3EUNA

Crystal structure of the 2[4fe-4s] c57a ferredoxin variant from allochromatium vinosum
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
ALMITDECINCDVCEPECPNGAISQGDETYVIEPSLCTECVGHYETSQCVEVCPVDAIIKDPSHEETEDELRAKYERITGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insight into the protein and solvent contributions to the reduction potentials of [4Fe-4S]2+/+ clusters: crystal structures of the Allochromatium vinosum ferredoxin variants C57A and V13G and the homologous Escherichia coli ferredoxin.
pubmed doi rcsb
source organism Allochromatium vinosum
molecule tags Electron transport
molecule keywords Ferredoxin
total genus 16
structure length 81
sequence length 81
ec nomenclature
pdb deposition date 2008-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00037 Fer4 4Fe-4S binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.20 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3eunA00
2ZVSA 1FDBA 1FRKA 1IQZA 1GAOA 2Z8QA 2FJAB 2VPZB 1H7XA 1PC4A 1F2GA 3MM5B 4DHVA 3OR2B 2V4JA 3MM6A 1BC6A 2PMZD 1B0TA 1FDAA 5BYSA 4OV1A 2VPWB 1SJ1A 7FD1A 2WSFC 1WTFA 1FDNA 1JNZB 2GMJA 2FJDB 2Y0SD 2C3PA 3MM7A 4XK8C 4OMFG 1FRHA 4Y28C 1FCAA 1BD6A 1A6LA 1IR0A 1DFDA 3PNIA 3OR2A 2V4JB 3MM6B 1AXQA 2WSEC 1C4CA 1XERA 3EGWB 1KEKA 1SIWB 2XSJA 1R27B 1BQXA 3MMAB 1D3WA 1JNRB 5CH7B 1F5CA 1H98A 1HFEL 1Q16B 1FRLA 1C4AA 1H0HB 3EXYA 2GMHA 1FD2A 1FERA 1FEHA 2C3OA 1SIZA 6FD1A 4XDCA 1F5BA 2XSJB 3OR1B 2FD2A 5CHCB 1B0PA 6FDRA 3MM9B 1CLFA 1Y5LB 2FJEB 7FDRA 3MM7B 1FRIA 2WSCC 2C3MA 3MM8A 4XDDA 1JB0C 4AYBD 4CI0B 4KT0C 1H7WA 5E7OB 1VJWA 1FRXA 1Y5IB 1RGVA 1FTCA 5BYRA 3IR7B 1DURA 1GT8A 1FRMA 1GTHA 2VPXB 2WAQD 1K0TA 2C42A 5FD1A 3HKZD 3MM9A 3MMAA 1KQGB 2O01C 3MMCA 1KQFB 1Y4ZB 1DAXA 1B0VA 1ROFA 1G6BA 3MM8B 1FDDA 2WB1D 2C3UA 2C3YA 1PC5A 2PDAA 3IR5B 1G3OA 2VPYB 2VKRA 3C8YA 2PA8D 5BYQA 1FF2A 1FXDA 2FDNA 1BWEA 4YDDB 2V2KA 3MMCB 3OR1A 5L8RC 4L6V3 3EUNA 1GTEA 3MMBB 1FXRA 2UZAA 2IVFB 3GYXB 3MM5A 1Y5NB 2FGOA 1FRJA 4ID8A 4RKUC 3LW5C 1BLUA 2FJBB 3MMBA 3IR6B
chains in the Genus database with same CATH superfamily
4FYXB 3PIPQ 3NBPB 2BE9B 3MDFA 3DLKA 4ZJOA 4Q44A 3TRGA 1R3NA 3G6XA 3MEGB 3W63A 3RAQA 3F44A 2CPEA 4RX6A 4DHVA 2Y9HA 1LOUA 4JI5F 1DLOA 2I38A 2CVIA 4M5IA 4TY8B 2F9JA 1Z4UA 2MKCA 3W9JA 2W7OA 4DQRA 4H4MA 3CJ5A 4EK2A 4ZCLA 2CPIA 1WTFA 2DHXA 3NCRA 3QSYB 2MKKA 2Y8YA 3CDBA 3W1YC 3JAMU 1B99A 1UL3A 2RILA 1KHWA 5D0EA 3Q8PB 2HQDA 4J9QA 4F3OA 5K8OA 1RHUB 2I1RA 2RF2B 3V81A 1H2UX 4HR2A 5FIIA 4DG1A 1H73A 3IRXA 4Y2MA 4CRJA 2YKMB 5CCMA 2ZOGA 3MFIA 3P5BP 3UWTA 1X9WA 2DK2A 3V4MA 3DXSX 3FK4A 2QMXA 3OFFA 4B17A 1WSRA 3JSRA 2HMIA 3KNAA 4XPCA 4IQMA 3SV3A 4L72B 2DD8S 2F40A 4J7CA 4FVMA 3OFGA 3CTRA 4IFVA 4NA3A 3OHBA 2F1FA 2VC1A 3QLHA 1CJKA 2BXJA 1LK7A 1Y0HA 4P74A 1K1SA 4ANDA 3GIMA 3FMBA 1RU2A 2XHCA 2M2BA 5LL6d 3KLIA 4I7FB 3TVZA 5BR8F 3NOCA 1HNXF 1WD6A 2N3LA 5KFVA 1OYEA 3Q83A 5IQ6A 2GMHA 2M5YA 3FSXA 3NG8A 2RS2A 2R2SA 1Y7PA 3KG1A 2C3OA 5HMZA 2VD3A 3LTOA 2K7JA 3PO4A 3KG0A 2DT9A 1O51A 1PJ5A 1EETA 3DRRA 4CLFA 4NCAA 4X4OA 2KG0A 3W2WA 2XMVA 4G65A 3JB9k 3MM7B 2LEAA 2QTWA 2BJ1A 2GVDB 2AEFA 1FX4A 5CYMB 3NL0A 1Y10A 2VL1A 2CQ4A 1U8WA 2V67A 1Y5IB 3L3CA 3IRWP 1RGVA 2ILYA 3QZ7A 1Q81T 2R7SA 3A8KA 2R42A 2P6TA 1FKOB 3DLEB 4PXDA 4ES3A 4DL7A 4LIWA 3VWSA 1T05B 3IM8A 2JDJA 2F4VF 2ACMA 4WE1A 4JI8F 4YY3F 2IMWP 4URGA 2E7WA 1K0VA 4J9VA 3HVWA 1IWAA 1SCJB 4DS4A 2G0JA 1S7HA 2XZTB 4NLUA 3D1HA 4MAKA 2WB1D 1U6BA 4GC6A 3R27A 2V0NA 1FO1A 4ECYA 3A3OB 4AL7A 2QX0A 1J5OA 2IVYA 3PHEA 2M70A 2PA3A 2E9ZA 1S0OA 1REGX 3QSIA 3KLVA 4K4VA 3B6BA 4CTAB 1DY3A 3CD7A 4ZVEA 1RT5B 4B9LA 1M5VC 1D09B 4AE5A 3HJFA 3CCTA 5AT1B 3G8TA 2VJVA 1HL6A 3DM2A 3W3SA 1U25A 4UOGA 3NOGA 3FKBA 2BMBA 4F26A 4F4XA 3S6EA 2PE8A 4NLOA 3MPWA 3GR1A 3MEDA 2FC8A 1R6VA 3L7UA 4M63A 3D0GE 4NYOA 2Z2MA 3HT0A 3G6VA 1WNEA 4KE5A 1FTRA 3DCAA 1FA0A 1X4BA 3DLGA 2RSQA 3RAMA 5GAEU 1X9SA 2AYBA 3DLHA 4YUDA 2J9DE 3N0VA 4WJBA 2UVVA 2BE7D 4OYBA 4K5RA 3DDIA 4DUTA 3T9ZA 2PO4A 3IGNA 3Q24A 1VQ4S 3VTIA 4C8OA 4JV2A 1BLUA 1SC6A 4OHXA 2VQEF 1S1TA 2HSEB 1LNQA 1EKRA 4HHHA 2CJAA 2K1RB 4ZVQB 4EU0A 4A8MP 4NZ7A 5GMEA 1FRKA 1U7LA 4C7QA 2O66A 1S1UA 1HR0F 3DNCA 3OTDA 3BZQA 3W2VA 1K9MT 3JTPA 2FVCA 3VGTA 3PV8A 5A8WA 2I9SA 3VAMA 1R8HA 4N76A 4WFNQ 4NLGA 1WOSA 2A1BA 5K5MA 5CXTA 1NHUA 2HBQB 2HFUA 4O3SA 1YBUA 2OHDA 2GHVC 3DU6A 5CYQA 2DHSA 4ED4A 4PUOA 1JNZB 2HZAA 3HX9A 5IT9U 4Q0BB 1RI7A 3D3CJ 2JOQA 3JYTB 2GJFA 3CIZA 1HWIA 2QA2A 5H9EJ 5K8PA 1YIJS 1BMQB 3C14A 4KAIA 3B8HA 2V6AA 2F3JA 2NSBA 4AXIA 2V4JB 1YJVA 4USMA 2ZHAA 2ZHBA 1TFYA 4NWBA 1CS4B 2JX2A 1HNZF 2XMJA 1U1MA 2M4MA 3BH7B 1RTHA 4F0MA 2HIYA 3OT9A 2HVHA 2XMTA 4G6VB 1AB8A 1IKXB 2VJUA 1U02A 1S79A 1KR4A 1QE1A 4KKOA 3NS7B 3LP0B 5FDLA 5HJXA 5L39A 4C8MA 4A8WA 2CJYB 4M5NA 2FHJA 1UETA 4MYUA 1NJIT 4UY8T 2VFRA 3V2UC 1PYTA 4DG1B 2L9DA 3QFHA 1RT4B 1C4AA 3OL8A 1YJTA 4A8KA 4LFAJ 4NMLA 4WZQA 1U48A 2EBEA 1SIZA 2ZUGA 4NRTA 6FD1A 4ZITA 1WHVA 2FQQB 3CJRA 3VGSA 3PW2A 2LA6A 2XHWA 3VVTA 3IGVA 8RUCA 2E1MC 4M5KA 3AXMA 6AT1B 5DGBA 5D15A 1FEEA 3AD8C 5C25A 3MM9B 4DV3F 5ETSA 1Y5LB 3CCUS 4R0JA 2CQDA 2XY6A 4QYZK 3NMAA 1Q53A 1B7FA 5E0OA 2JLFA 5HAOA 