3EUNA

Crystal structure of the 2[4fe-4s] c57a ferredoxin variant from allochromatium vinosum
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDAIIKDPSHEETEDELRAKYERITGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin
publication title Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Electron transport
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3eunA00
3MM5B 1Y4ZB 1BWEA 1FRHA 2WSCC 4OMFG 1GT8A 2FJEB 3MM9A 3OR2A 1JB0C 4YDDB 2C3MA 6FD1A 1B0VA 3HKZD 1Q16B 2PMZD 1GTEA 2IVFB 2WAQD 1H7WA 1K0TA 1FDDA 2V4JA 5FD1A 1C4CA 2C3YA 1VJWA 1FXDA 3OR1B 5E7OB 3IR6B 3MM7A 1FDNA 1RGVA 2C3PA 1B0TA 1DURA 1GTHA 1KQGB 2C3OA 3EGWB 3MMBA 1BC6A 2UZAA 1F5BA 4Y28C 2XSJB 5BYSA 3GYXB 4RKUC 1G6BA 5BYRA 2VPWB 1WTFA 3EUNA 1FERA 1H98A 2C3UA 1CLFA 1ROFA 1FRKA 1FRMA 3MMCA 3MM9B 3OR2B 1AXQA 1HFEL 1XERA 1KQFB 4AYBD 1F5CA 3MM5A 1GAOA 2FD2A 2V4JB 1BD6A 3MM7B 3LW5C 1FRLA 3MMBB 3MM6A 2O01C 1D3WA 4L6V3 1IQZA 1R27B 1SIWB 1FEHA 2VPYB 2WB1D 2Y0SD 2GMJA 2PDAA 7FDRA 1SJ1A 3MM8A 1FRJA 3PNIA 1FCAA 1FDBA 1FDAA 4DHVA 2GMHA 1PC5A 1JNRB 1FRIA 5CH7B 1KEKA 3MMAA 1Y5IB 2FGOA 4XDDA 2WSFC 2V2KA 5CHCB 1FF2A 1FTCA 1FRXA 1A6LA 5L8RC 1Y5NB 4ID8A 2FJAB 2VPXB 4OV1A 3MMCB 2VKRA 1B0PA 6FDRA 1DFDA 4CI0B 1FXRA 3C8YA 1FD2A 2VPZB 3IR7B 1JNZB 4XDCA 2FDNA 2Z8QA 1SIZA 1DAXA 5BYQA 3OR1A 1H0HB 4KT0C 3MM6B 2ZVSA 7FD1A 1Y5LB 3EXYA 1IR0A 3MM8B 2XSJA 1BQXA 2FJDB 1C4AA 3IR5B 3MMAB 2FJBB 1BLUA 4XK8C 2WSEC 1G3OA 2PA8D 1F2GA 1PC4A 2C42A 1H7XA
chains in the Genus database with same CATH superfamily
2J76E 1TL4A 3QRRA 3HKZD 2WW8A 3MURP 4NLTA 2VBYA 1VCTA 1E6VB 3PYEA 3HULA 2HS0A 3WIUA 1WC4A 3W2WA 3W2VA 1F2HA 2H48B 2RMLA 2DH8A 1D9FA 1VC0A 5C5JA 3OTOJ 2R7QA 5EWEA 4B02A 3PRVA 4DV4J 4K4WA 2BACA 3SQGB 3B8HA 3HO1A 4CNZA 4G1QB 5A76A 4P71A 3T19A 1EZZB 1U1RA 3QMQA 2WBMA 2G2ZA 1MMNA 1X5SA 1LQ9A 3S6EA 1GMVA 4FP9A 4UOGA 3A3NB 3U27A 1SJ1A 4RUHA 4PG5A 4DF4A 1REVA 4C8KA 3M8QA 3TZZA 3DLKA 3EPGA 3MOZA 4IFYB 4N47A 1TUVA 1J27A 4EU0A 1MG7A 1XNQJ 1PSDA 2UVWA 2YPZA 2VHGA 2HHUA 4DSLA 4LVNP 2W24A 3O8WA 2RNEA 3C8YA 2AW0A 1HR0J 2HK3A 3ZTOA 4G1IA 5T7LB 2DNOA 2HBZB 2V4JA 4F0HA 3DRSB 4ED0A 3PJXA 1FJEB 2E66A 4ANDA 1YI2S 3H8YA 4Q2MA 1UZDA 5ETQA 5KFQA 3VWSA 4W92B 4WF9Q 3ENWA 2AU0A 3I6PA 1WC1A 3W62A 3QAEA 4OL8A 1WORA 3TR5A 1S9EA 3EWGA 1JLFB 3MECB 3LWLA 2MKJA 1U1QA 3OTBA 1B99A 5C2CA 1PYSB 2RKIB 1ZZNA 2IC3B 2LP4A 2KFNA 4DV5J 3KJVB 2HPUA 4QWBA 1AZSB 2B56A 1UVNA 3GIRA 5KFFA 2DGUA 2CVIA 3CMAS 3HK2A 2HFSA 2AJ2A 1BWEA 4DR6F 4YDDB 3UFCX 4DEZA 4ATNA 4TQRA 2A0FB 3FEYB 4R25A 2F9JA 4P6QA 1QJHA 2AYMA 3W9IA 2IY5B 1F5BA 2HRYA 3TW0A 5BYRA 3KK3B 4Y2IA 3I55S 2Z58B 2CG4A 3HSDA 5KT4A 5IV4A 2GC8A 3NMAA 3UD3P 3M6XA 2W4DA 4PZVA 2F8HA 3HJVA 3MMJA 4TU7A 4DOZA 2JFKA 1SJ3P 3M6WA 3BYRA 1TELA 1JQGA 2N4DA 1TL1B 4I2QB 4B3TJ 2BABA 1RDRA 5L8RC 2EKYA 4Z7YA 1HYSB 4ED6A 4NI2A 4RW8A 1SB6A 4CM0A 1N0UA 3OT9A 3Q23A 2Z8QA 2VG5B 4DPTA 5IS2A 2D7SA 2ZM6J 4IRCA 2VFVA 2ZZMA 8RUCA 3T3FA 4BC9A 4I6AA 2NXJA 1UETA 2IVMA 2UXDF 3U1LA 3NMRA 2L9DA 1PGZA 3CE8A 2FUG9 2GGPA 3UO0A 1RTJA 4ZIWA 1WOOA 3QJJA 5AJ3F 2E29A 1KRPA 4CZCA 3NWRA 4IQXA 4RL1A 4JI5J 1YJ9S 3DYAA 4CM2A 4KJIA 3BGOP 5CYQB 4KC5A 4YHHJ 4B9MA 2NREA 4ZLJA 1V3ZA 2JEJA 3DC2A 3D1OA 1R27B 3D6FB 3HHLD 2DGQA 1UEVA 4F04B 3S8SA 1NAQA 4ZN3A 2UU9F 3POTB 1XTZA 4QYZJ 1WC3A 1Z4UA 5L1KA 2R8GA 1DZ5A 4P2XA 4F0MA 3NLCA 3CO0P 3DLGB 4KY3A 3W63A 2ZH7A 1V5IB 3BEGB 3BBFA 5EGYA 1S99A 1SKUB 3CULA 4DX7A 1ZA1B 4ZLLA 1SQEA 3NCRA 4X64F 3TAMA 2F5GA 2ATCB 1CJVB 3I5CA 2MZSA 3SDEB 5KFJA 4NRTA 4JI0J 2OIHA 2HHTA 2ACMA 3HPOA 1VQNS 3O6QA 3H90A 3I96A 1JX4A 1S0MA 2MEWA 2ZD1B 1NJZA 4KHPJ 2CPYA 1ROFA 2HS4A 5DZ6A 3K58A 4F3MA 1U09A 4NA3A 2YX1A 1S6QA 2ALZA 2DCLA 2RDDA 5C25B 3R7BB 3CJRA 2H4YB 1FDAA 5CXTA 5DM7Q 3MFHA 2CDQA 4LRBA 1T3OA 3RB4A 2FVSA 3OTCA 4LVOP 3KHLA 1OMSA 1IR1A 1KLMA 2QYGA 2CPJA 1YWXA 3PYFA 1YTYA 2H51B 3IRXA 1DTTA 4HEA9 4B3RF 1C0TA 4MH8A 1HD0A 3UCZP 1XMBA 1DQAA 1CQNA 1ZAVA 1KHVA 2R7TA 1VC5A 4LF6J 4PRFA 4DUTA 1ICEB 1GMWA 4Y2KA 3SZ2A 2L9WA 4M5JA 2A1BA 2QTWA 2CRLA 4LFAJ 1SH0A 1S1XA 2VQEF 5FLXU 1F9FA 2HQGA 3G2XA 4DUYF 2GMLA 1RAIB 4K2JA 2K8GA 2MKIA 4NLGA 2DTJA 1IBKF 2C2DA 4DUZF 1QTNB 3GG1A 3B4MA 3MMBB 4E98A 2DNKA 4B9TA 1DARA 1HBOA 3IO1A 2DHXA 1F9EB 3KJQB 1HW8A 1FDBA 2L08A 1LWCB 3TX0A 4LF4F 3DHWC 3IA0A 3VZHA 4OZ0A 2DY1A 1RLCL 3AHPA 4JB8B 2GNKA 2OFHX 5HP1B 1SH3A 4O0IA 5BYQA 1S9GB 1RHRB 3OR1A 3NAHA 3W9JA 1VQ8S 2QLBB 2ZJQQ 3C6UB 5THWA 3JQMA 5K5MA 5HMXA 1APSA 3OR2A 1HMVB 2HFUA 1U45A 1IKVA 4ZJOA 2CQIA 4R0EA 3SCIE 1YZ7A 3I0SB 1NSQA 1FXDA 2Z4PA 2MZ1A 3PW5A 4N41A 1EETA 4A8XA 2YVSA 2IVYA 2VC0A 2OELA 2XI3A 1FERA 5KT2A 5GAEU 3KKFA 1HNZJ 1N5YA 2HNDA 3OW2R 4BDPA 4OHXA 2R8JA 3PTWA 4OHWA 2BW7A 3W2WB 3W2VB 1LK5A 4WCEQ 3BQ0A 2ASJA 1VDHA 4DX5A 1AW0A 1BQMB 1WF0A 2XC9A 1LV5A 4ILLA 1MW7A 5F8JA 1YQHA 2RUGA 3KJNB 2CQDA 4RW4A 1R0CB 4RUCA 3MR2A 5J2NA 1HNWF 3K2YA 3O44A 2QO3A 4LIRA 3Q8UA 2R2RA 4NPOA 4W4MA 2LYVA 4ZITA 1M5SA 4LSNA 1REVB 3M8QB 2RILA 2DNYA 3NBPA 3VCDA 2XMAA 1L3SA 2O67A 2D1CA 3DLKB 5HL7Q 3QIPA 5B0AA 5LM7E 3HSZA 2QE5A 2JWNA 4AQYJ 1ZA2B 4YB6A 2UZAA 3RRKA 2C2RA 3ICLA 