1TE2A 3G6VA 1VCBA 9ICMA 2XGPA 2WB1C 1WE7A 3BINA 3I5JC 4BX9C 3TEWA 1X9XA 2PVGC 4YMNA 7ICOA 2ZPYA 1D5XC 3BZDB 1KH0A 4BDPA 4PS3A 4WURA 4PHDA 3GU3A 1JMLA 3S2AA 4QWCA 3ICXA 4A20A 3H9DA 4QZBA 4PPXA 1G6JA 1MHHE 2DBYA 3WK9A 2BKFA 2O2VB 5DG7A 1WJNA 1IGCA 4MGYE 3O0FA 3P4SB 2JEFA 1XS9D 3RAXA 4I28A 8ICVA 1ZXHA 3OAWA 1BPZA 3ECIA 4DFDA 4QZDA 2A3VA 3A4RA 3ZDCA 4PT5A 3ZIMA 5T8IA 2WHIA 5AI9A 1F1HA 3BS7A 4MELA 5IKCM 4DLEA 2KP7A 4UB3A 3BQ0A 1L6VA 3APDA 5CHWA 3ZQ4A 3WK7A 3Q8SB 4K7WA 1RQLA 3E0FA 2D11A 4I2CA 2IY1B 9ICIA 3ZI4A 5AI0A 2G3QB 7ICEA 1ZDXA 1KW4A 3JPSA 2F76X 9ICBA 2G45B 3V6KA 5KG0A 3TCAA 2VKQA 1MG8A 4O3MA 1FFUA 1MC8A 4RGOS 2HHQA 1C20A 4RQMA 1FIQA 1BPDA 4DDGD 5J29A 2KFKB 3FAHA 4W9HA 4AYBF 1FCLA 5DDMA 8ICNA 3C21A 3VAWA 2GLEA 3H7SA 5HFYA 5KG1A 2WXIA 2DPJA 1V6EA 2MUTB 4LDTD 4EUTA 4GXBA 2EKIA 3WAPA 3CYMA 2AQ1B 3BDPA 2IGGA 2KK8A 3RZWC 4QZAA 4F4WA 2M1MA 4G11A 2EH9A 3RJFA 3PW0A 5HMLA 4P0PB 2KTRA 2C60A 1ZQGA 3FYHA 4EBEA 1NK5A 2ZTCA 4Z6DA 1GC6A 3HM3A 5KT5A 5BPCA 1HE8A 1A70A 3MFHA 4FS2A 9ICGA 4FJZA 2KO3A 2O6VA 1T7PA 5KT2A 2B21A 1VDVA 5DQIA 1NBFC 2NBUA 3T5JA 3AECB 4RPYA 3DBSA 3U7ZA 2HW3A 3PW4A 4XC2A 2BS2B 4M9NA 4C56C 1N60A 1U47A 4BKSD 3C23A 2BCRA 3PW2A 4M9GA 4OJ6A 4FBUA 2KJ5A 3BYTB 3VUYA 2AGQA 2G4SA 3H4BA 1JI7A 2JSVX 3QCAA 1YOVB 2BDUA 1ZQ1C 2ISPA 2X38A 2AEHA 2KWDA 2JPHA 1WWVA 3H6NA 4Y2JA 5KG3A 3ZUNA 5DG9A 1ZJNA 3QAQA 4RMAA 3ZTCA 3PW7A 3M8RA 4DOCA 3BQTA 1ZQKA 1S77D 1FNVA 1Z00A 5CEHA 3AE1B 1ZQJA 3AEBB 2FPKA 1ZJMA 1T6BX 3SZ2A 4JGHB 2W9AA 4ZHPA 3PO5A 5IO9A 1KFYB 1PVQA 1LFDA 4JE3B 5KFYA 1WX7A 2L52A 4A3PA 3U26A 1ZOYB 4ARCA 3JPRA 1XLQA 4KX5A 3OJSA 1S5LU 1L7PA 3F5AA 1L7MA 1RYUA 3VR8B 3KWVA 2O6VD 3RB0A 2OEHA 2PE9A 4JWSC 2FCMA 2PTLA 4PGYA 2KTRB 5HHIA 3JSVB 2FPMA 4ECUA 4B95A 3QIJA 2IGHA 2JHDA 4D2KA 4GC7A 2KHQA 4F5OA 3GFKB 4Z6EA 5JHAA 3H8HA 9ICJA 3TEXA 4O5EA 2LFIA 1JUDA 4DL7A 2A1AA 1IPGA 5JUMA 4CDGA 1UQVA 1GAQB 2ON8A 2W55A 2RPQA 2ZJDA 1N48A 1WSPA 4DFKA 1XU4A 3JPNA 1XF5L 1E90A 4KGRA 1CMXB 3T3NA 1EF5A 2K5PA 4DOAA 2JYTA 3Q8PB 2KMMA 2LBOA 2OH2A 4Q8FA 3EYZA 4EBDA 2WWZA 1XLNA 4BXOB 3RRGA 4RM8A 3KZXA 3V3XA 3N32A 4TSSA 3ZRFA 4B9SA 4PK1A 1TZ1A 4F2SA 3UQ0A 3PGEA 3C2LA 4KLHA 4YR3A 1U45A 8ICXA 5KFMA 3R66C 2AHOB 2JWZA 4K4IA 2REXA 3KYDD 4KMOB 2DPIA 3SQIA 3EWAA 5K4LA 2AQ3B 1F0MA 3HUIA 1A5RA 4Z6FA 1ZQEA 2Z59B 1SZHA 3RF9A 1WH3A 2WX0A 2ZW0A 1QCKA 1ZKHA 1D6EC 7ICVA 4XWTA 2IZVB 4EX6A 4RQ8A 7ICFA 3ONSA 4HWIB 5KFVA 3IAS1 4DSFA 4MGZE 3O65B 4LZGA 5CB1A 3MTNB 3K1RB 4QIWF 5KFOA 3AE9B 3DWGC 4UBBA 1I4XA 2WXPA 1E5WA 1EM7A 4IR1A 1KLUD 1DOXA 5KFUA 5AM1A 5DB8A 3RNBC 1E7UA 4IOIE 2WP9B 4KKJA 4MFFA 1Z5SB 1BNOA 4TUUA 3RJKA 3V6CB 1N56A 2YTUA 2ZIWB 2WF5A 4RQ6A 2AU0A 1JROA 2ALZA 1ZYQA 2UYZB 1X1MA 1ZRMA 1GJZA 1KRHA 2XGQA 4FBJB 1CZPA 4NL9C 3DBHB 1E8ZA 1NNLA 3ALRA 4AS1A 2EDUA 2C7NB 4CF5A 1C76A 1HZ5A 4ELVA 1UWXA 2NPTB 1I42A 1KEJA 5AI6A 3PMNA 1TBEA 1L0VB 2WFAA 1J7BA 4FBTA 3KKAC 2KHVA 4NNJB 3QARA 1S0NA 3HIZA 1SWVA 4UB6U 4YN4A 2NBWB 5DGBA 1GC7A 4DDID 2N1WA 3NTUA 2K4HA 2XY6A 2VA3A 2JH7A 2KQSA 5BMHA 3X23A 2FIDA 5J2EA 4Q8EA 1WWTA 2DHZA 3FM9A 2UU7A 1WZ3A 1ZD3A 4KLEA 4UDUC 3RD2A 3NG0A 4DWIA 4HCPB 2IOHA 1HUZA 1A6SA 2YX8A 4MEMA 2PFQA 1SJHD 1N6ZA 3GOEA 3A0BU 2W9NA 4BXOA 3NVZA 1ZQWA 1I4QA 2VANA 4FZLA 1TKYA 3R8BA 3LK9A 4OJPA 3DVGX 4NLZA 4P4MA 4QWEA 3D2SA 2KSOB 3NZUA 5J2FA 3WKDA 3AV8A 2XK5B 3M9NB 1Y56A 2JQRB 2G1EA 1ZQFA 3ED5A 5CR0A 2PEAA 3PSIA 2LI5A 3B2FA 1B43A 5ALJA 4ZH4A 3LVVA 2K89A 2KANA 2F1IA 4DSEA 4F5PA 1U49A 1Z1VA 1UA1A 9ICAA 2BYEA 3GS2A 8ICWA 1K52A 1YQ3B 3ZD8A 3ABVB 4MF8A 1I7HA 3ML9A 2MX2A 4OZAA 1SKWA 2NO4A 1I4HA 2PW9A 3IN5A 2IBIB 4YTPB 2P6UA 4J3OD 2K4PA 1A76A 2J42A 3P2BA 5JTIA 2LXAA 3QU5A 1X42A 3MR2A 8ICTA 4IDIA 2ZIUB 2OHFA 2KSOA 2LM4A 2BQUA 1DOIA 2KDEB 5AEKB 1K1SA 2J0MA 4P0QB 3V72A 4MM3A 4W9CA 5MPOA 1DOYA 4I2AA 3AH7A 4RF1A 4OVVA 2K39A 4K4GA 3DBRI 4HEA1 2G09A 1AN8A 2D07B 4REZA 1KF6B 1C4AA 2KG5A 2ZG6A 4OZBA 3PR5B 2MCNB 3IHPC 4YQWA 5J0PA 1UT8A 3TFSA 3HJEA 4XE0A 4RQ4A 1GO3F 3RJGA 4C8LA 4Q2JA 4YTNB 4ECXA 1M4VA 2AQ2B 3WAMA 4RT3A 1UELA 3QYPA 2F1JA 3MGHA 2ZUBA 4PHPA 2BGWA 1GNUA 1WYGA 2MA9B 2YLMA 2R2QA 2A1JA 4UB5A 1VJKA 1YJIA 3RN9C 3U8ZA 3KW5B 1UT5A 1BXTA 3OGUA 1VD2A 3K4GA 2NRTA 2BF8B 2KACA 4HYKA 5ALIA 2HOFA 1D8BA 2N1VA 4JIOU 4LCDE 4R3DA 4X5VA 2CHWA 2IHNA 4MT5A 2KEYA 4M6WA 3Q8RB 3QK0A 4M0WB 2LXCA 3AE6B 3IT6B 1HA5A 4YG2A 4X57B 3C2KA 3V62A 1Q46A 1AARA 2YMPA 3LWMA 7ICLA 1KFTA 1SE9A 1C79A 1WE6A 4BJQA 4GXIA 1NENB 4WAAA 4ZDVA 5J18A 2N7DA 1S0OA 1PYWD 2P6RA 1QLNA 3AI5A 3KVFB 3L54A 3WAOA 3MC8A 2K9XA 2PIAA 3RNAC 4ANWA 4FO6A 4NLKA 3BVMA 4ED2A 2ICIA 2FMQA 2CKHB 1JQ4A 1F9JA 3RNFC 2YB1A 5HHDG 3D6JA 3VTVA 1N2XA 2W11A 7ICHA 3ZLZA 2QCZA 7ICNA 3A9KA 3FDSA 1ZQSA 2IPKD 1KBUA 4BKTA 3PO0A 4DLGA 4HCNB 2GO7A 2FUG1 1ZQBA 2MW5A 5CHGA 2HVHA 4KX3A 5J2BA 5BOLA 4IM3A 5AK3A 5E6OA 5IIKA 1MJDA 1BPEA 1T3QA 4P16A 1XWLA 3M1YA 1F77A 1RYJA 1WJ6A 4M8MA 1AROP 3TSSA 1P1AA 1T3NA 4EYIB 1V8CA 2ZJAA 5KL8B 3TAPA 1V85A 1J0GA 2FLPA 1FMAD 3UF8A 2DZKA 1R4NI 2KKCA 3NS1A 3RR7A 3MC1A 1QSYA 4US8A 4KTQA 9ICLA 2PVOD 2EZXA 3AEDB 3UXNA 2JZZA 5KT6A 5AM5A 1L4ZB 2V3NA 4G3XB 4ED3A 2IOFK 3MR6A 4ED7A 3PV1A 5I4DA 4DF8A 1MQ3A 4MGIE 5AUIA 3ZD9A 5AI4A 1D3ZA 4YVZA 4IR9A 3I76A 3SEIA 2BT6A 2GLSA 4M8NA 3NUQA 4YMMA 1D9FA 2GWSA 4WWMA 1GB1A 3N7RC 3LWLA 1PUTA 4IS7A 1HEKA 3QWZB 4LDTB 3AE7B 4NQLB 3BQ7A 3Q8MA 4C7YA 4YL8A 2PXIA 4MDKE 5KFNA 3H8SA 3EA6A 1KQQA 1OGWA 4RGMA 1IYFA 2WXMA 4HKQA 4I2FA 4AJWA 4Q45A 1KSPA 3GIJA 3N4MB 2KX3A 3RH6A 2BPFA 1WR1A 4JWUC 2KKPA 4O3RA 2M19A 4ECTA 4ICUA 3UMBA 1XO3A 5D3IB 4CO7A 4EOYA 1SJED 2I2YA 3HT3A 3TACB 2JR5A 3CW2C 1RYSA 4B0MA 4R8UB 4WWOA 3PZ8A 3RI7C 3PSTA 3P42A 5FR6A 2WDTB 1F2RI 2L3ZA 2MA1A 3GE8C 1L6UA 4W9DA 2Y9UA 4TQ0A 4F71A 1KJTA 2MBEA 5D94A 4QIWC 2V4RA 4QW8A 3DBLI 2K4EA 3OSNA 4XYCA 5IN7A 5IINA 1IGDA 4PZOA 1QOBA 1JWMD 3AE2B 4WJNA 2HHSA 2DX5B 2D2QA 4HDQA 2JXJA 3ZYYX 1KTKA 4KLIA 2JY6A 4GU2A 3GV5B 1L3UA 2DYBA 2Z7JA 3N9YC 3NOBA 3SFDB 4LK0M 1WF9A 1XT9B 2PMVA 1PGXA 1KLNA 1J8CA 4PHAA 2JU6X 5D3DA 1MSWD 4C4TA 2F44A 3EUB2 2L00B 5DB9A 2WS3B 4HKZE 4EEWA 3I28A 3QU9A 2C2DA 4BZAA 1WGYA 5H2FU 4KLMA 2KTQA 4OVZA 3L0WB 1PFDA 5AZGA 5J0QA 2HMXA 1FFVA 3LDAA 1Q10A 1ZOLA 1J2MA 4BGDA 3DHHC 4F3OA 2K8BA 3VQIA 2BVCA 1S1QB 4CRXA 1XO1A 1SV0A 1S9FA 4UQGA 5AICA 3NJTA 1PVPA 4Y2PA 1TY2A 4F4XA 2WXGA 1WGRA 1BT0A 2MH7A 1ECWA 2ASJA 1WXAA 2BCQA 4GN1A 1B4FA 2QSDA 1KFSA 2OYYA 2CJNA 2M4NA 3K1ZA 2LVPA 5ALTA 5CJ7A 2BTEA 2EKEC 3A0HU 2VJ4A 3R7QA 3MFIA 2VZKB 2IDYA 3H8WA 4F50A 3H8MA 1V1PB 1L8LA 4TQ1A 5AUKA 5L83A 2KNJA 4QAYA 3SD7A 2PKEA 2NCNA 5KT3A 2INDC 3WKAA 3B0AA 2Q4TA 2NYVA 2N4FA 4RQ1A 8ICOA 4F4YA 4TKNA 5AZFA 4B0EA 5ALOA 5AM2A 1WMHB 4C00A 2LKYA 4RFBA 2K25A 4LTUA 4MHVA 2YEPF 2H3ZA 1ZQUA 2W3RA 5ALXA 1NK9A 3AU2A 2WF6A 3VCBA 2KIVA 4DO9A 2BDPA 3N1ZC 2LGXA 4JLCA 1D8YA 4FJVB 3ZDMC 5D7GA 5ALQA 4EE2A 3HHMA 2KZZA 2WU2B 1FXIA 4MH0E 2W7OA 4IWPA 1TVAA 5AM4A 3VDZA 2G9HD 4NQKE 3SDLC 3QX7A 5ALVA 3WKCA 2R61A 2VH1A 4NV0A 1ZQDA 4B9TA 3VVWB 2NRVA 2FMPA 2KOBA 4FADA 2LRWA 3MDAA 5AI8A 1S76D 5D6JB 4MFAA 4EX7A 4Q44A 1YIWA 2NO5A 3SMVA 2UVVA 1TYGB 2ZVOA 2NR2A 2E1FA 2BS3B 3BZKA 3KZIU 4GSWA 4OW0A 2WQYB 3H4DA 1QT9A 2GB1A 2UWQA 3RFZB 2KVCA 3UQBA 3S6JA 1CK1A 1TJEA 5J0UA 4NLBA 3V6EB 1WI0A 2LGDA 3GE3C 3RB4A 1UWMA 2W9BB 4NM2A 4GXJA 3ZDBA 2L0TA 2MJDA 3LVWA 4C4VA 2PMZF 5CTRC 1IIPA 3AE5B 1NK8A 3MGVA 4O3OA 4NAWB 1YN5A 4E0DA 2ZPNA 3U2SC 3SV4A 4LNKA 3H0LB 1EWYC 1T8EA 1PDXA 1NK0A 2M0XA 1TV9A 4I29A 8ICHA 9ICWA 5D49A 3SU8X 1EXNA 2EZZA 1HUOA 1JXEA 5L1JA 1QZEA 2IO1B 3HX0A 3N3KB 2GH1A 2G4DB 4ACOA 1ZGUB 2KVRA 4NAMA 2QARA 3KUCB 2EAOA 4R8UA 4GGQA 1NK7A 1SIJA 2O2VA 2KQ4X 2KICA 3MBYA 4KVGB 2JYEA 3P4RB 8ICMA 4H2AA 3KHGA 1VZ8A 2GOWA 1IBXA 3PZ7A 4S0RA 4RCOA 1SWWA 2KFJA 2I1KA 3AMZA 1C1YB 3CWIA 2N7EA 5FK9C 2DZMA 5DPTA 5E79U 1JWAD 1MQ2A 2QILA 4DHZB 1RYRA 4C8KA 1FRDA 4UB4A 1X9WA 2INNE 3QC8B 1L0YB 5C5JA 1TT5B 2K60A 3OG5A 1ZQQA 4B9NA 1TS4A 5KNIA 3ORYA 4M2YA 4FA6A 4FZMA 4F91B 1WGKA 4WWPA 5AKIA 3BK1A 2AQ4A 2K0PA 5J2RA 2FNJB 5AKGA 2BPSA 3ZXVA 1TAUA 2X8XX 3N20C 3PZPA 2ZZPB 3MR3A 4GB9A 2ZUDA 1ZPSA 2YY6A 4XGAB 3QJZA 3ETLA 3WALA 1RM6C 3DHGC 2KWCA 4LJPB 1V49A 2EMTA 3HILA 4UBCA 3Q6BA 2DLBA 4A6QA 3F2CA 2XY5A 3WK6A 1Q3UA 2EQYA 4DQPA 3PSEB 4AOFA 3H7IA 2VA2A 2E8NA 4DL3A 2OEDA 3AM9A 2RR9A 3ENEA 2AL3A 3QUQA 4WJQA 1WRIA 2DUYA 2K8AA 4A90A 3AE8B 4KIKA 2JGAA 2MWSB 1HIWA 3L10B 3H0MB 5DPRA 3IM1A 5HMMA 2K4IA 3V7JA 4GDLB 4OJOA 2QB0A 7ICPA 2ACZB 1LB2B 1FPYA 4P4PA 3GIKA 