1ZAXA 3UW1A 5GAHU 2NS1B 3TNVA 2QFJA 4UUWA 3LA0A 2F7VA 1S6UA 4GMKA 4DCJB 3EPGA 2RB7A 2DYAA 2V63A 2IDEA 1GMVA 3I0RA 4I67A 4RW6B 1PYOB 2CPJA 2I5JB 2D7SA 2Z2YB 1UJ4A 4KQZA 5CYMA 1AFJA 3MMJA 2YX4A 3W66A 2VODA 4F50A 2B6AB 2NXNA 3K5PA 2YVSA 4NEZA 2O67A 2Z57B 1G3OA 1EQMA 3BBBA 2DRDA 4IG3A 3VQTA 4EWTA 5HMWA 1EARA 2BANA 3W60A 5J1EA 1REVB 2H3EB 2GQQA 4TYBA 3GMGA 3D3BJ 4WFBQ 3EPIA 1RP5A 4QW8A 3M9NB 1YHQS 5L1KA 2LQJA 1WJ9A 4GVLA 3ZTRA 2HHPA 3DRRB 3SQOP 4CO2A 2A0FB 4KHRA 2YXLA 1SKSA 1GTEA 4NI2B 1N5TA 3W2WB 4H4KC 3I31A 4ETXA 1FNOA 2UZAA 4X4RA 2Q79A 2D1CA 4CLZA 3OL9A 4NMXA 4HACA 5G0RB 4CO1A 3OJUA 1RTDA 2OD6A 1ZZNA 3TEGA 4IG0A 3QRPA 2ZUAA 4DR1J 2CJXB 3LANA 2QFIA 3VAFA 1S0NA 2IYGA 4KHMA 4O3NA 3T5JA 4YHHF 2YWGA 2IIHA 4P73A 5A2QY 1FESA 3OL7A 4RKUC 3H42A 4DI6A 4C97A 3O6QA 5D4PA 3D6TB 4OZ3A 4DL5A 2C2RA 2FJBB 3NEKA 1XQIA 2BZ2A 3MPVA 1N56A 4FYDA 2O1PA 4P2XA 1NJYA 2UV8A 1S57A 2E9RX 1YWXA 3Q8SB 3MEDB 1GAOA 3MR5A 5L1LA 2AGPA 3NP5A 5EX3A 2XLJA 4S0MA 2DCLA 4G3IA 2M52A 1RHMB 3BO4A 1DBDA 3CCRS 5F0WA 4ECUA 4WU2A 2YKNB 4U67Q 1H6KX 2QRRA 2X1GA 5DLGA 1BHNA 4NXNJ 2DO4A 4F67A 3PX0A 1SJ1A 2GV1A 4RBUA 4I6AA 4DR4F 2UXBF 2OMLA 4MFBB 1IBMJ 1DQ9A 2Y0SD 2CQCA 4J90A 4RLEA 3OTEA 4JI3F 3D28A 2V2ZA 4ZS6A 2G13A 1K1QA 2XI3A 3MGJA 3R5CA 1DZ5A 1K47A 1D8YA 2EXUA 3GCWP 4DF8A 1A9NB 5DDOC 3DRSB 2BJDA 2RKIA 3QT6A 1YDLA 1MU2B 2IDLA 1TFWA 5AXLA 4TVAB 3FZBA 2WSEC 2RRNA 3G86A 4USVA 3E51A 1J2VA 1LW2B 2DISA 4JI4J 4ECRA 3MD3A 1PYSB 1WOOA 3BGOP 2UUTA 3VCDA 5B0EA 1R8BA 2XLIA 3C3LA 1JLAB 2PT0A 4ECVA 2OO4A 2D41A 1RYSA 4BS2A 4A4JA 1ZS6A 3OBIA 3M1VA 1EP4A 3I82A 5DM7Q 3R7NB 2J7UA 2KG1A 4WXOA 2CNOB 3IAM9 3NAHA 2IJRA 5L1JA 1UVNA 1LXJA 3CCES 4FYVB 1H98A 4IH7A 2HGNA 1GMWD 3RZAA 3PW0A 1U1QA 2OPQB 2R4FA 3HHKA 4H54A 2NYIA 3C66A 4HH1A 3P6YC 3IBWA 1CJTA 1RABB 3D66A 3DRXA 3MEKA 1XC9A 1JJ2R 3V4IB 1N32J 3M8ZA 2Q43A 4XTTA 1URRA 4PUOB 1U45A 3LP0A 2MZJA 4OLOA 2FJVA 4IUFA 1M0SA 2IJFA 3LUYA 4O4RA 4RBVA 5AXMA 2KU7A 3SBMA 4AL6A 4DFKA 2MSSA 3FCWA 2MLYA 2ZD1A 3BKFA 1ZPVA 3BDEA 3MM8A 4ZLPA 1RDRA 4GRSA 5DG8A 2HHQA 1OJ4A 1UFKA 1CJVA 4RO0A 2DNRA 3MAQA 1UWBA 2ZJPQ 1NJXA 4FXDA 1XJWB 3QT5A 1WHXA 4HT5A 3HFKA 2DNOA 3GYGA 1RWVB 2HFSA 4ZJQA 1K8AT 8AT1B 2VICA 3EZ5A 3E8OA 2C42A 4QWEA 3CD6S 3T19A 4DSFA 1VQ6S 4CLUA 1YLXA 5HO4A 2LEBA 3X1LB 1AYEA 4J9LA 4ICLB 4O3RA 3ET6B 1M1KT 2XSFA 1S9EA 4FF4A 3C15B 2DGQA 3OHAA 4IDKB 1Q7LB 2GQCA 4Z2XA 1T95A 1VIXA 4CH7A 1UA1A 4U7UD 3K59A 3A13A 2HNDA 2QLJB 2PA8D 3H40A 1UW9A 3KUEA 1H74A 3ITHA 3M8YA 2V8VA 3M6WA 4YDDB 4RW4A 3WZ0A 3F73A 2AZ1A 1WKLA 5M2PA 3Q22A 2DR9A 2V2KA 1RLDA 1C1CB 4EMDA 5BJRA 1DHMA 2CQHA 3HK2A 3V81B 1HQ2A 3C6TB 3KJNB 3OQ2A 3PHTA 3BR8A 1FKPB 1X60A 4M5MA 3GIJA 1U1NA 4LF4J 2IY5B 3Q89A 2R2TA 2LQ8A 3FRZA 3MXHP 1WUUA 1X4GA 5B0FA 3M30A 3OFEA 3LP1A 2VG5A 5DDRC 2HQIA 4FPRA 4OJGA 2DY9A 2AGQA 4DSKA 5H1SV 2OEJA 4JI7J 1M5OC 4ZCIA 1DLOB 1GMWA 1GK8A 3I5CA 4FNHA 2IBOA 4FZVA 2HS0A 4NCGA 2OPPB 3A4TA 5A8RB 3AFGA 1S6QB 1YJ7A 1WKJA 2CFXA 4DPXA 1N8RT 4QIEA 1IKVB 2HLUA 4DDFA 3GQCA 2OSQA 2QZ8A 2QSFA 1SXLA 5LJ3Y 4J5OA 1HNIA 2MMYA 1YTYA 1GXLA 1OY8A 1U1KA 2P9EA 1UVJA 3PX4A 1MWZA 3R3TA 2QG9B 2CQ3A 2F5GA 2G2OA 2GVZA 3J81Y 2X51A 2C2EA 3IRXB 4UOCA 2D69A 4IR9A 4K50A 3KJVA 2V8GA 2UVWA 4X64J 1KSPA 2EFGA 2WCXA 4IRDA 2CZVC 3OL6A 3JQMA 2OD4A 3MD1A 5FJ4A 1R89A 2ZBPA 1C0UA 2FJDB 2ROPA 4OI6A 1YBTA 2HAIA 3CCVS 4PWUA 5LMNF 1T3NA 1RBOB 1QVGR 1PAEX 3CDAA 2Y8WA 4P9SA 5HBMA 2M8HA 2CRLA 4JI3J 2GS8A 1FCAA 4UUXA 4PG8A 5ETRA 3PW7A 2NZ4A 3DRYA 4B9VA 3U1MA 1RAEB 2D3OR 3MECA 1VHIA 3AHPA 2F8EX 5J1NA 4B3OA 2R7XA 4IH5A 1TKXA 2CPZA 3J80U 2E9TA 2HBYB 1XERA 3DOMA 2E5JA 1LWFA 3RW6A 5DZ6A 5K14A 2CVEA 2MXYA 1OSDA 3M2UB 4ID5A 2FVRA 4PWDA 1FFSB 2Z2ZA 4YFUA 1D3WA 3QWUA 1JLQA 5J2QB 5F8NA 3DHWC 1S49A 3NBPA 4DN9A 2JJ4D 4YQWA 3D0IE 4DV6F 2O3DA 5AXKA 1TMJA 4DLEA 2JEFA 4K4ZA 2Y0BB 1IR1A 4ED5A 4DR2J 4P52A 1FERA 1N88A 2WBRA 3BGLA 1LEOA 4K8RA 1OPIA 2PSZA 2NQPA 3FUYA 1WI6A 4XDCA 3DRPB 3S7RA 4NE9C 1Z2LA 4JV1A 1HI0P 5DQIA 4LSZB 1I94F 2DPJA 2HFNA 5CQGA 5KG4A 1T05A 2MKHA 3V5RA 1CLFA 1TR0A 3UVJB 1FJGJ 4DSIA 4BCAA 1RISA 5AXNA 4WKRA 3ZZRA 2BJ7A 4LR9A 1T03B 2ZKTA 4DR2F 1P9QC 1UZDA 2ZZNA 5LXRA 5K9FA 3OW2R 3CMAS 1OMSA 4A48A 5GAEI 2ZM6F 4JI1F 3D7SB 1PG5B 1LW2A 2H4WB 2DGXA 2E7XA 2JFKA 1GX6A 5I3UA 1NK7A 2UUBJ 5LSOA 3HSGA 3I9ZA 2OPRA 3I0SA 3UR3C 3SMZA 3UCUP 3ULHA 3HKZD 2X3GA 2DJWA 1FE4A 3MMCA 5IT9Y 2E1AA 3M1VB 3MOZA 4IFVB 4P2SA 2CAJA 1NZAA 4LUBA 4KRWA 3W62A 5AE1A 2FLLA 2EC0A 2CPDA 3FSIA 2QLXA 1LWXA 2C3YA 5DETA 3TO8A 1NEEA 2M7SA 5E41A 1SKRA 2WB4A 2OPQA 5DG9A 5EGYA 2Z0GA 1U1RA 3R1HA 1UEKA 2JL9A 3H2LA 5KFJA 1VQ5S 4RW7A 1FWLA 4O3PA 5GADU 3CF5Q 1Z2ZA 2QT7A 2GIQA 2CQ0A 3IO1A 3D4JA 1EZZB 3GSDA 4TLQA 5I3PA 2F9DA 2LECA 3CEDA 1M5SA 1S1WB 2JRSA 3HFVA 2QN6B 1FXRA 4ZDNA 3HHDA 2GVDA 5J2NB 3CJ3A 1D9AA 5LM7E 3VAJA 4NLRA 1VS3A 2VG6A 2YKOA 2KO1A 2XMWA 1CJVB 1JXEA 2HK3A 3Q8YA 3EVMA 5A8WB 2XQCA 3M9MB 3PJ9A 3K58A 3KLEB 4DR4J 2UXBJ 1PAUB 4C0BA 1KKHA 5E3CA 3TUIC 4OJ1A 1NKCA 1DARA 4L75A 3S1TA 2CWKA 3BGRB 3CD5A 2Q1LA 4LRAA 3BSOA 2HGMA 3KFWX 2B9YA 3VGUA 3RBEA 2EVZA 1KOOA 3EVOA 4WYLA 4DU7A 4FF3A 5ETPA 4USTA 3OTCA 1BE4A 3IG1B 1ZAWA 3FEYB 2HBZB 2CPFA 3C15A 4ALZA 