3EVRA

Crystal structure of calcium bound monomeric gcamp2
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
411
structure length
397
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 141
structure length 397
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evrA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evrA02
1LA0A 4I5NB 4W6IA 1XAEA 1W7TA 1M31A 4XVPA 4LJBA 3DVMA 1QYQA 2NCOA 2OS8B 2AAOA 3TMTA 4FTGA 2A50B 2KFHA 2KAYA 5EXBA 2VVJA 2WOSA 2G2SB 5HLOA 2F8PA 4P5OE 2DDDA 2SCPA 1UWOA 1YHIA 3LSAA 4Q04A 2HQ8A 5IBWA 1TNPA 1QTXA 2OKWA 1J7PA 2LVKA 2ZKMX 1CLMA 5FVGA 1RM9A 4IK9A 3OSRA 1UHIA 3CFFA 3LL8B 4PCWA 4W75A 4JF9A 1UISA 2L98A 3DQNA 2HGYA 4KAGA 5AQBB 2KQYA 2QZ0A 3AKOA 4J89A 2OJKA 3I19A 3SVRA 2LP2A 5HW9A 3PJBA 3BUWB 3SG3A 2WCEA 3PALA 1PULA 3ST3A 1MF8B 1TRFA 4ZFSA 3KCTA 4W7XA 3OSQA 3SSTA 1Y1UA 3AI5A 3U8CA 4DKMA 4NDBA 2LLTA 1JWDA 4HRGA 5DPIA 2RGIA 2K7BA 4L9MA 4MLWA 3O4YA 2HQZA 4P76A 2H2KA 2HJOA 3I5IB 4JQ0D 3LVAA 4PDZA 1Q73A 2AWKA 1A75A 2OPOA 4XYNA 2GGZA 4GNKB 1SYMA 4WQ3A 1XMZA 1ZFSA 1JF2A 4Q7TA 3CR2A 4W6LA 4YRUA 1S5GZ 2WSNA 1Q4EA 3E3RA 2D8NA 1QIVA 3U8PA 1FW4A 3O78A 4XJKB 4JC2A 3BXKA 4W72A 1BF5A 1TNXA 1NSHA 2QLIA 1GGXA 4W76A 4W6JA 3H4SE 4PHNA 3BXAA 1WLMA 3CFHA 4MEWA 2WIQA 1QLKA 1JF0A 1KYPA 2ICRA 4E68A 2G6EA 3A4UB 2M0RA 3EK8A 4TNCA 3C1VA 1RFJA 1CDMA 2OTGB 2G6XA 2PVBA 2KHNA 2P4MA 2EC6B 2Q91A 3SJSA 1YZWA 4GGFA 3SSHA 2F2OA 3ZNIA 4KW9A 1X02A 4HRHA 4GGNA 1K95A 4W6KA 2E6WA 3SRYA 2LLUA 2NXQA 2AWLA 5KU1A 1QYOA 2DDCA 2IB5A 2HPWA 2K61A 2GV5A 2F33A 2L5XB 1UURA 3AKBA 1YJFA 4Q7RA 1A4PA 2AMIA 4LQTA 1Z1PA 5LK4A 4R6BA 5HKZA 4WRIA 1NUBA 3PLFB 3KF9A 2JTTA 3ST4A 1UP5A 1CFDA 1D1OA 1FF1A 1BT6A 2FL1A 5I2OA 1CFPA 3QRXA 2Q4UA 1DGUA 2KYFA 1CDPA 1ZGOA 4DXQA 1G8IA 1YRTB 4L1IA 1C07A 3RWTA 2JXCA 3SG4A 1YX8A 3IQOA 3CGLA 2EMNA 1S36A 3HCMA 1JBAA 1AJ5A 5LTRA 5LTPA 3NSOA 1UHHA 3BOWB 5BTTB 1QVIY 3GK4X 5D7FA 1OMVA 1F70A 3EVVA 2KOTA 4YGEB 3DQ9A 5KTGA 1YRUB 5FHVA 2AH8A 2MA2A 1S6JA 2Q57A 4MZKA 1J1EA 1Y1XA 1BJFA 1J7RA 1PVBA 1XA5A 3CLNA 1NX3A 4OV2A 2A53B 3I5FB 1JSAA 3GOFA 2AHAA 3FWBA 1W7JB 1ZMZA 3CB9A 5HLVA 1MQ1A 3I5HC 1KFXS 1HQVA 3LCPC 4YGDB 2LANA 4JRBA 1F8HA 4JEOA 3DQJA 2LMTA 1CKKA 2QLHA 3K21A 1TCOB 3EVRA 1KQVA 4ZF4A 4XOWA 4N1GA 1DJHA 3SVNA 5J3XA 2V4EB 4QJ3B 1BMOA 2OTBA 5BQLA 3CBEA 2KGRA 5I2QA 1DT7B 2BE4A 4H3NA 2DUFA 3SVCA 1SR6C 2Z6ZA 1KQMB 1M46A 1MXEA 4AR7A 3DF0B 2ARLA 2L4IA 2SASA 1KWOC 1NCZA 2A52B 1S6CA 3DD4A 2ISDA 3BUOB 2PSRA 1RMMA 4W7FA 3GEXA 4H48A 3NF0A 1B7TZ 2MLEC 2JT8A 5EB7A 4L12A 4ANJA 2IB6A 2FWQA 4W6TA 1EMFA 1MUXA 2ZMWA 1BG1A 3DQFA 5HBDA 4Z4MA 1GFLA 1RTP1 1XFUO 4L13A 3ED8A 3MGFA 4LJDA 3KO0A 2MJWB 4XOVA 4Q7UA 3VICA 5G08A 1SL9A 4YBHB 3CTNA 1TTXA 2Y5IA 2ZO6A 1KYRA 5DKQA 1K90D 3E5TA 4W77A 1BR4B 1YJ2A 1L2OB 1B1GA 2L0PA 1GGWA 2BBMA 2LAPA 1VRKA 2GGMA 3WHUB 4OHSA 1IWQA 4DUQA 5I2LA 4B30A 3DPZA 1AVSA 4CFRA 2OS8C 3WHTB 3PATA 1B4CA 1DJXA 1IKUA 4NDCA 4AQIA 3CGAA 2ZN9A 2WISA 2V53A 1B8CA 3PM8A 4IK8A 1SCMB 1KP5A 1FI6A 5I8NA 1K93D 4QJ4B 1CV7A 1JBYA 2V4EA 2Z6YA 1N65A 5HYDA 1NX2A 2JT0A 5H88A 1SY9A 1ZUZA 1YVHA 4I5LB 2K7CA 3KPXA 1QLSA 1KK7Z 3E5WA 1RJVA 1SNLA 1Q4CA 3DF0A 2P6BB 1S5GY 1S3PA 5CSIA 4EULA 4W7DA 1B9AA 1YVLA 4DXIA 1NWDA 3OHMB 5T3IA 1J1DA 1TCFA 4A4BA 1CM4A 5H87A 3BXCA 3F45A 2DD9A 1QXPA 3SV5A 4HQ8A 5KTYA 1DJWA 4RYWA 1H6RA 1YURA 1MR8A 4CPVA 3FS7A 5AANA 1W7SA 4W73A 1YFPA 4W6PA 1OQPA 3NEZA 3TZ1A 2JT3A 2C9JA 2WHTA 4ZF5A 2CBLA 5DQMA 2QRFA 2VZXA 2L51A 2H8QA 3ST2A 1G33A 1BFPA 1NPQA 1F55A 5JOLA 3DQUA 3SVOA 1PSRA 2KQ6A 4PE4A 4HE4A 4ZF3A 2WCBA 4ZBLA 2DUIA 2B3PA 1OMRA 3MSEB 1RMPA 4M2PA 4ZINA 2LP3A 3I5GB 4N3DA 2LHLA 1RRXA 1E8AA 5CSJA 1W7IB 1G7KA 1B8LA 2JNXA 2A46A 1SPYA 5DKRA 1OXDA 1MOVA 1A29A 1XYDA 1SL7A 1HT9A 4GAOA 2FOTA 2KBIA 2E30A 3BUNB 5JJGA 2M1KB 1DJZA 2F3YA 1IRJA 1TN4A 2B1UA 4GFTA 4OCIA 1KFXL 3BX9A 3DQ5A 1CLBA 2FJUB 2MRDA 1Y0VH 1SMGA 1K94A 2O2BA 4WQ2A 5AFPA 2KAVA 4R6DA 4KEXA 1SBJA 1RMOA 4B5YA 1WRLA 3CS1A 2H5OA 1DVIA 2GX2A 3K1KA 1MWNA 4OR9B 5BT0A 3VRNA 2GX0A 3U0NA 1UHNA 3SVBA 3PN7B 1ZGPA 4DKNA 4H3LA 3DQ4A 3PJ7A 3PFVA 1XK4C 4PPJA 2YE0A 2KI4C 3UFZA 4W7AA 2Y1NA 4HSZA 3GL4A 2QACA 4IK4A 1KK8B 1Q4DA 3TS5C 2WURA 2M49B 1HCJA 4KGEA 3P28A 1RROA 5HZOA 4GOBA 4KF5A 3S05A 2B3QA 2VVIA 1QXTA 3BXBA 5EXCI 1CM1A 4Z4KA 2QU1A 1OMDA 4NQGA 1M39A 2H61C 1YR5A 1LINA 4AOMA 5H89A 1QATA 4BY5A 5HZSA 2G3OA 2O60A 1K9PA 3TDIA 4JPZB 1XFVO 3GK1A 1QV1A 3SS0A 4H3MA 3W1CA 2EMOA 3KEVA 3I5FC 1PALA 4W7CA 4OJ0A 4EMQA 1J7QA 2G3DB 4DXNA 3VRPA 1BU3A 2Q6PA 4W6MA 3IF7A 1B7TY 3D10A 2M97A 1IG5A 2IE2A 3DQHA 5B8IB 1Q80A 1L7ZA 3M22A 2A4JA 3A8RA 2ZFDA 1OOJA 2DOQA 1CMFA 4OVNF 1Q4AA 3SSPA 1KSOA 2IS9A 2HCGA 2WC8A 2K7OA 4F0ZB 4Q9WA 1WLZA 3JTDB 1SCVA 1EMEA 4M2QA 2I2RE 2LUCA 4AQJA 1KQMC 1DJGA 1YHGA 3G9AA 2JZIA 1ZGQA 4IK1A 1NX0A 3BUMB 1WY9A 2H9WA 2K2FA 2KFFA 2QLGA 1OZOA 3OB2B 1SRAA 2O5GA 3WLDA 1QX5B 1ZUXA 1CMGA 2O29A 1IQ5A 2L2EA 1QX7A 2LHIA 4B30B 1LVCD 2JQ6A 3CZTX 2FZUA 4ICBA 5DPHA 3CWGA 3CD1A 1K9KA 5FVFA 2WNDA 3LF4B 2DUEA 5DTLA 3O2PA 1DMOA 1XFYO 4C0LA 3EKJA 2QPTA 4DXPA 2KSPA 4JFGA 4JGEA 4ORCB 1CB1A 4IL1A 3SVUA 3SVDA 1EMMA 1L2OC 4LJCA 4KW8A 1KK7Y 1CNPA 4H47A 1DJIA 3OGOA 2PMYA 3BYAA 3OX6A 2BE6A 5HKYA 4CLNA 4W6OA 1NIWA 3BUXB 4YI8A 3GJ2A 3BQ3A 2NZ0A 1OZSA 4PPLA 2ZO7A 2HRSA 4LW5A 3V3DA 2M8UA 3U8AA 1QASA 2BL0C 2MBXA 2PALA 1QX2A 2H5RA 3IQQA 2LC5A 4CIDA 1SCMC 5HKWA 4GUKA 1K9UA 1NX1A 4W6AA 3ZWHA 4HQCA 4W69A 4CFQA 2WHUA 1PVAA 3EK7A 1SW8A 4IK3A 3LK0A 3NT9A 2BTJA 1JFKA 2CT9A 1EMAA 3NT3A 3OP0A 2G5ZB 5EXUA 1XFZO 1DGVA 5HZTA 5J2OA 1JC0A 4RYSA 2Y4QA 