2CPZA 2QC3A 1FNMA 1XNRF 5CD4A 4PG4A 2RUSA 3M2RA 1AXQA 1Y9OA 2MSTA 2KZMA 3KLGA 4KO0A 2V4JB 4FS2A 2LA4A 3BGLA 4GKKF 4ELVA 1MLAA 2NSCA 3LH2S 1GEHA 3AT1B 2G2YA 4DV3F 3MAHA 1P27B 1CSJA 2JJ4D 2RIJA 2JLFA 4KPYA 3IGVA 2HGNA 4ED2A 1S9EB 5B08A 2B7CB 3BGRA 3BV8A 5H1SV 1VC6A 3FJ2A 1URRA 4RW9A 2RRBA 1N88A 3IBWA 3HKWA 1FRHA 2M3DA 2I38A 3W65A 2ILZA 3EDQB 1YG0A 3FEXB 2CQCA 3G86A 1OWXA 3B54A 5JJBA 2C3OA 3TZWA 4DPXA 4DS4A 1GK8A 1Q82T 2QYCA 1ZETA 3GG0A 4M5LA 4WZMA 3VAIA 4LRDA 3N5BA 3ILLA 3A3PB 2L41A 3AB4B 2Q66A 2FLPA 5DQIA 4Q8EA 3A3OB 2CNOB 1XIQA 3JAMU 2IJNA 3UNYA 2V2KA 2B7BB 2IM2A 4ZVPB 4NXNF 3I4HX 1NPPA 3E8OA 1NKEA 1VMBA 4PYDA 4JI8J 4C8MA 2MDAA 1SL0A 4CT8A 3V4MA 4ITSA 3LP2A 1S57A 4OZ5A 2PEHA 2VICA 4CH0S 2DK2A 2W7PA 3IN5A 4NI2B 4RW8B 2JNJA 3S1TA 4RWXA 4K4TA 4A8QA 5AXLA 4Y28C 3GYXB 2UUBJ 2G1DA 4JV1A 3OHBA 3FDSA 1TUGB 3J81U 4UUXA 1KC8T 1CULB 2I0XA 5LXRA 3SEOA 2GGPB 1RTJB 2Y8YA 1H2VZ 3LUYA 2HWIA 4J91A 2O01C 1XQIA 4QYRA 4W90B 4YUDA 2CIMA 3GJTB 4KTQA 1P9YA 3D1QA 4X66J 3AFGA 3M32A 3CDAA 5F8LA 2UV8G 1UVIA 4KIAA 3DYAB 2DH7A 2MJUA 1PBUA 3ZZPA 4RW7A 2DRDA 2DIVA 3RYLA 4ZVTB 5MLCV 4P75A 3FNNA 5KFMA 3BYPA 3ISNC 3NP5A 4NA2A 4F4ZA 1UWBA 4URGA 1BLUA 1WEXA 1BQNA 4K59A 1OQ6A 1NSKL 2H5IB 4OJ1A 2OD4A 2IRUA 2D3OR 3T41A 1TTHB 2FQQB 1VQ4S 5KFCA 2LKZA 4LF7J 4EZ6A 3CCWA 5IWAF 2FY8A 4M5NA 4HLBA 3C15A 3TNVA 4DN9A 1QSYA 2O66A 5LT5A 5B0CA 4B9LA 3FSXA 1UA0A 2CXEA 4NX9A 1IJEB 2X3DA 5HVGA 3FSIA 3TAMB 3CNQP 5KFDA 2XMJA 1TL7A 3MAAA 4ILRA 4L6V3 2EWHA 2WVBA 1U48A 1RZMA 2RRNA 1FEHA 1IBLJ 1WI6A 5DLGA 3M6UA 1WWHA 3LALA 2LQ9A 3LP1A 4PPDA 2BJ7A 5BR8J 4CO3A 3NS5A 1S6QB 4NLRA 1BE4A 1FESA 2XCPA 3D4JA 3ZXWA 1KNZA 2QMXA 3M6VA 4R8UA 3V6KA 5AE1A 3CMES 5H9FK 2FJBB 2XZWA 2VA3A 1U6ZA 4QWAA 3I5AA 2QA2A 5H9EK 1G1XA 1T11A 1VK3A 2BEFA 4LT6A 4URSA 2Z30B 3GILA 3KK1A 3QAUA 2QL7B 3V6JA 4FKYA 3BM7A 3G8SA 2G4BA 4FZVA 4K4SA 1D8ZA 3IRXB 1DTTB 4KHMA 4JI2J 2DNPA 1C0TB 4N77A 2ROPA 3MF5A 4DCOB 2GHVC 3OFHA 1YBTA 1DBDA 3VALA 2OSQA 2Y1RI 4DF8A 4LF1A 2M4MA 1XC9A 4URQU 1NCLA 2VBWA 4FVCA 1HI1A 1S1XB 4HTIA 2A10A 1Y00A 3V2UC 4UQTA 3OD2A 3V6HA 4YY3F 2VKRA 4AL6A 4RO0A 3GYGA 4B9NA 3B6BA 4NXMJ 3AD8C 2CZ4A 1J5OA 4ZJQA 1HBOB 3AA9A 2V2QA 4B9UA 4LQ9A 4P7TA 1KKHA 4U7UK 2AGPA 5IT0A 1ZS6A 2IMOA 6AT1B 1R8PA 3MEGB 1U4BA 2O1PA 3JSYA 2IVFB 3CVKA 3GPAA 3OR1B 3MM7A 3ZZYA 3NNHA 3PW4A 3CJ3A 3T1YF 3D28A 5DG9A 1JLBA 4PEOA 1ZTTA 4YB1P 2VL1A 3OR2B 5M2RA 4JI6F 3ENAA 2C1EB 1IKVB 3BPDA 3OL7A 3DLLQ 2HQFA 1EETB 2XMUA 4GO7X 5DG8A 2WBRA 4YR3A 1H72C 3OPKA 3PX6A 4I0WA 2WB4A 1N5YB 1K9MT 2HHPA 2HNDB 3GSDA 3OFGA 5KFSA 2RU3A 1YVFA 2UUAJ 5F0WA 2GS8A 1WG5A 3QWUA 1PKUA 4LFBJ 2IBKA 1D1UA 1AYEA 1LKZA 2BX6A 3LO3A 1EQMA 2H9ZA 1NLKL 5K8PA 2RQCA 3OVAA 4LF5J 4NLWA 1R31A 4NLPA 1Y4ZB 4F50A 1N36F 4RW4B 1RACB 3HSJA 5I4MA 4IRKA 2VIHA 2DRAA 5J2NB 2DY9A 1V3SA 1VHIA 5D3GA 1S6PA 3GFYA 3V4IA 3BH6B 1KQGB 1FNOA 4IH6A 1OIAA 2F65A 4ECRA 4LSNB 1SQGA 2W1BA 3FQKA 5F9LA 2YWWA 3VQTA 4J9PA 1XMOF 2UXCJ 3QIPB 3PZPA 5D77A 1X4EA 1JLEB 1VGYA 4Y2CA 4NEYA 4EFAC 2YNHA 4X4PA 1IKXA 1TV6A 2H1YA 2F1FA 2LDYA 2VFTA 3TQ1A 3THPA 4V1Ak 4CCHA 1RAAB 3CCSS 2YKPA 3CD7A 2HK2A 1PYTA 2ZWOA 3M2RB 2CPXA 1N33F 3KLGB 2P8IA 4RNOA 2QIFA 1TZ0A 4KO0B 1J5EF 4DL5A 1QUPA 2MQNA 1QDUB 5A8KA 4U6PA 1C2PA 2CJXB 5JUMA 3LF0A 1U6FA 1T9XA 5ETNA 4KB7A 3I9V9 4K2XA 1RT5A 2ZH6A 1JLCA 3UCUP 1VBKA 1T9WA 4RX6A 3Q89A 2IBOA 4DX8H 1NJWA 1QVFR 3BO3A 3R7NB 5FLXY 4F4AA 4OYAA 3BGRB 4IUFA 4DL0C 3K5PA 4RW9B 3WX8A 1CJTA 4X65J 4LUBA 4LREA 1FRKA 1QLNA 2KYXA 5ETOA 1SJ4P 4ZLPA 2CQ0A 3TA2A 1VRQC 2ZH8A 2DPJA 5KG2A 2JLEA 4DV4F 3EZUA 3R27A 1RWMB 2OPSB 2R8HA 1KEKA 4CT9A 1S1UA 2YPYA 1N8RT 2UUWA 5ADZA 4LRCA 4O4GA 2WVFA 4YOEA 1EARA 3N28A 4A8WA 4H4KC 2D69A 4A8YA 1EJ7L 2HKEA 4QCLA 3CUNA 2HHVA 4RNMA 3CJTA 2XGQA 4CH1A 2NSBA 3NGUA 4OI0A 2CQHA 2Z0GA 3GJSB 4EO8A 4R0JA 1RWWB 1XNQF 3FCHA 2RVJA 2JC0A 5JVHQ 5F3ZA 3LP2B 3PW7A 1TL5A 3IP0A 1DQ9A 1JXVA 4P9SA 4WKYA 3MUMP 3EYZA 3A8EA 1HR0F 3KNGA 3Q8QB 3ZO7A 3K89A 4Y3CA 4ICLA 4CLUA 1CLFA 5LJ3Y 4DR5J 5G0RA 2PE8A 5JXSA 4EWTA 3JQKA 4IG0A 1UPPA 4DQQA 3G8TA 1HIYA 2CPDA 3BO2A 3N0VA 1N34J 4IH7A 3P3DA 4DSEA 3V6DA 3A1YG 2HGMA 3K57A 5KG6A 2X1BA 3GONA 4QR1A 4H4KA 2DKOB 3H25A 1YJUA 1AUSL 2R2SA 3UD5A 4ECYA 4ZVQB 1GX5A 1FD8A 4ILMA 4OZ1A 5HVHA 4DQIA 3CF5Q 3ZTSA 5KOWA 3DN9A 2M5YA 1FJ7A 4FNIA 2VFUA 1C4AA 1SC6A 3M32B 3D0GE 1PC4A 4DV5F 3R5AA 3MTJA 4RW7B 1X5TA 3HHNB 4A48A 1WDDA 1HNXJ 2CFXA 2V9WA 1QAXA 4DLGA 4RUAA 4OYWA 5IC6B 1DJ0A 3UVJA 1QAIA 2XSFA 3Q86A 2OPQA 4CLSA 1G6BA 1O8BA 3H5YA 2ZKUA 1BQNB 2KFYA 1QAYA 3OJUA 4N8OA 4OQJA 1WSRA 1RWOB 1RBOB 2V4QA 4N56A 3K17A 3C15B 1IJFB 4X64J 4ZP9A 1CJKA 3K5NA 3WBZA 2AGOA 1UZHA 2VOOA 2J7UA 4ZOSA 2YWKA 3CB4A 1ZM3A 4TU8A 4RR5A 1FEEA 1TL7B 2YY3A 3ZZZA 4A8FA 1S0NA 3MAAB 4DL2A 1IM6A 1MWQA 5IT9Y 5GAEI 4B3TF 4FPRA 1I3OB 3EXCX 1FTRA 5KFAA 1RXOB 3CD5A 1F6TA 3GJRB 1IKYA 2ILYA 1K8AT 1JB0C 3W64A 2ZM6F 1Q16B 2ASLA 3ENVA 3MR3A 2NXEA 4TU9A 4NL5A 1KR4A 2XHWA 3QSIA 4PG7A 1GQEA 3PY8A 1NPRA 1R8BA 4R8UB 2MZQA 4JI1J 4RKUC 4I56A 3KG0A 2F4FA 1AFJA 1RHMB 4PPZA 4G6VB 2LEBA 1S0VA 3KK1B 3D0IE 1RU2A 4PAAA 3ADAC 3R5DA 