1D8LA 2MQJA 1E10A 4II2B 4CF4A 1UNSA 3UPQA 1BNPA 4PL2A 5J2CA 5EWEA 3G6XA 4M01A 1VLBA 3DBLB 1XO0A 3ZW3A 2M9NA 1HJPA 4YCXA 5HR7A 2HTME 4Y2RA 3NY5A 1NZPA 2JRHA 2ZTDA 4F92B 2KZRA 3OSPA 3L17A 4M04A 1N5XA 2V3SA 2R8GA 3EW9A 3OHAA 4KLSA 3N30A 4W9GA 3ZKJC 2KD1A 2MSED 2H88B 2RDGA 4ECYA 4F4ZA 2YMLA 3WIMA 3C28A 3RZFA 3DHIC 3E58A 3T8MA 4F2RA 5HP4A 5KAIU 8ICFA 5TISU 2I38A 5IA7A 4ICVA 2DKZA 3IV6A 5KFTA 2KE7A 2D3BA 3BYYB 4RGTA 2J6UA 3U4EG 1I4GA 2KN4A 2B0CA 2AXTU 3HVZA 4AUQC 2V4IB 2W9MA 2ASLA 4KDLB 4IWQA 3VH3B 8ICCA 3Q8QB 2LHDA 5EE1A 2PFNA 3IRUA 2D3AA 2KOXA 4M47A 4AP9A 1ZQIA 1ZQHA 2KJRA 3IBEA 2WAQF 2GBNA 1B1ZA 2E8OA 2V1YA 2RDIA 3KKAA 2NV3A 2KN7A 4DQRA 1ZUD2 3Q3MC 2JZ3B 3RT3B 3M63B 4N59A 2KTFA 2WB1F 5F3XB 3SENA 4YP3A 3A1QB 1SGHA 3V7KA 3SD5A 5KFXA 1NK6A 2UVUA 4MGKE 1JX4A 1C77A 3N1YC 4IRCA 5AM3A 3RNEC 2XICA 2BGFA 4O1NA 4ANVA 1LGRA 4YXDB 1E0ZA 1S97A 4HAIA 3RH5A 1XSLA 1V9JA 4XWWA 3ML8A 3E9SA 3GIIA 2V4LA 3ZNGC 1C4PA 3BZCA 2K6QA 5AKEA 3VXWA 2IJ0A 2Z0DB 1WWUA 3IFWB 1KRPA 8ICUA 3CP8A 5J0XA 3UXPA 1F0ZA 2WXOA 4HVBA 1L0XB 4ZRPA 2Y1IA 1V9PA 1R4NB 5JRTA 4HRSA 4P1BC 2KZMA 3KUDB 5L1KA 3ZNID 1LVHA 2JXXA 2BWFA 5J2DA 2C7MB 5KG7A 1WCNA 3V60A 4DOBA 4R65A 4MJSA 1HTQA 4I2IA 4KMUA 5IIJA 4I2EA 5L1MA 2G5IB 1QOFA 3SR6A 1X40A 1GPXA 1FCCC 4NM1A 2A1JB 5KAFU 2C5LC 2W82A 2L83A 5KFDA 2ZNVB 1EO6A 5HHHA 1PUZA 1KKXA 3ZVVA 4P4OA 3BIID 4LNFA 2LHEA 3WCQA 1ZDVA 2ASQA 4WWNA 2P66A 1L8OA 3MJWA 1STEA 2KQ7A 1SSNA 3VTWA 4EELA 4YXJA 1SXEA 2VJ5A 1TGZB 1UD7A 1DK3A 2J4XA 4TMAB 4ANUA 1WZ0A 2L32A 2OJWA 1L5UA 4JV1A 2ZTEA 1NKBA 1E8XA 2IY0B 2G06A 2PFOA 5JZEB 2R18A 1KOTA 4UAVA 2GBMA 4HROA 1ZW7A 3TMPB 1FEZA 5KFZA 4NLCA 4FLHA 3CSFA 2E6XA 4KDIC 1N5WA 2HDOA 3NVYA 1T94A 4DSJA 1EWCA 4K81A 1H8CA 2QB1A 3HPOA 3LDZE 3VC8A 4CHKA 1M6YA 2RP5A 2HBJA 2KDFB 1TTNA 3LB8C 2KLCA 4C7ZA 3Q8BA 4ECVA 3I1YA 1S3SG 2PI5A 4CGZA 2HSZA 1F2RC 2L1AA 4N58A 3OJUA 3M9MB 2IBKA 5KTQA 2HBLA 4ECRA 1WGDA 7ICIA 4W9LA 7ICSA 2VA8A 3PY8A 3ZNHB 3ISBA 3BWUD 1TK0A 2W8KA 4GFJA 4DHZE 1O03A 5J2IA 1SE2A 2KD0A 2G0AA 1QF6A 2YB4A 2JT4B 2XIDA 2HHXA 4KZ0A 5L95C 2KLGA 4R64A 2LM1A 1V38A 4J9OA 1SKSA 2F3NA 1WXSA 5J2JA 1TFRA 4O0IA 4PH5A 3H1UA 3IG3A 2MRLA 3AEGB 1XLPA 3C1ZA 4LNNA 4DS5A 1L2NA 9ICOA 5DKWA 4CNQA 2INCC 4M00A 3F5EA 1COOA 4QZ9A 4PGQA 4XUSA 3JPQA 1NJYA 8ICGA 1F52A 2FE9A 2BB6A 9ICVA 4TUPA 4IRKA 4MFCA 3F53A 3B0YA 3H0RB 4DEZA 5JH5C 2EMSA 2FJ6A 5T14A 1R7SA 3C29A 3ZJVA 1YT3A 1M94A 2DFLA 4YR2A 2XNAC 2YEPB 4YSYB 3VRAB 3VR9B 5FR3A 4JV2A 5JXVA 1X9SA 2HDEA 3EGRA 3R2TA 1X9MA 2LASA 4KLQA 1WR6E 3C8YA 1YMHE 2E1EA 3W9CB 4WQOB 1SXDA 3UQ2A 9ICXA 4IKGA 1K51A 2JH1A 2FLNA 9ICPA 2QIEB 5JHBA 4Y2TA 4IM0A 1Y8RC 3QHTA 4KN4A 4HPLB 3PT2B 4KGSA 1WXMA 5J0RA 3MP9A 3JPTA 2M8SA 3K9OB 4ED6A 2Y1JA 4YTMB 5KFEA 4QJFB 4F4KA 2YVCA 2E8MA 3RNCC 2MHJA 4P1CC 3RYTA 1FEHA 4UB8U 2ZW1A 4M9LA 3NRWA 2WGSA 4BVUC 9ICSA 2N0SB 3PHWB 3MGIA 2WX1A 1ZQXA 4PHEA 3NVWA 3TARA 4KZCA 2WHEA 1T4GA 4QZEA 5AK4A 2ZJ8A 5GXGB 1U4BA 3TAQA 4K3CA 3GZFA 1WJUA 1UGMA 2Y9TA 2BQQA 3I3TB 1RRBA 3Q14C 2ODGA 4ELUA 3TIXA 3THVA 1NJXA 1TKEA 2VIXA 4FN2A 3TL5A 4KLTA 1TIFA 2OM6A 2IYDB 3MHSD 1MVKA 2QJLA 2KKVA 1QSSA 2AWTA 5AK5A 1DK2A 4BOZB 4JX1C 4DXGA 1MA7A 1SBBB 3B2GA 5EE0A 3AULA 2PFPA 8ICKA 1VJ5A 1WGHA 2MLBA 4GIVA 2FPLA 3OJ3A 2VH2A 4UW9A 4KGTA 4EZKA 3VUWA 1DYQA 3PRZA 3AXCA 3RFAA 2RMMA 4NJCA 3AEEB 3VTUA 2LWPA 3JPPA 2PI4A 4RF0A 3G6YA 3NZSA 4RPZA 1KL9A 2DENB 1OQRA 1V5OA 4O3SA 1UA0A 2ZVNA 2D3DA 4GDKB 3I57A 5AKJA 4M0WA 4F5RA 5IOIA 3RPFC 2K8BB 4O9MA 3OWEB 3HP6A 4ACFA 1SL2A 4ZOHC 4W9FA 4BFRA 9ICKA 5AKXA 2AYOB 1JXLA 1K8RB 2QEJC 2JF5A 1LV5A 3A4SC 2AJQA 2YMQA 4KLUA 1WFYA 3P1MA 1SL0A 3RMKC 1NEKB 2NTTA 2F2AB 2EZYA 2AGOA 2ONQA 3JYUA 4JMUA 4R63A 1AWDA 3PX4A 2UVWA 3UIOB 3A33B 1SEBD 3X0WA 4Q43A 1ZQYA 3U30A 1B22A 2WXLA 9ICEA 5LXIB 3M62B 3MFGA 4J9QA 4NZLB 1BUIC 2C9WB 4U7CA 4LLGM 4C4SA 1T5XD 3W5VB 2ZIVA 2XY7A 4IQWA 2GBRA 4Y2QA 4B6JA 2WF9A 2HD5B 2FE8A 4I2JA 3OPXA 1T0YA 3ONNA 4GC6A 1T0RC 5C1ZA 2KZ3A 2KV2A 5C0YA 2J0KA 1RDFA 4O3QA 1Z19A 4FFDA 5ALMA 2W9BA 2WU5B 2KDBA 2RD0A 2HJ1A 1UUPA 2J0JA 4MACA 3UIPB 2WF8A 5DG8A 4KLGA 4JV0A 4TUSA 3AE4B 2HTHA 1N61A 3AB5A 5H92C 1TY0A 1WM2A 3KTQA 1T0QC 4C4VB 4BOSC 2HI0A 4YFKA 3OTQA 2O6VB 1MFWA 3C5GA 3V61A 1Z3EB 1QQ5A 1EU3A 2F8LA 2L0FA 3C19A 2WF7A 3PLUA 1ZQCA 1FNWA 1JALA 8ICEA 2DYMA 4KLJA 3AU4A 2FLLA 1QLBB 3TJPA 3Q69A 4OCZA 2SAKA 1VZ7A 3QU4A 4QZIA 2NTSA 3EFUA 1X6IA 4LVSA 2FCSA 3AE3B 2YN4A 3BVGA 3KH0A 3N1XC 5KFFA 3T5HA 1SV0C 2LMRA 3WK5A 2ZEQA 3CNHA 3KFUF 5KFQA 3EPIA 1Z1BA 3NVVA 2D6FC 4RT2A 3QU7A 3DQVA 5F9NA 2RQ5A 2OCEA 5AIBA 5KFWA 2KX0A 3DBRB 1U9LA 1E6EB 2KFKA 3J81j 2XK5A 3D2QA 1C9FA 4O3PA 4NJ8A 2DL0A 4QW9A 5KT4A 3T5KA 2C22A 3RAQA 3BY4B 4KLOA 4I6PA 5AKHA 1ZETA 4C8NA 4E71A 5CHFA 2KWVB 1R4MB 2JEGA 2CS4A 3VFKA 2LPEA 1C7YA 3TEZA 1RFKA 3SI8A 1YJJA 3D32A 2DAFA 4YD2A 1XD3B 3DOWA 3L4PA 3ZO5B 1K1QA 3SYZA 8ICBA 4QWBA 3O13A 1BPYA 3AN1A 3JPOA 4USAA 2JWUA 2DQNB 3IP4B 4ELTA 5BYRA 2KYWA 2NRWA 2ZIVB 1QQ6A 4NAWA 1SZPA 3KQ4A 5L1IA 4LNOA 4A55A 4DQIA 2MAXA 4PGXA 3BQ1A 2G08A 1J7AA 2JZBA 3APCA 1SF0A 1CUKA 2XO7A 5KFAA 1PK1B 2Y5CA 5E6NA 4BAXA 2I5HA 5ALDA 4E3CA 3NZ3A 2WXQA 4U6PA 1UGJA 4MH8A 3KWLA 2HBMA 3QNMA 1CEZA 3F2DA 1AQ6A 3ZRCA 1OXJA 3ISDA 4F5QA 2L05A 3HK0A 3Q3OC 2RLTA 5FP0A 1VRAB 2AL6A 3URYA 2NPTA 1XC9A 4BKSA 1ZQZA 4J9SA 2ZCBA 1SKRA 2GOLA 2QHOA 4C8OA 4KLLA 2CU1A 2MBOA 1P3QU 1T0SC 1WUDA 5DBCA 4LJXA 1OEYJ 3PHXB 4FJYA 1KTQA 4RNNA 2CXYA 1PVRA 3CF6E 4W9IA 1I35A 4DF4A 2BBCA 1HZ6A 4ZRQA 1ZQRA 4KN7A 4KKIA 3EZ5A 2IMWP 1FNUA 1YN4A 3C1YA 5F9LA 4Y2YA 4K4HA 1LQBA 1QQRA 2Y5BB 1PK1A 1I4PA 2LYHA 2K8CA 5AHXA 2QARB 2KNBA 1IXRA 2Q0ZX 1MHXA 2NRZA 2JZPA 1Z4NA 4ED1A 4PYUA 5TR5A 3DDCB 4RNMA 2JX5A 1QKZA 4RQ2A 1NYRA 4F93B 1D5MC 4YD1A 3W5UB 5KFSA 4TQRA 3W2DA 4Y2VA 2KMAA 2KVZA 5AKKA 4M9JA 3N28A 1VR9A 2ZCCA 4ARIA 5DBBA 1YQBA 3KLSX 4IQVA 3UGBB 4RGNA 1HQRD 1RWSA 4TQSA 3SHQA 2WXHA 5DLFA 2L5YA 2HOQA 3FC4A 4M02A 3TADA 2LMCA 4EZ9A 2MEKA 2N9EB 4DSIA 3PRPB 4GOCA 3RUIB 4W9KA 4K7SA 4O5KA 2C2EA 3AU5A 4KSLC 4MJSB 4MSMB 1UPHA 3GILA 2LUEA 1RG6A 2N1RA 4R66A 1E8YA 1YN3A 4YR0A 3NGDA 3KYCD 4JK1A 1EF1A 4UAUA 4WIPA 3GIMA 1ESFA 3TI0A 2KDMA 3FKYA 2P35A 1S8OA 4HPMB 3IT4B 3GZNB 2DKXA 5ALHA 4F1SA 3R3MA 4EBCA 3A9JA 2AX5A 5HR6A 4NPNA 5IILA 9ICQA 4BBNC 1IV8A 5J2HA 2ZIXA 4DK5A 3IG5A 4AQ7A 5BMIA 1SL1A 1QOGA 4CF3A 4J9RA 2Z8LA 2B3AA 2LGYA 1HTOA 3FILB 5J0WA 5GTHU 7ICMA 3PS6A 1J97A 5AK6A 4OD0A 5D46A 3F2BA 4Z6CA 5EWGA 5J2GA 4C0ZA 4WH4A 3GB1A 4CCHA 2QMTA 1LXDA 5KG2A 2FCNA 4ICAA 2H5XA 3TADC 5ALFA 7ICQA 1S0MA 1ET9A 3DPDA 1IBXB 2KK0A 3DCGA 4UAWA 4EKUA 1H38A 3RNGC 3DEEA 1JRPA 2ESEA 2JEIA 4JL9A 4KX6B 5J8YC 2D8CA 4F72A 1JN3A 3E2EA 2I1QA 4GLXA 1WIAA 2BKRB 1WM3A 4G9BA 5BO4B 4BUGA 3BS5B 5EE3A 1GUAB 1NKCA 5KFJA 1OFFA 2WXFA 5ALWA 3N7PD 4P0QA 4MM3B 5KHQA 1SE3A 2MRPA 2MJEA 2HVIA 3WKEA 3GP7A 3HVDA 3ZDDA 4BBNF 1L7OA 9ICCA 2L8JA 2CR5A 4ZRKA 3PZDA 2K8CB 1DRGA 1A77A 4MEXA 3KHRA 3AEAB 4WQMA 1I4RA 3QZ7A 4EEKA 7ICGA 9ICNA 5ALRA 3N97B 2ATLA 2KJ8A 5DQHA 4DSLA 1RPLA 2BYFA 3RBDA 1BPBA 3PR4A 4DQOC 1D5ZC 4K3BA 2ZIXB 5KFBA 1OQQA 1D4BA 5B66U 3M8SA 1ZQMA 2ES6A 4UATA 2K1FA 2A19A 4G3IA 2IO0B 1ZP0B 2BS4B 2BPGA 4QWDA 5DB6A 2CJOA 1UH6A 5AZHA 1SB3C 3DBHI 3UINB 5KFHA 1ENFA 4IC7B 1GOZA 1FM0D 4QZGA 1JWUD 5C23A 4F7ZA 4EENA 5AM0A 3M9OB 2UVRA 3QZ8A 3VUXA 4GDLA 3B9JA 1IM4A 3M6ZA 9ICFA 1E9MA 2XBBC 3RULA 1K5OA 3JW0X 3QEBZ 1Y88A 3JVZX 5KFLA 2H3VA 3M6KA 2BCSA 3H8JA 2OWOA 1V1OA 4I6LB 1NZBA 8ICQA 2WDQB 4RZRA 4RQ3A 1Q0WB 1TAQA 1KDHA 2IO3B 2LGIA 3OJ4B 4ZYSA 5TZVA 3UM9A 1TS2A 2C28A 5IIIA 2BQ3A 4FZNA 3ZTDA 3B1LX 3T79A 5KG6A 1Q8KA 2G07A 9ICTA 3H7PA 4S17A 3ZXRA 2HJ8A 2BWES 4RQ5A 4YXMA 3QE9Y 4I2GA 2Z0EB 2N9KA 3A9KB 4ASWC 2ZIUA 4IG7B 4DFMA 4DCCA 4DBGA 1V5TA 4L2YA 2RDBC 4WJOA 3ZNZB 4BKGA 5ALUA 2RHFA 2CHXA 1PQSA 4N9F4 4M0AA 3C5FA 2QKQA 4NXZA 4C8MA 4NWIA 4NLNA 4IUMB 3GDXA 2DWQA 2CU3A 1ZD2P 1ZXIA 4UB2A 5CRXA 2R8HA 1V97A 4LZDA 4E74A 2KJ9A 5DCNA 4J9MA 2E5SA 4WAFA 8ICZA 3AUOA 1P7EA 2XEWA 2IOFA 4Y2UA 3IXSA 3WANA 2KMDA 4I2HA 2H89B 2K22A 2FIFA 3GQCA 4TURA 1K50A 2M0AA 2XCAA 1QQ7A 7ICKA 1YZ7A 2V9HA 4RH6A 3UI3A 5AKLA 3ETRA 1CRXA 2Y5PA 3MJ5A 3RH4A 1JW9D 1NYQA 2ZUCA 2LVOA 3LYYA 1F44A 3H7PB 1F5SA 3PSPA 1YQ4B 5J2AA 4P6VF 5J17A 2ZXHA 5J0OA 2W43A 4EZJA 4ZRIA 3R9KA 5CX3A 2RDHA 4IQTA 5KFGA 3KHHA 3Q3FA 4K1RB 1DXSA 1L3VA 3AEVA 4ECZA 4CE6A 3PREA 3UMGA 1FXTB 3Q8CA 4YT0B 5IIOA 1NI2A 2BCUA 2K3UA 4O3NA 1WGGA 2FUHB 3T3FA 3Q3JA 5KG5A 2ISOA 2MP2B 3IDWA 2PJHA 3MC9A 1WX8A 4RQNA 4P7IA 