1DF0A 1JFJA 1K96A 3TUYB 2O24A 4J8AA 1JUOA 3O77A 3EVUA 5ER4X 1BODA 2CCMA 1XQMA 2AWMA 1LXFC 2JU0A 1WRKA 4W6FA 2ZN8A 2G2BA 4PE0A 2PXSA 1RECA 1CFCA 4I2YA 1QV0A 3AAJA 5AERA 2JOJA 4W6RA 3DQCA 2LUXA 1BR1B 5ER5A 1B8RA 2F2PA 1WDCB 3SSKA 3DVEA 3SIBA 4U2VA 2FCEA 3OB1B 1EG3A 1TOPA 2L4HA 2JC2A 1JBZA 4UPGA 1UHJA 2A47A 5D69A 1UUSA 2GW4B 1YTZC 2LVVA 1EG4A 3ZUJA 3ZUFA 1IH0A 4ZB1A 1Q4BA 1F09A 4GGFC 1ZOTB 1A2XA 3TDZA 3PJ5A 4P2YB 4EDSA 2ZNDA 3DQEA 2HQWA 2YFPA 2CXJA 1CFFA 4W6UA 2M9GA 1IJ5A 4AS8A 2ZRSA 3WNXB 3ZULA 3WLCA 4DXOA 1PSBA 4GPLB 1JC2A 4Q9XA 2K0JA 3SVSA 3CFAA 2TN4A 1EMLA 2G6YA 2MAZA 1FI5A 1FPWA 4C0JA 4W6BA 2ZMUA 4MRXA 5EB6A 2HETA 4MSPA 1F0BA 2WORA 2M7NA 4OKHA 2AWJA 3KHEA 1OSAA 4W6NA 3AAKA 1LKJA 3NEDA 4NDDA 3A8SA 1YUSA 4I5KA 2JTZA 2VRGA 3RLZA 2VAEA 2HQKA 2CTNA 5DQBA 2G9BA 5K89A 5EJUA 2VADA 3I5IC 1BLQA 2K7DA 2I7AA 1GGZA 5FYXA 3PIBA 2JWWA 1N0YA 5CPVA 1S6IA 2OGRA 2PXWA 1XFWO 4BDUA 3JVTB 4IZNA 2DD7A 4HQ9A 2HPSA 4PHJA 1B9CA 1QIWA 2LM5A 3PN7C 5KSZA 3SG2A 2M3WA 4PHMA 3LVDA 1GL4A 1EL4A 4USLA 2ZRTA 2WSOA 3U0MA 5DRGA 1NCYA 2H5PA 1KK8C 5DY6A 2OKYA 1LA3A 3TMRA 1QYFA 1KFUS 3LK1A 3CR4X 1TNWA 4PE1A 1N2DA 1SL8A 1A03A 2POXA 3DQDA 2OTGC 4N5XA 5DPJA 3GK2A 1KCYA 1YUUA 2EC6C 3NSIA 3CR5X 3NSKA 3D0YB 1FBVA 4YGBB 1S26D 1IJ6A 4XL5A 2Z6XA 4KF4A 2YDZA 2LCPA 4D1EA 1XO5A 2WCFA 4W74A 4PHKA 3U0LA 1PK0D 3WXAA 4R1EA 3O6BA 4KGFA 3E5VA 4ORAB 2NCPA 1F54A 2H6VA 2LVJA 5DPGA 3FIAA 5DRFA 1OE9B 1U5IA 4EDOA 2QLGB 1ALWA 2KYCA 3DQKA 3WCKA 4ORBB 5AEQA 4UTSA 1MXLC 3VHTB 5DTZA 1HUYA 1V1FA 3JTDC 3AKAA 3SG5A 1XA9A 1XSSA 4PFEA 3PSRA 3SSLA 2MHHA 4LJDC 3FWCA 4IK5A 4W6GA 1J55A 1MHOA 2BECA 5GQQC 2KI6C 3H1RA 2BKHB 4W6DA 1S1EA 4KPIA 2Y0GA 3M0WA 3RM1A 3W1DA 4DCKA 2DUGA 2QT2A 4GF6B 4W6CA 1GJYA 1CTRA 2KFGA 3LA1A 1AK8A 4ETOA 4EN1A 1XFXO 3LLEA 1QS7A 4LQUA 5BPJA 1AHRA 1EXRA 1R6PA 5CSFA 2PASA 3D0YA 2V4EC 2BKIB 1ODBA 4ZCVA 1XVJA 1SKTA 3ICBA 3DQIA 4W7EA 1Y6WA 3EKHA 4W6SA 2H5QA 1RWYA 1H8BA 3DVKA 3SIAA 1DF0B 2KI4B 1SK6D 1PRWA 3M24A 1EMCA 3EVPA 1CDLA 3HX4A 4DXMA 1RK9A 4KW4A 3TS5B 2C9IA 1QY3A 4P1QA 1GQMA 2JULA 2IOVA 3DQ3A 3CD9A 4W6HA 1F4OA 2LLSA 3DQAA 2HF5A 2KNEA 1KSMA 3EK4A 2KI6D 1EMGA 3VHTA 4MBEA 4XJKA 3DQ6A 1OXFA 2LE9B 2LMVA 5EBJA 3ADFA 1Z1QA 4W7RA 2I18A 2BCAA 2M1UA 1KYSA 3TUYC 2ZNEA 2AUCA 2CNPA 3VK1A 1ALVA 2EMDA 4MZJA 4HVFA 1G4YR 1K8UA 3P8UA 3IR8A 3LS3A 4N1FA 4MZLA 2YE1A 1WDCC 2HGDA 2I94A 4GBAA 3DQ2A 1F4QA 1YUTA 4YGAA 4DS7A 4PALA 1JC1A 2OTEA 2KDHA 2K2AA 3DQOA 2FCDA 1M45A 4TZGA 3SG6A 2Z1OA 3KCSA 1DTLA 3SSVA 1C7WA 2A48A 4MVFA 5PALA 2MLFC 1TIZA 4PE7A 1AP4A 2JADA 1YX7A 1NP8A 2F3ZA 4OGSA 1KFUL 1TNQA 1MYWA 4MRYA 4J88A 2LNKA 2EHBA 2R2IA 4ZIOA 4RTCA 1QJTA 1EJ3A 1IGVA 1BOCA 3DQLA 1XK4A 2M7LA 4ORNA 3VRRA 1IQ3A 2HFCA 5HZUA 3DVJA 2LMUA 3VRQA 3OX5A 2PRUA 1MOUA 1M63B 4I5JA 3I5HB 2DUHA 3ST0A 1EH2A 3VGOA 2KGBC 3BOWA 1J7OA 5BTTA 2EGDA 5LTQA 4M2OA 2VVHA 2A54B 2H61A 1UHKA 4JWQA 4FQOA 1OXEA 1C4FA 1W7UA 4A4CA 3DQ8A 1QVIZ 3GB3A 1DJYA 4MN0A 3AI4A 4GESB 4TZAA 4BY4A 5HGEA 1AUIB 3SSYA 2K8MB 2BCBA 1CDNA 4KF5C 1S6ZA 5DTYA 3ZTFA 5F9GA 4DRWA 2QLEA 1SR6B 2A56B 4OY4A 1NYAA 3H1OA 3JVTC 3LF3A 1YHHA 2BBNA 1KWOB 5F6TA 3U0KA 3RWAA 1V1GA 1EMKA 3DPXA 1CLLA 4ZCUA 2BCXA 3DQMA 2BL0B 2L50A 2JRFA 5DU0A 2WHSA 5EHUA 2COLB 1Y1AA 5DKNA 4KA9A 5TNCA 1K2HA 4HREE 3I5GC 3NSLA 3IP2A 1B47A 2RH7A 3DQ7A 2NLNA 3SG7A 1R2UA 4QJ5B 2KBMA 5DTXA 4U8DA 1AJ4A 1F71A 5AXIA 1U5IB 1C7VA 1H4UA 2LVIA 3DPWA 4YGCB 2LV7A 3TDUA 2JXLA 2KAXA 4OQWA 3NXAA 5CSNA 1WRZA 1EMBA 1A75B 3GJ1A 2GW3A 5FVIA 4C0KA 3DQ1A 2M29A 3LVCA 4NWSA 2JPTA 4XGYA 1H4BA 3SVEA 1ZACA 2Y1MA 4PPKA 3VROA 4DIRA 3UG0A 1NCXA 2G16B 2JNFA 4YI9A
chains in the Genus database with same CATH superfamily
1LA0A 4I5NB 4W6IA 1XAEA 1W7TA 1M31A 4XVPA 3OGNA 4LJBA 3DVMA 1QYQA 2NCOA 2OS8B 2AAOA 3TMTA 4FTGA 2A50B 2KFHA 2KAYA 5EXBA 2VVJA 2WOSA 2G2SB 5HLOA 2F8PA 4P5OE 2DDDA 2SCPA 1UWOA 1YHIA 3LSAA 4Q04A 2HQ8A 5IBWA 5HL1A 1TNPA 1QTXA 2OKWA 1J7PA 2LVKA 2ZKMX 1CLMA 5FVGA 1RM9A 4IK9A 3OSRA 1UHIA 3CFFA 3LL8B 4PCWA 4W75A 4JF9A 1UISA 5I94A 2L98A 3DQNA 2HGYA 4KAGA 5AQBB 2KQYA 2QZ0A 3AKOA 4J89A 2OJKA 3I19A 3SVRA 2LP2A 5HW9A 3PJBA 3BUWB 3SG3A 2WCEA 2BNXA 3PALA 1PULA 3ST3A 1MF8B 1TRFA 4ZFSA 1Z2CB 3KCTA 4W7XA 3OSQA 3SSTA 1Y1UA 3AI5A 3U8CA 3SS4A 2QEOA 4DKMA 4NDBA 2LLTA 1JWDA 4HRGA 5DPIA 2RGIA 2K7BA 4L9MA 4MLWA 3O4YA 2HQZA 4P76A 2H2KA 2HJOA 3I5IB 4JQ0D 3LVAA 4PDZA 1Q73A 2AWKA 1A75A 2OPOA 3Q8IA 4XYNA 2GGZA 4GNKB 1SYMA 4KYNA 4WQ3A 1XMZA 1ZFSA 1JF2A 1OW4A 3CR2A 4Q7TA 4W6LA 4YRUA 1S5GZ 2WSNA 1Q4EA 3E3RA 2D8NA 1QIVA 3U8PA 1FW4A 3O78A 4XJKB 4JC2A 3BXKA 4W72A 1BF5A 1TNXA 1NSHA 2QLIA 1GGXA 4W76A 2WCKA 2P70A 3S0DA 4W6JA 3H4SE 4PHNA 3BXAA 1WLMA 3CFHA 4MEWA 2WIQA 1QLKA 3B88A 1JF0A 1KYPA 2ICRA 4E68A 2G6EA 3A4UB 2M0RA 3EK8A 4TNCA 3C1VA 1RFJA 3IVTA 3L47A 1CDMA 2OTGB 2G6XA 2PVBA 2KHNA 2P4MA 2EC6B 2Q91A 3SJSA 1YZWA 3R1VA 4GGFA 3SSHA 2F2OA 3ZNIA 4KW9A 1X02A 3BFBA 4HRHA 4GGNA 1K95A 4W6KA 2E6WA 3SRYA 2LLUA 4IJ7A 2NXQA 2AWLA 5KU1A 1QYOA 2DDCA 2IB5A 2WCLA 2HPWA 2K61A 2GV5A 2F33A 2L5XB 1UURA 3AKBA 1YJFA 4Q7RA 1A4PA 2AMIA 4PT1A 4LQTA 1Z1PA 5LK4A 4R6BA 5HKZA 4WRIA 1NUBA 3PLFB 3KF9A 2JTTA 3ST4A 4JKTA 1UP5A 1CFDA 1D1OA 1FF1A 1BT6A 2FL1A 5I2OA 1CFPA 3QRXA 2Q4UA 1DGUA 2KYFA 1CDPA 1ZGOA 4DXQA 1G8IA 1YRTB 3D76A 4L1IA 1C07A 3RWTA 2JXCA 3SG4A 1YX8A 3IQOA 3CGLA 2EMNA 1S36A 3HCMA 1JBAA 1AJ5A 5LTRA 5LTPA 3NSOA 3DYEA 1UHHA 3SS5A 3BOWB 5BTTB 1QVIY 3GK4X 1C3ZA 5D7FA 1OMVA 1F70A 3EVVA 2KOTA 4YGEB 3DQ9A 5KTGA 1YRUB 5FHVA 2AH8A 2MA2A 1S6JA 2Q57A 4MZKA 1J1EA 1Y1XA 1BJFA 1J7RA 1PVBA 1XA5A 3CLNA 1NX3A 