2GGPA 3MM5B 4QZVB 3EMTA 1K44A 4TXSA 4DX5A 2GA7A 2PFDA 3H2VE 3NLCA 2DGVA 3MR7A 4MH8A 4WFXA 2AEMA 4OV1A 2DEIA 3SCJE 3TR5A 1I5OB 2MLZA 2YNIA 2QO3A 3ITHB 4CH1A 4DR1F 1P6TA 1NO8A 1S97A 3KMQA 1WF2A 1VCTA 2RUSA 3G6ES 2R7UA 1P8GA 3DM2B 4QWAA 4OQJA 3VZIA 1QUPA 1YG0A 4OHWA 4B9SA 1A7GE 1TP7A 3GCXP 3HO1A 1XWLA 1D1UA 1AZSA 2E5GA 3PR5B 3RG6A 3H59A 3PNIA 3TUZC 2NCKL 4I1TA 4USJC 1VQ9S 1TUWA 1ICEB 2HHTA 3QJLA 5DLFA 1HNXJ 2UXDJ 2JFDA 4USHA 1CC7A 1KOHA 3CDEA 5HROB 2PC6A 4Q2LA 3K0JA 1R27B 3GJQB 4GO7X 4A46A 5LMUF 2MKJA 2WVCA 4OX6A 3BYPA 2CNKB 1XK8A 2E5LF 2UUBF 2HQFA 2YPYA 3NGKA 1QSYA 2IPOB 1HNIB 4KO0A 4I2QB 4ITSA 1F6TA 2XWYA 1SKUB 2XULA 4WK1A 3TZZA 3FZ2A 5J1EB 2PI5A 3KDNA 2G4BA 1VQSA 2MJUA 3KMSA 3I4HX 3NS5A 1HIYA 3A8EA 3VV2B 2B9XA 3UD3P 2MKYA 4KTQA 1RT7B 4ZPBA 2BQRA 3GG0A 2GO9A 2YNGB 2ZHOA 3ENVA 4FXVA 1N5YB 1N5QA 1NHVA 4X65F 1VQKS 4DU8A 2IM2A 2XYPB 3EZUA 5J2QA 1QY7A 3DFEA 4I68A 3WX8A 3KLHA 2HK2A 1Q95G 2XO7A 3HSZA 4IO1A 1TQLA 2VC0A 4CWBA 1S48A 3JXOA 4DCOB 3DDKA 3DDNA 2B6AA 2CIMA 1XMBA 2DCUB 3QGGA 3RYLA 5HVGA 4RU2A 2HRTA 1R43A 1AROP 1HLWA 1RA6A 1TKXB 1X31C 2GFFA 2PMWA 3GSIA 1DURA 1REVA 2RQMA 4YDXA 4LF8F 2WAQD 1QD1A 3N79A 2QE5A 3IBFB 1C1BA 2JVOA 4RW9B 1EAYC 3BREA 4MKVA 1HA1A 2UVRA 1Y00A 4JI6J 4PWDB 2DHHA 1JLQB 4O3QA 9RUBA 2JHEA 1RHRB 3PR4A 2AEJA 4X4UA 1SI9A 4DX7A 3TA2A 4DR7F 2C3UA 1PC5A 3J7YI 2K2PA 1G1XA 1R8CA 2W9AA 2DTJA 3SCKE 2HW3A 4ZP6A 1WG5A 4MT1A 1BWEA 1VISA 4JI0F 4ECTA 2WOMB 1IR2A 5AE2A 1S5ZA 5HK4A 4EZ9A 1L3UA 3GIIA 2Y1JA 3BPSP 3A3NB 1NCLA 1S6PA 3MMBB 3NNAA 4M5JA 1PSDA 1T9WA 3K5MA 1QAXA 3PXGa 3B54A 4ILMA 2YKPA 4UTGA 2MPUA 5ETOA 2UVUA 3ZO7A 4CDIA 2EFPA 3UD4P 4FF1A 4DPYA 1RYRA 2EEYA 1YQHA 2QSWA 2EKYA 2KVIA 3RUBL 3VVUA 2AJ2A 3I32A 3LGMA 2DNGA 3JSMA 1HQEB 3HZEA 1IM6A 2OPRB 2XNQA 2I8EA 3NGTA 3PCOB 4ZPWR 1NSQA 5IFMA 3BO2A 4DQSA 1VBKA 4JI6F 2XB2D 2KB2A 2QMWA 2P9GA 1U09A 2XWXA 3TW0A 4PXCA 1TL1B 3K17A 3A8IA 2ZVIA 2VBXA 3U27A 4Q43A 1YJWS 2YY3A 5F8GA 3A8JA 2KRRA 2W2NP 1V9OA 3RB4A 5M2RA 3HVAA 3ELHA 3TYTA 2V4QA 4Q7AA 1YZ7A 4YB1P 3WHIA 1FDAA 1H72C 3CJTA 1RB0A 3ZZUA 1RBAA 4RBTA 1W7WA 2R8KA 3FNNA 2VPWB 5GMDA 4JYAF 1J5EJ 2ZFHA 2XYGB 2VKZG 3HSDA 3D2WA 2R2RA 4DUYF 1FKAF 2L3MA 3QLHB 3GONA 2J0WA 2X1FA 4DQQA 3NGUA 3DI6B 1A6LA 4W4MA 1ZM4A 3Q8VA 4YN3B 4F0HA 1UA0A 3I5BA 4IH6A 3NGDA 4J9MA 2YH1A 1T03A 1F3VA 3R5BA 4I56A 4U95A 1EHWA 3H5YA 2AJ0A 3CW2C 3VF0B 2KTQA 3PW4A 3IAS9 4OI0A 1HD1A 2ZH2A 4BBYA 1SV5A 4PQUB 2CQPA 4GVBB 4ED2A 2CWXA 3LAMA 2BW7A 3MMAB 4NLTA 1VQ7S 2PI4A 4X4PA 4ILLA 2YKQA 1RT3A 2R8IA 1EIYB 4JV5J 4ICLA 2UP1A 4CM2A 1XTZA 3RJMB 3ZC4A 3PACA 4NLYA 4KC5A 2KXHA 3M6XA 4F4KA 1AW0A 4UT4A 2W9CB 2A2CA 3CJ8A 2Y1IA 1KHVA 1S1VA 2KI2A 3H5SA 4ZVFA 2V69A 4ZVUB 4C3LA 4DEZA 5KFHA 3J7AN 4HI2A 1OS5A 3TJAA 5KFFA 2XSJB 4M5DB 1RT6B 2FC9A 2YNIB 4MFBA 5CHCB 5C42B 4ZPAA 2N82B 3P8BB 4KH1B 4YB5A 2AWZA 2F8MA 1HHQA 2B4OA 3ZZPA 4QIFA 3LP2A 1RAFB 3WC0A 1FKPA 1JQGA 3POTA 3R5GA 5H9FJ 4UW2A 2L9NA 2ZH7A 3MI7X 4NLVA 4YY3J 2W4PA 3OFHA 1F9EB 1B3TA 4C6AA 4RNNA 4NXNF 2HAFA 3UNYA 5HSPA 3N5FA 4FVCA 4PXBA 3TOQA 3V6DA 2QYGA 2ZBCA 1KVKA 1RT7A 3EICA 4NA1A 1OO0B 1QDUB 2P2CB 3ZZ0A 3JQKA 5JXSA 5DO2A 1S6QA 4JYAJ 2B51A 4RNMA 3HHLC 4TN2A 3ZZTA 5EN1A 1PJ7A 1U0SA 4KGXB 1KQFB 4PR6A 4DUYJ 1HBOA 1HMVA 2CG4A 5F3TA 1S99A 3R7BB 1N33J 3O2IA 2LXFA 4YMEA 2OFGX 2V9KA 1CULB 4J37A 4N8NA 4ZP7A 3D5MA 4RU9A 1M5PC 2MLXA 4I4BA 4KIAA 1HKAA 3SFGA 3BDPA 1Z1ZA 3Q0AA 1EX8A 2ZC3A 3ZZZA 4MKYA 5KFNA 4KJIA 5BYQA 4ZLNA 2DO0A 2YQ0A 4NLSA 3UO0A 5HN0A 4C98A 3E01A 5L8RC 4C2MA 1N6QB 5ETKA 1IKVA 2EK1A 1WG4A 3KDOA 3DU5A 4DSJA 1Q5VA 2XMMA 5KFYA 4PXEA 5ADZA 2KT3A 1MMDA 3ISZA 2ZC4A 3KLHB 1IBKF 4B3SJ 1RT2A 4D3GA 4EGLA 5KT3A 4XIUA 1Q8IA 1KS2A 2J7WA 3MECB 4PKDB 4CYUA 5JJBA 3IMQJ 2XMUA 1HNWJ 4O23A 5HP1A 1FNMA 1RCXB 1SC1B 2GIRA 1HR0J 3PYFA 1SL2A 3EGZA 4K2XA 3QAUA 1N5SA 1TKZB 2ATCB 1IUJA 5K14B 4AD6A 2RIJA 1NLKL 3BEGB 1JWWA 1EJ7L 3LW5C 4F3QA 3W9HA 1SH2A 1F1BB 1SBRA 3D6FB 3OSPA 4OYOA 3SDEB 3IC1A 2ZOFA 2DNYA 4Y00A 4OZLA 1HWLA 3D6HB 4U96A 1F0XA 2OEKA 1TV6A 2KJVA 4U8VA 5F8IA 1RWMB 3GFZA 1F9HA 3O8WA 1U1PA 4P6QA 4ZMMA 4X2BA 4DFMA 2HNDB 5D3GA 1LWCB 1Q4RA 2HURA 2WSFC 1I1GA 1KP6A 3S01A 1O0PA 2V2VA 3PJWA 3GIKA 1KLNA 3C46A 1RJJA 1Q1KA 2JVRA 3UDCA 3OLAA 2A6MA 3EVWA 5CYJA 1RAHB 4FKYA 4M5HA 2Q66A 1FRHA 4K4XA 3V6JA 1WORA 2GNKA 1M5HA 3FC9A 5F9LA 4QW9A 3RR8A 3OLBA 3JSYA 4MYTA 5AJ3F 2FJXA 5CD4A 2RNEA 1RT4A 4UZBA 3KTQA 4ECWA 3LP1B 1M5KC 1MN9A 4DWIA 2YWFA 3EGWB 4CO0A 2RHQB 4F4YA 2OELA 1Y11A 2MZRA 5KFRA 3GPAA 4KR0B 1RAJA 2N7YA 3RBXA 2VF3A 2YWKA 2XLKA 2LDIA 2B5JA 2WTFA 2GZOA 3K8WA 5KT2A 1LW0A 5CD4H 2APOA 3UN3A 4WFAQ 2XY5A 3I87A 3ZXWA 3PG9A 1LFPA 2LMIA 4IOBA 4B3SF 2LU1A 4KPCA 1FNXH 4WYWA 2HVDA 1HFEL 1RZMA 1NB2A 2BX6A 1MSWD 1H0HB 1EB0A 2BDPA 4Y34A 2YQ1A 3I4PA 2P8IA 3BGFA 4KGZB 5J2MA 4DCPB 1NDCA 3SCIE 5T7LB 2BOPA 2RQCA 3FFIB 3QATA 1VOMA 4LSNB 1SV5B 1ULRA 2DNNA 2OSRA 4GVBA 2IRYA 2RQKA 4FDFA 4PQUA 2DEJA 5D6GA 2VG7B 2A10A 3TA1A 5GADI 4QCLA 1KTQA 4F0KA 4NXMJ 4GKKJ 2R7VA 2BV3A 2HPUA 2WSCC 3D1QA 4W98A 2MY7A 4UQGA 4W92B 3PJXA 3EDQB 2W4DA 3CCSS 1RTZA 4DV1J 1KWMA 1H38A 1VIOA 3FMWA 5E3RA 2EPIA 2HWHA 2W2MP 4WTYA 4CZCA 1GEHA 3H98A 4TU7A 3VR1A 2J7KA 