3Q8AA 1TS3A 3GV7B 1V80A 2J7QB 5DPWA 4W9EA 1ZQAA 5ALGA 5DLGA 1DGJA 2KVSA 4EYHB 1WYWB 3WKBA 1EUVB 4PL1A 4B9MA 4XX5A 2D10A 2E3TA 4PYZA 1S0VA 3A9JB 2EAMA 1BGXT 4DFJA 3SEBA 3KHLA 5G5HA 8ICIA 1JRUA 4BWJA 4N6EB 1PGBA 2J52A 4KV2A 3UXOA 5HG2A 2W03A 2BZFA 3KD3A 3ZDEA 3RB6A 2LJ5A 2PPHA 3V7LA 2VZKD 4IM2A 4M9HA 4B9KA 1E7VA 4II3B 4URKA 3U52E 3DVNU 3VRBB 2MBQA 1GG3A 5LLIA 4MF2A 2IHMA 1GB4A 2OXOA 2JZBB 5ALSA 4HDOA 2OJRA 1VZ6A 5KFRA 3NS8A 2AGPA 1UZXB 2LGSA 4F8RA 5HI1A 4QZ8A 2BR0A 4OHJA 3MDCA 2DAJA 1WCLA 2ZNVC 3P4PB 3KBBA 5DQGA 4CYEA 3T9LA 2MBHA 5H8YE 3NASA 3C0RB 2R8IA 2KIWA 3PSFA 2GMIC 3PX6A 3ZJUA 1Q5WB 1MG4A 1ZD5A 1X2IA 4C80A 3PX0A 1C4CA 1QILA 1WXVA 2LEKA 4RM9A 1HXYD 4KLDA 1L4DB 1QOAA 4RNOA 3K75D 4I2DA 1IP9A 1SIFA 2LYAA 3CSTA 1R4MI 2RSUA 4OVUA 2XCPA 3ZGZA 4HJGE 4YMOA 3AQEA 1X6JA 4J03A 3HKZC 2PKOA 2O6KA 3NRZA 1S10A 3RJEA 3RJIA 2RGFA 3PTFC 2CRXA 4NL9A 4KITB 1NJWA 2V9WA 5GMVA 5J0YA 2V3PA 4XQ8A 5EDSA 2MSNA 4A8EA 1X66A 3VHTC 2WTFA 3D2NA 3DVNV 5J8YA 4OO1J 2E8PA 2WXJA 7ICTA 4IWOA 2W3SA 1V81A 4W9JA 2JRZA 5IIMA 2FCQA 3NHEB 4GDKA 2F77X 4JUZA 4ZRJA 1TAMA 3Q8EA 3QUTA 4MEYA 2BQRA 2MP2A 2KJ6A 2Y0SC 2JV3A 1Z00B 2JXTA 4UARA 3V05A 2BW2A 1RXVA 2WDVB 3ZDAA 2NRXA 1N63A 5ALKA 2W54A 1U48A 8ICJA 2GI9A 4EEYA 1L7YA 3BK2A 3PVLA 4XDDA 4EFOA 5LNK1 2R8KA 2HHTA 5C3JB 3PLVA 5BYQA 4OZCA 4DFPA 2PLPA 3BS5A 4DS4A 2N9PC 1U4AA 1L6NA 3EECA 4RQ7A 4A8XC 3GV8B 1QH9A 2PE6B 3W1YA 1J7CA 1MPEA 3C2MA 5J0SA 2L7RA 3PMLA 1RLFA 3L16A 5AKZA 1KN5A 4PS7A 3QQ8B 4XZ4A 4NJ6A 4ED0A 3Q3NC 5CP2A 1QTMA 4RU9A 4QZHA 5DPSA 1BPXA 1RAXA 4CQNA 1WRDB 3R2IA 4YSXB 2R8JA 2HHUA 2W7PA 2LD9A 2XN9C 3QX1A 1RZTA 3UMCA 1NI3A 1P98A 1J2NA 2CN1A 2KN5A 1WY8A 2IGDA 2WXKA 1B0XA 1KLGD 1ZQLA 3FILA 3IVFA 4ZYNA 1HEZE 1P9DU 1KM7A 4DXAB 2LYBA 4ECWA 3WA0A 5E6PA 1C78A 5A0LA 4K7UA 4NJ7A 5DB7A 5JU5A 1CJEA 1WX9A 4I6NB 2K6DB 1LKYB 5G5GA 3PVXA 1TK5A 1Q3VA 1XLOA 4P2HA 5L1LA 2QLTA 2BYTA 5KT7A 1K53A 2W9CA 1ZQOA 3PPAA 5HNKA 1JCKB 2DF4B 1L3TA 8ICPA 2WAQC 1JWBD 7ICUA 4XRHA 3SAGA 3MHZA 5CHVC 4G0NB 3SAFA 4XDCA 4GLSC 4DHJD 2KFZA 3AL0B 2M17A 2B76B 5G2NA 4NY0A 5TSSA 2DZJA 3WK4A 3KOOA 4UAZA 2NBVB 5G55A 1TK8A 4GIBA 2C2RA 3AU6A 2KDIA 8ICRA 1CQVA 1ZD4A 2Y3AA 5BMGA 4DWFA 5BYSA 3L5KA 1COKA 1OEYA 3TFRA 5KFKA 1XSPA 2MBBB 7ICRA 4TV3A 3SV3A 4O5CA 1EU4A 2J6SA 3BQ2A 2I9GA 5ALZA 2LHTA 3W1SA 5KFIA 4WJ3B 1Z2MA 1ROEA 4F8CB 5ALLA 2HOIA 2R2OA 5HKHA 3ISCA 3V6HA 5ALEA 3TEYA 5KG4A 2GRIA 4PJ0U 2XVTA 4RUAA 4EZ6A 3RR8A 3MABA 1P7DA 3UQAA 1KLVA 4TUQA 1KFDA 2W9CB 4L23A 4J9KA 2YMMA 5LXHA 4IL6U 3NUHB 2N9LA 3PV8A 8ICAA 9ICUA 3RTVA 5AIAA 3CRXA 4J9PA 2LZ6A 2B6GA
chains in the Genus database with same CATH topology
1RWSA 2WXHA 1SJHD 3FC4A 4JPSA 2LMCA 2I38A 3NVZA 1I4QA 3P63A 2MEKA 1TKYA 3R8BA 4YSZB 4US9A 2N7JA 3BYYB 4RGTA 3U4EG 1I4GA 2KN4A 5EE9A 3AV8A 1Y56A 2JQRB 1SXTA 3HVZA 1LO5D 2G1EA 2FBWB 2V4IB 3ZJTA 1YN3A 4WIPA 3MC0B 1ESFA 2KDMA 2LHDA 3B2FA 5EE1A 3IT4B 3CIRB 1TKGA 2AX5A 1SE4A 1B1ZA 3E56A 3GS2A 1K52A 1YQ3B 2MJ3A 4AQ7A 1ZUD2 3ABVB 5BMIA 1QOGA 2Z8LA 1I7HA 4N59A 4ZHOA 4OZAA 3FILB 3I9V1 1I4HA 2PW9A 1C77A 4WH4A 4YTPB 3GB1A 4J3OD 1V1PA 2QMTA 2J42A 3LXFA 1XEEA 4O1NA 4YXDB 1E0ZA 1IBXB 4IDIA 1ET9A 2OHFA 3AEFB 4XWWA 1DOIA 2WNMA 5MPOA 1DOYA 3E9SA 1JRPA 3AH7A 4RF1A 4KX6B 1C4PA 4HEA1 1NVID 1AN8A 2IJ0A 4REZA 4ITKA 1ACCA 1WXQA 1KF6B 1C4AA 4OZBA 1F0ZA 2WXOA 5EE3A 1L0XB 1OFFA 4XE0A 4ZRPA 2WXFA 4YTNB 4Q2JA 1M4VA 4HRSA 2AQ2B 4MM3B 2RPVA 2D5GA 1SE3A 2MJEA 2WDRB 3GP7A 3T3OA 1AW7A 3HVDA 1WYGA 4RNAA 1VJKA 1YJIA 3Q8FA 1P7FA 1BXTA 1QOFA 2Q5WD 3SR6A 1FO4A 2TSSA 1GPXA 3AEAB 1FCCC 2KACA 1I4RA 2L83A 2W82A 4WQMA 3BIID 4R3DA 4MT5A 2LHEA 3WCQA 1ZDVA 2WXRA 3J9CA 3AE6B 3IT6B 1HA5A 4DQOC 1D5ZC 4A9AA 1XCTL 1OQQA 1STEA 4DXFA 1D4BA 5C2TB 1SSNA 1C79A 1NENB 2LJIA 1PYWD 2J4XA 4TMAB 2K9XA 1ZP0B 2PIAA 2BS4B 2L32A 1AYFA 2CJOA 3BVMA 1TS5A 1SB3C 2ICIA 2KAJA 1JQ4A 1JWSD 1FD6A 1FRRA 1ENFA 4FXCA 5HHDG 3P4QB 1GOZA 1FM0D 1JWUD 2LUMA 4HROA 1TZOA 2IPKD 1PGAA 3PO0A 2E6XA 1N5WA 3B9JA 1E9MA 3NVYA 1EWCA 2M56B 2FUG1 1BMLC 2J53A 2SEBD 1T3QA 4P16A 1RYJA 1F77A 3LB8C 1V1OA 3TSSA 4C7ZA 3Q8BA 1V8CA 1YNTE 2WDQB 2LGIA 4ZYSA 1E7PB 1F2RC 1TS2A 2L1AA 4N58A 1FMAD 3NS1A 2PVOD 4US8A 1ZE3D 1MI0A 3AEDB 3BWUD 1L4ZB 2V3NA 2N9KA 1SE2A 1QF6A 2INPE 2WLBA 5AUIA 4L2YA 2BT6A 5FKAC 2BB5A 4WWMA 1GB1A 3HRDD 1PUTA 2V0GA 3AEGB 3DWMA 1ET6A 1XLPA 2DWQA 2CU3A 1ZXIA 1V97A 3AE7B 1XXGA 2EELA 4WAFA 2BB6A 4C7YA 1FXAA 1L5PA 1P7EA 3SFEB 3EA6A 4RGMA 1R7SA 2WXMA 3ZJVA 4HKQA 3IXSA 2H89B 2K22A 2XNAC 3VRAB 4YSYB 3VR9B 2YEPB 5FR3A 1K50A 2M0AA 4JWUC 4L1BA 5JXVA 1N62A 1XCQL 2HDEA 3EGRA 3R2TA 2M19A 4RH6A 1XO3A 5D3IB 3UI3A 1SJED 2I2YA 3ETRA 1YMHE 2WXNA 2Y5PA 3C8YA 1JW9D 1NYQA 3LYYA 3MJ5A 3TUOA 3W9CB 4B0MA 4IKGA 4YWGG 1K51A 2QIEB 3PZ8A 1YQ4B 4P6VF 3P42A 3BVZA 1F2RI 1L6UA 4TQ0A 2RDHA 4KGSA 1B9RA 3MP9A 1IUEA 2NMQA 5E6JA 2DYOA 1IGDA 4YTMB 1QOBA 1JWMD 3Q8CA 3AE2B 4YT0B 3ZYYX 1KTKA 2K3UA 1FEHA 2ZW1A 3TEWA 3N9YC 3SFDB 4LK0M 2PMVA 1PGXA 2PVGC 4WURA 3BZDB 1D5XC 1KH0A 2N0SB 1JMLA 2JU6X 5D3DA 3NVWA 3Q8AA 3EUB2 1TS3A 2WS3B 1MHHE 2DBYA 4HKZE 1IGCA 5GXGB 1DGJA 3P4SB 1ZXHA 4OVZA 1PFDA 4PT5A 2E3TA 5T8IA 1FFVA 1Q10A 3SEBA 1L6VA 3VQIA 1TKEA 5G5HA 4N6EB 1PGBA 3ZQ4A 5I4DA 2J52A 1TY2A 2WXGA 1MVKA 2QJLA 5HG2A 2MH7A 1ZDXA 4JX1C 4DXGA 1SBBB 3B2GA 5EE0A 2VZKD 2QSDA 2CJNA 1FFUA 3U52E 4RGOS 3VRBB 2BTEA 4KGTA 1FIQA 1GB4A 1DYQA 3FAHA 2VZKB 2IDYA 1FCLA 2RMMA 4NJCA 3AEEB 1VZ6A 1V1PB 4RF0A 5HFYA 2WXIA 4TQ1A 5AUKA 5HI1A 1OQRA 2EKIA 4GDKB 4OHJA 2AQ1B 3P4PB 2IGGA 3I57A 4M0WA 5H8YE 3RPFC 3OWEB 4ZOHC 4B0EA 2QEJC 3ZJUA 4RFBA 4C80A 1A70A 1C4CA 1QILA 2LEKA 4LTUA 1HXYD 2YEPF 2W3RA 1L4DB 1QOAA 3P1MA 1NEKB 2NTTA 2ONQA 1AWDA 4EE2A 5D7GA 1SEBD 2WU2B 1FXIA 3AECB 1VDVA 3U7ZA 2G9HD 3ZGZA 2BS2B 4HJGE 4C56C 2WXLA 1N60A 3MFGA 2PKOA 4NZLB 1BUIC 3NRZA 4LLGM 2R61A 1T5XD 3W5VB 3BYTB 2V3PA 2JSVX 2FE8A 2X38A 2KWDA 1TYGB 2WXJA 2W3SA 2BS3B 1FNVA 3AE1B 3IAM1 2WQYB 2WU5B 3AEBB 4OW0A 1QT9A 2GB1A 1T6BX 3RFZB 1UUPA 1CK1A 1TJEA 4MACA 4ZHPA 3Q8EA 3AE4B 3AB5A 1N61A 1UWMA 1KFYB 1TY0A 5H92C 4JE3B 2JXTA 3V05A 2L52A 2BW2A 2WDVB 1ZOYB 4ARCA 1XLQA 1N63A 4XDDA 2W54A 2MJDA 2GI9A 3BK2A 5LNK1 1EU3A 3AE5B 3VR8B 3KWVA 4NAWB 1FNWA 5C3JB 1JALA 1YN5A 4JWSC 2PTLA 2DYMA 5BYQA 4OZCA 3U2SC 1QLBB 2PLPA 2IGHA 4D2KA 3Q69A 1EWYC 1PDXA 2SAKA 1VZ7A 4A8XC 2NTSA 1J7CA 3H8HA 1MPEA 3AE3B 3BVGA 3TEXA 2LFIA 1GAQB 2ON8A 2W55A 4NAMA 3NVVA 1WSPA 1XF5L 4KGRA 1SIJA 3T3NA 2KQ4X 2K5PA 2JYEA 2JYTA 3P4RB 4H2AA 1E6EB 4CQNA 2KMMA 3R2IA 1VZ8A 1C9FA 4YSXB 1XLNA 3V3XA 3PZ7A 1IBXA 2XN9C 4RCOA 4TSSA 1NI3A 3CWIA 3AMZA 5FK9C 3FILA 2IGDA 2WXKA 1KLGD 1JWAD 2QILA 1HEZE 3TEZA 1FRDA 1RFKA 2INNE 1YJJA 1C78A 1L0YB 3L4PA 3O13A 3AN1A 2AQ3B 4USAA 1CJEA 1TS4A 2JWUA 3HUIA 2ZW0A 5BYRA 1D6EC 5G5GA 4XWTA 1WGKA 3KQ4A 1XLOA 3BK1A 4A55A 3IAS1 2K0PA 2BYTA 1J7AA 1K53A 1JCKB 1SF0A 1JWBD 2Y5CA 3AE9B 3DWGC 3MHZA 1I4XA 4XDCA 2WXPA 1ZPSA 1EM7A 3NZ3A 1KLUD 4GLSC 2WXQA 1DOXA 4MH8A 1RM6C 1UGJA 3KWLA 2B76B 4IOIE 2WP9B 4KKJA 5TSSA 2DLBA 4A6QA 1VRAB 3URYA 2OEDA 1JROA 3AM9A 1KRHA 1CQVA 2Y3AA 5BMGA 5BYSA 1CZPA 4AS1A 1WRIA 4A90A 3AE8B 1C76A 1HZ5A 1UWXA 2BBCA 1HZ6A 4ZRQA 1EU4A 4KKIA 4GDLB 1FNUA 1YN4A 1L0VB 2ACZB 3W1SA 1J7BA 1ROEA 1QQRA 1I4PA 1E10A 1UNSA 3TEYA 2JZPA 1MHXA 1VLBA 2GRIA 2HTME 2JX5A 1QKZA 4L23A 5BMHA 1NYRA 1D5MC 1N5XA 3W5UB 3NUHB 3W2DA 1WWTA 2N9LA 1VR9A 2H88B 2RDGA 4ARIA 3KLSX 4UDUC 4RGNA 1HQRD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FRR A;  1RWS A;  5GXG B;  1DGJ A;  3P4S B;  4FXC A;  3P4Q B;  1QLB B;  1FM0 D;  4HRO A;  1EWY C;  3FC4 A;  1PDX A;  1PFD A;  3PO0 A;  2E3T A;  3NVZ A;  1FFV A;  1J7C A;  3P63 A;  1N5W A;  3B9J A;  1E9M A;  3NVY A;  1TKY A;  3AE3 B;  1L6V A;  4US9 A;  1TKE A;  4YSZ B;  2M56 B;  1GAQ B;  5G5H A;  4N6E B;  2W55 A;  5EE9 A;  3AV8 A;  2JQR B;  3HVZ A;  2QJL A;  2G1E A;  3NVV A;  1T3Q A;  2FBW B;  2MH7 A;  1SIJ A;  1RYJ A;  4JX1 C;  3LB8 C;  2K5P A;  3B2G A;  5EE0 A;  3P4R B;  4C7Z A;  1E6E B;  2KMM A;  1V8C A;  3B2F A;  2WDQ B;  5EE1 A;  4YSX B;  2CJN A;  1FFU A;  1XLN A;  1E7P B;  3VRB B;  3CIR B;  1TKG A;  4N58 A;  1FIQ A;  1NI3 A;  2AX5 A;  3AMZ A;  3CWI A;  1FMA D;  3FAH A;  1JWA D;  3NS1 A;  1FRD A;  4US8 A;  1YQ3 B;  2PVO D;  1RFK A;  3AEE B;  1YJJ A;  2MJ3 A;  1ZUD 2;  3ABV B;  3AED B;  1QOG A;  1I7H A;  4N59 A;  4ZHO A;  3L4P A;  5AUK A;  1OQR A;  3AN1 A;  2EKI A;  4USA A;  1CJE A;  3HUI A;  1QF6 A;  2WLB A;  4YTP B;  5AUI A;  3P4P B;  5G5G A;  5H8Y E;  