5EWGA 1TKZA 2HLTA 3JAMY 4PCQA 3SV3A 4ZPWR 4M5DA 4WFZA 4FKXA 1RBLA 2CPHA 4YHHF 1RCXB 3BSNA 2VPXB 1SJQA 2XG8A 1BMQB 3Q8YA 2QG9B 1RT7B 4YP3A 2OEJA 5C7PA 1P1LA 2HVZA 3J80U 2PEBA 3MPDA 3O2IA 2H54B 3ONQA 3EGZA 4UOCA 3VZIA 4DI6A 3MGJA 1UVKA 3EZ5A 2MB0B 3JS9A 3R1HA 3FC9A 3GFZA 2DR5A 1T05A 1C1CA 4GKJF 2FJXA 2GHPA 3IRWP 3C19A 3UN3A 1DURA 2NQPA 3Q8PB 3TX8A 3VVTA 2W2OP 3OLAA 3RAMA 2EK1A 5HBMA 3BQ1A 1K0VA 5E3QA 3M8RA 2CNNB 1H73A 3MR7A 2YBVA 2R7SA 1IM4A 2E7WA 5U47A 3LWMA 2W4CA 3T5LA 4W98A 3MPYA 4P72A 2Q6CA 2BJDA 2IA6A 2YQ0A 4DR3J 2V0NA 3MM7B 1R8HA 3FSYA 1JLBB 2FLLA 4DFPA 4KHPF 3CCJS 2UP1A 1Y5IB 4DV1J 3RR8A 1WEYA 1WC6A 5DRKA 2DXEA 2V67A 3B4DA 2HRTA 4X62J 2LXIA 1SCJB 4QIEA 1WHWA 2W9CA 7AT1B 2BR0A 2EC0A 2DNZA 1BHNA 3R2DJ 2ZZTA 4L73A 2BOPA 1SL1A 2IM3A 1Q1KA 1FX4A 4CQ1A 3GWCA 1B64A 5B0GA 1NUEA 2VA2A 3LA0A 3TQEA 2VG7A 3P96A 3DRYA 4HKQA 4JI4J 3EGWB 4AD6A 3CMQA 1CS4A 1T8EA 1A9NB 4LF6F 4MFBA 1RWPB 1X7VA 2AT1B 4X4OA 2F8MA 2FD2A 5J1PA 5D3GB 1BD6A 1S6PB 4LFAF 3V4IB 2Y1IA 4CYUB 4RLEA 1ZPWX 1IR2A 3ELHA 2XYPB 4KKOA 5L46A 4WTYA 2BKNA 3K7RA 1Z2ZA 5E41A 4O3QA 4HT7A 4WPAA 3KJFB 2R7WA 2HIQA 2YKNA 4ZIVA 2B9EA 2XTJP 2EI5A 2V6AA 2YNHB 1IKXB 1TV6B 4RBTA 9ATCB 5KFIA 3Q2SC 5HAOA 1GXTA 3OSPA 2BRKA 3DCAA 4ZCLA 2XY5A 1PCAA 1RCOB 2J7WA 3VAMA 1X4AA 4G3IA 4QIVA 3EJMA 1FHTA 5A8KB 3PIPQ 3Q22A 4BHQA 4ZVFA 4FXVA 1S5ZA 2WVCA 1CVJA 5J2MB 4IOCQ 1VJQA 1H38A 1RT5B 4WP3A 2XQCA 1JLCB 3GSIA 4CO0A 4ZVGA 4AYBD 1X5OA 4YR2A 3PHTA 3EICA 3N79A 5DJBA 4D3HA 4C9DA 4B3MJ 2QGFB 1VQ7S 3PYGA 3PIOQ 1E6VA 1T7PA 1VQMS 1HNZF 1VBXA 3MM8A 4MYUA 2GMHA 3I4PA 1Y5NB 3T5HA 4J9OA 4PQAA 3IR7B 1S72S 1A7GE 3K59A 1SC4B 3NCPA 2MLXA 2LMIA 4B3OA 4HH0A 5SZTA 2JVOA 3C6TA 1FE4A 2QLJB 1QSSA 1S1UB 4F4KA 4NCAA 2BRLA 4O4GB 5M2PA 1O5JA 4TKTA 4JI7J 2OEKA 2LEAA 1OJ4A 4MJKA 3GP9A 2XLIA 1C1BA 4NLSA 1NK8A 1UJ5A 2QSFA 2KZZA 2XNQA 3TUIC 5LXYA 3RRGA 3H98A 3UDVA 1QM9A 3I0RA 3SFGA 3RW7A 4KBIA 2ZH5A 1NHVA 3JSMA 4AQYF 3R7SB 3VAJA 3H5UA 4MIBA 5KFYA 2FTRA 5HO4A 1VFJA 4F3OA 4EO6A 2ZOGA 2M9KA 4LF8J 3MCNA 2AKWB 3BKUA 2YKMA 3MUVP 2HQCA 4NEZA 4LSLA 1VQSA 2IA0A 4ICLB 1FWLA 5G0RB 2P9GA 1QVGR 1X31C 2W8LA 4O3OA 4IG0B 3E01A 1UFWA 3OUYA 2W25A 2HQIA 4DL3A 1T03A 4ED4A 2NUUG 2Y9HA 1IUJA 3V6DB 1RTHA 3CIZA 1RWKB 2ZHOA 1YRUA 1NDPA 2DCUB 2RQMA 5L9XA 1TVRB 1Y0HA 4EBDA 1SH2A 2ADBA 2E5HA 4C11A 2NZCA 1MROA 1M5KC 1K0TA 3BQ2A 5DDOC 2OJ3A 4DV2J 3RUBL 2P2CB 2DO4A 2VPWB 3MEDA 1LXNA 1D9DA 4WP8A 1N52B 2DH9A 4I6WA 2R4FA 2VPYB 3D3BJ 3UVJB 4UT4A 4IR1A 2X1AA 2OPQB 3JQJA 2PD1A 2CJ9A 1VR6A 3U7JA 3LTOA 2BDPA 2PI4A 1EQ0A 2PIIA 3OXGA 2F63A 1VK8A 2GVDA 4DWIA 1YIJS 4WKRA 4NLQA 1DHMA 1CJKB 4K4ZA 3ILOA 4DV0J 3NL0A 5B0FA 2MZRA 4JI8F 4ECSA 2FJEB 3MM9A 3QIDA 1GTEA 1SV5B 2HBRB 1RTDB 2B4UA 4O3RA 2HVHA 4WIQA 4OX9J 2CJKA 3NKYA 4OHVA 5A6PA 1SC3B 4ZN1A 2AJFE 3GJQB 3M2VA 4C3MA 4N76A 3OL6A 1IKYB 3DI6A 3D9BA 1MN9A 3F44A 4WFBQ 2UUBF 2G1HA 3KUHA 2K3IA 1NXIA 4BWMA 3OFEA 5F8NA 4HHUA 1N48A 4K8RA 2ZH1A 1MWZA 1Q4RA 4J9SA 2Q3PA 4ETXA 4GO5X 1UMJA 1FE0A 3KK2A 1TKXA 2HHHJ 3KLEA 1G2EA 1YBUA 4DPOA 4OV6A 1HL6A 2VF3A 2FC8A 2M52A 1TKZB 4X66F 2KVIA 3DRRA 4WTOB 2FHJA 3QO9A 1U2FA 3OHAA 2DGXA 4M5DB 3X1LB 1OSDA 1RTIB 1VLOA 3SSRA 4F26A 1NO8A 5I3PA 2M70A 3IBCB 4ZVUB 3CPWR 2GO8A 2XZTB 2P6SA 1HPZA 4CLWA 3N01A 2E9RX 1CPZA 4ID5A 5IOLA 4U7CA 2ZBRA 2HG4A 2MLZA 3CIMA 4J9MA 4X4RA 1T05B 1C1CB 4IOAQ 2EPIA 3O1LA 1F0XA 1WI8A 2MY7A 2ZJPQ 4N8NA 3KXDA 4EEYA 1U1MA 3AJDA 5HBMB 2E9ZA 5IQQA 3BBCA 5ETPA 2Z2MA 3MUTP 1JNRB 3MMAA 4O3PA 4ECXA 1KFDA 4C2MA 2A2DA 1FXRA 1JIHA 2DJWA 1FVQA 4IH5A 5AT1B 1IBLF 1LWXA 3IFEA 1B4SA 3L4BC 2QFIA 4H54A 5HN0A 2ZC3A 2MJNA 3JB9k 3H59A 4FBTA 5BR8F 3OL8A 3RB0A 1RBAA 5ETTA 1LNQA 4KSEB 1KVJA 3RAXA 2EFPA 2MKKA 2IDLA 4ZS6A 3R1LA 4P2MA 2XMKA 3UI3A 1RGVA 2W9CB 4DV7J 3IAS9 4F8RA 3I82A 2FHOB 3RU0A 3EUNA 3H40A 4PWUA 3HZEA 3R9LA 1LOUA 3B78A 2OTLS 4CTAA 4N5SA 2VG7B 2EG1A 3QGPA 4JI2F 3BS9A 1I94J 1FKOA 5D0RA 5LL6d 3ZNJ1 2H5EA 4ZVEA 4DCJB 1CS4B 1Q79A 2WSFC 3PO5A 2OPPA 5D4NA 4ID8A 2QL5B 1HBNA 4MFBB 4C97A 4RU2A 1WSVA 4LRAA 4ELTA 1UL3A 3CCZA 1A0OB 3HFVA 3AA8A 1GX6A 1RYRA 4UOHA 4Q2LA 2OD6A 3DDIA 4KKOB 2VB6A 2OAUA 3NWGA 3EM1A 1YJTA 1D09B 3V5RA 1CQMA 4OMFG 4NXMF 2FY1A 2B3TB 4JBCA 1UCNA 1FJGJ 1SKWA 2YKNB 5KT7A 1URNA 1IN0A 2N7CA 3T6BA 3AODA 1S9GA 1O6XA 3EPIA 2VONA 3AXMA 4QQBA 2CJAA 1TFYA 2NLWA 2R2UA 4TY8A 1HWIA 3T9NA 4F4YA 3ETOA 1BXNA 2HVIA 4AT1B 1EB0A 3W3SA 2BJ3A 3SCLE 3GIMA 2WB1D 3K8WA 4F67A 2K7JA 1HW9A 3DU6A 3KLIA 4XDDA 1V3RA 2UVVA 4UUWA 1W26A 4C8NA 2QA4S 2Y8WA 3PRBA 5KT5A 1N56A 5LMNJ 1RKIA 1YSJA 4ZKAA 3RBDA 4JV5J 1WNEA 2R7UA 2B0GA 3J80Y 3ZC4A 3HP6A 1RJJA 2B4VA 3OBIA 2VASA 1S79A 3H5SA 3MM8B 3BZQA 2YNGA 2UUAF 3A8KA 1BQMA 4PG6A 4LFBF 3Q8VA 4ZPBA 4CWBA 2E5LF 3SFUA 4PWDA 3BSOA 3IR6B 5EHHA 2C3PA 4B3OB 4LF5F 3VGUA 2D3ZA 2AZ1A 3C6TB 4FF4A 5B0BA 2HZCA 1OY8A 4NRUA 1RA6A 2DEIA 1M90T 4OYOA 2OP5A 4KV8A 2W2PP 3UR3C 3BO4A 1RWUA 4FYWB 1C1BB 3FZ2A 4LJMA 2VU5A 5J1EA 5KFGA 4RPFA 1IQZA 2Q43A 4GVLA 2VV5A 3I0RB 2UXCF 5GADU 2BJEA 3JSMB 1HI8A 1ITPA 5AE3A 4M5IA 3PX4A 1X60A 4EYHB 2J7KA 2JSXA 2RAQA 1RAFB 4WWSA 2YKMB 3DKDA 4LQ3A 2R42A 4LSLB 