1GTHA 2W7PA 2DR7A 3ENWA 3VAKA 3QJPA 4F7VA 5EWGA 4AL5A 2FHKA 2QLFB 4JOUA 3S8SA 4MKBA 2YX1A 2UUWA 2SXLA 2E7VA 1GMUA 1S1WA 5HLFB 4FS1A 4EFAC 4DL4A 2XS2A 4K4SA 2AP6A 3O1LA 4DV5F 1NPPA 3LO3A 4JB8B 4ANEA 4ZCKA 4FPIA 3ILJA 3ZTQA 4I2PA 2BKOA 1IXKA 2AF6A 4XPEA 1S1VB 1SUQA 3DGPB 1GXTA 1E6YA 1FK9A 3QGIA 4A8QA 1WTBA 3M05A 4CLYA 5LSLA 4N7TA 5C42A 3WIVA 2HFVA 2ZBRA 3AT1B 3TAMB 3LP2B 1UPPA 3CXCR 4TU9A 1U49A 4YB7A 3KNGA 1WSVA 4PCQA 4C11A 1L3VA 3F41A 3SYZA 3LAKA 2R8JA 1UPMB 2BW2A 1WC4A 1YX2A 1FVSA 2FGOA 3W5XA 2YKNA 4UZCA 2GIFA 1XNRJ 3GJSB 2V8HA 2LFVA 2B7CB 4PG6A 5KAKA 3V6DB 1QSSA 4FBTA 5KFSA 1NK5A 2AHOB 2XEXA 4IRCA 4LR7A 1KQSR 2OUGA 2VH7A 4LT6A 4OHVA 3UDVA 1W2BR 5IV3A 2B4UA 4KSEB 4X4VA 1W26A 2ZE2A 1HBOB 3AOBA 2JZ5A 2ZITA 2XCAA 2ALZA 4J9SA 2PD1A 1GFWB 2HQCA 1NMEB 4OYAA 1CULA 2VPZB 2ZZTA 3TA0A 4C48A 2Y1LB 2BJ8A 2MY8A 3FVYA 1OQ6A 1OIAA 3QFWA 3UD5A 1W25A 1K0TA 2MHNA 3GP9A 3BYRA 3VAGA 3M2RA 1C0TB 2MQ8A 1JJ4A 2PGCA 3H25A 1TL7B 1RTIB 3A1YG 4C8ZA 2BE2A 2MKIA 3W8GA 4ZVRB 2RRAA 2ZH5A 3SXLA 4G1PA 1NPRA 4DV0F 3TZWA 4Y28C 3BH6B 4K4UA 1MWQA 4P72A 1G2EA 1CSJA 4OYIA 2HQGA 2EFQA 3W5YA 5I4MA 3HVRA 2J6TA 2GCFA 2RU9A 4JBCA 2K06A 2FB0A 3D1OA 2VG6B 3MM6B 3SZ2A 4Q45A 1T11A 5IT0A 3FBBA 1FVQA 4LQ3A 1XNQF 4KV8B 3BGUA 4H4MB 1LWCA 2C2MB 2NUUG 4HYKA 1NB7A 1IN0A 1TKZA 4HH0A 4P75A 5HATA 2N7CA 3ZTSA 4WKYA 1XMOF 1P1LA 2RD5C 1PBAA 3F0NA 3QQCD 1Q79A 1RUSA 3BGRA 3V4IA 2CJ9A 2WONB 3HJVA 2D74B 2PN6A 1XEZA 4NYPA 2NYHA 1CBKA 1UZHA 3M6VA 3MAHA 4OI2A 2BM0A 2NLWA 3OUYB 1F5CA 1RSCA 1U2FA 2MQMA 2ZD1B 4U6PA 2WRMA 2P5VA 1VR6A 5LMNJ 2R7WA 3KJFB 2HNYB 1HNVB 5HVHA 4R0EA 1YSJA 3VZHA 1FD2A 3FCHA 4QU6A 1FEHA 1UEVA 1UTAA 4WU3A 4OX8A 4Q8FA 5KG0A 3JTNA 2PMHA 1NSKL 2V50A 3ADAC 4N5SA 3M8WA 3SCLE 1WC5A 1SL0A 4FNIA 2HVIA 2A6OA 2WW8A 5A6WA 1U26A 4W90B 1GH8A 1LKZA 4KBIA 3MCOA 2HYIB 4HKQA 2OTJS 1AZSB 2J5AA 3AA9A 4DMZA 1DJ0A 2GO8A 2DNKA 2I6WA 3MEEA 1L5UA 4OZ5A 1FTCA 5BYRA 5CCLA 1HHTP 4NRUA 1MNEA 1WACA 3H20A 2LKZA 1HPZA 3K8VA 4OLPA 5DQGA 2OJ3A 4LFAF 2R9LA 1HQEA 3WIUA 5B7WA 4LFCJ 3RU0A 4WTOB 1AUSL 2QYCA 3CJ2A 3NNHA 4UOFA 3B4DA 2B5JB 1R0AA 1ROFA 3VAHA 1TZ0A 2HHXA 2QL5B 5D4LA 1CQMA 4DL2A 3IP0A 1I51B 4I2QA 3BJYA 3KK3A 1OWXA 2FVPA 3IWXA 5E3QA 2OH2A 3HZGA 1FKOA 4M5LA 4QWDA 1TVRB 1YJRA 2BKNA 3LGHA 2HS3A 2GW8A 2KRBA 2KT2A 1U6ZA 3PRVA 2L41A 5KT7A 2AMCB 4HVZA 4JI1J 4JUZA 2JH3A 2H5JB 1NKEA 1QAYA 4TYAA 3G4SS 3R9LA 3P45B 4RWXA 1WF1A 3AOCA 2JC0A 2RDIA 4L3KA 4ZN3A 1HYSB 4LFBF 1NH8A 4RUCA 5ITHA 1Y5NB 2MSTA 1VQLS 4NXMF 2DXFA 2YH0A 3KJVB 1AT1B 1X4CA 5T14A 2IM1A 2YTCA 3CB4A 5LXYA 3CUNA 2DH8A 3R5JB 2KHCA 4F2SA 2GMLA 3IR6B 1TTHB 3CCMS 3T1YF 1LXNA 4H4OB 3BSNA 2KFZA 4XO0A 2BKPA 4LFBJ 1YITS 4ZPCA 3C2PA 3FSYA 2M0GB 3C19A 4Y65A 7AT1B 1DTQB 1RAOA 2B0GA 3QRRA 3DLGB 3RB6A 4WFYA 2DY1A 3GR0A 3R97A 3BF4A 5RUBA 4B3OB 1BC6A 2H4YB 2VFUA 2EFNA 2U1AA 1T9XA 1RWXB 2IYIA 3G71S 3GFXA 5KOXA 4UF4A 4DX6A 3KLGB 1LFWA 1SUQB 2V5HG 4RR5A 1ZH5A 2JEIA 3MPYA 2VQFJ 3H0PA 2LQ9A 1T9TA 2WVEA 3BS9A 4RNOA 1VRUA 2PIIA 5K20B 1L3SA 3G9CA 4XK8C 3P96A 1NZ8A 4OMFG 3CULA 2AX1A 2POKA 1BD6A 1R8AA 3G8SA 4X62J 4O0NA 3MCMA 2B8QA 4R25A 4Q5VA 3FGVA 1JLEB 3FDSA 4B3TJ 2XGQA 4D3HA 1KTVA 3H5XA 4EBCA 4DZ6A 4EBEA 4WZMA 2V2QA 3D0HE 4USKA 2ASLA 2XSJA 4M5DA 1TUGB 2HHWA 1JXLA 2DGUA 4Y3CA 4Z7CA 3KUHA 1QVFR 4KB7A 3N9UC 1JNRB 3RR7A 1RWNB 3C14B 3LOUA 1HHSA 5KOWA 2DH9A 2BOAA 3UN5A 2AW0A 2HVZA 2WW4A 1X5SA 3DHXA 1ZA2B 4HHJA 2CQBA 4LIRA 4CNZA 2MYFA 2CNNB 2MQPA 1KONA 3D54A 4QIVA 2BQUA 1KD1T 3Q8RB 3GV7B 3B4MA 1FXLA 2LVWA 5B0AA 4DR5J 3CWJA 2V34A 3DLLQ 2FTRA 1JMTA 5F8LA 4ED3A 1TL7A 3J81j 1IM4A 1DQ8A 2LU2A 2BE2B 4M8LA 1QLNA 5D77A 4ZIWA 1VBXA 2FJEB 4ED7A 4F36A 2J6SA 3C16A 1FRIA 4AYBD 3MZIA 1IKWA 2B3TB 5ETLA 4RNHA 2B43A 1WHWA 1S0MA 2HS4A 4CLPA 4LF7J 4R5PB 1S9FA 1YRTA 1CG2A 1GNKA 3L9ZA 2DIVA 1RACB 1Q8LA 2C2KB 5DZ7A 4ELTA 1SQGA 2IRXA 3DGVA 3PFEA 2ZM6J 1J5EF 4A47A 3CCLS 2OIHA 4RW7B 5U47A 1VI7A 3MMAA 4WCEQ 3SDEA 3GU0A 1XNQJ 1QE1B 4KKOB 1MG7A 2F65A 3R2CJ 4FN5A 5E5NA 2OP5A 3HCXA 4EYIB 1SJ3P 5E2QA 2UXCF 1HI1A 2I0XA 1W2IA 1HNVA 1NUEA 1O5JA 3KWMA 2W9CA 1ZZFA 2IBKA 5JVHQ 2NR0A 4NLQA 3KLEA 2ROEA 3L95X 2J8SA 1EKSA 4C8YA 4ERDA 2JSXA 2J0QD 3CCWA 2BUNA 5KG2A 2UUAJ 2HNZA 2X7IA 1NPKA 2YBVA 3T5KA 3PX6A 3JSBA 2XMAA 3PW5A 2HHVA 2YNFA 3N6MA 2AX0A 2JLGA 1X5TA 1NDKA 2XS5A 3POTB 2PEBA 5I3QA 1URNA 1ZOTA 4ELUA 2HKEA 3NAIA 3QAEA 2K7KA 3N4WA 3PYDA 1V3ZA 1FFWB 4K59A 4ID8A 2AV5A 4DR7J 2DKOB 3ISNC 2KFNA 3MAAA 3MF5A 5HANA 2AYGA 4LBPA 3CC7S 4U7UK 4ZLLA 4KGMA 4K4WA 1R0AB 5J2PB 1FDBA 2K8GA 4RNFA 4Y0FA 1HMVB 2XGPA 2EW9A 4A8SA 4QOTA 3NGRA 3I9V9 2XG8A 1BQMB 3IWLA 5FLXU 2ABYA 3N28A 4Y6IA 4DFJA 1VC5A 5KFXA 2R8HA 3KK3B 2H65B 2PMZD 4IOCQ 3TVYA 1PKUA 2CDQA 4QPTA 1RKJA 3IFEA 4J91A 1NNDA 1T94A 1EETB 1MMNA 3CC2S 4KPYA 2W1BA 4LR8A 1JLBB 2R3VA 2Z56B 5GAGU 2Q3PA 3WDOA 2B56A 1VQOS 4NI2A 5C7PA 1CJKB 1IWGA 3QGHA 3AH6A 4CT9A 2LEPA 1N36J 1B64A 4DL0C 1ITPA 1KFSA 1HYSA 1FFGB 2EBGA 4PABA 2Z58B 1ZYQA 1VC0A 4AQYF 1NK6A 4O3OA 3K5OA 4V19X 4C9DA 3ENAA 4PPDA 2J8AA 3GILA 3SSRA 4FKXA 2D9PA 3E2EA 2YNGA 2NSCA 2CJQA 3AOAA 3QRQA 4LBHA 3ZNUA 3ILOA 4USWA 5A6PA 3FRYA 2E29A 5B0GA 1RE1B 9ATCB 3V6HA 4H4OA 4EYHB 3U1NA 4K0KF 2E5LJ 