4OV2A 2A53B 3I5FB 1JSAA 3GOFA 2AHAA 3FWBA 1W7JB 1QWVA 1ZMZA 3CB9A 5HLVA 1MQ1A 3I5HC 3V2LA 1KFXS 1HQVA 3LCPC 4YGDB 2LANA 4JRBA 1F8HA 4JEOA 3DQJA 2LMTA 1CKKA 2QLHA 3K21A 2BAPA 1TCOB 3EVRA 1KQVA 4ZF4A 4XOWA 4N1GA 1DJHA 3SVNA 5J3XA 2V4EB 4QJ3B 1BMOA 2OTBA 5BQLA 3CBEA 2KGRA 5I2QA 1DT7B 2BE4A 4H3NA 2DUFA 3SVCA 1SR6C 2Z6ZA 1KQMB 1M46A 1MXEA 4AR7A 3DF0B 2ARLA 2L4IA 2SASA 1KWOC 1NCZA 2A52B 1S6CA 3DD4A 2ISDA 4OZDA 3BUOB 2PSRA 1RMMA 4W7FA 3GEXA 4H48A 3NF0A 1B7TZ 2MLEC 2JT8A 3CZ1A 5EB7A 4L12A 4ANJA 2IB6A 1SSEB 2FWQA 4W6TA 1EMFA 1MUXA 2ZMWA 1BG1A 3DQFA 5HBDA 4Z4MA 1GFLA 1RTP1 1XFUO 4L13A 3ED8A 3MGFA 4LJDA 3KO0A 2MJWB 4XOVA 4Q7UA 3EG5B 3VICA 5G08A 1SL9A 4YBHB 3CTNA 1TTXA 2Y5IA 2ZO6A 1KYRA 5DKQA 1K90D 3QMEA 3E5TA 4W77A 1BR4B 1YJ2A 5EL2A 1L2OB 2QEBA 1B1GA 2L0PA 1GGWA 2BBMA 2LAPA 1VRKA 2GGMA 3WHUB 4OHSA 1IWQA 4DUQA 5I2LA 4B30A 3DPZA 1AVSA 4CFRA 2OS8C 3WHTB 3PATA 1B4CA 1DJXA 3CZ0A 1IKUA 4NDCA 4AQIA 3CGAA 2ZN9A 2WISA 2V53A 1B8CA 3PM8A 4IK8A 1SCMB 1KP5A 1FI6A 5I8NA 1K93D 3BJHA 4QJ4B 1CV7A 1JBYA 2V4EA 2Z6YA 1N65A 5HYDA 1NX2A 2JT0A 5H88A 1SY9A 1ZUZA 3R1PA 1YVHA 5FI6A 4I5LB 2K7CA 3KPXA 1QLSA 1KK7Z 3E5WA 1RJVA 1SNLA 1Q4CA 3DF0A 2P6BB 1S5GY 1S3PA 5CSIA 4EULA 4W7DA 1B9AA 1YVLA 4DXIA 1NWDA 3OHMB 3S0FA 5T3IA 1J1DA 1TCFA 4A4BA 1CM4A 5H87A 3BXCA 3F45A 3B87A 2DD9A 1QXPA 5FI2A 3SV5A 4HQ8A 5KTYA 4FQTA 1DJWA 4RYWA 3N7HA 1H6RA 1YURA 1MR8A 4CPVA 3FS7A 5AANA 1W7SA 4W73A 1YFPA 4W6PA 1OQPA 3NEZA 3TZ1A 2JT3A 2C9JA 2WHTA 4ZF5A 1W9ZA 2CBLA 5DQMA 2QRFA 2VZXA 2L51A 2H8QA 3ST2A 1G33A 1DC1A 1BFPA 1NPQA 1F55A 3PM2A 5JOLA 3DQUA 3B86A 3SVOA 1PSRA 2KQ6A 4PE4A 3O4XA 4HE4A 4ZF3A 2WCBA 4ZBLA 2DUIA 2B3PA 4JD9A 1OMRA 3MSEB 1RMPA 4M2PA 3S0GA 4ZINA 2LP3A 3I5GB 4N3DA 3FE8A 2LHLA 1RRXA 1E8AA 5CSJA 1W7IB 1G7KA 1B8LA 2JNXA 2A46A 1SPYA 5DKRA 1OXDA 3CZ2A 2PQLA 1MOVA 1A29A 1XYDA 1SL7A 1HT9A 1OOIX 4GAOA 2FOTA 3B6XA 2KBIA 1C3YA 2E30A 3BUNB 5JJGA 2JPOA 2M1KB 1DJZA 2F3YA 1IRJA 1TN4A 2B1UA 4GFTA 4OCIA 1KFXL 3BX9A 3DQ5A 1CLBA 2FJUB 2MRDA 1Y0VH 1SMGA 1K94A 2O2BA 4WQ2A 5AFPA 2KAVA 4R6DA 4KEXA 1SBJA 1RMOA 4B5YA 1WRLA 3R72A 3CS1A 2H5OA 1DVIA 2GX2A 3S0AA 3K1KA 1MWNA 4OR9B 5BT0A 3VRNA 2GX0A 3U0NA 1UHNA 3SVBA 3PN7B 1ZGPA 4DKNA 4H3LA 4F7FA 3DQ4A 3PJ7A 3PFVA 1XK4C 4PPJA 2YE0A 2KI4C 3UFZA 4W7AA 2Y1NA 4HSZA 3GL4A 2WCJA 2QACA 4IK4A 1KK8B 1Q4DA 3TS5C 2WURA 3BFAA 2M49B 1HCJA 4KGEA 3P28A 1RROA 5HZOA 4GOBA 4KF5A 3S05A 2B3QA 2VVIA 1QXTA 3BXBA 5EXCI 1CM1A 4Z4KA 2QU1A 1OMDA 4NQGA 1M39A 2H61C 1YR5A 1LINA 4AOMA 5H89A 1QATA 4BY5A 5HZSA 2G3OA 2O60A 1K9PA 3TDIA 4JPZB 1XFVO 3GK1A 1QV1A 3SS0A 4H3MA 3W1CA 2EMOA 3KEVA 3I5FC 1PALA 4W7CA 3VB1A 4OJ0A 4EMQA 1J7QA 2G3DB 4DXNA 3VRPA 1BU3A 2Q6PA 4W6MA 3IF7A 1B7TY 3D10A 2M97A 1IG5A 2IE2A 3DQHA 5B8IB 3D73A 1Q80A 3FE6A 1L7ZA 3M22A 2A4JA 3K1EA 3A8RA 2ZFDA 1OOJA 2WC6A 2DOQA 1CMFA 4OVNF 1Q4AA 3SSPA 1KSOA 2IS9A 2HCGA 2WC8A 2K7OA 4F0ZB 4Q9WA 1WLZA 3JTDB 1SCVA 1EMEA 4M2QA 2I2RE 2LUCA 4AQJA 1KQMC 1DJGA 1YHGA 3G9AA 2JZIA 1ZGQA 3S0BA 4IK1A 1NX0A 3BUMB 1WY9A 2H8VA 2H9WA 2K2FA 2KFFA 2QLGA 2ERBA 1OZOA 3OB2B 1SRAA 2O5GA 3WLDA 1QX5B 1ZUXA 1CMGA 2O29A 1IQ5A 2L2EA 1QX7A 2LHIA 4B30B 1LVCD 2JQ6A 2YGUA 3CZTX 2FZUA 4ICBA 5DPHA 3CWGA 3CD1A 1K9KA 5FVFA 2WNDA 2QDIA 3LF4B 2DUEA 5DTLA 3O2PA 1DMOA 1XFYO 4C0LA 3EKJA 2QPTA 4DXPA 3RZSA 2KSPA 4JFGA 4JGEA 4ORCB 1CB1A 4IL1A 3CYZA 3SVUA 3SVDA 1EMMA 1L2OC 4LJCA 4KW8A 3BFHA 1KK7Y 1CNPA 4H47A 1DJIA 3OGOA 2PMYA 3BYAA 3OX6A 2BE6A 5HKYA 4CLNA 4W6OA 1NIWA 3BUXB 4YI8A 3GJ2A 3BQ3A 2NZ0A 2FJYA 4INWA 1OZSA 4PPLA 2ZO7A 3D74A 2HRSA 4LW5A 3V3DA 2M8UA 3U8AA 1QASA 2BL0C 1IIOA 2MBXA 3PJIA 2PALA 1QX2A 2H5RA 3IQQA 2LC5A 4CIDA 1SCMC 5HKWA 4GUKA 1K9UA 1NX1A 4W6AA 3ZWHA 4HQCA 4W69A 4CFQA 2WHUA 1PVAA 3EK7A 1SW8A 4IK3A 3D75A 3LK0A 3NT9A 2BTJA 1JFKA 2CT9A 1EMAA 3NT3A 3OP0A 2G5ZB 5EXUA 1XFZO 1DEKA 1DGVA 5HZTA 5J2OA 1JC0A 4RYSA 1XFRA 2Y4QA 1DF0A 1JFJA 1K96A 3TUYB 2O24A 4J8AA 1JUOA 3S0EA 3O77A 5FI7A 3EVUA 5ER4X 1BODA 2CCMA 1XQMA 2AWMA 1LXFC 2JU0A 1WRKA 4W6FA 2ZN8A 2G2BA 4PE0A 2PXSA 1RECA 1CFCA 4I2YA 1QV0A 3AAJA 5AERA 2JOJA 4W6RA 3DQCA 2LUXA 1BR1B 5ER5A 1B8RA 2F2PA 1WDCB 3SSKA 3DVEA 3SIBA 4U2VA 2FCEA 3OB1B 1EG3A 1TOPA 1OOHA 2K60A 2L4HA 2JC2A 1JBZA 4UPGA 1UHJA 3D77A 2A47A 5D69A 3DY9A 1UUSA 2GW4B 2QEVA 1YTZC 2LVVA 2GTEA 1EG4A 3ZUJA 3ZUFA 1IH0A 4ZB1A 1OOGA 1Q4BA 1F09A 4GGFC 1ZOTB 1A2XA 3TDZA 3PJ5A 4P2YB 4EDSA 2ZNDA 3DQEA 2WC5A 2HQWA 2YFPA 2CXJA 1CFFA 4W6UA 2M9GA 1IJ5A 4AS8A 2ZRSA 3WNXB 3ZULA 1OOFA 3WLCA 4DXOA 1PSBA 1TUJA 4GPLB 1JC2A 4Q9XA 2K0JA 3SVSA 3CFAA 2TN4A 1EMLA 2G6YA 2MAZA 1FI5A 1FPWA 4C0JA 2KLDA 4W6BA 2ZMUA 4MRXA 5EB6A 2HETA 4MSPA 1F0BA 2WORA 2M7NA 4OKHA 2AWJA 3KHEA 1OSAA 4W6NA 3D78A 3AAKA 1LKJA 3NEDA 4NDDA 3A8SA 1YUSA 4I5KA 2JTZA 2VRGA 3RLZA 2VAEA 2HQKA 2CTNA 5DQBA 2G9BA 5K89A 5EJUA 2VADA 3I5IC 1BLQA 2K7DA 1DQEA 2I7AA 1GGZA 5FYXA 3PIBA 2JWWA 1N0YA 5CPVA 1S6IA 2OGRA 2PXWA 1XFWO 4BDUA 3JVTB 4IZNA 2DD7A 4HQ9A 2HPSA 4PHJA 1B9CA 1QIWA 2LM5A 3PN7C 5KSZA 3SG2A 2M3WA 4PHMA 3LVDA 1GL4A 1EL4A 4USLA 2ZRTA 2WSOA 3U0MA 5DRGA 1NCYA 2H5PA 1KK8C 5DY6A 2OKYA 1LA3A 3TMRA 1QYFA 1KFUS 3LK1A 3CR4X 1TNWA 4PE1A 1N2DA 1SL8A 1A03A 2POXA 3DQDA 2OTGC 2WCMA 4N5XA 5DPJA 3GK2A 1KCYA 1YUUA 2EC6C 3NSIA 3CR5X 3NSKA 3D0YB 1FBVA 4YGBB 1S26D 1IJ6A 4XL5A 2L2CA 1ORGA 2Z6XA 4KF4A 2YDZA 2LCPA 4D1EA 1XO5A 2WCFA 4W74A 4PHKA 3U0LA 1PK0D 3WXAA 4R1EA 3O6BA 4KGFA 3E5VA 4ORAB 2NCPA 1F54A 2H6VA 2LVJA 5DPGA 3FIAA 5DRFA 1OE9B 1U5IA 4EDOA 2QLGB 1ALWA 2KYCA 3DQKA 3WCKA 4ORBB 5AEQA 4UTSA 1MXLC 3VHTB 5DTZA 1HUYA 1V1FA 3SS3A 3JTDC 3AKAA 3SG5A 1XA9A 