4QIFA 3F41A 3RBZA 4DR2J 5L39A 3IWLA 2B8PA 1QAJA 3MR6A 2XMTA 2KG0A 2FZCB 3CTRA 4HHHA 1TMJA 4OLPA 3E01B 3OUYB 4MMOA 4NMLA 2N7YA 1D0EA 3LANA 2J8SA 2J0QD 2I1RA 1T03B 3SQOP 2EFNA 2RU9A 2KFZA 1RTHB 2FLOA 3M8WA 1WTFA 4ENOA 3MI7X 4O3SA 1KS2A 5CCMA 3G96A 3FMWA 3R2CJ 3PJWA 4OYBA 1RTZA 4C11B 3D2WA 4OFZA 1MROB 2HGLA 3G6ES 2AWZA 2KHCA 4J9QA 4M5KA 1IKWA 4KRWA 5BJRA 3H0PA 2CDRB 4X65F 1GFWB 4QIGA 2VJUA 4CLZA 3IG1A 1PYOB 3NY0A 4C0BA 4IQMA 3SCJE 3MEDB 1M1HA 2XY7A 2RS2A 2K06A 1YX2A 2JEFA 1UKUA 3CCRS 5EWFA 2W2MP 1S1TA 4I69A 4K50A 4BCAA 5HMYA 1U25A 4Q5VA 4OJHA 5K20B 4X4NA 3OQ2A 1XR5A 5E2QA 4NZ6A 2YWGA 3CWJA 3ISND 2EFVA 2GVDB 3CDEA 5DS7A 3CJKA 2MHNA 3TJAA 3OTDA 2YH1A 3MM9B 1RB0A 3LPEA 2DGWA 4QPXA 4P73A 1NEEA 4CO4A 4L3KA 4M5HA 4MTPA 3THVA 4DR5F 3BPSP 2FGOA 3M2VB 2R7OA 1VQ6S 2V8DA 3DI6B 1QTMA 4YFUA 1VIOA 3HM9A 2LU2A 2MSSA 2AP6A 2QV6A 2G13A 1N34F 1CULA 3OLBA 1FFGB 4CH7A 1LK7A 1YJWS 2LLZA 1VHFA 3QFHA 4QPTA 4YQWA 2M7SA 4P74A 3KK2B 1TKXB 1RE1B 2CWKA 3KLEB 2IMWP 1S9FA 3DRRB 3QT8A 3QO9B 1S1VA 3HDSA 3PFEA 1F60B 1TK8A 5A0YB 5K8MA 1H98A 5E33A 2HBYB 3R5CA 4K4XA 1HNXF 3G82B 4CO5A 1HPZB 4QWEA 4TLQA 3JYTA 3CCES 4G1PA 2XB2D 4ID5B 1N5SA 1CEZA 2U1AA 3KFWX 3W7BA 2CQ1A 4GKJJ 3AXKA 1YJNS 1A6LA 3JXOA 8AT1B 2WW4A 3HI9A 1Y3JA 3HVTA 4HHJA 4XPCA 2DR7A 5K8NA 1FKPA 3NGKA 4K4YA 4L3NA 3CC2S 2XSJA 3MAQA 3MMAB 2DITA 3NAIA 5DG7A 4NZ7A 3CJ4A 4I7FA 2DGVA 2LQ5A 1JXEA 4ED1A 1NRKA 3G8QA 3L9ZA 3TVKA 4USTA 4NOHA 4X4SA 1OY6A 2A6OA 1YITS 1PJ5A 3B82A 3U02A 1FFWB 5D4PA 2DHGA 1FI4A 5FIIA 2QL9B 3BF4A 3HX9A 1XJWB 3MMCA 4FN5A 3K0JA 1F9HA 3LGMA 4CO1A 2VJVA 1QUVA 2QLXA 4ES3A 4Y65A 4JI1F 4Z7CA 1SXLA 1CJUA 4L75A 5E3PA 4UQGA 2M0GB 1GXUA 1FRJA 2F9DA 4EZ9A 3JTNA 4G65A 1U0HA 3E2EA 2QSWA 1EKRA 4A8OA 2PGCA 4WU3A 3FCWA 4LR7A 4IDKA 5HJXA 3DGPA 4J90A 1KQSR 4CTAB 3UDLA 4YN3B 4WZQA 1FKOB 2OUGA 1NH7A 2FPHX 2MQOA 1OYDA 1S1WA 2XS7A 2MQLA 2OPPB 1VRTB 1HBNB 2ZBQA 3DOMA 3ILIA 1MSWD 2RRAA 5CA5A 1LWEA 2OSRA 3MEKA 4M5MA 5D0EA 5K14B 2V8GA 4UTGA 4XO0A 1ACMB 1FDNA 1T95A 1I6JA 4C3KA 4M63A 1M1GA 1YKWA 2HNZA 3L7PA 4KFBA 1SI9A 4M1KA 4DFMA 1RUSA 4XTTA 3MEGA 4DQSA 4Y2AA 4WFNQ 1KN6A 1HHQA 4C8YA 5LSLA 1RT4A 1NB7A 2YWHA 5I3QA 4QU7A 1PAUB 1HQUA 3QRQA 3P5BP 4ANCA 4B9VA 4DR3F 1Q86T 1X4CA 3PW0A 2R7VA 4TY8B 2Z2ZA 2CNLB 2KT2A 2FVRA 3JTPA 5HJYA 2WRMA 4I64A 2CPEA 4DV1F 2ZFHA 2L9NA 2FHMA 2PA3A 4E0DA 2HNYB 3CC4S 3KLIB 4U95A 1VS3A 4X62F 3MM5B 4Q44A 2G0IA 2KT5A 4WBFA 4AXJA 2HAFA 3LAKA 3I31A 1NMEB 4CLTA 2B51A 4PG8A 2ACYA 2YNGB 1HHTP 3KG1A 2EBGA 3GE9A 3M7VA 3QT7A 4JI4F 2WVEA 2PFFB 3D54A 4PWDB 3H4DA 1L3TA 1O0PA 1U24A 4FNHA 1YJVA 1S77D 2VKZG 3KTQA 1TKTA 4U8VA 1VI7A 3SXLA 1R8CA 4OX7A 2BVZA 1OY9A 2Q79A 1TK5A 1ULRA 5DETA 1U1OA 3WDOA 3GCWP 4KV8B 4K5RA 4ECWA 4JYAJ 2VD3A 4XDCA 2EFQA 5DM6Q 1DAXA 1F1BB 5J1EB 4F4WA 4AL5A 4H4OA 1M0SA 1KSPA 1JLEA 2ZEJA 2VFSA 4YS2A 4NYPA 2AF6A 3D0HE 3V81A 4PR6A 4TYAA 1RI7A 3I56S 1NK5A 4PKDB 1VQYA 1YJRA 3UCGA 3TYTA 3QGIA 4WIIA 2PC6A 4OI3A 5KAKA 2BE9B 4JP8A 2BYCA 1RHKB 3JSBA 5F3TA 4C0OC 4ZLNA 3H2VE 3N6MA 2BBEA 1WHVA 2ZUAA 2EK6A 3GTYX 3PX0A 3DGVA 1YHQS 3QZ8A 2OEMA 2IYGA 5IT9U 2V9KA 3DLJA 4Y6IA 3FK4A 1S10A 4I2PA 2RDJA 4B3MF 2AJ0A 5BXIA 3IS9A 1GH8A 1IKWB 2E7XA 3UWTA 2M88A 2PT0A 4RUBA 3UPFA 3PYDA 2JFDA 4O3NA 2AEFA 3IG1B 2AYBA 4QR2A 2OPSA 2NZ4A 1R7IA 4MKVA 5C42A 3KNAA 2E1MC 1BUXA 1ELOA 4USMA 4QZVB 4C3LA 4Z2XA 1S1TB 1NK6A 3HJFA 1RAEB 4JI7F 4QBUA 4DR7J 5ITHA 2YTCA 3W66A 3QSYB 3KHRA 4DN0A 3IM9A 2IRXA 3CCTA 2W9BA 4RNHA 1WC5A 2LQBA 4ANEA 3CJKB 7FDRA 4FF2A 4LFCJ 2MQMA 4C8OA 3KDOA 2A3JA 3D3CJ 5L1JA 2J9EA 5KFHA 4C4WA 1MU2A 4LF8F 4F4XA 5CYMA 3LPYA 3DOKA 1WF2A 1WOPA 3W8GA 3VAHA 4DR1F 1RT3A 2QA1A 1UJ6A 3LGHA 3CT9A 3P6YC 3IWNC 1Q7LB 3SYZA 4IKAA 3MPVA 3QWPA 1OO0B 3J7A1 1Q0NA 3RAQA 4IFVB 3MFIA 5CZVA 2DNHA 4Q43A 4ELUA 2OTJS 2ZOFA 2EXUA 1WKLA 2JL9A 3NGSA 2CAJA 2HFVA 2BKOA 3CJQA 3ISZA 4MK9A 3M8YA 1KDNA 2AEMA 3AQOA 2CZ9A 3FEZA 1LWFA 3M8PA 4B3SJ 4WK3A 4DV2F 2UVRA 4IO9Q 3PM9A 2F4VF 2JRSA 2KXNB 1U1NA 2X3GA 3BN4A 1S1VB 3FGVA 2SXLA 4OZLA 2RHSB 2ZHBA 4CI0B 1UFKA 1KWMA 2ZE2A 4KGMA 2FDNA 2Q1LA 1H3DA 2DYAA 1DTQA 3D68A 2QEXS 4OX8A 3JYTB 4EK2A 1VBYA 2IFXA 5DDPC 3SSQA 4DU7A 4YR0A 2KU7A 3PEHA 5E3AA 2IAJA 2VQFJ 4F3QA 1X4BA 2E1AA 3HVTB 4RU9A 4X4VA 2V2VA 4KGZB 2IJFA 1NH8A 2HZVA 3ZZUA 1FKPB 1J2VA 3C14A 4DSKA 3E3XA 2Z2LA 4DV0F 1M5VC 2XBPA 2XSJB 4EBEA 1FJCA 4AL7A 3L7UA 1NZAA 4I7FB 4LSZB 1VYAA 3CD6S 1Z2LA 3MD3A 3VR1A 2ERRA 1GMUA 4OX9F 2XZDB 2CQ3A 4DG1A 3DM2A 3UQSA 1SIWB 3LP0A 3ILJA 3PNIA 4NLDA 4OZ3A 3CGIA 1ZM4A 2ATLA 2BKPA 4ED3A 3MMCB 1WC0A 5IT4A 4TYBA 4DQPA 3K5OA 2L48A 4HT5A 3PKYA 1HNVA 3C2PA 5F8HA 1W2BR 1N32J 1CJUB 3CJ5A 2HYIB 3NS7B 2YKOA 1WTBA 2FJVA 3NGTA 5KG3A 1IWAA 1U0HB 2HHHF 5C2GA 4IDKB 2V63A 1HWLA 2DBBA 3DGPB 3L7OA 1NJIT 3T1HJ 2BQRA 2GVZA 2AYEA 4OI2A 1RT7A 1R6YA 1B0TA 3P45B 2FVQA 1UTAA 1XR6A 5DQGA 4F7VA 5GADI 2JX2A 2MGZA 4KH0B 1L5UA 1KTVA 1S1WB 3DOMB 3IGNA 3P49B 3G6XA 1RHQB 2HRUA 4PYAA 2HZAA 3ZZ0A 1LWEB 4B08A 1B7YB 2MY8A 2J5AA 3M9NB 2ZH3A 1NZ8A 1UW9A 3LQVA 2HNZB 3R3TA 3L95X 3NCQA 2BMBA 4KFBB 2YH0A 2RJZA 4C0HA 4MKAA 3QLHA 1X4FA 1XMQJ 1W7WA 1KP6A 4M94A 