1X4HA 3AQPA 3ZTPA 4B3MF 2DNLA 3K89A 2FHOB 2J0XA 2DNQA 2XNRA 2CQ1A 2DRBA 2DNHA 4HEA9 3DGPA 1WEZA 2CUYA 2CYYA 5IC6B 3TARA 3QIDA 2UUAF 2W01A 4A8OA 5F8JA 2EI5A 5E33A 2LCWA 3CE8A 2ASDA 2HHUA 3N5BA 1S76D 1PIEA 3H90A 2KFYA 1D0EA 1HBMA 2JNJA 1SVDA 2HBRB 4UQTA 7FDRA 4EEYA 4C11B 3IWNC 4B3RF 1YRXA 5HLFA 3UE2A 3VGVA 4X66J 3FBFA 2A3JA 3DRSA 3MHYA 2RKIB 1XBWA 1VJWA 1U1OA 1R31A 3D6MB 3W7BA 3QJJA 2FVSA 2NXJA 4ED1A 1UCNA 1WC3A 2GJ2A 1FRMA 4CTAA 2UXCJ 4ZVHA 2XZWA 3DMJA 2E1CA 4MJKA 2VONA 1N52B 5SUHA 2FZKB 4IRKA 4MIBA 5B0CA 4ER8A 1B0VA 3TVKA 2WVFA 1NJWA 1X4FA 1X4DA 3R6LB 3DYAB 4PAAA 3V6KA 2H9ZA 1N36F 2FPHX 4F04B 2ALYB 2MTLA 3ZTOA 3BBCA 3P5TL 2OTLS 3TZXA 3OSNA 1UJ6A 4DV0J 3NCPA 4AXJA 2KZMA 3OXFA 1WC1A 5F41A 4DL3A 2ZOMA 2HIQA 1N32F 3EE3A 2K3KA 1Q82T 4EUVA 2FLOA 2U2FA 4JV5F 1X7VA 3FEXB 1KLMA 2K1RA 5AE3A 2ZE2B 1RT1A 5CZVA 3I56S 3C16B 5KG5A 4IDKA 2BRKA 2KZZA 5A76A 2VBWA 4ENOA 1M1GA 5IC4B 4ZCMA 3QBCA 4O0IA 1IBLJ 3Q2TC 2BVZA 5B0BA 3MR2A 4RW4B 4DV2J 5DJBA 2HNZB 1HBNA 2C2NA 4DF4A 1DRZA 2OMOA 1WF0A 2W9BB 4M95A 2WONA 1RTIA 4OX9J 1UW4A 3EDRB 3W65A 2VHGA 3OUYA 3QIPA 2ZH3A 1C2PA 3AD9C 1IQZA 3T3FA 2C28A 2L48A 4HL9A 1ZTWA 1FJCA 1KFDA 3GFYA 2VOOA 4OV6A 4OZ1A 1PCAA 4WP8A 5IOLA 2OEMA 3EGVA 2F4VJ 3AJ1A 5FLXY 3ILLA 3IS9B 2V4JA 2YQ3A 3NS6A 2I2YA 4KHPJ 2DR5A 2CJKA 1T9UA 4I2PB 4NCGB 2J9CA 4KV8A 4C8NA 3MAAB 4Y2IA 1UKUA 1ZETA 2HWIA 3HP6A 4YOEA 4QR1A 2DVIA 1U8SA 3M2VB 4PYDA 1C1CA 1K73T 1NJZA 1RT3B 1T0TV 2W2OP 4CT8A 3CT9A 2ZH4A 1X0FA 3QO9B 5EUHA 4WP3A 4ZVPB 5CZXA 1DFDA 1N5VA 2GVZB 3OR2A 1XMQF 2GC8A 3DKDA 3M30B 2L9WA 4HHUA 2Z2LA 5SZTA 3IN5A 1PO6A 4ANCA 1F60B 3PYGA 3IA0A 5IZHA 5KFIA 2D3O1 1ZBTA 1C0UB 1IJFB 1JLCA 1JLBA 1WEYA 1BQXA 2QA4G 1TELA 1ZM9A 4DBQA 4RW6A 2KKHA 4A8XA 5C25B 1E6VB 1ZTTA 1NHKL 3NRBA 1N6QA 4F2RA 1N33F 3ETOA 5J2PA 2CPHA 4NL5A 1XMQJ 2FJWA 3U02A 4OJ3A 2IAJB 1NK0A 2ZH9A 5B09A 3KK1A 1WKKA 2E1PA 5T41A 5KFEA 4HDGA 4TQSA 2LDYA 1JXVA 3OXLA 1SB6A 1C0TA 4P10A 3N6NA 4C3KA 5KFMA 4YR0A 2QA1A 2W2QP 4FYYB 3M2UA 4NA2A 4TY9A 1MMLA 3L7PA 4LSLA 4I69A 2DH7A 5A8KB 5EDWA 4DV2F 3K57A 2HVEA 3M8QB 1P27B 1N34J 3G8QA 1F2HA 2Q6CA 3AJDA 1BUXA 1G4CA 2CJBA 3NWRA 3EZOA 2X3DA 3TX0A 4C0HA 3OVSA 3M8SA 4CI0B 4XDDA 2C2OB 3G96A 2BABA 2XZDB 3VALA 1VQPS 1LV5A 4C8LA 5E7OB 1JLFA 1S4EA 1FRXA 3MPDA 4ZP8A 1ELOA 3VQSA 1Q8BA 2FIUA 1TK0A 3H4BA 2Y3YA 3QGPA 1TL3B 2R7RA 3UFCX 4BC9A 4OX7A 1TU0B 4O4GB 2EFOA 3E3XA 3PDNA 4YEAA 1FT8A 1RHQB 3BM7A 4FYWB 4OX9F 3BR9A 1Y4ZB 2KXFA 4Y2CA 1UMJA 4V19J 2WK4A 1XNRF 2B9EA 4RW8B 3MR3A 2FLNA 4DQPA 1WC0A 1Q7YT 3WC2A 1MLAA 2IFXA 1LWEB 4ZN1A 2OLWA 2HNYA 2ZJQQ 2ZZMA 2MDAA 4CIOA 3HPOA 4IR1A 5HP1B 2GHPA 5KFLA 3SEOA 2G1DA 1OSCA 3M8PA 3QT8A 4WIIA 5L38A 2L08A 1S6OA 2VZ9A 4LJMA 5L9NA 5A2QU 4DV4J 2YWHA 4DL6A 2KL8A 1VRUB 1FWPA 1XIQA 4MK7A 2DGOA 5KTQA 2XCPA 3MR6A 1N48A 3NWGA 1HBMB 5DGAA 5GMKa 2O5DA 3T6JA 2JLEA 4V1Ak 4HT7A 2MQOA 4LF1A 2VB6A 5A0YB 4MMOA 1L3TA 1IBKJ 3MUVP 5LMUJ 2QL7B 4B9NA 4DSLA 4URQU 1JKHA 4LF7F 3H2UB 1NXIA 2AJQA 3TJ9A 3DC2A 3M32B 3T1HJ 1S4FA 1CQNA 2HZVA 3PO5A 1NRKA 1CJUA 1OY6A 3I0SB 4OFZA 2EK6A 4QIWD 5LOQA 4HTIA 1JK9B 4CO5A 2QA4S 4GKKF 1O8BA 4PQAA 1HWJA 3AY0A 4YR2A 1PJ6A 3GFHA 5J2NA 4DZDA 3OXGA 4I64A 3H8YA 3CO9A 3GJRB 5D4NA 3TEHB 1MU2A 4ES2A 3THPA 2RAQA 4CP5A 1NDLA 1FJ7A 1B4SA 2QGFB 2W7AA 1RCOB 4DQIA 1N54B 5KG1A 4ZVTB 2AYMA 2HHHJ 4N47A 1YJ9S 3C6UB 1VBYA 2MZSA 3LPEA 4C4WA 2XYHB 1XMOJ 2C3PA 3BO3A 1A0OB 2BJ9A 3PTWA 1FX2A 1RBLA 2QMUB 4NLWA 1RT1B 1VFJA 3CCZA 5KFOA 3CDUA 4LRDA 4HLBA 3KLFB 4DUZF 3RB0A 4CO4A 1N0UA 2V68A 2FVQA 2H48B 4HI1A 1SIWB 2W8LA 4ZVSB 3EX7B 4J9RA 2CQGA 4EBDA 2W9BA 2M9KA 2N4DA 2RF2A 4L73A 2QIFA 3DOKB 1SQEA 2QV6A 3BN4A 2DITA 4F3MA 2JC1A 3J80Y 1PILA 4XAKA 3FEZA 5KFUA 2CDRB 2K3IA 1RLCL 3EXYA 4DR5F 4NLXA 4P2MA 1JJCB 5H9FK 3KUGA 2QL9B 4X65J 2HLTA 4OYWA 2DHAA 5IT4A 2ASJA 1B70B 2A18A 2NXUA 1ZAVA 2Z30B 1X4AA 6FDRA 3BQ2A 3RAXA 1UVLA 1BGXT 3PY8A 5F3ZA 2NREA 3OTOF 3CJKB 3HDSA 4RJVA 4ZHRA 2D9OA 1BQNA 3QNWB 3Q86A 2ASYA 5IQQA 4X62F 1OPZA 1XR7A 2YWEA 5KG6A 1YJNS 3CSKA 3SIPB 2FY1A 3FQKA 1TKTB 1JLEA 1D9FA 5LSRA 4LF5F 1GT8A 3FCVA 3W64A 4DV5J 1V6HA 1HBUB 4WXWA 5DQHA 1SKWA 4X4TA 5HROA 2NUHA 1TK5A 3M4XA 1KQGB 3CDWA 3MWBA 3R8YA 3PM9A 4OYPA 3VHQA 1UEUA 2AZ3A 2FUG9 3TAMA 2W4CA 4FXWA 4OJHA 5K8MA 5KT6A 3KJQB 1VGYA 1NKBA 1L3KA 4MKAA 5IXUA 1VHFA 5KFWA 4IYQA 1HW9A 1T9VA 3BKUA 1DTTB 2QJ3A 4P71A 4A8YA 3CJ4A 3F56A 3KK1B 2UU9J 1TL3A 4I0WA 3KHGA 3HXMA 3NGSA 2XMKA 2IC3A 1NM2A 1QAIA 5L9XA 1FE0A 4U8YA 4LSLB 1RHKB 5C24B 3MUMP 1MN7A 2ERRA 4L6V3 5ETMA 5HQ8A 3LGNA 3T5HA 3ZNJ1 2IRUA 4DV7J 2MQQA 4CLWA 2G9OA 2AT1B 5GAGI 1CC8A 4CM0A 5KFPA 1RWPB 1XR5A 2ZNZA 5BR8J 1SL1A 3R2DJ 2UU9F 4GKJJ 2C2DA 4N8OA 1JLFB 2PFFB 2HEKA 3KKFA 1S7IA 2KJWA 1X4EA 3H4DA 5F8HA 5H9EK 1LWFB 2CG8A 5KT4A 2ZH6A 3Q23A 2KM8C 2ATLA 1RT5A 1UP1A 3PEJA 1RKIA 4K0KJ 1AUDA 4O4GA 4CO3A 4JP8A 1R8PA 1S6PB 3MMBA 4ECXA 1U6FA 1RTJA 1V5VA 5ETVA 4ZPDA 4OI4A 2AGOA 4E98A 4OHYA 4L76A 5HBMB 2FJAB 2FY8A 4F4AA 2MQNA 4K2JA 5B0DA 4PG5A 2DR8A 3MM6A 4X84A 1M1HA 3I96A 3RRGA 3DOMB 2MQLA 4QYRA 3RRKA 1QJHA 1N0VC 2DXEA 2XTJP 2VBZA 3N01A 5EWFA 2C1EB 3UPFA 4ED6A 5DG7A 3HD1A 1PBUA 5IM0B 2QLBB 2FHMA 1T3OA 2HRYA 4CQ1A 1S1UB 2DGSA 