1XSSA 4PFEA 3PSRA 3SSLA 2MHHA 4LJDC 3FWCA 1LS8A 4IK5A 4W6GA 1J55A 1MHOA 3UO9A 3DZTA 4INXA 2BECA 5GQQC 2KI6C 3H1RA 2BKHB 4W6DA 1S1EA 4KPIA 2Y0GA 3M0WA 3RM1A 3W1DA 4DCKA 2DUGA 2QT2A 4GF6B 2L5YA 4W6CA 1GJYA 1CTRA 2KFGA 3LA1A 1AK8A 4ETOA 4EN1A 1XFXO 3LLEA 1QS7A 4LQUA 5BPJA 1AHRA 1EXRA 1R6PA 5CSFA 2PASA 3D0YA 2V4EC 2BKIB 1TWOA 1ODBA 4ZCVA 1XVJA 1SKTA 2KLEA 3L4AA 3ICBA 3DQIA 4W7EA 1Y6WA 3EKHA 4W6SA 2H5QA 1RWYA 1H8BA 3DVKA 3SIAA 1DF0B 2KI4B 1SK6D 1PRWA 3M24A 1EMCA 3EVPA 1CDLA 3HX4A 4DXMA 1RK9A 4KW4A 3TS5B 2C9IA 1QY3A 4P1QA 1GQMA 2JULA 2IOVA 2P71A 3DQ3A 3CD9A 4W6HA 1F4OA 2LLSA 3DQAA 2HF5A 2KNEA 1KSMA 3EK4A 2KI6D 1EMGA 3VHTA 4MBEA 4XJKA 3DQ6A 1OXFA 2LE9B 2LMVA 5EBJA 3ADFA 1DELA 1Z1QA 4W7RA 5DICA 2I18A 2BCAA 2M1UA 1KYSA 3TUYC 2ZNEA 2AUCA 2CNPA 3VK1A 1ALVA 2EMDA 4MZJA 4HVFA 1G4YR 1K8UA 3R1OA 3P8UA 3IR8A 3L4LA 3LS3A 4N1FA 4MZLA 2YE1A 1WDCC 2HGDA 2I94A 4GBAA 3DQ2A 1F4QA 1TUZA 1YUTA 4YGAA 1GM0A 4DS7A 4PALA 1JC1A 2OTEA 2KDHA 2K2AA 3DQOA 2FCDA 1M45A 4TZGA 3SG6A 2Z1OA 3KCSA 1DTLA 1Z4HA 3SSVA 1C7WA 2A48A 4MVFA 5PALA 2MLFC 1TIZA 4PE7A 3CABA 1AP4A 2JADA 1YX7A 1NP8A 2F3ZA 4OGSA 1KFUL 1TNQA 1MYWA 4MRYA 4J88A 2LNKA 2EHBA 2R2IA 4ZIOA 4RTCA 1QJTA 1EJ3A 1IGVA 1BOCA 3DQLA 1XK4A 2M7LA 4ORNA 2KPHA 3VRRA 1IQ3A 2HFCA 5HZUA 3DVJA 2LMUA 3VRQA 3NHTA 1T14A 3NHIA 3OX5A 2PRUA 1MOUA 1M63B 4I5JA 3I5HB 2DUHA 3ST0A 1EH2A 3VGOA 2KGBC 3BOWA 1J7OA 5BTTA 2EGDA 5LTQA 4M2OA 2VVHA 2A54B 2H61A 2WCHA 1UHKA 4JWQA 4FQOA 1OXEA 3B7AA 1C4FA 3UNWA 1W7UA 4A4CA 3DQ8A 1QVIZ 3GB3A 1DJYA 4MN0A 3AI4A 4GESB 4TZAA 4BY4A 5HGEA 1AUIB 3SSYA 2K8MB 2BCBA 1CDNA 4KF5C 1S6ZA 5DTYA 3ZTFA 5F9GA 4DRWA 2QLEA 1SR6B 3FE9A 2A56B 3CDNA 4OY4A 1NYAA 3H1OA 3JVTC 3LF3A 1YHHA 2BBNA 1KWOB 5F6TA 3U0KA 3RWAA 1V1GA 1EMKA 3DPXA 1CLLA 4ZCUA 2BCXA 3DQMA 2BL0B 2L50A 2JRFA 5DU0A 2WHSA 5EHUA 2COLB 1Y1AA 5DKNA 4KA9A 5TNCA 1K2HA 4HREE 3I5GC 1P28A 3NSLA 2PYQA 3IP2A 1B47A 2RH7A 3DQ7A 2NLNA 2QEHA 3SG7A 1R2UA 3NGVA 4QJ5B 2KBMA 5DTXA 4U8DA 1AJ4A 1F71A 5AXIA 1U5IB 1C7VA 1H4UA 2LVIA 3DPWA 4YGCB 2LV7A 3TDUA 2JXLA 2KAXA 4OQWA 3NXAA 5CSNA 1WRZA 1EMBA 1A75B 3GJ1A 2GW3A 5FVIA 4C0KA 3DQ1A 2M29A 3LVCA 4NWSA 2JPTA 5D3OA 4XGYA 3DXLA 1H4BA 3SVEA 1ZACA 2Y1MA 4PPKA 3VROA 4DIRA 3UG0A 1NCXA 2G16B 2JNFA 3OBVA 4YI9A
chains in the Genus database with same CATH topology
1LA0A 4I5NB 4W6IA 1XAEA 1W7TA 1M31A 4XVPA 4LJBA 3DVMA 1QYQA 2NCOA 2OS8B 2AAOA 3TMTA 4FTGA 2A50B 2KFHA 2KAYA 5EXBA 2VVJA 2WOSA 2G2SB 5HLOA 2F8PA 4P5OE 2DDDA 2SCPA 1UWOA 1YHIA 3LSAA 4Q04A 2HQ8A 5IBWA 1TNPA 1QTXA 2OKWA 1J7PA 2LVKA 2ZKMX 1CLMA 5FVGA 1RM9A 4IK9A 3OSRA 1UHIA 3CFFA 3LL8B 4PCWA 4W75A 4JF9A 1UISA 2L98A 3DQNA 2HGYA 4KAGA 5AQBB 2KQYA 2QZ0A 3AKOA 4J89A 2OJKA 3I19A 3SVRA 2LP2A 5HW9A 3PJBA 3BUWB 3SG3A 2WCEA 3PALA 1PULA 3ST3A 1MF8B 1TRFA 4ZFSA 3KCTA 4W7XA 3OSQA 3SSTA 1Y1UA 3AI5A 3U8CA 4DKMA 4NDBA 2LLTA 1JWDA 4HRGA 5DPIA 2RGIA 2K7BA 4L9MA 4MLWA 3O4YA 2HQZA 4P76A 2H2KA 2HJOA 3I5IB 4JQ0D 3LVAA 4PDZA 1Q73A 2AWKA 1A75A 2OPOA 4XYNA 2GGZA 4GNKB 1SYMA 4WQ3A 1XMZA 1ZFSA 1JF2A 4Q7TA 3CR2A 4W6LA 4YRUA 1S5GZ 2WSNA 1Q4EA 3E3RA 2D8NA 1QIVA 3U8PA 1FW4A 3O78A 4XJKB 4JC2A 3BXKA 4W72A 1BF5A 1TNXA 1NSHA 2QLIA 1GGXA 4W76A 4W6JA 3H4SE 4PHNA 3BXAA 1WLMA 3CFHA 4MEWA 2WIQA 1QLKA 1JF0A 1KYPA 2ICRA 4E68A 2G6EA 3A4UB 2M0RA 3EK8A 4TNCA 3C1VA 1RFJA 1CDMA 2OTGB 2G6XA 2PVBA 2KHNA 2P4MA 2EC6B 2Q91A 3SJSA 1YZWA 4GGFA 3SSHA 2F2OA 3ZNIA 4KW9A 1X02A 4HRHA 4GGNA 1K95A 4W6KA 2E6WA 3SRYA 2LLUA 2NXQA 2AWLA 5KU1A 1QYOA 2DDCA 2IB5A 2HPWA 2K61A 2GV5A 2F33A 2L5XB 1UURA 3AKBA 1YJFA 4Q7RA 1A4PA 2AMIA 4LQTA 1Z1PA 5LK4A 4R6BA 5HKZA 4WRIA 1NUBA 3PLFB 3KF9A 2JTTA 3ST4A 1UP5A 1CFDA 1D1OA 1FF1A 1BT6A 2FL1A 5I2OA 1CFPA 3QRXA 2Q4UA 1DGUA 2KYFA 1CDPA 1ZGOA 4DXQA 1G8IA 1YRTB 4L1IA 1C07A 3RWTA 2JXCA 3SG4A 1YX8A 3IQOA 3CGLA 2EMNA 1S36A 3HCMA 1JBAA 1AJ5A 5LTRA 5LTPA 3NSOA 1UHHA 3BOWB 5BTTB 1QVIY 3GK4X 5D7FA 1OMVA 1F70A 3EVVA 2KOTA 4YGEB 3DQ9A 5KTGA 1YRUB 5FHVA 2AH8A 2MA2A 1S6JA 2Q57A 4MZKA 1J1EA 1Y1XA 1BJFA 1J7RA 1PVBA 1XA5A 3CLNA 1NX3A 4OV2A 2A53B 3I5FB 1JSAA 3GOFA 2AHAA 3FWBA 1W7JB 1ZMZA 3CB9A 5HLVA 1MQ1A 3I5HC 1KFXS 1HQVA 3LCPC 4YGDB 2LANA 4JRBA 1F8HA 4JEOA 3DQJA 2LMTA 1CKKA 2QLHA 3K21A 1TCOB 3EVRA 1KQVA 4ZF4A 4XOWA 4N1GA 1DJHA 3SVNA 5J3XA 2V4EB 4QJ3B 1BMOA 2OTBA 5BQLA 3CBEA 2KGRA 5I2QA 1DT7B 2BE4A 4H3NA 2DUFA 3SVCA 1SR6C 2Z6ZA 1KQMB 1M46A 1MXEA 4AR7A 3DF0B 2ARLA 2L4IA 2SASA 1KWOC 1NCZA 2A52B 1S6CA 3DD4A 2ISDA 3BUOB 2PSRA 1RMMA 4W7FA 3GEXA 4H48A 3NF0A 1B7TZ 2MLEC 2JT8A 5EB7A 4L12A 4ANJA 2IB6A 2FWQA 4W6TA 1EMFA 1MUXA 2ZMWA 1BG1A 3DQFA 5HBDA 4Z4MA 1GFLA 1RTP1 1XFUO 4L13A 3ED8A 3MGFA 4LJDA 3KO0A 2MJWB 4XOVA 4Q7UA 3VICA 5G08A 1SL9A 4YBHB 3CTNA 1TTXA 2Y5IA 2ZO6A 1KYRA 5DKQA 1K90D 3E5TA 4W77A 1BR4B 1YJ2A 1L2OB 1B1GA 2L0PA 1GGWA 2BBMA 2LAPA 1VRKA 2GGMA 3WHUB 4OHSA 1IWQA 4DUQA 5I2LA 4B30A 3DPZA 1AVSA 4CFRA 2OS8C 3WHTB 3PATA 1B4CA 1DJXA 1IKUA 4NDCA 4AQIA 3CGAA 2ZN9A 2WISA 2V53A 1B8CA 3PM8A 4IK8A 1SCMB 1KP5A 1FI6A 5I8NA 1K93D 4QJ4B 1CV7A 1JBYA 2V4EA 2Z6YA 1N65A 5HYDA 1NX2A 2JT0A 5H88A 1SY9A 1ZUZA 1YVHA 4I5LB 2K7CA 3KPXA 1QLSA 1KK7Z 3E5WA 1RJVA 1SNLA 1Q4CA 3DF0A 2P6BB 1S5GY 1S3PA 5CSIA 4EULA 4W7DA 1B9AA 1YVLA 4DXIA 1NWDA 3OHMB 5T3IA 1J1DA 1TCFA 4A4BA 1CM4A 5H87A 3BXCA 3F45A 2DD9A 1QXPA 3SV5A 4HQ8A 5KTYA 1DJWA 4RYWA 1H6RA 1YURA 1MR8A 4CPVA 3FS7A 5AANA 1W7SA 4W73A 1YFPA 4W6PA 1OQPA 3NEZA 3TZ1A 2JT3A 2C9JA 2WHTA 4ZF5A 2CBLA 5DQMA 2QRFA 2VZXA 2L51A 2H8QA 3ST2A 1G33A 1BFPA 1NPQA 1F55A 5JOLA 3DQUA 3SVOA 1PSRA 2KQ6A 4PE4A 4HE4A 4ZF3A 2WCBA 4ZBLA 2DUIA 2B3PA 