3LXF A;  4YXD B;  1WGK A;  2BT6 A;  3RPF C;  1E0Z A;  1XLO A;  4IDI A;  2OHF A;  3AEF B;  4WWM A;  1DOI A;  1J7A A;  4ZOH C;  3HRD D;  5MPO A;  1PUT A;  1DOY A;  1SF0 A;  3AEG B;  3DWM A;  1JRP A;  3AH7 A;  1XLP A;  2DWQ A;  4KX6 B;  1JWB D;  2Y5C A;  4C80 A;  2CU3 A;  1A70 A;  1ZXI A;  2LEK A;  3AE9 B;  3DWG C;  1V97 A;  1NVI D;  4LTU A;  3AE7 B;  2W3R A;  1QOA A;  4ITK A;  1WXQ A;  1KF6 B;  3P1M A;  1DOX A;  1RM6 C;  1NEK B;  3KWL A;  4C7Y A;  2B76 B;  1FXA A;  1L5P A;  2WP9 B;  1AWD A;  3SFE B;  1F0Z A;  5EE3 A;  1OFF A;  1R7S A;  2WU2 B;  1FXI A;  3AEC B;  1VDV A;  4YTN B;  2H89 B;  2K22 A;  3VRA B;  4YSY B;  3VR9 B;  4HRS A;  2BS2 B;  1JRO A;  3AM9 A;  1N60 A;  4JWU C;  1KRH A;  1N62 A;  2MJE A;  1CZP A;  2M19 A;  2PKO A;  3NRZ A;  2WDR B;  1WRI A;  1XO3 A;  1WYG A;  3ETR A;  3AE8 B;  3W5V B;  1JW9 D;  1NYQ A;  1VJK A;  1YJI A;  3W9C B;  2QIE B;  1YQ4 B;  4P6V F;  1QOF A;  2Q5W D;  3SR6 A;  1FO4 A;  1GPX A;  1TYG B;  3AEA B;  1L0V B;  2ACZ B;  1L6U A;  4WQM A;  2W3S A;  2BS3 B;  2L83 A;  1J7B A;  1ROE A;  1B9R A;  3AE1 B;  2WQY B;  2WU5 B;  3AEB B;  3BII D;  1QT9 A;  1IUE A;  1E10 A;  1TJE A;  3WCQ A;  4ZHP A;  4YTM B;  3AE6 B;  1QOB A;  1VLB A;  3AE4 B;  3AB5 A;  1N61 A;  1UWM A;  1KFY B;  3AE2 B;  4YT0 B;  1OQQ A;  2HTM E;  2JX5 A;  5H92 C;  5C2T B;  4A9A A;  3ZYY X;  2L52 A;  1NEN B;  1NYR A;  2WDV B;  1ZOY B;  1N5X A;  3SFD B;  1XLQ A;  3W5U B;  1N63 A;  2PVG C;  2W54 A;  2MJD A;  1WWT A;  2K9X A;  1ZP0 B;  2N0S B;  2BS4 B;  2PIA A;  3NVW A;  1AYF A;  3AE5 B;  2CJO A;  2H88 B;  3EUB 2;  3VR8 B;  2WS3 B;  1SB3 C;  2DBY A;  1JAL A;  2KAJ A;  4JWS C;  5C3J B;  1JQ4 A; 
#chains in the Genus database with same CATH topology
 3RBE A;  4M6W B;  5CA7 A;  3TBL D;  5DDY A;  2DGZ A;  2MUT A;  1Z4O A;  1UBI A;  4JPS A;  2FI1 A;  3APF A;  3P63 A;  1JMS A;  5J2K A;  4YSZ B;  2KJH B;  4US9 A;  2JMG A;  3L3F X;  5ALY A;  2IA6 A;  2MU2 A;  2N7J A;  2KMC A;  4JB3 A;  1D9D A;  5EE9 A;  2HBK A;  2KT7 A;  4G50 A;  1LM8 B;  3W1S C;  1SXT A;  1LO5 D;  4KIK B;  2FBW B;  3ZJT A;  4HJK A;  4B6W A;  3PRM B;  2N9X A;  1MN8 A;  4IW0 A;  3MC0 B;  1P0R A;  3HKZ F;  5DGA A;  3T5L A;  8ICS A;  5KHO A;  3CIR B;  1TKG A;  1YX6 B;  1DGS A;  1SE4 A;  2F8K A;  9ICH A;  3OHB A;  3E56 A;  3M3J A;  5EOZ A;  4J9L A;  2MJ3 A;  2V4Q A;  4ZHO A;  3I9V 1;  2VRR B;  4DHJ B;  1ZQT A;  3K9P B;  2NVU I;  3EPG A;  4UB1 A;  1V1P A;  2LI6 A;  2GBJ A;  3RB3 A;  3LXF A;  1XEE A;  4FUL A;  1YJ1 A;  5EWF A;  4EZL A;  3GZN I;  3AEF B;  2FMS A;  4UAY A;  4Y2S A;  2WNM A;  3CMM B;  5D4B A;  4XA5 A;  1NKE A;  1ZQV A;  2CPR A;  3HM6 X;  3B0X A;  5KFC A;  1NK4 A;  4A3O A;  1A0P A;  2PMZ C;  4J9N A;  1L7N A;  3U7D A;  1NVI D;  1ZRN A;  4DSK A;  1XNS A;  4ITK A;  4B9L A;  3LYS A;  4UAS A;  4NLG A;  4FS1 A;  1ACC A;  1WXQ A;  2H3F A;  1UF0 A;  3LJ3 A;  2DZI A;  3JSV A;  5AKY A;  4B9V A;  2EAP A;  4LJO B;  7ICJ A;  4QNL A;  3RJH A;  1V86 A;  3PW5 A;  2HE7 A;  4J6I A;  3WK8 A;  2RPV A;  2D5G A;  4QZF A;  1SV4 A;  2M0N A;  4DL4 A;  2C7H A;  2WDR B;  3Q8K A;  1CI4 A;  3T3O A;  5KFP A;  4HLE A;  1AW7 A;  4Y2X A;  5IAA C;  2QB0 B;  8ICL A;  4HXD A;  3DV9 A;  4RNA A;  4GXK A;  4RPX A;  2BYV E;  3Q8F A;  1P7F A;  4IC9 A;  2ZJ5 A;  4QZC A;  2Q5W D;  1FO4 A;  2TSS A;  5IP4 D;  3WU2 U;  2HCF A;  2ASD A;  3Q8L A;  2ZXI A;  3QA8 A;  4DQS A;  3AQF A;  4HK2 A;  3ZDT A;  2BHN A;  2W8L A;  1WMH A;  5B5E U;  2JEJ A;  3VH4 B;  5BOM A;  3J9C A;  2WXR A;  3EC8 A;  3I63 C;  3M95 A;  4B9U A;  4ECQ A;  3QUC A;  4A9A A;  1XSN A;  1NJZ A;  1XCT L;  4DXF A;  1ZQP A;  3EFC A;  2NS5 A;  2XI9 A;  1E8W A;  2LJI A;  3HWT A;  1YX5 B;  4HPP A;  1TKD A;  1PK3 A;  1PZN A;  1RXW A;  3L08 A;  1AYF A;  1RFA A;  3L13 A;  3TKA A;  1TS5 A;  2KAJ A;  2J6T A;  1OUQ A;  4IRD A;  1JWS D;  1FD6 A;  2H3I A;  1FRR A;  3KUZ A;  4AP4 C;  2A4Z A;  4FXC A;  1NOM A;  3P4Q B;  1IG6 A;  5ALP A;  2A5U A;  2LUM A;  1TZO A;  4JQW C;  4RQ0 A;  1PGA A;  5J0T A;  2DNF A;  3M7D A;  4NY8 A;  2D3C A;  2LVQ A;  3HW8 A;  2LRU A;  2WYQ A;  2AH5 A;  2M56 B;  1J19 A;  4MSQ B;  4FHK A;  1UHU A;  4JWM A;  2YQE A;  4OJL A;  3SAH A;  4DL5 A;  3PNC A;  1BML C;  2CHZ A;  2KWU B;  1YD8 U;  1SGG A;  2J53 A;  2SEB D;  2HHW A;  1QSL A;  2Y0S F;  1L3S A;  3IG8 A;  5ALN A;  2RDJ A;  1O08 A;  2ZIW A;  4QWA A;  1YNT E;  4KSK C;  2I1J A;  1DOQ A;  2QC8 A;  1E7P B;  4P0P A;  4KLF A;  4BWM A;  1JIH A;  1URJ A;  4LNI A;  3IHQ B;  4WJP A;  1UBQ A;  2HHV A;  3MR5 A;  4IQU A;  2KHW B;  3QUB A;  3V6J A;  3PO4 A;  1ZE3 D;  2IO2 B;  3OLM D;  1MI0 A;  4AJY B;  5L9X A;  4DQQ A;  2XC9 A;  4ECS A;  2GBK A;  3R7R A;  2I6X A;  2FDR A;  1ED1 A;  3BJY A;  3QXG A;  2INP E;  2KXJ A;  5D2M B;  3H40 A;  2WLB A;  1NDD A;  2BPC A;  4F5N A;  3A1Q A;  3DVG Y;  4I27 A;  3EHV A;  4C4R A;  5FKA C;  2BCV A;  2BB5 A;  2KC1 A;  4DL6 A;  1H4R A;  3HRD D;  4DL2 A;  1RQN A;  2W04 A;  2V0G A;  2F1H A;  3DWM A;  1V2Y A;  1ET6 A;  2H3Q A;  4AWJ A;  4RUC A;  4GMV A;  3N7S C;  4PZN A;  5CWR A;  2EAN A;  3QEA Z;  1XXG A;  4FE3 A;  2EEL A;  2D3G A;  2AQ0 A;  3RRH A;  5KL1 B;  3Q2A C;  2OOB B;  5C2T B;  3DDH A;  3RCZ A;  4PS8 A;  1FXA A;  2G5H B;  1L5P A;  2FAZ A;  2JRI B;  3SFE B;  3TQ1 A;  1UCV A;  4OJ5 A;  1YZ6 A;  3IAM 1;  1WG8 A;  4FHJ A;  4ANX A;  5DBA A;  1C3T A;  4ED8 A;  4L1B A;  2L76 A;  1XQQ A;  1N62 A;  3QU2 A;  1XCQ L;  3B08 A;  4JWN A;  2KC2 A;  3RJJ A;  2WXN A;  1LKY A;  3TUO A;  2JVC A;  2K8H A;  1OW5 A;  4YWG G;  5AI5 A;  3TAN A;  1Q1O A;  3BVZ A;  2QDF A;  9ICR A;  1ZQN A;  5GTI U;  4I2B A;  1WJ4 A;  1B9R A;  8ICY A;  1IUE A;  1ISN A;  2NMQ A;  5E6J A;  2DYO A;  2KFN A;  3ALB A;  1BVS A;  1OTR B;  4AYB C;  2JUO A;  2BKE A;  2RRD A;  1OQY A;  1TE2 A;  3G6V A;  1VCB A;  9ICM A;  2XGP A;  2WB1 C;  1WE7 A;  3BIN A;  3I5J C;  4BX9 C;  3TEW A;  1X9X A;  2PVG C;  4YMN A;  7ICO A;  2ZPY A;  1D5X C;  3BZD B;  1KH0 A;  4BDP A;  4PS3 A;  4WUR A;  4PHD A;  3GU3 A;  1JML A;  3S2A A;  4QWC A;  3ICX A;  4A20 A;  3H9D A;  4QZB A;  4PPX A;  1G6J A;  1MHH E;  2DBY A;  3WK9 A;  2BKF A;  2O2V B;  5DG7 A;  1WJN A;  1IGC A;  4MGY E;  3O0F A;  3P4S B;  2JEF A;  1XS9 D;  3RAX A;  4I28 A;  8ICV A;  1ZXH A;  3OAW A;  1BPZ A;  3ECI A;  4DFD A;  4QZD A;  2A3V A;  3A4R A;  3ZDC A;  4PT5 A;  3ZIM A;  5T8I A;  2WHI A;  5AI9 A;  1F1H A;  3BS7 A;  4MEL A;  5IKC M;  4DLE A;  2KP7 A;  4UB3 A;  3BQ0 A;  1L6V A;  3APD A;  5CHW A;  3ZQ4 A;  3WK7 A;  3Q8S B;  4K7W A;  1RQL A;  3E0F A;  2D11 A;  4I2C A;  2IY1 B;  9ICI A;  3ZI4 A;  5AI0 A;  2G3Q B;  7ICE A;  1ZDX A;  1KW4 A;  3JPS A;  2F76 X;  9ICB A;  2G45 B;  3V6K A;  5KG0 A;  3TCA A;  2VKQ A;  1MG8 A;  4O3M A;  1FFU A;  1MC8 A;  4RGO S;  2HHQ A;  1C20 A;  4RQM A;  1FIQ A;  1BPD A;  4DDG D;  5J29 A;  2KFK B;  3FAH A;  4W9H A;  4AYB F;  1FCL A;  5DDM A;  8ICN A;  3C21 A;  3VAW A;  2GLE A;  3H7S A;  5HFY A;  5KG1 A;  2WXI A;  2DPJ A;  1V6E A;  2MUT B;  4LDT D;  4EUT A;  4GXB A;  2EKI A;  3WAP A;  3CYM A;  2AQ1 B;  3BDP A;  2IGG A;  2KK8 A;  3RZW C;  4QZA A;  4F4W A;  2M1M A;  4G11 A;  2EH9 A;  3RJF A;  3PW0 A;  5HML A;  4P0P B;  2KTR A;  2C60 A;  1ZQG A;  3FYH A;  4EBE A;  1NK5 A;  2ZTC A;  4Z6D A;  1GC6 A;  3HM3 A;  5KT5 A;  5BPC A;  1HE8 A;  1A70 A;  3MFH A;  4FS2 A;  9ICG A;  4FJZ A;  2KO3 A;  2O6V A;  1T7P A;  5KT2 A;  2B21 A;  1VDV A;  5DQI A;  1NBF C;  2NBU A;  3T5J A;  3AEC B;  4RPY A;  3DBS A;  3U7Z A;  2HW3 A;  3PW4 A;  4XC2 A;  2BS2 B;  4M9N A;  4C56 C;  1N60 A;  1U47 A;  4BKS D;  3C23 A;  2BCR A;  3PW2 A;  4M9G A;  4OJ6 A;  4FBU A;  2KJ5 A;  3BYT B;  3VUY A;  2AGQ A;  2G4S A;  3H4B A;  1JI7 A;  2JSV X;  3QCA A;  1YOV B;  2BDU A;  1ZQ1 C;  2ISP A;  2X38 A;  2AEH A;  2KWD A;  2JPH A;  1WWV A;  3H6N A;  4Y2J A;  5KG3 A;  3ZUN A;  5DG9 A;  1ZJN A;  3QAQ A;  4RMA A;  3ZTC A;  3PW7 A;  3M8R A;  4DOC A;  3BQT A;  1ZQK A;  1S77 D;  1FNV A;  1Z00 A;  5CEH A;  3AE1 B;  1ZQJ A;  3AEB B;  2FPK A;  1ZJM A;  1T6B X;  3SZ2 A;  4JGH B;  2W9A A;  4ZHP A;  3PO5 A;  5IO9 A;  1KFY B;  1PVQ A;  1LFD A;  4JE3 B;  5KFY A;  1WX7 A;  2L52 A;  4A3P A;  3U26 A;  1ZOY B;  4ARC A;  3JPR A;  1XLQ A;  4KX5 A;  3OJS A;  1S5L U;  1L7P A;  3F5A A;  1L7M A;  1RYU A;  3VR8 B;  3KWV A;  2O6V D;  3RB0 A;  2OEH A;  2PE9 A;  4JWS C;  2FCM A;  2PTL A;  4PGY A;  2KTR B;  5HHI A;  3JSV B;  