4CNYA 1V6HA 1RT4B 1VQOS 1S76D 2GZOA 4QOTA 2KTQA 2MQ8A 4L74A 1N5QA 1WUUA 1HQUB 2DHSA 3UW1A 3BBBA 2JDJA 2CQ2A 1VQKS 2C42A 1S12A 3MTKA 4UW2A 4Y2MA 5E3CA 4ED5A 1WG1A 2KM8C 3TWZA 2WK4A 3HFZB 5I42A 3HLUA 2J6UA 4J9KA 2FZKB 3OTEA 3KLHA 2JH3A 2HHQA 2CPFA 2KG1A 3R97A 1SKRA 4FPIA 2C3UA 5ETKA 2RQKA 1SUQA 2DISA 1NKCA 4DV7F 1R0AA 2ZNYA 5T41A 5KFWA 4RNNA 1RAJA 4Y34A 2AJ4A 3RBEA 1OPIA 3AJ1A 2V50A 2E5LJ 2VC1A 3A12A 2X7IA 1RWNB 4UF4A 1ZM2A 3EGNA 4NLXA 4ETZA 3TANA 2HHXA 1KOOA 2GIFA 3NS6A 5IV3A 2GQQA 1I94F 1Q81T 4QR0A 3RBXA 4Q8FA 1H0HB 4OHYA 2KN4A 1TKTB 3OSNA 2AEJA 4ERDA 2NUHA 4I4BA 4CYUA 4USKA 4A8MP 1K73T 3MCMA 5E0OA 1NKBA 4MIWA 2IHR1 2EBEA 5LSOA 2KL8A 4J37A 2C3MA 1B0VA 3QT6A 5D4OA 1Y10A 3NNCA 2COLA 2ZDOA 2XLJA 3FBBA 3A4TA 1Q95G 4H4OB 2IM0A 3FKBA 4UZCA 2AHOB 2P6TA 5EX3A 4JUZA 2DNGA 2IPOB 1KBRA 1KD1T 4BLGA 1X9SA 1WJ9A 1FJGF 1HD1A 3ET6A 3V81B 1X4GA 4DS5A 2D3UA 5D0HA 2YQ1A 2Q6BA 5A2QU 3OFFA 3AAWB 2WCXA 3HF5A 4DR4J 1FTCA 1P6TA 3GMGA 5J2MA 1HQ2A 5LMUF 4KHRA 1TL3A 1L3UA 2LEPA 2CUYA 1F3VA 3M1VA 2A18A 3C66A 2EC2A 2XS5A 2G0CA 4P10A 1LEOA 2NPFA 2QLFB 1BQXA 3IR5B 5LMNF 4JV5F 3BGUA 4ZPVR 2ZH9A 2W9AA 4I2PB 1PAEX 4Q0BA 2ZITA 5KFKA 2GA7A 4MAKA 4TVAB 2F7VA 3IS9B 4PXCA 4X84A 4RNFA 1ZBTA 2JZ5A 1U6BA 5IFMA 3SI8A 3PW2A 4H4MA 5KFLA 5C42B 1IVZA 2RT3A 4ZPAA 2YNIA 4J7CA 3J7ZT 2ASYA 3J7AN 3BB5A 3DDKA 3M30A 1U2RA 1XK8A 3QPIA 1RT2A 3F73A 1JLGA 1SVDA 4LIWA 4E2FB 1FRIA 3JTOA 2XMVA 3U1NA 5GVQA 4WU2A 3BDPA 5LSRA 2FJAB 5F41A 3EZOA 2W9BB 3BR8A 1JMTA 5GMEA 2XI2A 2NS1B 4DU8A 2V69A 1YGYA 5DO2A 3FRZA 2I6WA 2ADCA 1S6UA 2B9YA 4BWJA 5IXUA 1X9MA 2RH3A 2M8HA 1MU2B 1NDLA 4GMKA 4KQZA 5CYMB 3DOKB 3P8BB 1Y3KA 1GTHA 4DR2F 1RT3B 3L09A 2HW3A 3UE2A 3J7Z5 2KI2A 1SJRA 3T5KA 2FHJD 4ZP7A 2BQ3A 1UWAA 3CD0A 1JK9B 2XO6A 1TVRA 3O3LA 4AE5A 3WX4A 2LDIA 2Y1LB 1LW0A 2K7KA 2P5VA 4QW8A 1X5PA 1NK4A 3US5A 5B0EA 3DNCA 4MIAA 3DU5A 2VUGA 3BSCA 4YDXA 1S0OA 3SCKE 5AXKA 3NG8A 1LWFB 3HD2A 3M8PB 1YK9A 5CQGA 4KAIA 1FFSB 2HIYA 2D9PA 5GAHU 4OI1A 5D8HB 2R9LA 2HVEA 2OI2A 3PHEA 2FJDB 3DHXA 4U67Q 1RT6A 1P8GA 2KXHA 1VRUB 2W7OA 2ZKTA 2E1RA 4HL9A 4K4VA 2ZE2B 1FNXH 4O23A 3D6HB 2K3KA 5LOQA 2GV1A 3W8PA 1DTQB 1M5HA 9RUBA 3VVUA 3H4BA 5CYJA 4DBQA 3KLVA 4WFYA 1W25A 3AOAA 4OLOA 1TAUA 4NMXA 1MN7A 1DLOB 4PXBA 3EVOA 3BKFA 4O4RA 2IAJB 2ZOMA 3Q24A 2D74B 2M8DB 3DMJA 3DRPA 2K2PA 2RE1A 5KFBA 5J1NA 2EFGA 3C14B 1SV5A 3R6LB 2VBZA 4CO2A 1JXLA 1RTDA 4JI3J 1IBMJ 2NYHA 4DHVA 5D78A 4USJC 5KG4A 4S0MA 3GV8B 1UVMA 3TUZC 1QE1A 4MKBA 6FDRA 3OXLA 3CCMS 2WVDA 5KG7A 1B7FA 3G6VA 3CCQS 2DR8A 2HWHA 1P1TA 3IWXA 4Q7AA 4DG1B 3DM2B 1LFWA 3EVWA 2C2MB 2KH9A 2I2YA 3DLHA 3LP0B 1TMMA 1TFWA 4RZRA 5HI7A 4MK7A 3GIKA 1RHUB 2BZ2A 1CC8A 2FYXA 2KJWA 3MCSA 1UP1A 3VAKA 1HNVB 2ZC4A 1VJWA 4XAKA 4DZ6A 1Q78A 4GC6A 4A8SA 2UV8A 1HWJA 3ENQA 2IJRA 1OYEA 3HT0A 1X0PA 2WZ1A 4WK1A 1XWLA 2FB0A 3RZAA 2RHQB 4LBPA 1ZAXA 1RTIA 3T9ZA 3CCLS 2RF2A 5K9FA 2GVZB 3J7YU 4ED8A 3TI0A 3PACA 2XMWA 2E1CA 2DNQA 3VGSA 4USIA 2BM1A 1TUWA 1P9QC 1XR7A 1FCAA 4FF3A 2MGZB 2WONA 4CLFA 1DRZA 4KGKA 4DXLA 1NJYA 4YB7A 1QSLA 1YRXA 3W1YC 3C16A 3TA0A 2MLYA 5RUBA 1Y11A 5L1IA 1FKAF 1OSCA 5HQMA 4DZDA 1N4LA 4ZPCA 5EX0A 3D1HA 3D6MB 3TVZA 1S97A 1F2GA 2FC9A 4PXDA 1S7IA 3FBEA 4ZCKA 4EI2A 2VOPA 3R5BA 4I1TA 4DJBA 2FLNA 3QLHB 3M9OB 1EP4A 1RKJA 5FD1A 1NBEB 5HANA 2OFGX 1REGX 1O51A 2QFJA 5J2PA 5C24A 4HH1A 3N6NA 2ZHAA 3QGGA 3THTA 3IM8A 3MDFA 1Q8LA 2LA6A 2R7RA 3CCUS 4X4TA 1VQ5S 2AQ4A 2P9EA 2F3JA 1K1QA 4Z37A 3D66A 2VFRA 5F8MA 3D6TB 1SBRA 3SIPB 5A6WA 1KTQA 3M4XA 1QD1A 5I42B 3KLHB 4ZCIA 5CABA 5DGBA 1SUQB 1FD2A 2B8QA 1X9WA 5HLFA 1R0AB 1SIZA 2GW8A 1JJ4A 5H9FJ 3FQLA 3HVWA 1Q5YA 3K5MA 3NXZA 4OZ2A 5H9EJ 4LF9F 4QWCA 1UVJA 2AIRB 3M2UA 1KVKA 2ZNZA 2DD8S 3FCVA 3CJSA 1T94A 2W2QP 5HMWA 3BH7B 4PQUA 1T9YA 1QY7A 5CAAA 3A8IA 4EBCA 3ZNUA 4ZHRA 3RG6A 2JLGA 2UXBJ 1NSPA 1NM2A 2GIRA 3T1AA 2C2ZB 2YWEA 1E6YA 2KM8B 1BGXT 2B9WA 2QX0A 4HACA 2H5JB 3HD1A 1WKKA 2BA9A 3H7HB 1EKSA 1D3WA 3ZTQA 1NHKL 2F40A 2KRRA 3UDEA 2EVZA 3MEEA 4KGVB 1RP5A 2WOMA 4RWWA 4ZMMA 2R2TA 1AFIA 1RAHB 5DLFA 4ECUA 3ET6B 2GJFA 5K8OA 2YX4A 2OGUA 2D9OA 2RB7A 3MPUB 4NCGA 2QT7A 2V8VA 2HWTA 2Z57B 3WZ0A 2MKCA 2QMUB 4WXWA 1T9VA 3ZTPA 4FS1A 1ZYQA 3N6LA 2E9TA 2MPUA 2B43A 2KVQE 4C48A 2N4CA 3CDWA 3PR4A 3KLFA 2RQ4A 4NYOA 2BV3A 3N9UC 2WSCC 2I5JA 1F3FA 1TL3B 3NOCA 4K4UA 3M1VB 1Q8BA 1HWUA 3TRGA 3G71S 2QLWA 1BC6A 1FXLA 5GMKa 4K5SA 2J0WA 4FYDA 2JVRA 3AB2B 1H6KX 1L3VA 3KYLA 3CDUA 1YLXA 3TOQA 1N5VA 1U1KA 1FRMA 4K0KJ 1EX8A 2F8EX 1IXKA 5AXMA 2MKSA 4Q0BB 2RS8A 1AROP 3QJPA 4DV6J 1UEUA 5DDRC 1C0UA 4MT1A 1VLYA 3GZ7A 1X4HA 3CJ2A 2IYIA 2J6SA 3L3CA 4H4MB 2BANA 4IG3A 2HAIA 3UR0A 4EUVA 3FVYA 5I3UA 2YNIB 3WIVA 1NU4A 3M30B 3EE3A 4OYMA 3LGNA 4F36A 3KMSA 4EGLA 4V19X 1RT2B 4O44A 1B3TA 1Y5LB 1JLGB 1OQ3A 1OPZA 3AOBA 3TA1A 3R6GB 4JYAF 2ALYB 1WHXA 2YKAA 2H3EB 1H7WA 2C3YA 2LQ8A 3Q8RB 1IQTA 3D7SB 5B0DA 1RADB 4NA1A 4ZP8A 1WOSA 2E5IA 3R8YA 4OIXA 5FJ4A 1NDCA 3HHLC 4WYWA 1M5PC 2XS2A 1JJHA 2CZVC 1KLMB 4DR1J 3EDRB 2V34A 3U1MA 2DT9A 2ABYA 1U1PA 4M8LA 3S7RA 2GMJA 2DNLA 2B4PA 1SC1B 4DPUA 1GNKA 1RYSA 2IDEA 5CH7B 5LJ5Y 3RB3A 4R5PA 2AD9A 2HQDA 