1OMRA 3MSEB 1RMPA 4M2PA 4ZINA 2LP3A 3I5GB 4N3DA 2LHLA 1RRXA 1E8AA 5CSJA 1W7IB 1G7KA 1B8LA 2JNXA 2A46A 1SPYA 5DKRA 1OXDA 1MOVA 1A29A 1XYDA 1SL7A 1HT9A 4GAOA 2FOTA 2KBIA 2E30A 3BUNB 5JJGA 2M1KB 1DJZA 2F3YA 1IRJA 1TN4A 2B1UA 4GFTA 4OCIA 1KFXL 3BX9A 3DQ5A 1CLBA 2FJUB 2MRDA 1Y0VH 1SMGA 1K94A 2O2BA 4WQ2A 5AFPA 2KAVA 4R6DA 4KEXA 1SBJA 1RMOA 4B5YA 1WRLA 3CS1A 2H5OA 1DVIA 2GX2A 3K1KA 1MWNA 4OR9B 5BT0A 3VRNA 2GX0A 3U0NA 1UHNA 3SVBA 3PN7B 1ZGPA 4DKNA 4H3LA 3DQ4A 3PJ7A 3PFVA 1XK4C 4PPJA 2YE0A 2KI4C 3UFZA 4W7AA 2Y1NA 4HSZA 3GL4A 2QACA 4IK4A 1KK8B 1Q4DA 3TS5C 2WURA 2M49B 1HCJA 4KGEA 3P28A 1RROA 5HZOA 4GOBA 4KF5A 3S05A 2B3QA 2VVIA 1QXTA 3BXBA 5EXCI 1CM1A 4Z4KA 2QU1A 1OMDA 4NQGA 1M39A 2H61C 1YR5A 1LINA 4AOMA 5H89A 1QATA 4BY5A 5HZSA 2G3OA 2O60A 1K9PA 3TDIA 4JPZB 1XFVO 3GK1A 1QV1A 3SS0A 4H3MA 3W1CA 2EMOA 3KEVA 3I5FC 1PALA 4W7CA 4OJ0A 4EMQA 1J7QA 2G3DB 4DXNA 3VRPA 1BU3A 2Q6PA 4W6MA 3IF7A 1B7TY 3D10A 2M97A 1IG5A 2IE2A 3DQHA 5B8IB 1Q80A 1L7ZA 3M22A 2A4JA 3A8RA 2ZFDA 1OOJA 2DOQA 1CMFA 4OVNF 1Q4AA 3SSPA 1KSOA 2IS9A 2HCGA 2WC8A 2K7OA 4F0ZB 4Q9WA 1WLZA 3JTDB 1SCVA 1EMEA 4M2QA 2I2RE 2LUCA 4AQJA 1KQMC 1DJGA 1YHGA 3G9AA 2JZIA 1ZGQA 4IK1A 1NX0A 3BUMB 1WY9A 2H9WA 2K2FA 2KFFA 2QLGA 1OZOA 3OB2B 1SRAA 2O5GA 3WLDA 1QX5B 1ZUXA 1CMGA 2O29A 1IQ5A 2L2EA 1QX7A 2LHIA 4B30B 1LVCD 2JQ6A 3CZTX 2FZUA 4ICBA 5DPHA 3CWGA 3CD1A 1K9KA 5FVFA 2WNDA 3LF4B 2DUEA 5DTLA 3O2PA 1DMOA 1XFYO 4C0LA 3EKJA 2QPTA 4DXPA 2KSPA 4JFGA 4JGEA 4ORCB 1CB1A 4IL1A 3SVUA 3SVDA 1EMMA 1L2OC 4LJCA 4KW8A 1KK7Y 1CNPA 4H47A 1DJIA 3OGOA 2PMYA 3BYAA 3OX6A 2BE6A 5HKYA 4CLNA 4W6OA 1NIWA 3BUXB 4YI8A 3GJ2A 3BQ3A 2NZ0A 1OZSA 4PPLA 2ZO7A 2HRSA 4LW5A 3V3DA 2M8UA 3U8AA 1QASA 2BL0C 2MBXA 2PALA 1QX2A 2H5RA 3IQQA 2LC5A 4CIDA 1SCMC 5HKWA 4GUKA 1K9UA 1NX1A 4W6AA 3ZWHA 4HQCA 4W69A 4CFQA 2WHUA 1PVAA 3EK7A 1SW8A 4IK3A 3LK0A 3NT9A 2BTJA 1JFKA 2CT9A 1EMAA 3NT3A 3OP0A 2G5ZB 5EXUA 1XFZO 1DGVA 5HZTA 5J2OA 1JC0A 4RYSA 2Y4QA 1DF0A 1JFJA 1K96A 3TUYB 2O24A 4J8AA 1JUOA 3O77A 3EVUA 5ER4X 1BODA 2CCMA 1XQMA 2AWMA 1LXFC 2JU0A 1WRKA 4W6FA 2ZN8A 2G2BA 4PE0A 2PXSA 1RECA 1CFCA 4I2YA 1QV0A 3AAJA 5AERA 2JOJA 4W6RA 3DQCA 2LUXA 1BR1B 5ER5A 1B8RA 2F2PA 1WDCB 3SSKA 3DVEA 3SIBA 4U2VA 2FCEA 3OB1B 1EG3A 1TOPA 2L4HA 2JC2A 1JBZA 4UPGA 1UHJA 2A47A 5D69A 1UUSA 2GW4B 1YTZC 2LVVA 1EG4A 3ZUJA 3ZUFA 1IH0A 4ZB1A 1Q4BA 1F09A 4GGFC 1ZOTB 1A2XA 3TDZA 3PJ5A 4P2YB 4EDSA 2ZNDA 3DQEA 2HQWA 2YFPA 2CXJA 1CFFA 4W6UA 2M9GA 1IJ5A 4AS8A 2ZRSA 3WNXB 3ZULA 3WLCA 4DXOA 1PSBA 4GPLB 1JC2A 4Q9XA 2K0JA 3SVSA 3CFAA 2TN4A 1EMLA 2G6YA 2MAZA 1FI5A 1FPWA 4C0JA 4W6BA 2ZMUA 4MRXA 5EB6A 2HETA 4MSPA 1F0BA 2WORA 2M7NA 4OKHA 2AWJA 3KHEA 1OSAA 4W6NA 3AAKA 1LKJA 3NEDA 4NDDA 3A8SA 1YUSA 4I5KA 2JTZA 2VRGA 3RLZA 2VAEA 2HQKA 2CTNA 5DQBA 2G9BA 5K89A 5EJUA 2VADA 3I5IC 1BLQA 2K7DA 2I7AA 1GGZA 5FYXA 3PIBA 2JWWA 1N0YA 5CPVA 1S6IA 2OGRA 2PXWA 1XFWO 4BDUA 3JVTB 4IZNA 2DD7A 4HQ9A 2HPSA 4PHJA 1B9CA 1QIWA 2LM5A 3PN7C 5KSZA 3SG2A 2M3WA 4PHMA 3LVDA 1GL4A 1EL4A 4USLA 2ZRTA 2WSOA 3U0MA 5DRGA 1NCYA 2H5PA 1KK8C 5DY6A 2OKYA 1LA3A 3TMRA 1QYFA 1KFUS 3LK1A 3CR4X 1TNWA 4PE1A 1N2DA 1SL8A 1A03A 2POXA 3DQDA 2OTGC 4N5XA 5DPJA 3GK2A 1KCYA 1YUUA 2EC6C 3NSIA 3CR5X 3NSKA 3D0YB 1FBVA 4YGBB 1S26D 1IJ6A 4XL5A 2Z6XA 4KF4A 2YDZA 2LCPA 4D1EA 1XO5A 2WCFA 4W74A 4PHKA 3U0LA 1PK0D 3WXAA 4R1EA 3O6BA 4KGFA 3E5VA 4ORAB 2NCPA 1F54A 2H6VA 2LVJA 5DPGA 3FIAA 5DRFA 1OE9B 1U5IA 4EDOA 2QLGB 1ALWA 2KYCA 3DQKA 3WCKA 4ORBB 5AEQA 4UTSA 1MXLC 3VHTB 5DTZA 1HUYA 1V1FA 3JTDC 3AKAA 3SG5A 1XA9A 1XSSA 4PFEA 3PSRA 3SSLA 2MHHA 4LJDC 3FWCA 4IK5A 4W6GA 1J55A 1MHOA 2BECA 5GQQC 2KI6C 3H1RA 2BKHB 4W6DA 1S1EA 4KPIA 2Y0GA 3M0WA 3RM1A 3W1DA 4DCKA 2DUGA 2QT2A 4GF6B 4W6CA 1GJYA 1CTRA 2KFGA 3LA1A 1AK8A 4ETOA 4EN1A 1XFXO 3LLEA 1QS7A 4LQUA 5BPJA 1AHRA 1EXRA 1R6PA 5CSFA 2PASA 3D0YA 2V4EC 2BKIB 1ODBA 4ZCVA 1XVJA 1SKTA 3ICBA 3DQIA 4W7EA 1Y6WA 3EKHA 4W6SA 2H5QA 1RWYA 1H8BA 3DVKA 3SIAA 1DF0B 2KI4B 1SK6D 1PRWA 3M24A 1EMCA 3EVPA 1CDLA 3HX4A 4DXMA 1RK9A 4KW4A 3TS5B 2C9IA 1QY3A 4P1QA 1GQMA 2JULA 2IOVA 3DQ3A 3CD9A 4W6HA 1F4OA 2LLSA 3DQAA 2HF5A 2KNEA 1KSMA 3EK4A 2KI6D 1EMGA 3VHTA 4MBEA 4XJKA 3DQ6A 1OXFA 2LE9B 2LMVA 5EBJA 3ADFA 1Z1QA 4W7RA 2I18A 2BCAA 2M1UA 1KYSA 3TUYC 2ZNEA 2AUCA 2CNPA 3VK1A 1ALVA 2EMDA 4MZJA 4HVFA 1G4YR 1K8UA 3P8UA 3IR8A 3LS3A 4N1FA 4MZLA 2YE1A 1WDCC 2HGDA 2I94A 4GBAA 3DQ2A 1F4QA 1YUTA 4YGAA 4DS7A 4PALA 1JC1A 2OTEA 2KDHA 2K2AA 3DQOA 2FCDA 1M45A 4TZGA 3SG6A 2Z1OA 3KCSA 1DTLA 3SSVA 1C7WA 2A48A 4MVFA 5PALA 2MLFC 1TIZA 4PE7A 1AP4A 2JADA 1YX7A 1NP8A 2F3ZA 4OGSA 1KFUL 1TNQA 1MYWA 4MRYA 4J88A 2LNKA 2EHBA 2R2IA 4ZIOA 4RTCA 1QJTA 1EJ3A 1IGVA 1BOCA 3DQLA 1XK4A 2M7LA 4ORNA 3VRRA 1IQ3A 2HFCA 5HZUA 3DVJA 2LMUA 3VRQA 3OX5A 2PRUA 1MOUA 1M63B 4I5JA 3I5HB 2DUHA 3ST0A 1EH2A 3VGOA 2KGBC 3BOWA 1J7OA 5BTTA 2EGDA 5LTQA 4M2OA 2VVHA 2A54B 2H61A 1UHKA 4JWQA 4FQOA 1OXEA 1C4FA 1W7UA 4A4CA 3DQ8A 1QVIZ 3GB3A 1DJYA 4MN0A 3AI4A 4GESB 4TZAA 4BY4A 5HGEA 1AUIB 3SSYA 2K8MB 2BCBA 1CDNA 4KF5C 1S6ZA 5DTYA 3ZTFA 5F9GA 4DRWA 2QLEA 1SR6B 2A56B 4OY4A 1NYAA 3H1OA 3JVTC 3LF3A 1YHHA 2BBNA 1KWOB 5F6TA 3U0KA 3RWAA 1V1GA 1EMKA 3DPXA 1CLLA 4ZCUA 2BCXA 3DQMA 2BL0B 2L50A 2JRFA 5DU0A 2WHSA 5EHUA 2COLB 1Y1AA 5DKNA 4KA9A 5TNCA 1K2HA 4HREE 3I5GC 3NSLA 3IP2A 1B47A 2RH7A 3DQ7A 2NLNA 3SG7A 1R2UA 4QJ5B 2KBMA 5DTXA 4U8DA 1AJ4A 1F71A 5AXIA 1U5IB 1C7VA 1H4UA 2LVIA 3DPWA 4YGCB 2LV7A 3TDUA 2JXLA 2KAXA 4OQWA 3NXAA 5CSNA 1WRZA 1EMBA 1A75B 3GJ1A 2GW3A 5FVIA 4C0KA 3DQ1A 2M29A 3LVCA 4NWSA 2JPTA 4XGYA 1H4BA 3SVEA 1ZACA 2Y1MA 4PPKA 