2FPM A;  4ECU A;  4B95 A;  3QIJ A;  2IGH A;  2JHD A;  4D2K A;  4GC7 A;  2KHQ A;  4F5O A;  3GFK B;  4Z6E A;  5JHA A;  3H8H A;  9ICJ A;  3TEX A;  4O5E A;  2LFI A;  1JUD A;  4DL7 A;  2A1A A;  1IPG A;  5JUM A;  4CDG A;  1UQV A;  1GAQ B;  2ON8 A;  2W55 A;  2RPQ A;  2ZJD A;  1N48 A;  1WSP A;  4DFK A;  1XU4 A;  3JPN A;  1XF5 L;  1E90 A;  4KGR A;  1CMX B;  3T3N A;  1EF5 A;  2K5P A;  4DOA A;  2JYT A;  3Q8P B;  2KMM A;  2LBO A;  2OH2 A;  4Q8F A;  3EYZ A;  4EBD A;  2WWZ A;  1XLN A;  4BXO B;  3RRG A;  4RM8 A;  3KZX A;  3V3X A;  3N32 A;  4TSS A;  3ZRF A;  4B9S A;  4PK1 A;  1TZ1 A;  4F2S A;  3UQ0 A;  3PGE A;  3C2L A;  4KLH A;  4YR3 A;  1U45 A;  8ICX A;  5KFM A;  3R66 C;  2AHO B;  2JWZ A;  4K4I A;  2REX A;  3KYD D;  4KMO B;  2DPI A;  3SQI A;  3EWA A;  5K4L A;  2AQ3 B;  1F0M A;  3HUI A;  1A5R A;  4Z6F A;  1ZQE A;  2Z59 B;  1SZH A;  3RF9 A;  1WH3 A;  2WX0 A;  2ZW0 A;  1QCK A;  1ZKH A;  1D6E C;  7ICV A;  4XWT A;  2IZV B;  4EX6 A;  4RQ8 A;  7ICF A;  3ONS A;  4HWI B;  5KFV A;  3IAS 1;  4DSF A;  4MGZ E;  3O65 B;  4LZG A;  5CB1 A;  3MTN B;  3K1R B;  4QIW F;  5KFO A;  3AE9 B;  3DWG C;  4UBB A;  1I4X A;  2WXP A;  1E5W A;  1EM7 A;  4IR1 A;  1KLU D;  1DOX A;  5KFU A;  5AM1 A;  5DB8 A;  3RNB C;  1E7U A;  4IOI E;  2WP9 B;  4KKJ A;  4MFF A;  1Z5S B;  1BNO A;  4TUU A;  3RJK A;  3V6C B;  1N56 A;  2YTU A;  2ZIW B;  2WF5 A;  4RQ6 A;  2AU0 A;  1JRO A;  2ALZ A;  1ZYQ A;  2UYZ B;  1X1M A;  1ZRM A;  1GJZ A;  1KRH A;  2XGQ A;  4FBJ B;  1CZP A;  4NL9 C;  3DBH B;  1E8Z A;  1NNL A;  3ALR A;  4AS1 A;  2EDU A;  2C7N B;  4CF5 A;  1C76 A;  1HZ5 A;  4ELV A;  1UWX A;  2NPT B;  1I42 A;  1KEJ A;  5AI6 A;  3PMN A;  1TBE A;  1L0V B;  2WFA A;  1J7B A;  4FBT A;  3KKA C;  2KHV A;  4NNJ B;  3QAR A;  1S0N A;  3HIZ A;  1SWV A;  4UB6 U;  4YN4 A;  2NBW B;  5DGB A;  1GC7 A;  4DDI D;  2N1W A;  3NTU A;  2K4H A;  2XY6 A;  2VA3 A;  2JH7 A;  2KQS A;  5BMH A;  3X23 A;  2FID A;  5J2E A;  4Q8E A;  1WWT A;  2DHZ A;  3FM9 A;  2UU7 A;  1WZ3 A;  1ZD3 A;  4KLE A;  4UDU C;  3RD2 A;  3NG0 A;  4DWI A;  4HCP B;  2IOH A;  1HUZ A;  1A6S A;  2YX8 A;  4MEM A;  2PFQ A;  1SJH D;  1N6Z A;  3GOE A;  3A0B U;  2W9N A;  4BXO A;  3NVZ A;  1ZQW A;  1I4Q A;  2VAN A;  4FZL A;  1TKY A;  3R8B A;  3LK9 A;  4OJP A;  3DVG X;  4NLZ A;  4P4M A;  4QWE A;  3D2S A;  2KSO B;  3NZU A;  5J2F A;  3WKD A;  3AV8 A;  2XK5 B;  3M9N B;  1Y56 A;  2JQR B;  2G1E A;  1ZQF A;  3ED5 A;  5CR0 A;  2PEA A;  3PSI A;  2LI5 A;  3B2F A;  1B43 A;  5ALJ A;  4ZH4 A;  3LVV A;  2K89 A;  2KAN A;  2F1I A;  4DSE A;  4F5P A;  1U49 A;  1Z1V A;  1UA1 A;  9ICA A;  2BYE A;  3GS2 A;  8ICW A;  1K52 A;  1YQ3 B;  3ZD8 A;  3ABV B;  4MF8 A;  1I7H A;  3ML9 A;  2MX2 A;  4OZA A;  1SKW A;  2NO4 A;  1I4H A;  2PW9 A;  3IN5 A;  2IBI B;  4YTP B;  2P6U A;  4J3O D;  2K4P A;  1A76 A;  2J42 A;  3P2B A;  5JTI A;  2LXA A;  3QU5 A;  1X42 A;  3MR2 A;  8ICT A;  4IDI A;  2ZIU B;  2OHF A;  2KSO A;  2LM4 A;  2BQU A;  1DOI A;  2KDE B;  5AEK B;  1K1S A;  2J0M A;  4P0Q B;  3V72 A;  4MM3 A;  4W9C A;  5MPO A;  1DOY A;  4I2A A;  3AH7 A;  4RF1 A;  4OVV A;  2K39 A;  4K4G A;  3DBR I;  4HEA 1;  2G09 A;  1AN8 A;  2D07 B;  4REZ A;  1KF6 B;  1C4A A;  2KG5 A;  2ZG6 A;  4OZB A;  3PR5 B;  2MCN B;  3IHP C;  4YQW A;  5J0P A;  1UT8 A;  3TFS A;  3HJE A;  4XE0 A;  4RQ4 A;  1GO3 F;  3RJG A;  4C8L A;  4Q2J A;  4YTN B;  4ECX A;  1M4V A;  2AQ2 B;  3WAM A;  4RT3 A;  1UEL A;  3QYP A;  2F1J A;  3MGH A;  2ZUB A;  4PHP A;  2BGW A;  1GNU A;  1WYG A;  2MA9 B;  2YLM A;  2R2Q A;  2A1J A;  4UB5 A;  1VJK A;  1YJI A;  3RN9 C;  3U8Z A;  3KW5 B;  1UT5 A;  1BXT A;  3OGU A;  1VD2 A;  3K4G A;  2NRT A;  2BF8 B;  2KAC A;  4HYK A;  5ALI A;  2HOF A;  1D8B A;  2N1V A;  4JIO U;  4LCD E;  4R3D A;  4X5V A;  2CHW A;  2IHN A;  4MT5 A;  2KEY A;  4M6W A;  3Q8R B;  3QK0 A;  4M0W B;  2LXC A;  3AE6 B;  3IT6 B;  1HA5 A;  4YG2 A;  4X57 B;  3C2K A;  3V62 A;  1Q46 A;  1AAR A;  2YMP A;  3LWM A;  7ICL A;  1KFT A;  1SE9 A;  1C79 A;  1WE6 A;  4BJQ A;  4GXI A;  1NEN B;  4WAA A;  4ZDV A;  5J18 A;  2N7D A;  1S0O A;  1PYW D;  2P6R A;  1QLN A;  3AI5 A;  3KVF B;  3L54 A;  3WAO A;  3MC8 A;  2K9X A;  2PIA A;  3RNA C;  4ANW A;  4FO6 A;  4NLK A;  3BVM A;  4ED2 A;  2ICI A;  2FMQ A;  2CKH B;  1JQ4 A;  1F9J A;  3RNF C;  2YB1 A;  5HHD G;  3D6J A;  3VTV A;  1N2X A;  2W11 A;  7ICH A;  3ZLZ A;  2QCZ A;  7ICN A;  3A9K A;  3FDS A;  1ZQS A;  2IPK D;  1KBU A;  4BKT A;  3PO0 A;  4DLG A;  4HCN B;  2GO7 A;  2FUG 1;  1ZQB A;  2MW5 A;  5CHG A;  2HVH A;  4KX3 A;  5J2B A;  5BOL A;  4IM3 A;  5AK3 A;  5E6O A;  5IIK A;  1MJD A;  1BPE A;  1T3Q A;  4P16 A;  1XWL A;  3M1Y A;  1F77 A;  1RYJ A;  1WJ6 A;  4M8M A;  1ARO P;  3TSS A;  1P1A A;  1T3N A;  4EYI B;  1V8C A;  2ZJA A;  5KL8 B;  3TAP A;  1V85 A;  1J0G A;  2FLP A;  1FMA D;  3UF8 A;  2DZK A;  1R4N I;  2KKC A;  3NS1 A;  3RR7 A;  3MC1 A;  1QSY A;  4US8 A;  4KTQ A;  9ICL A;  2PVO D;  2EZX A;  3AED B;  3UXN A;  2JZZ A;  5KT6 A;  5AM5 A;  1L4Z B;  2V3N A;  4G3X B;  4ED3 A;  2IOF K;  3MR6 A;  4ED7 A;  3PV1 A;  5I4D A;  4DF8 A;  1MQ3 A;  4MGI E;  5AUI A;  3ZD9 A;  5AI4 A;  1D3Z A;  4YVZ A;  4IR9 A;  3I76 A;  3SEI A;  2BT6 A;  2GLS A;  4M8N A;  3NUQ A;  4YMM A;  1D9F A;  2GWS A;  4WWM A;  1GB1 A;  3N7R C;  3LWL A;  1PUT A;  4IS7 A;  1HEK A;  3QWZ B;  4LDT B;  3AE7 B;  4NQL B;  3BQ7 A;  3Q8M A;  4C7Y A;  4YL8 A;  2PXI A;  4MDK E;  5KFN A;  3H8S A;  3EA6 A;  1KQQ A;  1OGW A;  4RGM A;  1IYF A;  2WXM A;  4HKQ A;  4I2F A;  4AJW A;  4Q45 A;  1KSP A;  3GIJ A;  3N4M B;  2KX3 A;  3RH6 A;  2BPF A;  1WR1 A;  4JWU C;  2KKP A;  4O3R A;  2M19 A;  4ECT A;  4ICU A;  3UMB A;  1XO3 A;  5D3I B;  4CO7 A;  4EOY A;  1SJE D;  2I2Y A;  3HT3 A;  3TAC B;  2JR5 A;  3CW2 C;  1RYS A;  4B0M A;  4R8U B;  4WWO A;  3PZ8 A;  3RI7 C;  3PST A;  3P42 A;  5FR6 A;  2WDT B;  1F2R I;  2L3Z A;  2MA1 A;  3GE8 C;  1L6U A;  4W9D A;  2Y9U A;  4TQ0 A;  4F71 A;  1KJT A;  2MBE A;  5D94 A;  4QIW C;  2V4R A;  4QW8 A;  3DBL I;  2K4E A;  3OSN A;  4XYC A;  5IN7 A;  5IIN A;  1IGD A;  4PZO A;  1QOB A;  1JWM D;  3AE2 B;  4WJN A;  2HHS A;  2DX5 B;  2D2Q A;  4HDQ A;  2JXJ A;  3ZYY X;  1KTK A;  4KLI A;  2JY6 A;  4GU2 A;  3GV5 B;  1L3U A;  2DYB A;  2Z7J A;  3N9Y C;  3NOB A;  3SFD B;  4LK0 M;  1WF9 A;  1XT9 B;  2PMV A;  1PGX A;  1KLN A;  1J8C A;  4PHA A;  2JU6 X;  5D3D A;  1MSW D;  4C4T A;  2F44 A;  3EUB 2;  2L00 B;  5DB9 A;  2WS3 B;  4HKZ E;  4EEW A;  3I28 A;  3QU9 A;  2C2D A;  4BZA A;  1WGY A;  5H2F U;  4KLM A;  2KTQ A;  4OVZ A;  3L0W B;  1PFD A;  5AZG A;  5J0Q A;  2HMX A;  1FFV A;  3LDA A;  1Q10 A;  1ZOL A;  1J2M A;  4BGD A;  3DHH C;  4F3O A;  2K8B A;  3VQI A;  2BVC A;  1S1Q B;  4CRX A;  1XO1 A;  1SV0 A;  1S9F A;  4UQG A;  5AIC A;  3NJT A;  1PVP A;  4Y2P A;  1TY2 A;  4F4X A;  2WXG A;  1WGR A;  1BT0 A;  2MH7 A;  1ECW A;  2ASJ A;  1WXA A;  2BCQ A;  4GN1 A;  1B4F A;  2QSD A;  1KFS A;  2OYY A;  2CJN A;  2M4N A;  3K1Z A;  2LVP A;  5ALT A;  5CJ7 A;  2BTE A;  2EKE C;  3A0H U;  2VJ4 A;  3R7Q A;  3MFI A;  2VZK B;  2IDY A;  3H8W A;  4F50 A;  3H8M A;  1V1P B;  1L8L A;  4TQ1 A;  5AUK A;  5L83 A;  2KNJ A;  4QAY A;  3SD7 A;  2PKE A;  2NCN A;  5KT3 A;  2IND C;  3WKA A;  3B0A A;  2Q4T A;  2NYV A;  2N4F A;  4RQ1 A;  8ICO A;  4F4Y A;  4TKN A;  5AZF A;  4B0E A;  5ALO A;  5AM2 A;  1WMH B;  4C00 A;  2LKY A;  4RFB A;  2K25 A;  4LTU A;  4MHV A;  2YEP F;  2H3Z A;  1ZQU A;  2W3R A;  5ALX A;  1NK9 A;  3AU2 A;  2WF6 A;  3VCB A;  2KIV A;  4DO9 A;  2BDP A;  3N1Z C;  2LGX A;  4JLC A;  1D8Y A;  4FJV B;  3ZDM C;  5D7G A;  5ALQ A;  4EE2 A;  3HHM A;  2KZZ A;  2WU2 B;  1FXI A;  4MH0 E;  2W7O A;  4IWP A;  1TVA A;  5AM4 A;  3VDZ A;  2G9H D;  4NQK E;  3SDL C;  3QX7 A;  5ALV A;  3WKC A;  2R61 A;  2VH1 A;  4NV0 A;  1ZQD A;  4B9T A;  3VVW B;  2NRV A;  2FMP A;  2KOB A;  4FAD A;  2LRW A;  3MDA A;  5AI8 A;  1S76 D;  5D6J B;  4MFA A;  4EX7 A;  4Q44 A;  1YIW A;  2NO5 A;  3SMV A;  2UVV A;  1TYG B;  2ZVO A;  2NR2 A;  2E1F A;  2BS3 B;  3BZK A;  3KZI U;  4GSW A;  4OW0 A;  2WQY B;  3H4D A;  1QT9 A;  2GB1 A;  2UWQ A;  3RFZ B;  2KVC A;  3UQB A;  3S6J A;  1CK1 A;  1TJE A;  5J0U A;  4NLB A;  3V6E B;  1WI0 A;  2LGD A;  3GE3 C;  3RB4 A;  1UWM A;  2W9B B;  4NM2 A;  4GXJ A;  3ZDB A;  2L0T A;  2MJD A;  3LVW A;  4C4V A;  2PMZ F;  5CTR C;  1IIP A;  3AE5 B;  1NK8 A;  3MGV A;  4O3O A;  4NAW B;  1YN5 A;  4E0D A;  2ZPN A;  3U2S C;  3SV4 A;  