4DXLA 2IJNA 3W2VB 1RXOB 2VFSA 2F63A 3WX4A 4A8FA 1HW8A 3EYZA 4FF2A 2XO6A 4MK9A 4G1QB 4ZLJA 4JI7F 1TAQA 5C2CA 4I6YA 1AXQA 1YKWA 2B4PA 3BB5A 3L7OA 3PZPA 1S72S 1QSLA 4UY85 1C4CA 1H3DA 1I3OB 2XBPA 3IBCB 5CAAA 3K5NA 5I3UB 2VQFF 1JKHB 3DMJB 4FBUA 3KHLA 4WF9Q 3SSQA 3NMRA 2LLZA 2YNHB 1ZM2A 1I94J 3J7ZT 3MURP 1TMMA 3MTKA 4ED0A 3QYYA 3UVJA 1T9YA 1VK3A 2GHWA 2GAGC 2D3UA 2XC9A 4LMZA 3WQPA 1TKDA 2EC2A 3CMES 1VRTB 1SJQA 2DIUA 3SQGA 1Q16B 1BQMA 2G2YA 3KLFA 4B3TF 5HMXA 3CPWR 2UUCJ 2ZBQA 2XI2A 3I55S 2DXDA 3MEEB 2ZNYA 2LQ5A 3BN7A 1JX4A 3CO0P 3H5UA 2N3OA 2JWNA 4TLRA 5F9NA 1Y3KA 2C2ZB 2NXCA 1ZM3A 3OR1B 5KFQA 1CVJA 2RE1A 3PIOQ 3CJ0A 3CIMA 2CQ2A 4OZNA 5LT5A 4X66F 2H54B 4KFBA 3GWCA 4PYAA 4USIA 2XS7A 5K8NA 4WK3A 4RUBA 3LQVA 1EQ0A 2B4VA 3DYAA 1NDPA 4AUKA 3AJ2A 4OYXA 1WOPA 3DI6A 4GKJF 3HHLD 2BA9A 3KYLA 2KDOA 1NK8A 5HVFA 1VQMS 2DR6A 5MAOA 1VYAA 1V3SA 4AT1B 1R6YA 4BWJA 3NY0A 3IM9A 1TVRA 1RT6A 2FZCB 2G0CA 3KOAA 4PRFA 1HARA 5DS7A 2HGLA 4ECQA 1IJEB 3W9IA 4QIGA 1U47A 1DAXA 3HVTB 1UVKA 5L46A 1KLMB 1S77D 1G6BA 1ZA1B 1SJFA 1NAQA 2CXEA 2CPXA 2EWHA 3MEGA 4DX8H 4ETZA 2RS8A 5JMNA 2YKAA 1TKTA 2VQEJ 4ECZA 1FJEB 4MIWA 4OI3A 1RWKB 2ZWPA 4QR0A 1VBZA 2GAHC 3ILIA 3JTOA 2FDNA 4LRCA 2AJ4A 2RT3A 3JAMY 2ZDPA 3MPUB 3B78A 1BWVA 1RADB 2WVBA 3UDLA 4ZK7M 5IWAF 3I0RB 2LQBA 4OZ2A 1QTMA 2H5IB 1S9GA 3HFZB 3Q8QB 2CZ4A 2I5JA 3HF5A 2E44A 3HKWA 3TX8A 1S0VA 1CEZA 1IVZA 4DR6J 2KYXA 2HRUA 3CD0A 1GQEA 3UNGC 5DRKA 2IVFB 2DGWA 5HL7Q 4Q8EA 5D8HB 3GYXB 3DLBA 3HULA 1BQNB 4RUHA 1F9FA 4R8UA 2YKMA 4QYZJ 2AU0A 2GGPB 2BEFA 3MM5A 3PVXA 3DOLB 2J9DA 2WVDA 3IS9A 3PEHA 1FRJA 2VASA 4OIXA 4LF6F 1TAUA 4QR2A 5LJ5Y 4NOHA 1JLGB 1S1XB 1MW7A 3T6BA 2ADCA 3RGIA 5D0RA 4FP9A 5M2UA 5JUMA 4J9OA 1SH0A 2KYZA 4ZIVA 2Q6BA 4P7TA 1TUVA 2RHSB 4G1IA 5C2GA 2AKWB 2IA0A 4QJVA 2ZVSA 4X4QA 2Y1RI 4Q2MA 1IBLF 2R8GA 1BY9A 2GQ2A 4IQXA 3AXKA 1D8ZA 5BXIA 2ZH1A 3LPYA 4LF4F 1YRUA 1TL5A 1DTTA 4RZRA 3KK2A 4P7VA 1OQ3A 3KG4A 1QM9A 1IBMF 1VLYA 5BYSA 4NCBA 4DR6F 4WWSA 2AJFE 4LVNP 4LVOP 4EZ6A 3T5LA 3IXQA 2IC3B 5A8KA 1N5YA 2IA6A 2GMJA 2RRBA 3M8QA 1JLCB 1J27A 2E5HA 3BSCA 3I5AA 1U2CA 2V8DA 5C24A 1VDHA 3E01B 3AODA 4PWWA 3TANA 3ETMA 1M90T 3W8PA 1FD8A 4JI8J 3OVBA 1YBAA 2B7BB 2XY7A 2DNZA 3QPIA 1IR0A 1QTNB 2MJNA 3JS9A 3R6GB 4KO0B 4KGKA 3N6LA 4QPXA 5E3AA 4PG7A 4GO5X 4CYUB 2W25A 2R7QA 1RHJB 2GJIA 4MIAA 4TY8A 2MB0B 4DV7F 2IMOA 4E8UA 1KEKA 4K7QA 4DR3J 1WDTA 1VC6A 5KFDA 1U2RA 5I42A 3FJ2A 1NK4A 4OI1A 4Y2KA 3BQ0A 1AA1B 4USUA 3Q8UA 4JI2F 3SI8A 1V5IB 5JVGQ 3UCGA 4G1QA 2HG4A 3SV4A 1LWEA 1FRLA 2BRLA 4YB6A 4KY3A 1TV6B 1RAGB 4BHQA 4R5PA 3CC4S 4ELVA 3PKMA 4N41A 4LREA 4YR3A 3CCQS 3M6UA 3M8PB 1AFIA 2WOMA 1VQ8S 1JLAA 1F5BA 2YNHA 3RW7A 2G1HA 2YX7A 4B9UA 1U0HA 4JI2J 1NK9A 2J76E 4RW9A 3AD7C 3OV7A 1X0PA 1U4BA 2P6SA 3UN2A 4C3MA 3M7VA 3R5AA 1VRTA 4RW8A 1JB0C 2LXUA 3D67A 4I7FA 3QO9A 4B3MJ 3EXCX 3HSJA 3TP2A 2J0SD 1UJ5A 4OYZA 4NLPA 2CKWA 4ZJLA 4KHPF 4DV6J 1CJTB 3GLJA 3IR7B 4CH0S 2J6UA 1CPZA 3GV5B 2RVJA 4LSNA 5KG3A 1TL4A 3DLJA 1IBCB 1P9YA 4RUAA 4WBFA 3QT7A 2VBYA 2VG7A 4LQ9A 4ZA1A 3BKTA 2EG2A 2Z4PA 5FD1A 4LBIA 2AD9A 4LF8J 2O01C 3ZZYA 3MCSA 4K4YA 2HFOA 1LW0B 1SC3B 1YGYA 1E6VA 2ACYA 2YNFB 1X5PA 3G2XA 3MM8B 2VV5A 4LRBA 1NH7A 5HI7A 5KFKA 3O44A 2HZCA 4UOHA 1YK9A 3CCJS 3D9BA 3NNCA 2HQ3A 4F4WA 1RQ0A 5A0YA 4DV3J 2IAJA 3OPKA 4U7CA 4Z37A 4WPAA 4NLDA 4C0OC 3AB4B 1S10A 2VIHA 2JEJA 2CPYA 4DPTA 1FXDA 3NKYA 1R0BG 4DN0A 4LF6J 3JSMB 2W24A 3L09A 1F3FA 2OKQA 3OR1A 2YPZA 2AYEA 5B08A 1Q8KA 3JYTA 4TNOA 2WBMA 3UDEA 3O5TB 3LF0A 8ATCB 4MK8A 4BLGA 5ETTA 5IWAJ 4L3NA 4Y2AA 4J9PA 3QZ8A 4U9RA 3RTVA 3R1LA 1TL1A 1N4LA 2LXIA 1HI8A 2VFVA 2VA3A 1LQ9A 1P1TA 3AA8A 3ONQA 1SC4B 1KN6A 5EHHA 1B7YB 3P3DA 1FI4A 1VRQC 1UWAA 2RDJA 2NPFA 1X5OA 2FGCA 3EWGA 3BQ1A 5HQMA 2MGZB 1FK9B 2COLA 1KRPA 1VJQA 2X1BA 1HD0A 4PPZA 3GG1A 4PZVA 4NYZA 1SJ4P 5D0HA 1GXUA 3B82A 4WE1B 1NU4A 2QLWA 3BV8A 4YP3A 3DOKA 2WZ1A 1IKYA 2LP4A 2EKNA 4YS2A 2B8PA 2BM1A 2Z8QA 4ZPVR 4B3RJ 1HNWF 2OAUA 3QWPA 4NEYA 1PC4A 1RWUA 1F2GA 2VG5B 4O44A 3G82B 3HHLB 3DOLA 2HWTA 4ZVOB 2G2ZA 3R5DA 3MCNA 3MUTP 4ATNA 5DDPC 4KH0B 4NZ6A 2OPPA 5A8RA 5IS2A 1FDNA 2DRAA 1E6YB 2MZTA 3PKYA 4DFPA 2VOPA 1XR6A 1S9GB 4J9KA 1UFLA 3GZ7A 1F5AA 4N56A 2UUCF 3UR0A 3RRHA 2BACA 4TQRA 4F02A 2F4FA 2ZWOA 3T1YJ 2BR0A 4N77A 1PGZA 1ACMB 1JIHA 2OI2A 2OPSB 1VK8A 3K2YA 1WI8A 2CNLB 1SJRA 3GE9A 3EJMA 1H2TZ 3PRBA 5GAHI 5KFZA 2X1AA 1SPBP 3CGIA 2RU3A 4OZ0A 4M5GA 5CYQB 5KFAA 1UVMA 4AQYJ 4EO6A 4QQBA 5KG7A 3T1HF 3TAQA 5L1IA 4J9NA 1S12A 1MROA 1CJUB 1R0CB 2ILZA 2R7OA 2CZ9A 3K7RA 4WFZA 2FYXA 4LRFA 2NPIA 3W5ZA 4LF9J 3CJKA 3VAIA 3RBDA 2ADBA 3K5LA 2V9WA 1FHTA 4ZHRB 3GB0A 4OL8A 2GX8A 4P2FA 3OD2A 1UAWA 2DGTA 1HWKA 4L74A 4NASA 4IG3B 5C5JA 3J7YU 2NZCA 3SSSA 5F8MA 2FLPA 4HDHA 1QUVA 4NX9A 4RL1A 1RAAB 3KK2B 2ZBIA 4X64F 2RDDA 1RWWB 2W2PP 3Q2SC 3EM1A 1RAIB 4HTJA 2DBBA 3THTA 1HBUA 1OY9A 5I42B 2V4RA 1APSA 3C6UA 4K5SA 1WELA 4Q0BA 3TJ8A 4F8RA 3AB2B 3WBZA 4B08A 4JI4F 2FHJD 3HLUA 5ETQA 2CA9A 1KVJA 5CABA 1O6XA 4KT0C 3RB3A 4HACB 5G0RA 1H7WA 1RTDB 2D3ZA 2MZQA 3TUPA 1UFWA 1I6JA 1IQTA 4CLLA 1Y9OA 5IV4A 3PYEA 4LFCF 3LH2S 3X3UA 4C8KA 3DRPA 2VPXB 3TQEA 3M9OB 1QAJA 5KFTA 1RTHB 2RUGA 3AAWB 3RBZA 2VA2A 4RWWA 