3VROA 4DIRA 3UG0A 1NCXA 2G16B 2JNFA 4YI9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LA0 A;  4I5N B;  4W6I A;  1XAE A;  1W7T A;  1M31 A;  4XVP A;  4LJB A;  3DVM A;  1QYQ A;  2NCO A;  2OS8 B;  2AAO A;  3TMT A;  4FTG A;  2A50 B;  2KFH A;  2KAY A;  5EXB A;  2VVJ A;  2WOS A;  2G2S B;  5HLO A;  2F8P A;  4P5O E;  2DDD A;  2SCP A;  1UWO A;  1YHI A;  3LSA A;  4Q04 A;  2HQ8 A;  5IBW A;  1TNP A;  1QTX A;  2OKW A;  1J7P A;  2LVK A;  2ZKM X;  1CLM A;  5FVG A;  1RM9 A;  4IK9 A;  3OSR A;  1UHI A;  3CFF A;  3LL8 B;  4PCW A;  4W75 A;  4JF9 A;  1UIS A;  2L98 A;  3DQN A;  2HGY A;  4KAG A;  5AQB B;  2KQY A;  2QZ0 A;  3AKO A;  4J89 A;  2OJK A;  3I19 A;  3SVR A;  2LP2 A;  5HW9 A;  3PJB A;  3BUW B;  3SG3 A;  2WCE A;  3PAL A;  1PUL A;  3ST3 A;  1MF8 B;  1TRF A;  4ZFS A;  3KCT A;  4W7X A;  3OSQ A;  3SST A;  1Y1U A;  3AI5 A;  3U8C A;  4DKM A;  4NDB A;  2LLT A;  1JWD A;  4HRG A;  5DPI A;  2RGI A;  2K7B A;  4L9M A;  4MLW A;  3O4Y A;  2HQZ A;  4P76 A;  2H2K A;  2HJO A;  3I5I B;  4JQ0 D;  3LVA A;  4PDZ A;  1Q73 A;  2AWK A;  1A75 A;  2OPO A;  4XYN A;  2GGZ A;  4GNK B;  1SYM A;  4WQ3 A;  1XMZ A;  1ZFS A;  1JF2 A;  4Q7T A;  3CR2 A;  4W6L A;  4YRU A;  1S5G Z;  2WSN A;  1Q4E A;  3E3R A;  2D8N A;  1QIV A;  3U8P A;  1FW4 A;  3O78 A;  4XJK B;  4JC2 A;  3BXK A;  4W72 A;  1BF5 A;  1TNX A;  1NSH A;  2QLI A;  1GGX A;  4W76 A;  4W6J A;  3H4S E;  4PHN A;  3BXA A;  1WLM A;  3CFH A;  4MEW A;  2WIQ A;  1QLK A;  1JF0 A;  1KYP A;  2ICR A;  4E68 A;  2G6E A;  3A4U B;  2M0R A;  3EK8 A;  4TNC A;  3C1V A;  1RFJ A;  1CDM A;  2OTG B;  2G6X A;  2PVB A;  2KHN A;  2P4M A;  2EC6 B;  2Q91 A;  3SJS A;  1YZW A;  4GGF A;  3SSH A;  2F2O A;  3ZNI A;  4KW9 A;  1X02 A;  4HRH A;  4GGN A;  1K95 A;  4W6K A;  2E6W A;  3SRY A;  2LLU A;  2NXQ A;  2AWL A;  5KU1 A;  1QYO A;  2DDC A;  2IB5 A;  2HPW A;  2K61 A;  2GV5 A;  2F33 A;  2L5X B;  1UUR A;  3AKB A;  1YJF A;  4Q7R A;  1A4P A;  2AMI A;  4LQT A;  1Z1P A;  5LK4 A;  4R6B A;  5HKZ A;  4WRI A;  1NUB A;  3PLF B;  3KF9 A;  2JTT A;  3ST4 A;  1UP5 A;  1CFD A;  1D1O A;  1FF1 A;  1BT6 A;  2FL1 A;  5I2O A;  1CFP A;  3QRX A;  2Q4U A;  1DGU A;  2KYF A;  1CDP A;  1ZGO A;  4DXQ A;  1G8I A;  1YRT B;  4L1I A;  1C07 A;  3RWT A;  2JXC A;  3SG4 A;  1YX8 A;  3IQO A;  3CGL A;  2EMN A;  1S36 A;  3HCM A;  1JBA A;  1AJ5 A;  5LTR A;  5LTP A;  3NSO A;  1UHH A;  3BOW B;  5BTT B;  1QVI Y;  3GK4 X;  5D7F A;  1OMV A;  1F70 A;  3EVV A;  2KOT A;  4YGE B;  3DQ9 A;  5KTG A;  1YRU B;  5FHV A;  2AH8 A;  2MA2 A;  1S6J A;  2Q57 A;  4MZK A;  1J1E A;  1Y1X A;  1BJF A;  1J7R A;  1PVB A;  1XA5 A;  3CLN A;  1NX3 A;  4OV2 A;  2A53 B;  3I5F B;  1JSA A;  3GOF A;  2AHA A;  3FWB A;  1W7J B;  1ZMZ A;  3CB9 A;  5HLV A;  1MQ1 A;  3I5H C;  1KFX S;  1HQV A;  3LCP C;  4YGD B;  2LAN A;  4JRB A;  1F8H A;  4JEO A;  3DQJ A;  2LMT A;  1CKK A;  2QLH A;  3K21 A;  1TCO B;  3EVR A;  1KQV A;  4ZF4 A;  4XOW A;  4N1G A;  1DJH A;  3SVN A;  5J3X A;  2V4E B;  4QJ3 B;  1BMO A;  2OTB A;  5BQL A;  3CBE A;  2KGR A;  5I2Q A;  1DT7 B;  2BE4 A;  4H3N A;  2DUF A;  3SVC A;  1SR6 C;  2Z6Z A;  1KQM B;  1M46 A;  1MXE A;  4AR7 A;  3DF0 B;  2ARL A;  2L4I A;  2SAS A;  1KWO C;  1NCZ A;  2A52 B;  1S6C A;  3DD4 A;  2ISD A;  3BUO B;  2PSR A;  1RMM A;  4W7F A;  3GEX A;  4H48 A;  3NF0 A;  1B7T Z;  2MLE C;  2JT8 A;  5EB7 A;  4L12 A;  4ANJ A;  2IB6 A;  2FWQ A;  4W6T A;  1EMF A;  1MUX A;  2ZMW A;  1BG1 A;  3DQF A;  5HBD A;  4Z4M A;  1GFL A;  1RTP 1;  1XFU O;  4L13 A;  3ED8 A;  3MGF A;  4LJD A;  3KO0 A;  2MJW B;  4XOV A;  4Q7U A;  3VIC A;  5G08 A;  1SL9 A;  4YBH B;  3CTN A;  1TTX A;  2Y5I A;  2ZO6 A;  1KYR A;  5DKQ A;  1K90 D;  3E5T A;  4W77 A;  1BR4 B;  1YJ2 A;  1L2O B;  1B1G A;  2L0P A;  1GGW A;  2BBM A;  2LAP A;  1VRK A;  2GGM A;  3WHU B;  4OHS A;  1IWQ A;  4DUQ A;  5I2L A;  4B30 A;  3DPZ A;  1AVS A;  4CFR A;  2OS8 C;  3WHT B;  3PAT A;  1B4C A;  1DJX A;  1IKU A;  4NDC A;  4AQI A;  3CGA A;  2ZN9 A;  2WIS A;  2V53 A;  1B8C A;  3PM8 A;  4IK8 A;  1SCM B;  1KP5 A;  1FI6 A;  5I8N A;  1K93 D;  4QJ4 B;  1CV7 A;  1JBY A;  2V4E A;  2Z6Y A;  1N65 A;  5HYD A;  1NX2 A;  2JT0 A;  5H88 A;  1SY9 A;  1ZUZ A;  1YVH A;  4I5L B;  2K7C A;  3KPX A;  1QLS A;  1KK7 Z;  3E5W A;  1RJV A;  1SNL A;  1Q4C A;  3DF0 A;  2P6B B;  1S5G Y;  1S3P A;  5CSI A;  4EUL A;  4W7D A;  1B9A A;  1YVL A;  4DXI A;  1NWD A;  3OHM B;  5T3I A;  1J1D A;  1TCF A;  4A4B A;  1CM4 A;  5H87 A;  3BXC A;  3F45 A;  2DD9 A;  1QXP A;  3SV5 A;  4HQ8 A;  5KTY A;  1DJW A;  4RYW A;  1H6R A;  1YUR A;  1MR8 A;  4CPV A;  3FS7 A;  5AAN A;  1W7S A;  4W73 A;  1YFP A;  4W6P A;  1OQP A;  3NEZ A;  3TZ1 A;  2JT3 A;  2C9J A;  2WHT A;  4ZF5 A;  2CBL A;  5DQM A;  2QRF A;  2VZX A;  2L51 A;  2H8Q A;  3ST2 A;  1G33 A;  1BFP A;  1NPQ A;  1F55 A;  5JOL A;  3DQU A;  3SVO A;  1PSR A;  2KQ6 A;  4PE4 A;  4HE4 A;  4ZF3 A;  2WCB A;  4ZBL A;  2DUI A;  2B3P A;  1OMR A;  3MSE B;  1RMP A;  4M2P A;  4ZIN A;  2LP3 A;  3I5G B;  4N3D A;  2LHL A;  1RRX A;  1E8A A;  5CSJ A;  1W7I B;  1G7K A;  1B8L A;  2JNX A;  2A46 A;  1SPY A;  5DKR A;  1OXD A;  1MOV A;  1A29 A;  1XYD A;  1SL7 A;  1HT9 A;  4GAO A;  2FOT A;  2KBI A;  2E30 A;  3BUN B;  5JJG A;  2M1K B;  1DJZ A;  2F3Y A;  1IRJ A;  1TN4 A;  2B1U A;  4GFT A;  4OCI A;  1KFX L;  3BX9 A;  3DQ5 A;  1CLB A;  2FJU B;  2MRD A;  1Y0V H;  1SMG A;  1K94 A;  2O2B A;  4WQ2 A;  5AFP A;  2KAV A;  4R6D A;  4KEX A;  1SBJ A;  1RMO A;  4B5Y A;  1WRL A;  3CS1 A;  2H5O A;  1DVI A;  2GX2 A;  3K1K A;  1MWN A;  4OR9 