4LNK A;  3H0L B;  1EWY C;  1T8E A;  1PDX A;  1NK0 A;  2M0X A;  1TV9 A;  4I29 A;  8ICH A;  9ICW A;  5D49 A;  3SU8 X;  1EXN A;  2EZZ A;  1HUO A;  1JXE A;  5L1J A;  1QZE A;  2IO1 B;  3HX0 A;  3N3K B;  2GH1 A;  2G4D B;  4ACO A;  1ZGU B;  2KVR A;  4NAM A;  2QAR A;  3KUC B;  2EAO A;  4R8U A;  4GGQ A;  1NK7 A;  1SIJ A;  2O2V A;  2KQ4 X;  2KIC A;  3MBY A;  4KVG B;  2JYE A;  3P4R B;  8ICM A;  4H2A A;  3KHG A;  1VZ8 A;  2GOW A;  1IBX A;  3PZ7 A;  4S0R A;  4RCO A;  1SWW A;  2KFJ A;  2I1K A;  3AMZ A;  1C1Y B;  3CWI A;  2N7E A;  5FK9 C;  2DZM A;  5DPT A;  5E79 U;  1JWA D;  1MQ2 A;  2QIL A;  4DHZ B;  1RYR A;  4C8K A;  1FRD A;  4UB4 A;  1X9W A;  2INN E;  3QC8 B;  1L0Y B;  5C5J A;  1TT5 B;  2K60 A;  3OG5 A;  1ZQQ A;  4B9N A;  1TS4 A;  5KNI A;  3ORY A;  4M2Y A;  4FA6 A;  4FZM A;  4F91 B;  1WGK A;  4WWP A;  5AKI A;  3BK1 A;  2AQ4 A;  2K0P A;  5J2R A;  2FNJ B;  5AKG A;  2BPS A;  3ZXV A;  1TAU A;  2X8X X;  3N20 C;  3PZP A;  2ZZP B;  3MR3 A;  4GB9 A;  2ZUD A;  1ZPS A;  2YY6 A;  4XGA B;  3QJZ A;  3ETL A;  3WAL A;  1RM6 C;  3DHG C;  2KWC A;  4LJP B;  1V49 A;  2EMT A;  3HIL A;  4UBC A;  3Q6B A;  2DLB A;  4A6Q A;  3F2C A;  2XY5 A;  3WK6 A;  1Q3U A;  2EQY A;  4DQP A;  3PSE B;  4AOF A;  3H7I A;  2VA2 A;  2E8N A;  4DL3 A;  2OED A;  3AM9 A;  2RR9 A;  3ENE A;  2AL3 A;  3QUQ A;  4WJQ A;  1WRI A;  2DUY A;  2K8A A;  4A90 A;  3AE8 B;  4KIK A;  2JGA A;  2MWS B;  1HIW A;  3L10 B;  3H0M B;  5DPR A;  3IM1 A;  5HMM A;  2K4I A;  3V7J A;  4GDL B;  4OJO A;  2QB0 A;  7ICP A;  2ACZ B;  1LB2 B;  1FPY A;  4P4P A;  3GIK A;  1D8L A;  2MQJ A;  1E10 A;  4II2 B;  4CF4 A;  1UNS A;  3UPQ A;  1BNP A;  4PL2 A;  5J2C A;  5EWE A;  3G6X A;  4M01 A;  1VLB A;  3DBL B;  1XO0 A;  3ZW3 A;  2M9N A;  1HJP A;  4YCX A;  5HR7 A;  2HTM E;  4Y2R A;  3NY5 A;  1NZP A;  2JRH A;  2ZTD A;  4F92 B;  2KZR A;  3OSP A;  3L17 A;  4M04 A;  1N5X A;  2V3S A;  2R8G A;  3EW9 A;  3OHA A;  4KLS A;  3N30 A;  4W9G A;  3ZKJ C;  2KD1 A;  2MSE D;  2H88 B;  2RDG A;  4ECY A;  4F4Z A;  2YML A;  3WIM A;  3C28 A;  3RZF A;  3DHI C;  3E58 A;  3T8M A;  4F2R A;  5HP4 A;  5KAI U;  8ICF A;  5TIS U;  2I38 A;  5IA7 A;  4ICV A;  2DKZ A;  3IV6 A;  5KFT A;  2KE7 A;  2D3B A;  3BYY B;  4RGT A;  2J6U A;  3U4E G;  1I4G A;  2KN4 A;  2B0C A;  2AXT U;  3HVZ A;  4AUQ C;  2V4I B;  2W9M A;  2ASL A;  4KDL B;  4IWQ A;  3VH3 B;  8ICC A;  3Q8Q B;  2LHD A;  5EE1 A;  2PFN A;  3IRU A;  2D3A A;  2KOX A;  4M47 A;  4AP9 A;  1ZQI A;  1ZQH A;  2KJR A;  3IBE A;  2WAQ F;  2GBN A;  1B1Z A;  2E8O A;  2V1Y A;  2RDI A;  3KKA A;  2NV3 A;  2KN7 A;  4DQR A;  1ZUD 2;  3Q3M C;  2JZ3 B;  3RT3 B;  3M63 B;  4N59 A;  2KTF A;  2WB1 F;  5F3X B;  3SEN A;  4YP3 A;  3A1Q B;  1SGH A;  3V7K A;  3SD5 A;  5KFX A;  1NK6 A;  2UVU A;  4MGK E;  1JX4 A;  1C77 A;  3N1Y C;  4IRC A;  5AM3 A;  3RNE C;  2XIC A;  2BGF A;  4O1N A;  4ANV A;  1LGR A;  4YXD B;  1E0Z A;  1S97 A;  4HAI A;  3RH5 A;  1XSL A;  1V9J A;  4XWW A;  3ML8 A;  3E9S A;  3GII A;  2V4L A;  3ZNG C;  1C4P A;  3BZC A;  2K6Q A;  5AKE A;  3VXW A;  2IJ0 A;  2Z0D B;  1WWU A;  3IFW B;  1KRP A;  8ICU A;  3CP8 A;  5J0X A;  3UXP A;  1F0Z A;  2WXO A;  4HVB A;  1L0X B;  4ZRP A;  2Y1I A;  1V9P A;  1R4N B;  5JRT A;  4HRS A;  4P1B C;  2KZM A;  3KUD B;  5L1K A;  3ZNI D;  1LVH A;  2JXX A;  2BWF A;  5J2D A;  2C7M B;  5KG7 A;  1WCN A;  3V60 A;  4DOB A;  4R65 A;  4MJS A;  1HTQ A;  4I2I A;  4KMU A;  5IIJ A;  4I2E A;  5L1M A;  2G5I B;  1QOF A;  3SR6 A;  1X40 A;  1GPX A;  1FCC C;  4NM1 A;  2A1J B;  5KAF U;  2C5L C;  2W82 A;  2L83 A;  5KFD A;  2ZNV B;  1EO6 A;  5HHH A;  1PUZ A;  1KKX A;  3ZVV A;  4P4O A;  3BII D;  4LNF A;  2LHE A;  3WCQ A;  1ZDV A;  2ASQ A;  4WWN A;  2P66 A;  1L8O A;  3MJW A;  1STE A;  2KQ7 A;  1SSN A;  3VTW A;  4EEL A;  4YXJ A;  1SXE A;  2VJ5 A;  1TGZ B;  1UD7 A;  1DK3 A;  2J4X A;  4TMA B;  4ANU A;  1WZ0 A;  2L32 A;  2OJW A;  1L5U A;  4JV1 A;  2ZTE A;  1NKB A;  1E8X A;  2IY0 B;  2G06 A;  2PFO A;  5JZE B;  2R18 A;  1KOT A;  4UAV A;  2GBM A;  4HRO A;  1ZW7 A;  3TMP B;  1FEZ A;  5KFZ A;  4NLC A;  4FLH A;  3CSF A;  2E6X A;  4KDI C;  1N5W A;  2HDO A;  3NVY A;  1T94 A;  4DSJ A;  1EWC A;  4K81 A;  1H8C A;  2QB1 A;  3HPO A;  3LDZ E;  3VC8 A;  4CHK A;  1M6Y A;  2RP5 A;  2HBJ A;  2KDF B;  1TTN A;  3LB8 C;  2KLC A;  4C7Z A;  3Q8B A;  4ECV A;  3I1Y A;  1S3S G;  2PI5 A;  4CGZ A;  2HSZ A;  1F2R C;  2L1A A;  4N58 A;  3OJU A;  3M9M B;  2IBK A;  5KTQ A;  2HBL A;  4ECR A;  1WGD A;  7ICI A;  4W9L A;  7ICS A;  2VA8 A;  3PY8 A;  3ZNH B;  3ISB A;  3BWU D;  1TK0 A;  2W8K A;  4GFJ A;  4DHZ E;  1O03 A;  5J2I A;  1SE2 A;  2KD0 A;  2G0A A;  1QF6 A;  2YB4 A;  2JT4 B;  2XID A;  2HHX A;  4KZ0 A;  5L95 C;  2KLG A;  4R64 A;  2LM1 A;  1V38 A;  4J9O A;  1SKS A;  2F3N A;  1WXS A;  5J2J A;  1TFR A;  4O0I A;  4PH5 A;  3H1U A;  3IG3 A;  2MRL A;  3AEG B;  1XLP A;  3C1Z A;  4LNN A;  4DS5 A;  1L2N A;  9ICO A;  5DKW A;  4CNQ A;  2INC C;  4M00 A;  3F5E A;  1COO A;  4QZ9 A;  4PGQ A;  4XUS A;  3JPQ A;  1NJY A;  8ICG A;  1F52 A;  2FE9 A;  2BB6 A;  9ICV A;  4TUP A;  4IRK A;  4MFC A;  3F53 A;  3B0Y A;  3H0R B;  4DEZ A;  5JH5 C;  2EMS A;  2FJ6 A;  5T14 A;  1R7S A;  3C29 A;  3ZJV A;  1YT3 A;  1M94 A;  2DFL A;  4YR2 A;  2XNA C;  2YEP B;  4YSY B;  3VRA B;  3VR9 B;  5FR3 A;  4JV2 A;  5JXV A;  1X9S A;  2HDE A;  3EGR A;  3R2T A;  1X9M A;  2LAS A;  4KLQ A;  1WR6 E;  3C8Y A;  1YMH E;  2E1E A;  3W9C B;  4WQO B;  1SXD A;  3UQ2 A;  9ICX A;  4IKG A;  1K51 A;  2JH1 A;  2FLN A;  9ICP A;  2QIE B;  5JHB A;  4Y2T A;  4IM0 A;  1Y8R C;  3QHT A;  4KN4 A;  4HPL B;  3PT2 B;  4KGS A;  1WXM A;  5J0R A;  3MP9 A;  3JPT A;  2M8S A;  3K9O B;  4ED6 A;  2Y1J A;  4YTM B;  5KFE A;  4QJF B;  4F4K A;  2YVC A;  2E8M A;  3RNC C;  2MHJ A;  4P1C C;  3RYT A;  1FEH A;  4UB8 U;  2ZW1 A;  4M9L A;  3NRW A;  2WGS A;  4BVU C;  9ICS A;  2N0S B;  3PHW B;  3MGI A;  2WX1 A;  1ZQX A;  4PHE A;  3NVW A;  3TAR A;  4KZC A;  2WHE A;  1T4G A;  4QZE A;  5AK4 A;  2ZJ8 A;  5GXG B;  1U4B A;  3TAQ A;  4K3C A;  3GZF A;  1WJU A;  1UGM A;  2Y9T A;  2BQQ A;  3I3T B;  1RRB A;  3Q14 C;  2ODG A;  4ELU A;  3TIX A;  3THV A;  1NJX A;  1TKE A;  2VIX A;  4FN2 A;  3TL5 A;  4KLT A;  1TIF A;  2OM6 A;  2IYD B;  3MHS D;  1MVK A;  2QJL A;  2KKV A;  1QSS A;  2AWT A;  5AK5 A;  1DK2 A;  4BOZ B;  4JX1 C;  4DXG A;  1MA7 A;  1SBB B;  3B2G A;  5EE0 A;  3AUL A;  2PFP A;  8ICK A;  1VJ5 A;  1WGH A;  2MLB A;  4GIV A;  2FPL A;  3OJ3 A;  2VH2 A;  4UW9 A;  4KGT A;  4EZK A;  3VUW A;  1DYQ A;  3PRZ A;  3AXC A;  3RFA A;  2RMM A;  4NJC A;  3AEE B;  3VTU A;  2LWP A;  3JPP A;  2PI4 A;  4RF0 A;  3G6Y A;  3NZS A;  4RPZ A;  1KL9 A;  2DEN B;  1OQR A;  1V5O A;  4O3S A;  1UA0 A;  2ZVN A;  2D3D A;  4GDK B;  3I57 A;  5AKJ A;  4M0W A;  4F5R A;  5IOI A;  3RPF C;  2K8B B;  4O9M A;  3OWE B;  3HP6 A;  4ACF A;  1SL2 A;  4ZOH C;  4W9F A;  4BFR A;  9ICK A;  5AKX A;  2AYO B;  1JXL A;  1K8R B;  2QEJ C;  2JF5 A;  1LV5 A;  3A4S C;  2AJQ A;  2YMQ A;  4KLU A;  1WFY A;  3P1M A;  1SL0 A;  3RMK C;  1NEK B;  2NTT A;  2F2A B;  2EZY A;  2AGO A;  2ONQ A;  3JYU A;  4JMU A;  4R63 A;  1AWD A;  3PX4 A;  2UVW A;  3UIO B;  3A33 B;  1SEB D;  3X0W A;  4Q43 A;  1ZQY A;  3U30 A;  1B22 A;  2WXL A;  9ICE A;  5LXI B;  3M62 B;  3MFG A;  4J9Q A;  4NZL B;  1BUI C;  2C9W B;  4U7C A;  4LLG M;  4C4S A;  1T5X D;  3W5V B;  2ZIV A;  2XY7 A;  4IQW A;  2GBR A;  4Y2Q A;  4B6J A;  2WF9 A;  2HD5 B;  2FE8 A;  4I2J A;  3OPX A;  1T0Y A;  3ONN A;  4GC6 A;  1T0R C;  5C1Z A;  2KZ3 A;  2KV2 A;  5C0Y A;  2J0K A;  1RDF A;  4O3Q A;  1Z19 A;  4FFD A;  5ALM A;  2W9B A;  2WU5 B;  2KDB A;  2RD0 A;  2HJ1 A;  1UUP A;  2J0J A;  4MAC A;  3UIP B;  2WF8 A;  5DG8 A;  4KLG A;  4JV0 A;  4TUS A;  3AE4 B;  2HTH A;  1N61 A;  3AB5 A;  5H92 C;  1TY0 A;  1WM2 A;  3KTQ A;  1T0Q C;  4C4V B;  4BOS C;  2HI0 A;  4YFK A;  3OTQ A;  2O6V B;  1MFW A;  3C5G A;  3V61 A;  1Z3E B;  1QQ5 A;  1EU3 A;  2F8L A;  2L0F A;  3C19 A;  2WF7 A;  3PLU A;  1ZQC A;  1FNW A;  1JAL A;  8ICE A;  2DYM A;  4KLJ A;  3AU4 A;  2FLL A;  1QLB B;  3TJP A;  3Q69 A;  4OCZ A;  2SAK A;  1VZ7 A;  3QU4 A;  4QZI A;  2NTS A;  3EFU A;  1X6I A;  4LVS A;  2FCS A;  3AE3 B;  2YN4 A;  3BVG A;  3KH0 A;  3N1X C;  5KFF A;  3T5H A;  1SV0 C;  2LMR A;  3WK5 A;  2ZEQ A;  3CNH A;  3KFU F;  5KFQ A;  3EPI A;  1Z1B A;  3NVV A;  2D6F C;  4RT2 A;  3QU7 A;  3DQV A;  5F9N A;  2RQ5 A;  2OCE A;  5AIB A;  5KFW