3I87A 2PN6A 5B09A 4QW9A 1YDLA 2V8HA 4JV0A 1LW0B 4J9VA 5CCLA 3SMZA 2DNNA 2K1RA 5CD4H 2F4VJ 4ZVRB 2A2CA 4DSFA 3QFWA 5F8GA 1WHYA 1S48A 2RSQA 4QIWD 2WAQD 3ETMA 3KUGA 2UUCJ 3HHLA 2X51A 3CO9A 2CKWA 1WDTA 4MK8A 4RJVA 1RWVB 4LF2A 3G87A 3PJ9A 3K5LA 1RT6B 1T0TV 1RAOA 2CQPA 4OJ3A 2E5GA 1LFPA 1L3KA 5A2QY 4CLKA 2AYGA 3MM6A 1Y7PA 3AD7C 2DNRA 4DR7F 4F25A 2P9CA 2DXFA 3CJ0A 1PO6A 3R5JB 4KR0B 1WF1A 2BE2A 2QA4G 2GFFA 2DHAA 5KFTA 2PSZA 4ECVA 2OH2A 1ZTWA 2IM1A 3DMJB 4AFFA 3DRPB 2DEJA 4QWDA 5E5NA 3CSKA 3UN5A 5F8IA 2AJ1A 1S4FA 4LFCF 1S7HA 3EXYA 4CP5A 3UD4P 2V94A 3ITHA 1RT1A 1S59A 2ASDA 1FK9A 1PJ7A 1ZAWA 2XO7A 1HWKA 3VQSA 4PWWA 2E44A 1QE1B 4J9RA 1FDDA 2CQ4A 3PVXA 1C4CA 4FYYB 2EFOA 1X8DA 1H2UX 1NHUA 3RGIA 1T9UA 3IXQA 5A8WA 5IC4B 5KFPA 3HSGA 4NLUA 2AX0A 2CJBA 1X4DA 3QT5A 3W61A 4UZBA 1MMDA 3LW5C 1N54B 4E8UA 1MMLA 3F0NA 5T14A 4OI4A 3NBPB 1UA1A 4ZPTR 2HSEB 4ZVHA 3WHIA 4B3SF 5A0YA 3TARA 1ZPVA 2CQGA 2Z56B 3QGHA 2RF2B 1RLDA 3G82A 1WG4A 2BJ1A 4BS2A 1PJ6A 4YMEA 3NGDA 2YX7A 2V5HG 3KHHA 2HHSA 3M05A 2GX8A 3R5GA 4LMZA 4HYKA 4IO1A 1U8SA 2WONB 1MNEA 1AB8A 2V2ZA 5EUHA 5KOXA 4FYVB 1HA1A 2L3MA 2C2NA 4WP9A 1NDKA 4NWBA 2PMZD 5GAGU 1HNIA 1T02A 2OMLA 4I6YA 2E7VA 5KT3A 1FA0A 4USHA 3NOGA 3C16B 1I1GA 4GRSA 5IM0A 2DNMA 2DGTA 2BOAA 2VQFF 4FF1A 3P4UB 2O5DA 4ZJLA 3Q83A 2DO0A 4DSIA 2OKQA 2VH7A 2CQBA 2I8EA 5HROA 1B70B 1GAOA 1EP4B 3QJLA 4LBHA 1R6VA 3ZTRA 5B7WA 2ZWPA 5J2PB 5C24B 3UDCA 2PDAA 5ETLA 3TEHB 4X4QA 5FDLA 2HFZA 2GCFA 3DRXA 1N6QA 2HURA 2XCAA 3GIIA 4CDIA 4RBUA 3EVMA 3OTOF 1U47A 4DR6J 3RJMB 3TUPA 5F9NA 4XPEA 3HHKA 3H2UB 2ZBCA 1IR0A 1YJ7A 2KJVA 5L1LA 2LFVA 1VIXA 3VGTA 4DPWA 1KHWA 2GJIA 2W7AA 1D9AA 1N32F 3BREA 2C22A 1NJXA 5HLFB 2N3OA 4PXEA 1PBAA 2R8KA 2R7XA 3I32A 1UJ4A 3VHQA 4JV2A 5AXNA 3PKMA 1XEZA 3M2UB 5D15A 4AXIA 4KGXB 3HMJG 3T1HF 2JHEA 2BE7D 4AUKA 2CVEA 1VRTA 4PQUB 3M8SA 3KUEA 3MWBA 2HLUA 1FO1A 4TN2A 1UEKA 5K14A 4ZHRB 2Y0SD 3DFEA 4UY8T 2V8PA 4JOUA 1K47A 4DPYA 1NB2A 1E6YB 3MZIA 4HVZA 1B0PA 1U0SA 3HHEA 3OXFA 4HACB 2BQUA 2UXDJ 5L38A 5JVGQ 2D3O1 1H74A 5EDWA 4B17A 1HQEA 3OVBA 3Q2TC 1ZM9A 4U96A 3KHGA 5ETRA 1RK8A 5KFRA 4RW6A 3MEEB 2WOMB 4A4JA 2XHCA 1Z1ZA 3SBMA 4C7QA 5AJ3J 1G3OA 3HZGA 1KLNA 2ZBIA 5IZHA 1NK7A 2C28A 1GT8A 1XMQF 2AV5A 4FXWA 2XWXA 2BW2A 2DHHA 3IC1A 4RBVA 4NCGB 5CZXA 4J9LA 4K7QA 2V4RA 5LMUJ 1VQLS 2HMIA 3BDEA 5BYSA 4PABA 2HS3A 3RR7A 3TZXA 3KLFB 4OZJA 2H4WB 4YEAA 2XNRA 2HNYA 2ZH4A 2I5JB 1U1LA 1PILA 3NRBA 5GAHI 2DGOA 2UU9J 3MM5A 3PR5B 1VQPS 3TVYA 4UY85 4EYIB 1TP7A 1UWBB 1V5VA 2FVPA 2NYIA 3VV2B 3RTVA 1HBMA 1RWXB 5IQ6A 2QJ3A 2PO4A 4DQRA 2KB2A 2E1PA 2J6TA 2Z2YB 1TQLA 1HHSA 3H42A 2ZJRQ 3WC2A 3GLJA 3CCVS 3GV5B 3M9MB 5KFXA 1HI0P 2DIUA 1C0UB 2MZTA 2VODA 3EGVA 1XN9A 3MR5A 2ZVIA 1RA7A 2BANB 5SUHA 4GC7A 4IG3B 2XLKA 1UFLA 2C2KB 3CEDA 5I3UB 2YKQA 4ES1A 3GCXP 3Q8SB 3HT3A 4O44B 1GXLA 5J2QA 4TNOA 2J9DA 3LP1B 4WYLA 2QMWA 1JLQA 2IIHA 1HFEL 4KH1B 1F5AA 1JKHA 2O3DA 2DXDA 4UOFA 3OV7A 4M5GA 4NLYA 4TQSA 2FHKA 4ALZA 1PC5A 2CWXA 1WELA 3CJ8A 4B3RJ 2B6AA 1DQ8A 1KQKA 5JMNA 1T3NA 3EMTA 4JI5F 3W9HA 4DR4F 2ZVSA 1SKSA 2PFDA 5G4DA 2HBQB 4WFXA 4HI1A 2YNFA 1R43A 4NASA 2HQ3A 4R5PB 1HLWA 3TUJC 2VQEJ 3J7YI 3UNGC 3MCOA 4DUYJ 2HEKA 3CDBA 3WC0A 2KXFA 3FFIA 2AMCB 3BN7A 3F56A 1IBKJ 5ETVA 4DUZJ 3P5TL 2LECA 2AJQA 2K1RB 4I67A 3FRYA 2ROEA 2GQ2A 1RABB 2YQ3A 2EKNA 3NEKA 4Y00A 3DLBA 2KDOA 1J5OB 4GVBA 4LF4J 1NNDA 3DOLA 3NNAA 3HHLB 2Y1JA 1FWPA 2XYHB 3N4WA 4OI6A 3J81Y 2CNKB 3ULHA 4ECZA 3KOAA 4TXSA 3H2LA 1UVLA 4DL7A 4JI0F 2HVDA 2POKA 3PDNA 4KPCA 4ECQA 3KMQA 4IR9A 4U8YA 4OYXA 4DFKA 3BSAA 5D6GA 3MM6B 5DZ7A 1TAQA 2B5JA 1RSCA 4Y0FA 2GAHC 1NSAA 2C2OB 1LW2A 4EMDA 2V68A 2BE2B 1VOMA 1H2TZ 4F2RA 4C98A 1NPKA 1FVSA 2CYYA 4PUOA 1EIYB 1TR0A 5A8RA 1Q5VA 3EX7B 2EG2A 4L72B 2CADA 4BC7A 2OHDA 3JSRA 3QBCA 1JLAA 3ITHB 1Q8IA 1RT1B 1U49A 1FK9B 3PO4A 3PCOB 4N7TA 4WE1A 2LU1A 4CLPA 5HVFA 2DVIA 1CG2A 4U7UD 1R0BG 1KQFB 2OPRA 4IFVA 2AX1A 4O0NA 4FVMA 3TEGA 5A8WB 3G9CA 1KOHA 1HNWJ 5KG0A 2PMHA 4X4UA 2DR6A 2KYZA 1DFDA 1S6OA 3VAFA 2W2NP 4TLRA 2MMYA 2MQPA 5MAOA 1N0VC 3A8JA 3HCXA 2M2BA 4ZPDA 1JJCB 3TO8A 4DDFA 5HQLA 2J0SD 1H7XA 3QZ7A 1XNRJ 6FD1A 5GMDA 2GIQA 3KG4A 2NXNA 4OJGA 3AJ2A 1ZZFA 8ATCB 4J9UE 3DDNA 1K1SA 1I51B 5KFOA 3TZYA 2VG6A 1KONA 4WXOA 4XIUA 4B9SA 2B4OA 1YBAA 4YB5A 4QU6A 4GKKJ 2JEIA 2MKYA 1N5TA 2GAGC 5D4LA 4DV3J 1HNIB 2XMMA 4BBYA 5DGAA 2MQQA 3TAQA 2CG8A 2APOA 1WKJA 3QQCD 3PFOA 4DX6A 5IM0B 2MTLA 4DL4A 1HBUA 5HMZA 2CA9A 3I9ZA 3GFXA 3DLEA 3I5BA 1ZH5A 5KT6A 5HROB 2UVUA 4L76A 4JI3F 1IBMF 5KFVA 1RQ0A 5KTQA 3MXHP 3FBCA 1LXJA 1EAYC 4CLYA 1CJTB 5FDLB 5KFUA 2OLWA 1CBKA 1UAWA 3MD1A 3SQGA 4G1QA 1TKDA 1RHJB 3CW2C 1N6QB 4DL6A 1VBZA 2YXLA 4KYZA 4HI2A 1NK9A 4HTJA 5E7OB 1TK0A 4ED7A 3DXSX 1EHWA 3ZZRA 1M5OC 3HVRA 2MYFA 1T9TA 2RD5C 4LRFA 3IMQJ 2ZUGA 3GR1A 3ZZTA 3VF0B 1D8YA 2EEYA 4LF9J 4IFYA 2R3VA 4TY9A 1G7CB 2LVWA 2GO9A 4WJBA 1SQFA 4NXNJ 3M8ZA 1AT1B 5KG1A 4A47A 5ETSA 3W5YA 1M1KT 1UW4A 3N5FA 3NGRA 2YWFA 4NYZA 2ROGA 1JNZB 5DQHA 5T7LA 4HR2A 3BR9A 4D3GA 3DRSA 3H20A 4MYTA 4KT0C 3HXMA 4J5OA 4WFAQ 3GB0A 3RRHA 3K8VA 4ZA1A 2DPIA 3MPWA 2G2OA 4P2SA 2J9CA 4IRDA 4DFJA 2WSEC 