B;  5BT0 A;  3VRN A;  2GX0 A;  3U0N A;  1UHN A;  3SVB A;  3PN7 B;  1ZGP A;  4DKN A;  4H3L A;  3DQ4 A;  3PJ7 A;  3PFV A;  1XK4 C;  4PPJ A;  2YE0 A;  2KI4 C;  3UFZ A;  4W7A A;  2Y1N A;  4HSZ A;  3GL4 A;  2QAC A;  4IK4 A;  1KK8 B;  1Q4D A;  3TS5 C;  2WUR A;  2M49 B;  1HCJ A;  4KGE A;  3P28 A;  1RRO A;  5HZO A;  4GOB A;  4KF5 A;  3S05 A;  2B3Q A;  2VVI A;  1QXT A;  3BXB A;  5EXC I;  1CM1 A;  4Z4K A;  2QU1 A;  1OMD A;  4NQG A;  1M39 A;  2H61 C;  1YR5 A;  1LIN A;  4AOM A;  5H89 A;  1QAT A;  4BY5 A;  5HZS A;  2G3O A;  2O60 A;  1K9P A;  3TDI A;  4JPZ B;  1XFV O;  3GK1 A;  1QV1 A;  3SS0 A;  4H3M A;  3W1C A;  2EMO A;  3KEV A;  3I5F C;  1PAL A;  4W7C A;  4OJ0 A;  4EMQ A;  1J7Q A;  2G3D B;  4DXN A;  3VRP A;  1BU3 A;  2Q6P A;  4W6M A;  3IF7 A;  1B7T Y;  3D10 A;  2M97 A;  1IG5 A;  2IE2 A;  3DQH A;  5B8I B;  1Q80 A;  1L7Z A;  3M22 A;  2A4J A;  3A8R A;  2ZFD A;  1OOJ A;  2DOQ A;  1CMF A;  4OVN F;  1Q4A A;  3SSP A;  1KSO A;  2IS9 A;  2HCG A;  2WC8 A;  2K7O A;  4F0Z B;  4Q9W A;  1WLZ A;  3JTD B;  1SCV A;  1EME A;  4M2Q A;  2I2R E;  2LUC A;  4AQJ A;  1KQM C;  1DJG A;  1YHG A;  3G9A A;  2JZI A;  1ZGQ A;  4IK1 A;  1NX0 A;  3BUM B;  1WY9 A;  2H9W A;  2K2F A;  2KFF A;  2QLG A;  1OZO A;  3OB2 B;  1SRA A;  2O5G A;  3WLD A;  1QX5 B;  1ZUX A;  1CMG A;  2O29 A;  1IQ5 A;  2L2E A;  1QX7 A;  2LHI A;  4B30 B;  1LVC D;  2JQ6 A;  3CZT X;  2FZU A;  4ICB A;  5DPH A;  3CWG A;  3CD1 A;  1K9K A;  5FVF A;  2WND A;  3LF4 B;  2DUE A;  5DTL A;  3O2P A;  1DMO A;  1XFY O;  4C0L A;  3EKJ A;  2QPT A;  4DXP A;  2KSP A;  4JFG A;  4JGE A;  4ORC B;  1CB1 A;  4IL1 A;  3SVU A;  3SVD A;  1EMM A;  1L2O C;  4LJC A;  4KW8 A;  1KK7 Y;  1CNP A;  4H47 A;  1DJI A;  3OGO A;  2PMY A;  3BYA A;  3OX6 A;  2BE6 A;  5HKY A;  4CLN A;  4W6O A;  1NIW A;  3BUX B;  4YI8 A;  3GJ2 A;  3BQ3 A;  2NZ0 A;  1OZS A;  4PPL A;  2ZO7 A;  2HRS A;  4LW5 A;  3V3D A;  2M8U A;  3U8A A;  1QAS A;  2BL0 C;  2MBX A;  2PAL A;  1QX2 A;  2H5R A;  3IQQ A;  2LC5 A;  4CID A;  1SCM C;  5HKW A;  4GUK A;  1K9U A;  1NX1 A;  4W6A A;  3ZWH A;  4HQC A;  4W69 A;  4CFQ A;  2WHU A;  1PVA A;  3EK7 A;  1SW8 A;  4IK3 A;  3LK0 A;  3NT9 A;  2BTJ A;  1JFK A;  2CT9 A;  1EMA A;  3NT3 A;  3OP0 A;  2G5Z B;  5EXU A;  1XFZ O;  1DGV A;  5HZT A;  5J2O A;  1JC0 A;  4RYS A;  2Y4Q A;  1DF0 A;  1JFJ A;  1K96 A;  3TUY B;  2O24 A;  4J8A A;  1JUO A;  3O77 A;  3EVU A;  5ER4 X;  1BOD A;  2CCM A;  1XQM A;  2AWM A;  1LXF C;  2JU0 A;  1WRK A;  4W6F A;  2ZN8 A;  2G2B A;  4PE0 A;  2PXS A;  1REC A;  1CFC A;  4I2Y A;  1QV0 A;  3AAJ A;  5AER A;  2JOJ A;  4W6R A;  3DQC A;  2LUX A;  1BR1 B;  5ER5 A;  1B8R A;  2F2P A;  1WDC B;  3SSK A;  3DVE A;  3SIB A;  4U2V A;  2FCE A;  3OB1 B;  1EG3 A;  1TOP A;  2L4H A;  2JC2 A;  1JBZ A;  4UPG A;  1UHJ A;  2A47 A;  5D69 A;  1UUS A;  2GW4 B;  1YTZ C;  2LVV A;  1EG4 A;  3ZUJ A;  3ZUF A;  1IH0 A;  4ZB1 A;  1Q4B A;  1F09 A;  4GGF C;  1ZOT B;  1A2X A;  3TDZ A;  3PJ5 A;  4P2Y B;  4EDS A;  2ZND A;  3DQE A;  2HQW A;  2YFP A;  2CXJ A;  1CFF A;  4W6U A;  2M9G A;  1IJ5 A;  4AS8 A;  2ZRS A;  3WNX B;  3ZUL A;  3WLC A;  4DXO A;  1PSB A;  4GPL B;  1JC2 A;  4Q9X A;  2K0J A;  3SVS A;  3CFA A;  2TN4 A;  1EML A;  2G6Y A;  2MAZ A;  1FI5 A;  1FPW A;  4C0J A;  4W6B A;  2ZMU A;  4MRX A;  5EB6 A;  2HET A;  4MSP A;  1F0B A;  2WOR A;  2M7N A;  4OKH A;  2AWJ A;  3KHE A;  1OSA A;  4W6N A;  3AAK A;  1LKJ A;  3NED A;  4NDD A;  3A8S A;  1YUS A;  4I5K A;  2JTZ A;  2VRG A;  3RLZ A;  2VAE A;  2HQK A;  2CTN A;  5DQB A;  2G9B A;  5K89 A;  5EJU A;  2VAD A;  3I5I C;  1BLQ A;  2K7D A;  2I7A A;  1GGZ A;  5FYX A;  3PIB A;  2JWW A;  1N0Y A;  5CPV A;  1S6I A;  2OGR A;  2PXW A;  1XFW O;  4BDU A;  3JVT B;  4IZN A;  2DD7 A;  4HQ9 A;  2HPS A;  4PHJ A;  1B9C A;  1QIW A;  2LM5 A;  3PN7 C;  5KSZ A;  3SG2 A;  2M3W A;  4PHM A;  3LVD A;  1GL4 A;  1EL4 A;  4USL A;  2ZRT A;  2WSO A;  3U0M A;  5DRG A;  1NCY A;  2H5P A;  1KK8 C;  5DY6 A;  2OKY A;  1LA3 A;  3TMR A;  1QYF A;  1KFU S;  3LK1 A;  3CR4 X;  1TNW A;  4PE1 A;  1N2D A;  1SL8 A;  1A03 A;  2POX A;  3DQD A;  2OTG C;  4N5X A;  5DPJ A;  3GK2 A;  1KCY A;  1YUU A;  2EC6 C;  3NSI A;  3CR5 X;  3NSK A;  3D0Y B;  1FBV A;  4YGB B;  1S26 D;  1IJ6 A;  4XL5 A;  2Z6X A;  4KF4 A;  2YDZ A;  2LCP A;  4D1E A;  1XO5 A;  2WCF A;  4W74 A;  4PHK A;  3U0L A;  1PK0 D;  3WXA A;  4R1E A;  3O6B A;  4KGF A;  3E5V A;  4ORA B;  2NCP A;  1F54 A;  2H6V A;  2LVJ A;  5DPG A;  3FIA A;  5DRF A;  1OE9 B;  1U5I A;  4EDO A;  2QLG B;  1ALW A;  2KYC A;  3DQK A;  3WCK A;  4ORB B;  5AEQ A;  4UTS A;  1MXL C;  3VHT B;  5DTZ A;  1HUY A;  1V1F A;  3JTD C;  3AKA A;  3SG5 A;  1XA9 A;  1XSS A;  4PFE A;  3PSR A;  3SSL A;  2MHH A;  4LJD C;  3FWC A;  4IK5 A;  4W6G A;  1J55 A;  1MHO A;  2BEC A;  5GQQ C;  2KI6 C;  3H1R A;  2BKH B;  4W6D A;  1S1E A;  4KPI A;  2Y0G A;  3M0W A;  3RM1 A;  3W1D A;  4DCK A;  2DUG A;  2QT2 A;  4GF6 B;  4W6C A;  1GJY A;  1CTR A;  2KFG A;  3LA1 A;  1AK8 A;  4ETO A;  4EN1 A;  1XFX O;  3LLE A;  1QS7 A;  4LQU A;  5BPJ A;  1AHR A;  1EXR A;  1R6P A;  5CSF A;  2PAS A;  3D0Y A;  2V4E C;  2BKI B;  1ODB A;  4ZCV A;  1XVJ A;  1SKT A;  3ICB A;  3DQI A;  4W7E A;  1Y6W A;  3EKH A;  4W6S A;  2H5Q A;  1RWY A;  1H8B A;  3DVK A;  3SIA A;  1DF0 B;  2KI4 B;  1SK6 D;  1PRW A;  3M24 A;  1EMC A;  3EVP A;  1CDL A;  3HX4 A;  4DXM A;  1RK9 A;  4KW4 A;  3TS5 B;  2C9I A;  1QY3 A;  4P1Q A;  1GQM A;  2JUL A;  2IOV A;  3DQ3 A;  3CD9 A;  4W6H A;  1F4O A;  2LLS A;  3DQA A;  2HF5 A;  2KNE A;  1KSM