2AJ1A 2VDIA 2BBEA 1U0HB 2V94A 3CJSA 3US5A 3HMJG 5KFBA 4DLGA 3MM9A 4H4KA 2KH9A 1IKXA 1DQAA 1Y3JA 2MHEA 4X4SA 1HNZJ 3DLKB 2MKSA 1FWKA 1WEXA 5CA5A 4DV4F 3U7JA 1YZ6A 3UCZP 2WHOA 2M88A 1RT2B 5THWA 3GIRA 3TZYA 1HQUB 2FZGB 1N34F 3AQOA 3QMQA 3GV8B 1WC6A 4NZ0A 2ROGA 1T7PA 2LA4A 2E1RA 3C8YA 4JV0A 1HPZB 1FF2A 1G7CB 2OGUA 2ZDOA 5HMYA 3LWLA 4AFFA 2C22A 2BQ3A 2RQ4A 1HBNB 1WG1A 2KT5A 4ZKAA 3MMCB 2MEWA 3D68A 3NXZA 5IM0A 4YHHJ 3ENQA 2XM3A 3T9NA 2KM8B 4IO9Q 3G6YA 1RTJB 1FJGF 2M3DA 4IFYB 1D9DA 1UVIA 3QIPB 2UXDF 3G87A 2HFZA 2KHDA 2KXNB 4DS5A 2RH3A 4Z7YA 3DXBA 2LYVA 1H2VZ 4ZVGA 2BYCA 4LF5J 3GYNA 3A3PB 3BBFA 5D3GB 1U24A 2DHGA 4KGVB 5DM6Q 4E2FB 1RK8A 1VMBA 2VUGA 2F8HA 3M2VA 2IM3A 4ZPTR 3DN9A 2YWWA 4EI2A 2JEGA 1H7XA 2J9EA 3HI9A 2UV8G 3MTJA 4IG0B 4OZJA 5J2MB 3OR2B 3PFOA 4DR3F 1R7IA 1B0TA 5T7LA 1X9MA 4DPWA 1TK8A 2R7TA 2BANB 4I6WA 5AJ3J 3THVA 3HD2A 2IM0A 3HHEA 7FD1A 2HMIB 3NCQA 4X4NA 3R7SB 3CVKA 2DNMA 2HHSA 1VQYA 3T1AA 3BSAA 5E3PA 1RA7A 3MM7A 1WHYA 1U1LA 1SQFA 3IG1A 3HT3A 1SH3A 1OYDA 1ZPWX 2AIRB 2E5IA 3CMQA 3T41A 1LK5A 3G82A 3HHLA 1MWYA 3KLIB 3SQGB 2DB1A 2VFTA 4TKTA 3UQSA 4BC7A 1KBRA 1S59A 2PEHA 1NBEB 3GJTB 2E66A 2H5EA 5F0UA 5G4DA 3OTOJ 4ED8A 3KLGA 3PRDA 3FFIA 4J9UE 2MGZA 3HM9A 4E0DA 3A12A 5EX0A 2QEXS 1WDDA 3HVTA 2W8KA 1KC8T 3HHNB 4ILRA 2RMLA 2VDHA 1XN9A 1S9EB 1YJUA 5CH7B 5D0GA 4PEOA 1IKYB 1NSAA 5GVQA 4DPUA 5MLCV 3TI0A 3ZZOA 4ES1A 3FQLA 1NSPA 1BXNA 1T8EA 4CLTA 2OPSA 4LF9F 1J5OB 1DTQA 5D4OA 4O44B 5J1PA 3JQJA 3SFUA 2QC3A 4IKAA 3H7HB 2IHR1 3M8RA 4WP9A 4QWBA 3LALA 4OHZA 1KQKA 3DLEA 4F25A 4TU8A 5D78A 4DV1F 2FD2A 3TQ1A 1B0PA 4DUZJ 3P49B 2H51B 2KVQE 4IOAQ 4B02A 3BPDA 4CLKA 3LWMA 3J7A1 3ZFVA 4DPOA 2C3MA 3KXDA 3OVAA 2DPIA 4R8UB 4QU7A 3EGNA 4URSA 3W61A 2G0IA 4CLSA 4QWCA 4BDPA 3FBEA 4QBUA 5KFGA 3L4BC 2ZKUA 1KNZA 1JJHA 3P4UB 3I6PA 1YVFA 4M94A 4NPOA 2HHHF 1S1TB 2EG1A 3FBCA 3UI3A 2BJEA 1HWUA 3OTBA 4RPFA 2R2UA 4ECSA 1MROB 1EP4B 2BJ3A 5KFCA 3O3LA 4B9MA 1IKWB 4DSEA 2A2DA 3MFHA 1FDDA 5HQLA 5ETNA 1GX5A 4CCHA 2B9WA 2PDAA 3IR5B 1UWBB 2V8PA 3CJQA 4BWMA 2P9CA 4FS2A 2VPYB 4JI0J 2VKRA 3M2RB 3TAPA 1Q86T 2AQ4A 1VQNS 5DDQC 2MZ1A 5EWEA 4DJBA 2NXEA 1JLGA 1S1XA 2VU5A 4KYZA 1Q0NA 1C1BB 2IVMA 3M32A 4GC7A 3J7Z5 3TUJC 4DOZA 1YI2S 5HJYA 2OFHX 2M8DB 3MOJB 3EUNA 3CNQP 4JI5J 3ET6A 4OYMA 4CNYA 1Q78A 4KFBB 5KT5A 2ZH8A 1RWOB 2KN4A 3GTYX 4K4TA 2EFVA 3TWZA 3ISND 1VLOA 4MTPA 4F4ZA 1HQUA 1KVIA 4WIQA 1KDNA 1T02A 4M1KA 2ZJRQ 4B9TA 1V3RA 1CS4A 1Q5YA 2CQIA 4ZP9A 2H1YA 2RJZA 4PG4A 2DNPA 3ICLA 3OJSA 3J81U 3U1LA 1RU1A 2N4CA 3KHRA 1X8DA 4ID5B 2ZEJA 5FDLB 1WWHA 4EO8A 4ZOSA 4LF2A 2CADA 3KHHA 3C6TA 4IFYA
chains in the Genus database with same CATH topology
3PIPQ 3NBPB 3MDFA 3DLKA 4Q44A 3TRGA 1R3NA 3G6XA 3MEGB 3RAQA 3F44A 2CPEA 4RX6A 4DHVA 1LOUA 4JI5F 1DLOA 2I38A 2CVIA 4TY8B 4DQRA 2F9JA 1Z4UA 2MKCA 2W7OA 4H4MA 3CJ5A 4ZCLA 2CPIA 1WTFA 2DHXA 3NCRA 2MKKA 3CDBA 3TAPA 4J9QA 1UL3A 2RILA 1KHWA 3Q8PB 4F3OA 5K8OA 2I1RA 2RF2B 3V81A 1H2UX 5FIIA 4DG1A 3IRXA 4Y2MA 2YKMB 5CCMA 2ZOGA 3MFIA 1X9WA 3UWTA 2DK2A 3V4MA 3DXSX 3OFFA 2QMXA 4B17A 2HMIA 3JSRA 3KNAA 4XPCA 4IQMA 3SV3A 4L72B 2DD8S 2F40A 4FVMA 3OFGA 3CTRA 4IFVA 4NA3A 3OHBA 2F1FA 2VC1A 3QLHA 2BXJA 1LK7A 1Y0HA 1K1SA 3FMBA 5LL6d 2M2BA 3KLIA 4I7FB 3TVZA 5BR8F 1HNXF 1WD6A 2N3LA 5KFVA 5IQ6A 2GMHA 2M5YA 3FSXA 3NG8A 2RS2A 2R2SA 1Y7PA 3KG1A 2C3OA 5HMZA 2VD3A 2K7JA 3PO4A 3KG0A 2DT9A 1O51A 3DRRA 1EETA 4NCAA 4X4OA 2KG0A 3W2WA 2XMVA 3MM7B 2LEAA 5CYMB 3NL0A 2VL1A 2CQ4A 1Y5IB 3L3CA 3IRWP 1RGVA 2ILYA 3QZ7A 1Q81T 2R7SA 2P6TA 1FKOB 3DLEB 4PXDA 4DL7A 4LIWA 3VWSA 1T05B 2JDJA 2F4VF 4WE1A 4JI8F 4YY3F 2IMWP 4URGA 2E7WA 1K0VA 4DS4A 3HVWA 1S7HA 4NLUA 3D1HA 4MAKA 2WB1D 1U6BA 4GC6A 3R27A 2V0NA 1FO1A 4ECYA 4AL7A 1J5OA 2IVYA 3PHEA 2M70A 2PA3A 2E9ZA 1S0OA 3KLVA 4K4VA 4CTAB 3CD7A 4ZVEA 1RT5B 4B9LA 1M5VC 4AE5A 3HJFA 3CCTA 3G8TA 1HL6A 3DM2A 3W3SA 1U25A 4F26A 4F4XA 3S6EA 2PE8A 4NLOA 3MPWA 3GR1A 3MEDA 2FC8A 4M63A 3D0GE 4NYOA 2Z2MA 3G6VA 1WNEA 4KE5A 1FTRA 3DCAA 1FA0A 1X4BA 3DLGA 2RSQA 3RAMA 5GAEU 1X9SA 2AYBA 3DLHA 4YUDA 2J9DE 3N0VA 4WJBA 2UVVA 4K5RA 3T9ZA 2PO4A 3IGNA 3Q24A 1VQ4S 3VTIA 4C8OA 4JV2A 1BLUA 1SC6A 4OHXA 2VQEF 1S1TA 2CJAA 2K1RB 4EU0A 4A8MP 4NZ7A 1FRKA 1U7LA 4C7QA 2O66A 1S1UA 1HR0F 3DNCA 3OTDA 3BZQA 3W2VA 1K9MT 3JTPA 2FVCA 3PV8A 5A8WA 2I9SA 3VAMA 1R8HA 4N76A 4WFNQ 4NLGA 5K5MA 2A1BA 5CXTA 1NHUA 4O3SA 2GHVC 3DU6A 5CYQA 2DHSA 4PUOA 1JNZB 3HX9A 4Q0BB 1RI7A 2JOQA 3JYTB 3CIZA 1HWIA 2QA2A 5H9EJ 5K8PA 1YIJS 4KAIA 3B8HA 2F3JA 2NSBA 4AXIA 2V4JB 1YJVA 2ZHAA 2ZHBA 1TFYA 4NWBA 2JX2A 1HNZF 2XMJA 1U1MA 2M4MA 1RTHA 2HVHA 2XMTA 4G6VB 1IKXB 5FDLA 1S79A 1KR4A 1QE1A 4KKOA 3LP0B 5L39A 4C8MA 4A8WA 2FHJA 1UETA 4MYUA 1NJIT 4UY8T 2VFRA 3V2UC 4DG1B 2L9DA 1RT4B 1C4AA 3OL8A 1YJTA 4A8KA 4NMLA 4WZQA 1U48A 2EBEA 1SIZA 2ZUGA 4NRTA 6FD1A 1WHVA 3PW2A 2LA6A 2XHWA 3IGVA 2E1MC 5DGBA 1FEEA 5C25A 4DV3F 3MM9B 1Y5LB 3CCUS 4R0JA 2CQDA 2XY6A 3NMAA 1Q53A 1B7FA 5E0OA 2JLFA 1ZAXA 3UW1A 5GAHU 2NS1B 3TNVA 2QFJA 4UUWA 2F7VA 1S6UA 4GMKA 3EPGA 2RB7A 3I0RA 4I67A 4RW6B 2CPJA 2I5JB 2D7SA 1UJ4A 4KQZA 5CYMA 3MMJA 2YX4A 2VODA 4F50A 2B6AB 3K5PA 2YVSA 2O67A 1G3OA 4EWTA 4IG3A 3VQTA 5J1EA 5HMWA 2AQ4A 2BANA 1REVB 4TYBA 