2FJWA 2A6MA 2GQCA 3E51A 3A13A 1U8WA 4Q45A 4M95A 2JEGA 5DDQC 3GYNA 1BWVA 1DY3A 3GFHA 4CIOA 3HHDA 2N3LA 2FIUA 1HQEB 2BM0A 5HSPA 2MZJA 1JLFA 3MECA 2W8KA 4RW6B 1AUDA 4P52A 3VTIA 3SV4A 1S4EA 2Y0BB 3AD9C 3PV8A 3CXCR 1U26A 2RKIA 2IC3A 3OJSA 3KJVA 4V19J 3IAM9 2G0JA 1AZSA 4ZK7M 1FRLA 1Q53A 2GJ2A 2BXJA 4LR8A 3UN2A 1G4CA 2XY6A 5KG5A 4QYZK 2HMIB 2BJ8A 1U7LA 2EW9A 3FBFA 3G4SS 2XWYA 4USWA 2E5JA 4OYPA 3DXBA 4MKYA 3CC7S 1PIEA 1HBMB 2KKHA 1R89A 3W5XA 2FVCA 1IBCB 5IWAJ 4IOBA 2G9OA 3KK3A 2J0XA 2NXUA 1FX2A 3D67A 3TP2A 1KFSA 5HATA 2LCWA 2LXFA 5AE2A 2H65B 3KDNA 2DGSA 3SSSA 1SPBP 3BJYA 4U9RA 4FXDA 2OMOA 2KHDA 2XGPA 3FMBA 2XULA 2OO4A 5E3RA 2ZDPA 3ZZOA 1YZ6A 2VDHA 4IYQA 4P2FA 1TL1A 4I2QA 3AY0A 1HYSA 4CLLA 2DRBA 3C46A 2UUTA 2X1GA 1SL2A 1RISA 2GHWA 1JWWA 2HHWA 1IWGA 2BUNA 2UXBF 2VG5A 1WACA 5J2QB 3TJ8A 1U2CA 1NK0A 2ZBPA 4F02A 2ZH2A 4F2SA 2HFOA 1S49A 3QATA 1FF2A 1JLQB 3QRPA 2IRYA 2VPZB 3OL9A 1JKHB 3FUYA 1FT8A 2CJYB 7FD1A 1GMWD 1HARA 3T5JA 4ECTA 4XK8C 2PA8D 1YRTA 3PRDA 2B6AB 4OYIA 5CYQA 4ZVSB 3IBFB 5KFNA 1XBWA 4X2BA 3VGVA 2YNFB 4P7VA 3HVAA 2KT3A 2XEXA 3QYYA 3POTA 2DB1A 3PG9A 5HQ8A 3TJ9A 4DCPB 2LQJA 3J81j 2MKHA 3LAMA 4YY3J 4OZNA 3O5TB 5D0GA 1U02A 3FFIB 1R3NA 1FWKA 3DLGA 3TAPA 2XM3A 2PI5A 4DSJA 3VAGA 3GR0A 4K0KF 3RB6A 5CHCB 2QN6B 4A8KA 4C8LA 3QNWB 1FRXA 4USVA 5GAGI 4LF7F 1SJFA 4OV1A 4DV6F 2WTFA 4GVBB 1CJVA 4CRJA 4ZCMA 1AA1B 2BJ9A 3DOLB 1TU0B 3SDEA 3PXGa 2VBXA 1VISA 3W5ZA 5KFEA 3MHYA 4J9NA 1RU1A 3H5XA 3T1YJ 1JJ2R 2D41A 1ZOTA 1W2IA 2ZD1A 2PMWA 4OX6A 3W60A 2NXCA 4ES2A 4C8ZA 4FBUA 2RDIA 4JI6J 3HFKA 4KE5A 2W01A 4LR9A 4ZDNA 3GIJA 1PG5B 1UPMB 2B5JB 5C25A 4ER8A 1MWYA 1LW2B 3X3UA 3LOUA 5F0UA 1CC7A 2VDIA 2R8IA 1R8AA 3ZFVA 4PUOB 2MXYA 5A8RB 3GU0A 5KFZA 1XERA 5ETMA 4FDFA 4ZP6A 2NPIA 4NLVA 4OYZA 3RW6A 1JLAB 4C6AA 2QRRA 2NCKL 2FGCA 2WHOA 4WE1B 3GQCA 1Q8KA 2JC1A 4USUA 4DLEA 3AOCA 2X1FA 2OPRB 2LXUA 3KWMA 1N36J 1X0FA 4NCBA 1K44A 1Q7YT 3BKTA 2DR9A 1WD6A 1RAGB 4DMZA 3OVSA 1BY9A 3BGFA 3AH6A 3PEJA 2CPIA 4LBIA 4I68A 5EN1A 2QZ8A 2W4PA 2FZGB 1XMOJ 3MMBA 3D5MA 4NLOA 4HDHA 3S01A 2JOQA 2Y3YA 3C3LA 4HDGA 1LWCA 2ZZNA 2KRBA 2AZ3A 2AGQA 2UUCF 3MOJB 1KVIA 2N82B 1I5OB 1VRUA 1F5CA 1WEZA 2B9XA 2VZ9A 1HKAA 5HP1A 1OS5A 4QJVA 4F0KA 4ZVOB 1N33J 1V9OA 2HFNA 4OHZA 1J5EJ 2VG6B 3C6UA 2KO1A 2C2EA 3G6YA 4NZ0A 2J9DE 1DLOA 3GV7B 1HMVA 5HK4A 4FYXB 3FZBA 2I9SA 3I0SA 2MHEA 2XYGB 2J8AA 2CJQA 3T6JA 3WQPA 4NE9C 5M2UA 1VQ9S 1HBUB 4A46A 2NR0A 3AQPA 5L9NA 3Q0AA 3DLEB 2U2FA
chains in the Genus database with same CATH topology
4DV5F 1VRTB 1HBNB 2J76E 3R5AA 3MTJA 3DOMA 1TL4A 1MSWD 2RRAA 2YKAA 4RW7B 1X5TA 3HHNB 3HKZD 5CA5A 2WW8A 1LWEA 3MURP 2OSRA 3MEKA 4A48A 1H7WA 4NLTA 2VBYA 5K14B 2C3YA 1E6VB 2V8GA 2CFXA 3Q8RB 4XO0A 2HS0A 1FDNA 1T95A 1I6JA 2V9WA 4C3KA 1IQTA 1QAXA 4M63A 4DLGA 4RUAA 3W2WA 5B0DA 3W2VA 1DJ0A 1QAIA 4NA1A 2RMLA 4ZP8A 2HNZA 2DH8A 2XSFA 2E5IA 1D9FA 2OPQA 1G6BA 1VC0A 1O8BA 4OIXA 5C5JA 3HHLC 5FJ4A 4WYWA 2ZKUA 2R7QA 5EWEA 3H5YA 4B02A 1BQNB 1M5PC 3L7PA 4K4WA 2BACA 2KFYA 1QAYA 4KFBA 3SQGB 1SI9A 3B8HA 3HO1A 3OJUA 4M1KA 1JJHA 2XS2A 2CZVC 4N8OA 4CNZA 1KLMB 4G1QB 4OQJA 3T19A 4DFMA 1U1RA 3QMQA 2WBMA 3MEGA 4DQSA 1MMNA 1X5SA 4Y2AA 2V4QA 1LQ9A 3U1MA 4WFNQ 4N56A 2DT9A 1KN6A 2ABYA 4C8YA 5LSLA 1U1PA 1RT4A 3S6EA 1NB7A 4M8LA 3S7RA 4FP9A 1IJFB 2YWHA 5I3QA 4ZP9A 3U27A 2GMJA 1SJ1A 2DNLA 2B4PA 4RUHA 4QU7A 1GNKA 1RYSA 3K5NA 5CH7B 3WBZA 1HQUA 2AGOA 4PG5A 5LJ5Y 3RB3A 4DF4A 2VOOA 1REVA 4C8KA 4R5PA 3M8QA 2AD9A 4B9VA 4DR3F 1Q86T 3DLKA 1X4CA 3EPGA 3PW0A 3I87A 4TY8B 2R7VA 2PN6A 3MOZA 4IFYB 2J7UA 4ZOSA 4N47A 2YWKA 3CB4A 5B09A 1ZM3A 4TU8A 1TUVA 4EU0A 2KT2A 1FEEA 4QW9A 2YY3A 2FVRA 1PSDA 3JTPA 3ZZZA 2UVWA 4A8FA 1S0NA 4DL2A 2HHUA 2WRMA 2V8HA 4JV0A 1LW0B 4I64A 2CPEA 5IT9Y 4DV1F 2ZFHA 5GAEI 4DSLA 4B3TF 4FPRA 2L9NA 4LVNP 2FHMA 3EXCX 2W24A 5CCLA 3SMZA 2PA3A 2DNNA 1FTRA 2K1RA 3O8WA 5KFAA 5CD4H 4E0DA 2HNYB 3CC4S 3KLIB 3CD5A 2RNEA 1VS3A 4X62F 3C8YA 1IKYA 2A2CA 2AW0A 2ILYA 3MM5B 1K8AT 4DSFA 5F8GA 4Q44A 1WHYA 1JB0C 2ZM6F 2KT5A 1Q16B 1S48A 2RSQA 4G1IA 5T7LB 4QIWD 2ASLA 3ENVA 3MR3A 4TU9A 2WAQD 2DNOA 4NL5A 4AXJA 2V4JA 3LAKA 3DRSB 3HHLA 1KR4A 2X51A 3PJXA 4ED0A 3CO9A 2XHWA 2CKWA 3I31A 2E66A 4PG7A 1FJEB 4MK8A 1GQEA 3PY8A 1YI2S 2B51A 4PG8A 3H8YA 2ACYA 1R8BA 4Q2MA 4R8UB 2MZQA 4RKUC 2YNGB 4I56A 3KG0A 3K5LA 1HHTP 3KG1A 1RT6B 2EBGA 1AFJA 3GE9A 4PPZA 4G6VB 5KFQA 2CQPA 3VWSA 4OJ3A 2LEBA 1S0VA 2E5GA 4JI4F 4W92B 2PFFB 1LFPA 3D54A 3KK1B 3D0IE 1L3KA 5A2QY 3H4DA 1L3TA 4PWDB 1O0PA 4WF9Q 1U24A 4FNHA 3ENWA 1YJVA 3I6PA 2AU0A 2VKZG 1S77D 3R5DA 5EWGA 3KTQA 2AYGA 3QAEA 4OL8A 1TKZA 3MM6A 1S9EA 2HLTA 1TKTA 1Y7PA 3TR5A 2DNRA 3JAMY 4DR7F 4F25A 1VI7A 1JLFB 2P9CA 1R8CA 3SXLA 3MECB 4PCQA 4OX7A 2BVZA 3CJ0A 3LWLA 1PO6A 3SV3A 4ZPWR 2MKJA 2Q79A 4KR0B 1WF1A 4M5DA 1TK5A 1ULRA 4WFZA 5DETA 1U1QA 1U1OA 3OTBA 2BE2A 2QA4G 2GFFA 2CPHA 4YHHF 3WDOA 2DHAA 5KFTA 2PSZA 4ECVA 4KV8B 4K5RA 3BSNA 2OH2A 2VPXB 1SJQA 2XG8A 1ZTWA 2IM1A 3DMJB 4AFFA 4ECWA 2RKIB 1RT7B 2VD3A 3DRPB 4YP3A 4XDCA 2EFQA 5DM6Q 1ZZNA 2IC3B 4QWDA 2KFNA 5E5NA 3CSKA 5F8IA 3KJVB 2HPUA 4QWBA 1DAXA 2AJ1A 1P1LA 1S4FA 2B56A 5J1EB 