A;  2KX0 A;  3DBR B;  1U9L A;  1E6E B;  2KFK A;  3J81 j;  2XK5 A;  3D2Q A;  1C9F A;  4O3P A;  4NJ8 A;  2DL0 A;  4QW9 A;  5KT4 A;  3T5K A;  2C22 A;  3RAQ A;  3BY4 B;  4KLO A;  4I6P A;  5AKH A;  1ZET A;  4C8N A;  4E71 A;  5CHF A;  2KWV B;  1R4M B;  2JEG A;  2CS4 A;  3VFK A;  2LPE A;  1C7Y A;  3TEZ A;  1RFK A;  3SI8 A;  1YJJ A;  3D32 A;  2DAF A;  4YD2 A;  1XD3 B;  3DOW A;  3L4P A;  3ZO5 B;  1K1Q A;  3SYZ A;  8ICB A;  4QWB A;  3O13 A;  1BPY A;  3AN1 A;  3JPO A;  4USA A;  2JWU A;  2DQN B;  3IP4 B;  4ELT A;  5BYR A;  2KYW A;  2NRW A;  2ZIV B;  1QQ6 A;  4NAW A;  1SZP A;  3KQ4 A;  5L1I A;  4LNO A;  4A55 A;  4DQI A;  2MAX A;  4PGX A;  3BQ1 A;  2G08 A;  1J7A A;  2JZB A;  3APC A;  1SF0 A;  1CUK A;  2XO7 A;  5KFA A;  1PK1 B;  2Y5C A;  5E6N A;  4BAX A;  2I5H A;  5ALD A;  4E3C A;  3NZ3 A;  2WXQ A;  4U6P A;  1UGJ A;  4MH8 A;  3KWL A;  2HBM A;  3QNM A;  1CEZ A;  3F2D A;  1AQ6 A;  3ZRC A;  1OXJ A;  3ISD A;  4F5Q A;  2L05 A;  3HK0 A;  3Q3O C;  2RLT A;  5FP0 A;  1VRA B;  2AL6 A;  3URY A;  2NPT A;  1XC9 A;  4BKS A;  1ZQZ A;  4J9S A;  2ZCB A;  1SKR A;  2GOL A;  2QHO A;  4C8O A;  4KLL A;  2CU1 A;  2MBO A;  1P3Q U;  1T0S C;  1WUD A;  5DBC A;  4LJX A;  1OEY J;  3PHX B;  4FJY A;  1KTQ A;  4RNN A;  2CXY A;  1PVR A;  3CF6 E;  4W9I A;  1I35 A;  4DF4 A;  2BBC A;  1HZ6 A;  4ZRQ A;  1ZQR A;  4KN7 A;  4KKI A;  3EZ5 A;  2IMW P;  1FNU A;  1YN4 A;  3C1Y A;  5F9L A;  4Y2Y A;  4K4H A;  1LQB A;  1QQR A;  2Y5B B;  1PK1 A;  1I4P A;  2LYH A;  2K8C A;  5AHX A;  2QAR B;  2KNB A;  1IXR A;  2Q0Z X;  1MHX A;  2NRZ A;  2JZP A;  1Z4N A;  4ED1 A;  4PYU A;  5TR5 A;  3DDC B;  4RNM A;  2JX5 A;  1QKZ A;  4RQ2 A;  1NYR A;  4F93 B;  1D5M C;  4YD1 A;  3W5U B;  5KFS A;  4TQR A;  3W2D A;  4Y2V A;  2KMA A;  2KVZ A;  5AKK A;  4M9J A;  3N28 A;  1VR9 A;  2ZCC A;  4ARI A;  5DBB A;  1YQB A;  3KLS X;  4IQV A;  3UGB B;  4RGN A;  1HQR D;  1RWS A;  4TQS A;  3SHQ A;  2WXH A;  5DLF A;  2L5Y A;  2HOQ A;  3FC4 A;  4M02 A;  3TAD A;  2LMC A;  4EZ9 A;  2MEK A;  2N9E B;  4DSI A;  3PRP B;  4GOC A;  3RUI B;  4W9K A;  4K7S A;  4O5K A;  2C2E A;  3AU5 A;  4KSL C;  4MJS B;  4MSM B;  1UPH A;  3GIL A;  2LUE A;  1RG6 A;  2N1R A;  4R66 A;  1E8Y A;  1YN3 A;  4YR0 A;  3NGD A;  3KYC D;  4JK1 A;  1EF1 A;  4UAU A;  4WIP A;  3GIM A;  1ESF A;  3TI0 A;  2KDM A;  3FKY A;  2P35 A;  1S8O A;  4HPM B;  3IT4 B;  3GZN B;  2DKX A;  5ALH A;  4F1S A;  3R3M A;  4EBC A;  3A9J A;  2AX5 A;  5HR6 A;  4NPN A;  5IIL A;  9ICQ A;  4BBN C;  1IV8 A;  5J2H A;  2ZIX A;  4DK5 A;  3IG5 A;  4AQ7 A;  5BMI A;  1SL1 A;  1QOG A;  4CF3 A;  4J9R A;  2Z8L A;  2B3A A;  2LGY A;  1HTO A;  3FIL B;  5J0W A;  5GTH U;  7ICM A;  3PS6 A;  1J97 A;  5AK6 A;  4OD0 A;  5D46 A;  3F2B A;  4Z6C A;  5EWG A;  5J2G A;  4C0Z A;  4WH4 A;  3GB1 A;  4CCH A;  2QMT A;  1LXD A;  5KG2 A;  2FCN A;  4ICA A;  2H5X A;  3TAD C;  5ALF A;  7ICQ A;  1S0M A;  1ET9 A;  3DPD A;  1IBX B;  2KK0 A;  3DCG A;  4UAW A;  4EKU A;  1H38 A;  3RNG C;  3DEE A;  1JRP A;  2ESE A;  2JEI A;  4JL9 A;  4KX6 B;  5J8Y C;  2D8C A;  4F72 A;  1JN3 A;  3E2E A;  2I1Q A;  4GLX A;  1WIA A;  2BKR B;  1WM3 A;  4G9B A;  5BO4 B;  4BUG A;  3BS5 B;  5EE3 A;  1GUA B;  1NKC A;  5KFJ A;  1OFF A;  2WXF A;  5ALW A;  3N7P D;  4P0Q A;  4MM3 B;  5KHQ A;  1SE3 A;  2MRP A;  2MJE A;  2HVI A;  3WKE A;  3GP7 A;  3HVD A;  3ZDD A;  4BBN F;  1L7O A;  9ICC A;  2L8J A;  2CR5 A;  4ZRK A;  3PZD A;  2K8C B;  1DRG A;  1A77 A;  4MEX A;  3KHR A;  3AEA B;  4WQM A;  1I4R A;  3QZ7 A;  4EEK A;  7ICG A;  9ICN A;  5ALR A;  3N97 B;  2ATL A;  2KJ8 A;  5DQH A;  4DSL A;  1RPL A;  2BYF A;  3RBD A;  1BPB A;  3PR4 A;  4DQO C;  1D5Z C;  4K3B A;  2ZIX B;  5KFB A;  1OQQ A;  1D4B A;  5B66 U;  3M8S A;  1ZQM A;  2ES6 A;  4UAT A;  2K1F A;  2A19 A;  4G3I A;  2IO0 B;  1ZP0 B;  2BS4 B;  2BPG A;  4QWD A;  5DB6 A;  2CJO A;  1UH6 A;  5AZH A;  1SB3 C;  3DBH I;  3UIN B;  5KFH A;  1ENF A;  4IC7 B;  1GOZ A;  1FM0 D;  4QZG A;  1JWU D;  5C23 A;  4F7Z A;  4EEN A;  5AM0 A;  3M9O B;  2UVR A;  3QZ8 A;  3VUX A;  4GDL A;  3B9J A;  1IM4 A;  3M6Z A;  9ICF A;  1E9M A;  2XBB C;  3RUL A;  1K5O A;  3JW0 X;  3QEB Z;  1Y88 A;  3JVZ X;  5KFL A;  2H3V A;  3M6K A;  2BCS A;  3H8J A;  2OWO A;  1V1O A;  4I6L B;  1NZB A;  8ICQ A;  2WDQ B;  4RZR A;  4RQ3 A;  1Q0W B;  1TAQ A;  1KDH A;  2IO3 B;  2LGI A;  3OJ4 B;  4ZYS A;  5TZV A;  3UM9 A;  1TS2 A;  2C28 A;  5III A;  2BQ3 A;  4FZN A;  3ZTD A;  3B1L X;  3T79 A;  5KG6 A;  1Q8K A;  2G07 A;  9ICT A;  3H7P A;  4S17 A;  3ZXR A;  2HJ8 A;  2BWE S;  4RQ5 A;  4YXM A;  3QE9 Y;  4I2G A;  2Z0E B;  2N9K A;  3A9K B;  4ASW C;  2ZIU A;  4IG7 B;  4DFM A;  4DCC A;  4DBG A;  1V5T A;  4L2Y A;  2RDB C;  4WJO A;  3ZNZ B;  4BKG A;  5ALU A;  2RHF A;  2CHX A;  1PQS A;  4N9F 4;  4M0A A;  3C5F A;  2QKQ A;  4NXZ A;  4C8M A;  4NWI A;  4NLN A;  4IUM B;  3GDX A;  2DWQ A;  2CU3 A;  1ZD2 P;  1ZXI A;  4UB2 A;  5CRX A;  2R8H A;  1V97 A;  4LZD A;  4E74 A;  2KJ9 A;  5DCN A;  4J9M A;  2E5S A;  4WAF A;  8ICZ A;  3AUO A;  1P7E A;  2XEW A;  2IOF A;  4Y2U A;  3IXS A;  3WAN A;  2KMD A;  4I2H A;  2H89 B;  2K22 A;  2FIF A;  3GQC A;  4TUR A;  1K50 A;  2M0A A;  2XCA A;  1QQ7 A;  7ICK A;  1YZ7 A;  2V9H A;  4RH6 A;  3UI3 A;  5AKL A;  3ETR A;  1CRX A;  2Y5P A;  3MJ5 A;  3RH4 A;  1JW9 D;  1NYQ A;  2ZUC A;  2LVO A;  3LYY A;  1F44 A;  3H7P B;  1F5S A;  3PSP A;  1YQ4 B;  5J2A A;  4P6V F;  5J17 A;  2ZXH A;  5J0O A;  2W43 A;  4EZJ A;  4ZRI A;  3R9K A;  5CX3 A;  2RDH A;  4IQT A;  5KFG A;  3KHH A;  3Q3F A;  4K1R B;  1DXS A;  1L3V A;  3AEV A;  4ECZ A;  4CE6 A;  3PRE A;  3UMG A;  1FXT B;  3Q8C A;  4YT0 B;  5IIO A;  1NI2 A;  2BCU A;  2K3U A;  4O3N A;  1WGG A;  2FUH B;  3T3F A;  3Q3J A;  5KG5 A;  2ISO A;  2MP2 B;  3IDW A;  2PJH A;  3MC9 A;  1WX8 A;  4RQN A;  4P7I A;  3Q8A A;  1TS3 A;  3GV7 B;  1V80 A;  2J7Q B;  5DPW A;  4W9E A;  1ZQA A;  5ALG A;  5DLG A;  1DGJ A;  2KVS A;  4EYH B;  1WYW B;  3WKB A;  1EUV B;  4PL1 A;  4B9M A;  4XX5 A;  2D10 A;  2E3T A;  4PYZ A;  1S0V A;  3A9J B;  2EAM A;  1BGX T;  4DFJ A;  3SEB A;  3KHL A;  5G5H A;  8ICI A;  1JRU A;  4BWJ A;  4N6E B;  1PGB A;  2J52 A;  4KV2 A;  3UXO A;  5HG2 A;  2W03 A;  2BZF A;  3KD3 A;  3ZDE A;  3RB6 A;  2LJ5 A;  2PPH A;  3V7L A;  2VZK D;  4IM2 A;  4M9H A;  4B9K A;  1E7V A;  4II3 B;  4URK A;  3U52 E;  3DVN U;  3VRB B;  2MBQ A;  1GG3 A;  5LLI A;  4MF2 A;  2IHM A;  1GB4 A;  2OXO A;  2JZB B;  5ALS A;  4HDO A;  2OJR A;  1VZ6 A;  5KFR A;  3NS8 A;  2AGP A;  1UZX B;  2LGS A;  4F8R A;  5HI1 A;  4QZ8 A;  2BR0 A;  4OHJ A;  3MDC A;  2DAJ A;  1WCL A;  2ZNV C;  3P4P B;  3KBB A;  5DQG A;  4CYE A;  3T9L A;  2MBH A;  5H8Y E;  3NAS A;  3C0R B;  2R8I A;  2KIW A;  3PSF A;  2GMI C;  3PX6 A;  3ZJU A;  1Q5W B;  1MG4 A;  1ZD5 A;  1X2I A;  4C80 A;  3PX0 A;  1C4C A;  1QIL A;  1WXV A;  2LEK A;  4RM9 A;  1HXY D;  4KLD A;  1L4D B;  1QOA A;  4RNO A;  3K75 D;  4I2D A;  1IP9 A;  1SIF A;  2LYA A;  3CST A;  1R4M I;  2RSU A;  4OVU A;  2XCP A;  3ZGZ A;  4HJG E;  4YMO A;  3AQE A;  1X6J A;  4J03 A;  3HKZ C;  2PKO A;  2O6K A;  3NRZ A;  1S10 A;  3RJE A;  3RJI A;  2RGF A;  3PTF C;  2CRX A;  4NL9 A;  4KIT B;  1NJW A;  2V9W A;  5GMV A;  5J0Y A;  2V3P A;  4XQ8 A;  5EDS A;  2MSN A;  4A8E A;  1X66 A;  3VHT C;  2WTF A;  3D2N A;  3DVN V;  5J8Y A;  4OO1 J;  2E8P A;  2WXJ A;  7ICT A;  4IWO A;  2W3S A;  1V81 A;  4W9J A;  2JRZ A;  5IIM A;  2FCQ A;  3NHE B;  4GDK A;  2F77 X;  4JUZ A;  4ZRJ A;  1TAM A;  3Q8E A;  3QUT A;  4MEY A;  2BQR A;  2MP2 A;  2KJ6 A;  2Y0S C;  2JV3 A;  1Z00 B;  2JXT A;  4UAR A;  3V05 A;  2BW2 A;  1RXV A;  2WDV B;  3ZDA A;  2NRX A;  1N63 A;  5ALK A;  2W54 A;  1U48 A;  8ICJ A;  2GI9 A;  4EEY A;  1L7Y A;  3BK2 A;  3PVL A;  4XDD A;  4EFO A;  5LNK 1;  2R8K A;  2HHT A;  5C3J B;  3PLV A;  5BYQ A;  4OZC A;  4DFP A;  2PLP A;  3BS5 A;  4DS4 A;  2N9P C;  1U4A A;  1L6N A;  3EEC A;  4RQ7 A;  4A8X C;  3GV8 B;  1QH9 A;  2PE6 B;  3W1Y A;  1J7C A;  1MPE A;  3C2M A;  5J0S A;  2L7R A;  3PML A;  1RLF A;  3L16 A;  5AKZ A;  1KN5 A;  4PS7 A;  3QQ8 B;  4XZ4 A;  4NJ6 A;  4ED0 A;  3Q3N C;  5CP2 A;  1QTM A;  4RU9 A;  4QZH A;  5DPS A;  1BPX A;  1RAX A;  4CQN A;  1WRD B;  3R2I A;  4YSX B;  2R8J A;  2HHU A;  2W7P A;  2LD9 A;  2XN9 C;  3QX1 A;  1RZT A;  3UMC A;  1NI3 A;  1P98 A;  1J2N A;  2CN1 A;  2KN5 A;  1WY8 A;  2IGD A;  2WXK A;  1B0X A;  1KLG D;  1ZQL A;  3FIL A;  3IVF A;  4ZYN A;  1HEZ E;  1P9D