2GQQA 3EPIA 3GMGA 4WFBQ 1RP5A 4QW8A 3M9NB 1YHQS 5L1KA 2LQJA 4CO2A 2HHPA 3DRRB 4KHRA 1SKSA 1GTEA 1N5TA 3W2WB 4H4KC 3I31A 4ETXA 1FNOA 2UZAA 4X4RA 2Q79A 2D1CA 3OL9A 5G0RB 4CO1A 3OJUA 1RTDA 2OD6A 1ZZNA 4IG0A 3LANA 3VAFA 1S0NA 2IYGA 4KHMA 4O3NA 3T5JA 4YHHF 2YWGA 5A2QY 1FESA 3OL7A 4RKUC 4DL5A 2C2RA 4C97A 3O6QA 5D4PA 2FJBB 2BZ2A 1N56A 3MPVA 2O1PA 1NJYA 2UV8A 2E9RX 1YWXA 3Q8SB 3MEDB 1GAOA 3MR5A 5L1LA 2AGPA 3NP5A 5EX3A 2XLJA 2DCLA 4G3IA 2M52A 3BO4A 1DBDA 3CCRS 5F0WA 4ECUA 4WU2A 2YKNB 4U67Q 1H6KX 2QRRA 2X1GA 5DLGA 2DO4A 4F67A 3PX0A 1SJ1A 2GV1A 4RBUA 4I6AA 4DR4F 2UXBF 2OMLA 4MFBB 1DQ9A 2Y0SD 2CQCA 4RLEA 4JI3F 3OTEA 3D28A 4ZS6A 2G13A 1K1QA 2XI3A 3MGJA 3R5CA 1DZ5A 1D8YA 4DF8A 1A9NB 5DDOC 3DRSB 2BJDA 2RKIA 1MU2B 1TFWA 5AXLA 3FZBA 2WSEC 2RRNA 3G86A 3E51A 1J2VA 1LW2B 2DISA 4ECRA 3MD3A 2UUTA 3VCDA 5B0EA 1R8BA 2XLIA 3C3LA 1JLAB 2PT0A 4ECVA 2OO4A 2D41A 1RYSA 4BS2A 4A4JA 3OBIA 3M1VA 1EP4A 3I82A 5DM7Q 2J7UA 2KG1A 4WXOA 3IAM9 3NAHA 5L1JA 1UVNA 1LXJA 3CCES 1H98A 4IH7A 2HGNA 3RZAA 3PW0A 1U1QA 1T03B 2OPQB 2R4FA 3HHKA 4H54A 2NYIA 3C66A 4HH1A 3P6YC 3IBWA 3DRXA 3MEKA 1XC9A 1JJ2R 3V4IB 2Q43A 1URRA 4PUOB 1U45A 3LP0A 2MZJA 4OLOA 2FJVA 4IUFA 1M0SA 2IJFA 3LUYA 4O4RA 4RBVA 5AXMA 2KU7A 4AL6A 4DFKA 1VQ6S 2MSSA 4ZLPA 2ZD1A 3MM8A 2VONA 1ZPVA 3BDEA 1RDRA 5DG8A 2HHQA 3MAQA 2ZJPQ 1NJXA 2DNRA 1UWBA 4FXDA 1WHXA 4HT5A 3HFKA 2DNOA 1K8AT 3EZ5A 3E8OA 2C42A 4QWEA 3CD6S 3T19A 4DSFA 5HO4A 2LEBA 3X1LB 4J9LA 4ICLB 4O3RA 1M1KT 2XSFA 1S9EA 4FF4A 2DGQA 3OHAA 4IDKB 1Q7LB 2GQCA 4Z2XA 1T95A 1VIXA 4CH7A 1UA1A 3K59A 2HNDA 2PA8D 3H40A 3ITHA 2V8VA 3M6WA 4YDDB 4RW4A 3WZ0A 3F73A 3Q22A 5M2PA 2DR9A 2V2KA 5BJRA 1C1CB 1DHMA 2CQHA 3HK2A 3V81B 3C6TB 3OQ2A 3BR8A 1FKPB 3GIJA 1U1NA 2R2TA 3FRZA 3MXHP 1X4GA 5B0FA 3M30A 3OFEA 3LP1A 2VG5A 5DDRC 2HQIA 4FPRA 4OJGA 2AGQA 4DSKA 5H1SV 1M5OC 4ZCIA 1DLOB 3I5CA 4FNHA 2IBOA 4FZVA 2HS0A 4NCGA 2OPPB 5A8RB 1S6QB 2CFXA 1N8RT 4QIEA 1IKVB 2HLUA 4DDFA 3GQCA 2OSQA 2QZ8A 2QSFA 1SXLA 5LJ3Y 4J5OA 1HNIA 2MMYA 1YTYA 1GXLA 1U1KA 2P9EA 1UVJA 3PX4A 1MWZA 3R3TA 2CQ3A 3J81Y 1TAUA 2C2EA 2X51A 4IR9A 3IRXB 4UOCA 4K50A 3KJVA 2V8GA 2UVWA 1KSPA 2EFGA 2WCXA 4IRDA 2CZVC 3OL6A 3MD1A 2OD4A 5FJ4A 1R89A 1C0UA 2FJDB 2ROPA 4OI6A 3CCVS 2HAIA 5LMNF 4PWUA 1T3NA 1QVGR 3NMRA 3CDAA 5HBMA 2M8HA 2CRLA 1FCAA 4UUXA 4PG8A 3PW7A 3DRYA 4B9VA 3U1MA 2D3OR 3MECA 2R7XA 3AHPA 2F8EX 5J1NA 4B3OA 4IH5A 1TKXA 2CPZA 2E9TA 1XERA 3DOMA 2E5JA 1LWFA 3RW6A 5K14A 2CVEA 2MXYA 1OSDA 3M2UB 4ID5A 2FVRA 4PWDA 4YFUA 1D3WA 3QWUA 1JLQA 5J2QB 5F8NA 3DHWC 1S49A 3NBPA 4DN9A 2JJ4D 4YQWA 3D0IE 4DV6F 2O3DA 5AXKA 4DLEA 2JEFA 4K4ZA 4ED5A 1FERA 1N88A 2WBRA 3BGLA 1OPIA 2PSZA 2NQPA 1WI6A 4XDCA 3DRPB 3S7RA 1Z2LA 4JV1A 1HI0P 5DQIA 2DPJA 2HFNA 5CQGA 5KG4A 1T05A 2MKHA 3V5RA 1CLFA 1TR0A 4DSIA 4BCAA 1RISA 5AXNA 4WKRA 3ZZRA 2ZKTA 4DR2F 1P9QC 5LXRA 5K9FA 3OW2R 3CMAS 5GAEI 4A48A 4JI1F 2ZM6F 1LW2A 2DGXA 2E7XA 2JFKA 1GX6A 5I3UA 1NK7A 5LSOA 3I9ZA 2OPRA 3I0SA 3UR3C 3SMZA 3UCUP 3ULHA 3HKZD 2X3GA 2DJWA 1FE4A 3MMCA 5IT9Y 2E1AA 3M1VB 3MOZA 4IFVB 4P2SA 5AE1A 1NZAA 4LUBA 4KRWA 2FLLA 2EC0A 2CPDA 3FSIA 2QLXA 2C3YA 5DETA 3TO8A 1NEEA 2M7SA 5E41A 1SKRA 2WB4A 2OPQA 5DG9A 5EGYA 2Z0GA 1U1RA 3R1HA 2JL9A 3H2LA 5KFJA 1VQ5S 4RW7A 4O3PA 5GADU 3CF5Q 1Z2ZA 2QT7A 2GIQA 2CQ0A 3IO1A 4TLQA 3GSDA 5I3PA 1AFJA 2F9DA 2LECA 3CEDA 1M5SA 1S1WB 2JRSA 4ZDNA 1FXRA 3HHDA 5J2NB 3CJ3A 1D9AA 3VAJA 4NLRA 2YKOA 1VS3A 2VG6A 2KO1A 2XMWA 1JXEA 3M9MB 5A8WB 3K58A 3KLEB 4C0BA 5E3CA 3TUIC 4OJ1A 1NKCA 1DARA 3S1TA 3BGRB 3CD5A 2Q1LA 3BSOA 2HGMA 3KFWX 2B9YA 3RBEA 2EVZA 1KOOA 4WYLA 4FF3A 3OTCA 3IG1B 1ZAWA 3FEYB 2CPFA 4ALZA 2GGPA 3MM5B 4QZVB 4TXSA 2GA7A 3NLCA 3H2VE 4WFXA 2DGVA 4MH8A 4C4WA 4OV1A 3SCJE 3TR5A 4DR1F 3ITHB 2YNIA 2QO3A 4CH1A 1S97A 1P6TA 1NO8A 3KMQA 1WF2A 3G6ES 2R7UA 1P8GA 3DM2B 4QWAA 4OQJA 3VZIA 1QUPA 1YG0A 4OHWA 4B9SA 1A7GE 1TP7A 3HO1A 1XWLA 1D1UA 2E5GA 3PR5B 3H59A 3PNIA 3TUZC 4I1TA 4USJC 1VQ9S 2HHTA 3QJLA 5DLFA 2JFDA 4USHA 1CC7A 1KOHA 3CDEA 5HROB 2PC6A 4Q2LA 3K0JA 1R27B 4GO7X 4A46A 5LMUF 2MKJA 4OX6A 1XK8A 2E5LF 2UUBF 3NGKA 1QSYA 1HNIB 4KO0A 4I2QB 4ITSA 2XWYA 2PI5A 2XULA 4WK1A 2G4BA 3FZ2A 5J1EB 1VQSA 2MJUA 3KMSA 3I4HX 3NS5A 3A8EA 3UD3P 2B9XA 4KTQA 1RT7B 4ZPBA 2BQRA 3GG0A 2GO9A 2YNGB 2ZHOA 3ENVA 4FXVA 1N5YB 1N5QA 1NHVA 4X65F 1VQKS 2IM2A 3EZUA 5J2QA 1QY7A 3DFEA 4I68A 3KLHA 2XO7A 4IO1A 1TQLA 2VC0A 1S48A 3DDKA 3DDNA 2B6AA 2CIMA 1XMBA 2DCUB 3QGGA 3RYLA 4RU2A 1R43A 1AROP 1TKXB 1RA6A 2GFFA 2V4QA 1DURA 1REVA 2RQMA 4YDXA 4LF8F 2WAQD 3N79A 2QE5A 1C1BA 2JVOA 4RW9B 3BREA 2UVRA 1HA1A 4PWDB 1Y00A 1JLQB 4O3QA 2JHEA 3PR4A 4X4UA 1SI9A 4DR7F 3TA2A 2C3UA 1PC5A 3J7YI 2K2PA 1G1XA 1R8CA 2W9AA 2DTJA 3SCKE 2HW3A 4ZP6A 1WG5A 1BWEA 4ECTA 4JI0F 2WOMB 5AE2A 4EZ9A 1L3UA 3GIIA 2Y1JA 1S6PA 3MMBB 3NNAA 1PSDA 3K5MA 1QAXA 3PXGa 4ILMA 2YKPA 2MPUA 2UVUA 2EFPA 3UD4P 4FF1A 1RYRA 1YQHA 2QSWA 2EKYA 2KVIA 3I32A 3LGMA 2DNGA 3JSMA 1HQEB 3HZEA 2XNQA 2OPRB 4ZPWR 2I8EA 5IFMA 4DQSA 3JB9k 3BO2A 2XB2D 4JI6F 2KB2A 2QMWA 2P9GA 1U09A 2XWXA 3TW0A 4PXCA 1TL1B 3U27A 1YJWS 2VBXA 4Q43A 2YY3A 5F8GA 2KRRA 3RB4A 1V9OA 5M2RA 3HVAA 3TYTA 4Q7AA 4YB1P 1FDAA 3ZZUA 2R8KA 4RBTA 3FNNA 2VPWB 4JYAF 2ZFHA 2VKZG 3D2WA