1UVNA 2HVZA 4F4WA 5KFFA 4AL5A 4H4OA 4LFCF 3O2IA 1M0SA 3ONQA 2DGUA 1KSPA 1S7HA 2CVIA 3CMAS 3EGZA 1JLEA 3EXYA 3UD4P 3HK2A 4UOCA 2V94A 3ITHA 3VZIA 1RT1A 2VFSA 3MGJA 2ASDA 1FK9A 1UVKA 1ZAWA 2XO7A 4NYPA 2AF6A 3EZ5A 1HWKA 2MB0B 3R1HA 3VQSA 3D0HE 2E44A 1QE1B 1BWEA 4DR6F 3GFZA 4YDDB 3V81A 2DR5A 3UFCX 4DEZA 1T05A 4PR6A 1C1CA 4GKJF 4J9RA 4TYAA 1FDDA 4ATNA 2CQ4A 3PVXA 1C4CA 4TQRA 2FJXA 2GHPA 3IRWP 2EFOA 1X8DA 3FEYB 1H2UX 1NHUA 1DURA 2NQPA 3Q8PB 1RI7A 4R25A 3TX8A 3I56S 2F9JA 4P6QA 1QJHA 3IXQA 2AYMA 5A8WA 1NK5A 1F5BA 3OLAA 3RAMA 2EK1A 4PKDB 1VQYA 1YJRA 5HBMA 3UCGA 3TYTA 3QGIA 3BQ1A 2HRYA 5E3QA 5BYRA 3TW0A 5KFPA 4NLUA 3M8RA 1K0VA 3KK3B 4Y2IA 3I55S 2CG4A 2R7SA 2AX0A 2CJBA 5KT4A 1IM4A 4WIIA 2E7WA 2PC6A 5U47A 4OI3A 5KAKA 1X4DA 3LWMA 2W4CA 2GC8A 2BYCA 3T5LA 3NMAA 3MPYA 2Q6CA 3UD3P 2BJDA 3JSBA 5F3TA 3M6XA 4C0OC 2IA6A 1MMDA 2W4DA 2V0NA 3MM7B 3LW5C 3H2VE 3N6MA 2BBEA 1N54B 1WHVA 1R8HA 4E8UA 3FSYA 1MMLA 2F8HA 1JLBB 5T14A 2EK6A 2FLLA 3MMJA 4OI4A 4DOZA 2JFKA 4TU7A 4DFPA 3M6WA 3CCJS 3NBPB 1SJ3P 3PX0A 2UP1A 1UA1A 1YHQS 3QZ8A 1Y5IB 4ZPTR 2IYGA 2N4DA 1TL1B 3RR8A 2V9KA 1WEYA 4I2QB 4ZVHA 2BABA 3DLJA 1RDRA 5L8RC 4B3SF 2EKYA 5A0YA 4Y6IA 3TARA 1HYSB 5DRKA 4ED6A 1ZPVA 4RW8A 1S10A 1SB6A 2CQGA 4I2PA 2RDJA 3B4DA 4B3MF 3QGHA 1N0UA 2LXIA 2RF2B 3Q23A 2Z8QA 2AJ0A 1WG4A 2VG5B 5IS2A 4BS2A 2D7SA 3IS9A 4YMEA 3NGDA 4QIEA 1GH8A 1IKWB 1WHWA 2E7XA 3UWTA 2M88A 2W9CA 4IRCA 2YX7A 2V5HG 2PT0A 3KHHA 2HHSA 2VFVA 3UPFA 3M05A 2BR0A 2GX8A 2EC0A 2JFDA 2DNZA 2ZZMA 4O3NA 4LMZA 3T3FA 4HYKA 4BC9A 4I6AA 1SL1A 2BOPA 4IO1A 3IG1B 1U8SA 1UETA 2IVMA 1MNEA 2WONB 2IM3A 1Q1KA 5EUHA 5KOXA 2AYBA 2UXDF 1HA1A 4QR2A 2OPSA 2NZ4A 2L3MA 1R7IA 3U1LA 5C42A 4CQ1A 3NMRA 2L9DA 3GWCA 1B64A 5B0GA 1PGZA 2VA2A 3KNAA 4NWBA 2E1MC 2PMZD 5GAGU 1HNIA 1T02A 2OMLA 4I6YA 2VG7A 3P96A 3DRYA 3CE8A 4HKQA 5KT3A 2FUG9 2GGPA 1FA0A 1RTJA 1ELOA 4USHA 4QZVB 4C3LA 4Z2XA 3EGWB 3QJJA 1S1TB 1NK6A 5AJ3F 1I1GA 2E29A 5IM0A 3HJFA 2DNMA 2DGTA 1KRPA 2VQFF 4FF1A 4CZCA 2O5DA 4JI7F 4QBUA 4IQXA 1T8EA 1A9NB 5ITHA 2DO0A 1YJ9S 4DSIA 3DYAA 2YTCA 2OKQA 4LF6F 2VH7A 4KJIA 4MFBA 2CQBA 3KHRA 1X7VA 5CYQB 4DN0A 2I8EA 5HROA 4X4OA 4KC5A 2IRXA 3CCTA 2W9BA 4B9MA 1GAOA 2F8MA 2FD2A 5J1PA 1EP4B 4RNHA 3QJLA 5D3GB 2NREA 1BD6A 1V3ZA 1S6PB 4LFAF 2JEJA 3V4IB 2Y1IA 5B7WA 3DC2A 3D1OA 2LQBA 4RLEA 1ZPWX 1R27B 5J2PB 5C24B 3UDCA 2PDAA 3HHLD 3CJKB 7FDRA 4FF2A 2DGQA 4X4QA 5FDLA 3NL0A 1UEVA 4KKOA 3S8SA 2MQMA 4WTYA 1NAQA 2UU9F 2HFZA 3POTB 3K7RA 4C8OA 1Z2ZA 5E41A 2A3JA 1XTZA 2GCFA 3DRXA 5L1JA 4QYZJ 4O3QA 2J9EA 5KFHA 1N6QA 4C4WA 1MU2A 1Z4UA 2XCAA 4HT7A 3GIIA 5L1KA 4LF8F 4RBUA 2J0QD 2R7WA 4F4XA 2HIQA 2R8GA 5CYMA 3OTOF 3LPYA 3DOKA 1WF2A 1U47A 1T03B 2YKNA 1DZ5A 3VAHA 5F9NA 4XPEA 3NLCA 3HHKA 2EI5A 2YNHB 3H2UB 3DLGB 4DR1F 1RT3A 1IKXB 2ZH7A 1TV6B 4RBTA 2ZBCA 2QA1A 3BEGB 1UJ6A 1IR0A 3CT9A 3Q2SC 5KFIA 5EGYA 1S99A 3P6YC 3IWNC 2KJVA 1Q7LB 1GXTA 5L1LA 3SYZA 3OSPA 2BRKA 4IKAA 3CULA 3MPVA 3DCAA 3QWPA 1VIXA 4ZCLA 1OO0B 2XY5A 3J7A1 3RAQA 1SQEA 1KHWA 3NCRA 2GJIA 2W7AA 1D9AA 4IFVB 4X64F 3MFIA 3BREA 1N32F 2C22A 3TAMA 5CZVA 5HLFB 2J7WA 1NJXA 2DNHA 2N3OA 4Q43A 4PXEA 3I5CA 3VAMA 1X4AA 4G3IA 4QIVA 2MZSA 4ELUA 3SDEB 5KFJA 2R8KA 4NRTA 2OTJS 2R7XA 2ZOFA 1FHTA 3I32A 5A8KB 3PIPQ 1UJ4A 3Q22A 2OIHA 2HHTA 2JL9A 4BHQA 4ZVFA 3HPOA 4JV2A 1VQNS 5AXNA 4FXVA 3O6QA 1CVJA 3PKMA 1XEZA 5J2MB 3M2UB 4IOCQ 4AXIA 3I96A 3HMJG 1JX4A 3ISZA 4MK9A 1S0MA 1RT5B 1H38A 3T1HF 2JHEA 2ZD1B 1NJZA 1JLCB 2CPYA 1ROFA 2HS4A 3AQOA 3K58A 4AUKA 4CO0A 4F3MA 4ZVGA 4AYBD 1X5OA 3FEZA 4YR2A 1U09A 2CVEA 1LWFA 1VRTA 2YX1A 4NA3A 3M8PA 1S6QA 3N79A 4PQUB 5DJBA 4WK3A 2ALZA 4D3HA 2DCLA 3M8SA 4DV2F 4IO9Q 2UVRA 4C9DA 3PM9A 2F4VF 2JRSA 2KXNB 1U1NA 1VQ7S 3MWBA 2HLUA 2X3GA 1FO1A 4TN2A 5K14A 4ZHRB 1E6VA 3BN4A 5C25B 3PIOQ 1T7PA 1VQMS 1HNZF 2Y0SD 1S1VB 1VBXA 3FGVA 3MM8A 2SXLA 4MYUA 1FDAA 2GMHA 3DFEA 5CXTA 4UY8T 3I4PA 5DM7Q 4JOUA 4OZLA 3MFHA 2CDQA 1Y5NB 3T5HA 1E6YB 1T3OA 3MZIA 4PQAA 4J9OA 3RB4A 2ZHBA 4HVZA 1B0PA 2FVSA 4CI0B 3HHEA 3OTCA 3OXFA 4LVOP 3IR7B 2ZE2A 3KHLA 2BQUA 4KGMA 1S72S 5L38A 1A7GE 2FDNA 2Q1LA 1KLMA 1H3DA 2CPJA 5JVGQ 1DTQA 3K59A 5EDWA 2QEXS 4B17A 1YWXA 3NCPA 4OX8A 3JYTB 2LMIA 4B3OA 1HQEA 3OVBA 4HH0A 3Q2TC 1ZM9A 3KHGA 5SZTA 1RK8A 1YTYA 2JVOA 1VBYA 3C6TA 4RW6A 1FE4A 5KFRA 3MEEB 2WOMB 4A4JA 3IRXA 1DTTA 2IFXA 4HEA9 5DDPC 4B3RF 1Z1ZA 3SSQA 1C0TA 4C7QA 1QSSA 4YR0A 1S1UB 4MH8A 2KU7A 4F4KA 4NCAA 1G3OA 3HZGA 3PEHA 2BRLA 5E3AA 2IAJA 1HD0A 4F3QA 1X4BA 3UCZP 4O4GB 5M2PA 1O5JA 1XMBA 4TKTA 1DQAA 1KLNA 1CQNA 2ZBIA 5IZHA 2C28A 1NK7A 1GT8A 1XMQF 2LEAA 1ZAVA 2AV5A 2E1AA 3HVTB 4FXWA 2XWXA 1KHVA 2BW2A 4MJKA 4RU9A 4X4VA 2R7TA 3IC1A 1VC5A 2IJFA 4RBVA 4NCGB 1NH8A 5CZXA 4PRFA 3ZZUA 1FKPB 1J2VA 2XLIA 1C1BA 4NLSA 4J9LA 4Y2KA 4DSKA 3E3XA 4V19J 2Z2LA 2V4RA 4DV0F 1NK8A 1UJ5A 2QSFA 3SZ2A 2L9WA 2XNQA 2KZZA 3TUIC 2A1BA 2CRLA 5LXYA 1M5VC 1VQLS 2HMIA 2XBPA 3BDEA 2XSJB 5BYSA 4EBEA 1SH0A 3RRGA 1S1XA 2VQEF 1FJCA 3H98A 4AL7A 2HS3A 1NZAA 1QM9A 3I0RA 1F9FA 3SFGA 3RR7A 3RW7A 4KBIA 2ZH5A 1NHVA 3KLFB 4OZJA 3JSMA 4DUYF 4I7FB 4YEAA 2GMLA 2XNRA 2HNYA 4AQYF 3CD6S 3VAJA 2ZH4A 2I5JB 3H5UA