U;  1KM7 A;  4DXA B;  2LYB A;  4ECW A;  3WA0 A;  5E6P A;  1C78 A;  5A0L A;  4K7U A;  4NJ7 A;  5DB7 A;  5JU5 A;  1CJE A;  1WX9 A;  4I6N B;  2K6D B;  1LKY B;  5G5G A;  3PVX A;  1TK5 A;  1Q3V A;  1XLO A;  4P2H A;  5L1L A;  2QLT A;  2BYT A;  5KT7 A;  1K53 A;  2W9C A;  1ZQO A;  3PPA A;  5HNK A;  1JCK B;  2DF4 B;  1L3T A;  8ICP A;  2WAQ C;  1JWB D;  7ICU A;  4XRH A;  3SAG A;  3MHZ A;  5CHV C;  4G0N B;  3SAF A;  4XDC A;  4GLS C;  4DHJ D;  2KFZ A;  3AL0 B;  2M17 A;  2B76 B;  5G2N A;  4NY0 A;  5TSS A;  2DZJ A;  3WK4 A;  3KOO A;  4UAZ A;  2NBV B;  5G55 A;  1TK8 A;  4GIB A;  2C2R A;  3AU6 A;  2KDI A;  8ICR A;  1CQV A;  1ZD4 A;  2Y3A A;  5BMG A;  4DWF A;  5BYS A;  3L5K A;  1COK A;  1OEY A;  3TFR A;  5KFK A;  1XSP A;  2MBB B;  7ICR A;  4TV3 A;  3SV3 A;  4O5C A;  1EU4 A;  2J6S A;  3BQ2 A;  2I9G A;  5ALZ A;  2LHT A;  3W1S A;  5KFI A;  4WJ3 B;  1Z2M A;  1ROE A;  4F8C B;  5ALL A;  2HOI A;  2R2O A;  5HKH A;  3ISC A;  3V6H A;  5ALE A;  3TEY A;  5KG4 A;  2GRI A;  4PJ0 U;  2XVT A;  4RUA A;  4EZ6 A;  3RR8 A;  3MAB A;  1P7D A;  3UQA A;  1KLV A;  4TUQ A;  1KFD A;  2W9C B;  4L23 A;  4J9K A;  2YMM A;  5LXH A;  4IL6 U;  3NUH B;  2N9L A;  3PV8 A;  8ICA A;  9ICU A;  3RTV A;  5AIA A;  3CRX A;  4J9P A;  2LZ6 A;  2B6G A; 
#chains in the Genus database with same CATH homology
 1RWS A;  2WXH A;  1SJH D;  3FC4 A;  4JPS A;  2LMC A;  2I38 A;  3NVZ A;  1I4Q A;  3P63 A;  2MEK A;  1TKY A;  3R8B A;  4YSZ B;  4US9 A;  2N7J A;  3BYY B;  4RGT A;  3U4E G;  1I4G A;  2KN4 A;  5EE9 A;  3AV8 A;  1Y56 A;  2JQR B;  1SXT A;  3HVZ A;  1LO5 D;  2G1E A;  2FBW B;  2V4I B;  3ZJT A;  1YN3 A;  4WIP A;  3MC0 B;  1ESF A;  2KDM A;  2LHD A;  3B2F A;  5EE1 A;  3IT4 B;  3CIR B;  1TKG A;  2AX5 A;  1SE4 A;  1B1Z A;  3E56 A;  3GS2 A;  1K52 A;  1YQ3 B;  2MJ3 A;  4AQ7 A;  1ZUD 2;  3ABV B;  5BMI A;  1QOG A;  2Z8L A;  1I7H A;  4N59 A;  4ZHO A;  4OZA A;  3FIL B;  3I9V 1;  1I4H A;  2PW9 A;  1C77 A;  4WH4 A;  4YTP B;  3GB1 A;  4J3O D;  1V1P A;  2QMT A;  2J42 A;  3LXF A;  1XEE A;  4O1N A;  4YXD B;  1E0Z A;  1IBX B;  4IDI A;  1ET9 A;  2OHF A;  3AEF B;  4XWW A;  1DOI A;  2WNM A;  5MPO A;  1DOY A;  3E9S A;  1JRP A;  3AH7 A;  4RF1 A;  4KX6 B;  1C4P A;  4HEA 1;  1NVI D;  1AN8 A;  2IJ0 A;  4REZ A;  4ITK A;  1ACC A;  1WXQ A;  1KF6 B;  1C4A A;  4OZB A;  1F0Z A;  2WXO A;  5EE3 A;  1L0X B;  1OFF A;  4XE0 A;  4ZRP A;  2WXF A;  4YTN B;  4Q2J A;  1M4V A;  4HRS A;  2AQ2 B;  4MM3 B;  2RPV A;  2D5G A;  1SE3 A;  2MJE A;  2WDR B;  3GP7 A;  3T3O A;  1AW7 A;  3HVD A;  1WYG A;  4RNA A;  1VJK A;  1YJI A;  3Q8F A;  1P7F A;  1BXT A;  1QOF A;  2Q5W D;  3SR6 A;  1FO4 A;  2TSS A;  1GPX A;  3AEA B;  1FCC C;  2KAC A;  1I4R A;  2L83 A;  2W82 A;  4WQM A;  3BII D;  4R3D A;  4MT5 A;  2LHE A;  3WCQ A;  1ZDV A;  2WXR A;  3J9C A;  3AE6 B;  3IT6 B;  1HA5 A;  4DQO C;  1D5Z C;  4A9A A;  1XCT L;  1OQQ A;  1STE A;  4DXF A;  1D4B A;  5C2T B;  1SSN A;  1C79 A;  1NEN B;  2LJI A;  1PYW D;  2J4X A;  4TMA B;  2K9X A;  1ZP0 B;  2PIA A;  2BS4 B;  2L32 A;  1AYF A;  2CJO A;  3BVM A;  1TS5 A;  1SB3 C;  2ICI A;  2KAJ A;  1JQ4 A;  1JWS D;  1FD6 A;  1FRR A;  1ENF A;  4FXC A;  5HHD G;  3P4Q B;  1GOZ A;  1FM0 D;  1JWU D;  2LUM A;  4HRO A;  1TZO A;  2IPK D;  1PGA A;  3PO0 A;  2E6X A;  1N5W A;  3B9J A;  1E9M A;  3NVY A;  1EWC A;  2M56 B;  2FUG 1;  1BML C;  2J53 A;  2SEB D;  1T3Q A;  4P16 A;  1RYJ A;  1F77 A;  3LB8 C;  1V1O A;  3TSS A;  4C7Z A;  3Q8B A;  1V8C A;  1YNT E;  2WDQ B;  2LGI A;  4ZYS A;  1E7P B;  1F2R C;  1TS2 A;  2L1A A;  4N58 A;  1FMA D;  3NS1 A;  2PVO D;  4US8 A;  1ZE3 D;  1MI0 A;  3AED B;  3BWU D;  1L4Z B;  2V3N A;  2N9K A;  1SE2 A;  1QF6 A;  2INP E;  2WLB A;  5AUI A;  4L2Y A;  2BT6 A;  5FKA C;  2BB5 A;  4WWM A;  1GB1 A;  3HRD D;  1PUT A;  2V0G A;  3AEG B;  3DWM A;  1ET6 A;  1XLP A;  2DWQ A;  2CU3 A;  1ZXI A;  1V97 A;  3AE7 B;  1XXG A;  2EEL A;  4WAF A;  2BB6 A;  4C7Y A;  1FXA A;  1L5P A;  1P7E A;  3SFE B;  3EA6 A;  4RGM A;  1R7S A;  2WXM A;  3ZJV A;  4HKQ A;  3IXS A;  2H89 B;  2K22 A;  2XNA C;  3VRA B;  4YSY B;  3VR9 B;  2YEP B;  5FR3 A;  1K50 A;  2M0A A;  4JWU C;  4L1B A;  5JXV A;  1N62 A;  1XCQ L;  2HDE A;  3EGR A;  3R2T A;  2M19 A;  4RH6 A;  1XO3 A;  5D3I B;  3UI3 A;  1SJE D;  2I2Y A;  3ETR A;  1YMH E;  2WXN A;  2Y5P A;  3C8Y A;  1JW9 D;  1NYQ A;  3LYY A;  3MJ5 A;  3TUO A;  3W9C B;  4B0M A;  4IKG A;  4YWG G;  1K51 A;  2QIE B;  3PZ8 A;  1YQ4 B;  4P6V F;  3P42 A;  3BVZ A;  1F2R I;  1L6U A;  4TQ0 A;  2RDH A;  4KGS A;  1B9R A;  3MP9 A;  1IUE A;  2NMQ A;  5E6J A;  2DYO A;  1IGD A;  4YTM B;  1QOB A;  1JWM D;  3Q8C A;  3AE2 B;  4YT0 B;  3ZYY X;  1KTK A;  2K3U A;  1FEH A;  2ZW1 A;  3TEW A;  3N9Y C;  3SFD B;  4LK0 M;  2PMV A;  1PGX A;  2PVG C;  4WUR A;  3BZD B;  1D5X C;  1KH0 A;  2N0S B;  1JML A;  2JU6 X;  5D3D A;  3NVW A;  3Q8A A;  3EUB 2;  1TS3 A;  2WS3 B;  1MHH E;  2DBY A;  4HKZ E;  1IGC A;  5GXG B;  1DGJ A;  3P4S B;  1ZXH A;  4OVZ A;  1PFD A;  4PT5 A;  2E3T A;  5T8I A;  1FFV A;  1Q10 A;  3SEB A;  1L6V A;  3VQI A;  1TKE A;  5G5H A;  4N6E B;  1PGB A;  3ZQ4 A;  5I4D A;  2J52 A;  1TY2 A;  2WXG A;  1MVK A;  2QJL A;  5HG2 A;  2MH7 A;  1ZDX A;  4JX1 C;  4DXG A;  1SBB B;  3B2G A;  5EE0 A;  2VZK D;  2QSD A;  2CJN A;  1FFU A;  3U52 E;  4RGO S;  3VRB B;  2BTE A;  4KGT A;  1FIQ A;  1GB4 A;  1DYQ A;  3FAH A;  2VZK B;  2IDY A;  1FCL A;  2RMM A;  4NJC A;  3AEE B;  1VZ6 A;  1V1P B;  4RF0 A;  5HFY A;  2WXI A;  4TQ1 A;  5AUK A;  5HI1 A;  1OQR A;  2EKI A;  4GDK B;  4OHJ A;  2AQ1 B;  3P4P B;  2IGG A;  3I57 A;  4M0W A;  5H8Y E;  3RPF C;  3OWE B;  4ZOH C;  4B0E A;  2QEJ C;  3ZJU A;  4RFB A;  4C80 A;  1A70 A;  1C4C A;  1QIL A;  2LEK A;  4LTU A;  1HXY D;  2YEP F;  2W3R A;  1L4D B;  1QOA A;  3P1M A;  1NEK B;  2NTT A;  2ONQ A;  1AWD A;  4EE2 A;  5D7G A;  1SEB D;  2WU2 B;  1FXI A;  3AEC B;  1VDV A;  3U7Z A;  2G9H D;  3ZGZ A;  2BS2 B;  4HJG E;  4C56 C;  2WXL A;  1N60 A;  3MFG A;  2PKO A;  4NZL B;  1BUI C;  3NRZ A;  4LLG M;  2R61 A;  1T5X D;  3W5V B;  3BYT B;  2V3P A;  2JSV X;  2FE8 A;  2X38 A;  2KWD A;  1TYG B;  2WXJ A;  2W3S A;  2BS3 B;  1FNV A;  3AE1 B;  3IAM 1;  2WQY B;  2WU5 B;  3AEB B;  4OW0 A;  1QT9 A;  2GB1 A;  1T6B X;  3RFZ B;  1UUP A;  1CK1 A;  1TJE A;  4MAC A;  4ZHP A;  3Q8E A;  3AE4 B;  3AB5 A;  1N61 A;  1UWM A;  1KFY B;  1TY0 A;  5H92 C;  4JE3 B;  2JXT A;  3V05 A;  2L52 A;  2BW2 A;  2WDV B;  1ZOY B;  4ARC A;  1XLQ A;  1N63 A;  4XDD A;  2W54 A;  2MJD A;  2GI9 A;  3BK2 A;  5LNK 1;  1EU3 A;  3AE5 B;  3VR8 B;  3KWV A;  4NAW B;  1FNW A;  5C3J B;  1JAL A;  1YN5 A;  4JWS C;  2PTL A;  2DYM A;  5BYQ A;  4OZC A;  3U2S C;  1QLB B;  2PLP A;  2IGH A;  4D2K A;  3Q69 A;  1EWY C;  1PDX A;  2SAK A;  1VZ7 A;  4A8X C;  2NTS A;  1J7C A;  3H8H A;  1MPE A;  3AE3 B;  3BVG A;  3TEX A;  2LFI A;  1GAQ B;  2ON8 A;  2W55 A;  4NAM A;  3NVV A;  1WSP A;  1XF5 L;  4KGR A;  1SIJ A;  3T3N A;  2KQ4 X;  2K5P A;  2JYE A;  2JYT A;  3P4R B;  4H2A A;  1E6E B;  4CQN A;  2KMM A;  3R2I A;  1VZ8 A;  1C9F A;  4YSX B;  1XLN A;  3V3X A;  3PZ7 A;  1IBX A;  2XN9 C;  4RCO A;  4TSS A;  1NI3 A;  3CWI A;  3AMZ A;  5FK9 C;  3FIL A;  2IGD A;  2WXK A;  1KLG D;  1JWA D;  2QIL A;  1HEZ E;  3TEZ A;  1FRD A;  1RFK A;  2INN E;  1YJJ A;  1C78 A;  1L0Y B;  3L4P A;  3O13 A;  3AN1 A;  2AQ3 B;  4USA A;  1CJE A;  1TS4 A;  2JWU A;  3HUI A;  2ZW0 A;  5BYR A;  1D6E C;  5G5G A;  4XWT A;  1WGK A;  3KQ4 A;  1XLO A;  3BK1 A;  4A55 A;  3IAS 1;  2K0P A;  2BYT A;  1J7A A;  1K53 A;  1JCK B;  1SF0 A;  1JWB D;  2Y5C A;  3AE9 B;  3DWG C;  3MHZ A;  1I4X A;  4XDC A;  2WXP A;  1ZPS A;  1EM7 A;  3NZ3 A;  1KLU D;  4GLS C;  2WXQ A;  1DOX A;  4MH8 A;  1RM6 C;  1UGJ A;  3KWL A;  2B76 B;  4IOI E;  2WP9 B;  4KKJ A;  5TSS A;  2DLB A;  4A6Q A;  1VRA B;  3URY A;  2OED A;  1JRO A;  3AM9 A;  1KRH A;  1CQV A;  2Y3A A;  5BMG A;  5BYS A;  1CZP A;  4AS1 A;  1WRI A;  4A90 A;  3AE8 B;  1C76 A;  1HZ5 A;  1UWX A;  2BBC A;  1HZ6 A;  4ZRQ A;  1EU4 A;  4KKI A;  4GDL B;  1FNU A;  1YN4 A;  1L0V B;  2ACZ B;  3W1S A;  1J7B A;  1ROE A;  1QQR A;  1I4P A;  1E10 A;  1UNS A;  3TEY A;  2JZP A;  1MHX A;  1VLB A;  2GRI A;  2HTM E;  2JX5 A;  1QKZ A;  4L23 A;  5BMH A;  1NYR A;  1D5M C;  1N5X A;  3W5U B;  3NUH B;  3W2D A;  1WWT A;  2N9L A;  1VR9 A;  2H88 B;  2RDG A;  4ARI A;  3KLS X;  4UDU C;  4RGN A;  1HQR D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...