A;  3EK4 A;  2KI6 D;  1EMG A;  3VHT A;  4MBE A;  4XJK A;  3DQ6 A;  1OXF A;  2LE9 B;  2LMV A;  5EBJ A;  3ADF A;  1Z1Q A;  4W7R A;  2I18 A;  2BCA A;  2M1U A;  1KYS A;  3TUY C;  2ZNE A;  2AUC A;  2CNP A;  3VK1 A;  1ALV A;  2EMD A;  4MZJ A;  4HVF A;  1G4Y R;  1K8U A;  3P8U A;  3IR8 A;  3LS3 A;  4N1F A;  4MZL A;  2YE1 A;  1WDC C;  2HGD A;  2I94 A;  4GBA A;  3DQ2 A;  1F4Q A;  1YUT A;  4YGA A;  4DS7 A;  4PAL A;  1JC1 A;  2OTE A;  2KDH A;  2K2A A;  3DQO A;  2FCD A;  1M45 A;  4TZG A;  3SG6 A;  2Z1O A;  3KCS A;  1DTL A;  3SSV A;  1C7W A;  2A48 A;  4MVF A;  5PAL A;  2MLF C;  1TIZ A;  4PE7 A;  1AP4 A;  2JAD A;  1YX7 A;  1NP8 A;  2F3Z A;  4OGS A;  1KFU L;  1TNQ A;  1MYW A;  4MRY A;  4J88 A;  2LNK A;  2EHB A;  2R2I A;  4ZIO A;  4RTC A;  1QJT A;  1EJ3 A;  1IGV A;  1BOC A;  3DQL A;  1XK4 A;  2M7L A;  4ORN A;  3VRR A;  1IQ3 A;  2HFC A;  5HZU A;  3DVJ A;  2LMU A;  3VRQ A;  3OX5 A;  2PRU A;  1MOU A;  1M63 B;  4I5J A;  3I5H B;  2DUH A;  3ST0 A;  1EH2 A;  3VGO A;  2KGB C;  3BOW A;  1J7O A;  5BTT A;  2EGD A;  5LTQ A;  4M2O A;  2VVH A;  2A54 B;  2H61 A;  1UHK A;  4JWQ A;  4FQO A;  1OXE A;  1C4F A;  1W7U A;  4A4C A;  3DQ8 A;  1QVI Z;  3GB3 A;  1DJY A;  4MN0 A;  3AI4 A;  4GES B;  4TZA A;  4BY4 A;  5HGE A;  1AUI B;  3SSY A;  2K8M B;  2BCB A;  1CDN A;  4KF5 C;  1S6Z A;  5DTY A;  3ZTF A;  5F9G A;  4DRW A;  2QLE A;  1SR6 B;  2A56 B;  4OY4 A;  1NYA A;  3H1O A;  3JVT C;  3LF3 A;  1YHH A;  2BBN A;  1KWO B;  5F6T A;  3U0K A;  3RWA A;  1V1G A;  1EMK A;  3DPX A;  1CLL A;  4ZCU A;  2BCX A;  3DQM A;  2BL0 B;  2L50 A;  2JRF A;  5DU0 A;  2WHS A;  5EHU A;  2COL B;  1Y1A A;  5DKN A;  4KA9 A;  5TNC A;  1K2H A;  4HRE E;  3I5G C;  3NSL A;  3IP2 A;  1B47 A;  2RH7 A;  3DQ7 A;  2NLN A;  3SG7 A;  1R2U A;  4QJ5 B;  2KBM A;  5DTX A;  4U8D A;  1AJ4 A;  1F71 A;  5AXI A;  1U5I B;  1C7V A;  1H4U A;  2LVI A;  3DPW A;  4YGC B;  2LV7 A;  3TDU A;  2JXL A;  2KAX A;  4OQW A;  3NXA A;  5CSN A;  1WRZ A;  1EMB A;  1A75 B;  3GJ1 A;  2GW3 A;  5FVI A;  4C0K A;  3DQ1 A;  2M29 A;  3LVC A;  4NWS A;  2JPT A;  4XGY A;  1H4B A;  3SVE A;  1ZAC A;  2Y1M A;  4PPK A;  3VRO A;  4DIR A;  3UG0 A;  1NCX A;  2G16 B;  2JNF A;  4YI9 A; 
#chains in the Genus database with same CATH topology
 1LA0 A;  4I5N B;  4W6I A;  1XAE A;  1W7T A;  1M31 A;  4XVP A;  3OGN A;  4LJB A;  3DVM A;  1QYQ A;  2NCO A;  2OS8 B;  2AAO A;  3TMT A;  4FTG A;  2A50 B;  2KFH A;  2KAY A;  5EXB A;  2VVJ A;  2WOS A;  2G2S B;  5HLO A;  2F8P A;  4P5O E;  2DDD A;  2SCP A;  1UWO A;  1YHI A;  3LSA A;  4Q04 A;  2HQ8 A;  5IBW A;  5HL1 A;  1TNP A;  1QTX A;  2OKW A;  1J7P A;  2LVK A;  2ZKM X;  1CLM A;  5FVG A;  1RM9 A;  4IK9 A;  3OSR A;  1UHI A;  3CFF A;  3LL8 B;  4PCW A;  4W75 A;  4JF9 A;  1UIS A;  5I94 A;  2L98 A;  3DQN A;  2HGY A;  4KAG A;  5AQB B;  2KQY A;  2QZ0 A;  3AKO A;  4J89 A;  2OJK A;  3I19 A;  3SVR A;  2LP2 A;  5HW9 A;  3PJB A;  3BUW B;  3SG3 A;  2WCE A;  2BNX A;  3PAL A;  1PUL A;  3ST3 A;  1MF8 B;  1TRF A;  4ZFS A;  1Z2C B;  3KCT A;  4W7X A;  3OSQ A;  3SST A;  1Y1U A;  3AI5 A;  3U8C A;  3SS4 A;  2QEO A;  4DKM A;  4NDB A;  2LLT A;  1JWD A;  4HRG A;  5DPI A;  2RGI A;  2K7B A;  4L9M A;  4MLW A;  3O4Y A;  2HQZ A;  4P76 A;  2H2K A;  2HJO A;  3I5I B;  4JQ0 D;  3LVA A;  4PDZ A;  1Q73 A;  2AWK A;  1A75 A;  2OPO A;  3Q8I A;  4XYN A;  2GGZ A;  4GNK B;  1SYM A;  4KYN A;  4WQ3 A;  1XMZ A;  1ZFS A;  1JF2 A;  1OW4 A;  3CR2 A;  4Q7T A;  4W6L A;  4YRU A;  1S5G Z;  2WSN A;  1Q4E A;  3E3R A;  2D8N A;  1QIV A;  3U8P A;  1FW4 A;  3O78 A;  4XJK B;  4JC2 A;  3BXK A;  4W72 A;  1BF5 A;  1TNX A;  1NSH A;  2QLI A;  1GGX A;  4W76 A;  2WCK A;  2P70 A;  3S0D A;  4W6J A;  3H4S E;  4PHN A;  3BXA A;  1WLM A;  3CFH A;  4MEW A;  2WIQ A;  1QLK A;  3B88 A;  1JF0 A;  1KYP A;  2ICR A;  4E68 A;  2G6E A;  3A4U B;  2M0R A;  3EK8 A;  4TNC A;  3C1V A;  1RFJ A;  3IVT A;  3L47 A;  1CDM A;  2OTG B;  2G6X A;  2PVB A;  2KHN A;  2P4M A;  2EC6 B;  2Q91 A;  3SJS A;  1YZW A;  3R1V A;  4GGF A;  3SSH A;  2F2O A;  3ZNI A;  4KW9 A;  1X02 A;  3BFB A;  4HRH A;  4GGN A;  1K95 A;  4W6K A;  2E6W A;  3SRY A;  2LLU A;  4IJ7 A;  2NXQ A;  2AWL A;  5KU1 A;  1QYO A;  2DDC A;  2IB5 A;  2WCL A;  2HPW A;  2K61 A;  2GV5 A;  2F33 A;  2L5X B;  1UUR A;  3AKB A;  1YJF A;  4Q7R A;  1A4P A;  2AMI A;  4PT1 A;  4LQT A;  1Z1P A;  5LK4 A;  4R6B A;  5HKZ A;  4WRI A;  1NUB A;  3PLF B;  3KF9 A;  2JTT A;  3ST4 A;  4JKT A;  1UP5 A;  1CFD A;  1D1O A;  1FF1 A;  1BT6 A;  2FL1 A;  5I2O A;  1CFP A;  3QRX A;  2Q4U A;  1DGU A;  2KYF A;  1CDP A;  1ZGO A;  4DXQ A;  1G8I A;  1YRT B;  3D76 A;  4L1I A;  1C07 A;  3RWT A;  2JXC A;  3SG4 A;  1YX8 A;  3IQO A;  3CGL A;  2EMN A;  1S36 A;  3HCM A;  1JBA A;  1AJ5 A;  5LTR A;  5LTP A;  3NSO A;  3DYE A;  1UHH A;  3SS5 A;  3BOW B;  5BTT B;  1QVI Y;  3GK4 X;  1C3Z A;  5D7F A;  1OMV A;  1F70 A;  3EVV A;  2KOT A;  4YGE B;  3DQ9 A;  5KTG A;  1YRU B;  5FHV A;  2AH8 A;  2MA2 A;  1S6J A;  2Q57 A;  4MZK A;  1J1E A;  1Y1X A;  1BJF A;  1J7R A;  1PVB A;  1XA5 A;  3CLN A;  1NX3 A;  4OV2 A;  2A53 B;  3I5F B;  1JSA A;  3GOF A;  2AHA A;  3FWB A;  1W7J B;  1QWV A;  1ZMZ A;  3CB9 A;  5HLV A;  1MQ1 A;  3I5H C;  3V2L A;  1KFX S;  1HQV A;  3LCP C;  4YGD B;  2LAN A;  4JRB A;  1F8H A;  4JEO A;  3DQJ A;  2LMT A;  1CKK A;  2QLH A;  3K21 A;  2BAP A;  1TCO B;  3EVR A;  1KQV A;  4ZF4 A;  4XOW A;  4N1G A;  1DJH A;  3SVN A;  5J3X A;  2V4E B;  4QJ3 B;  1BMO A;  2OTB A;  5BQL A;  3CBE A;  2KGR A;  5I2Q A;  1DT7 B;  2BE4 A;  4H3N A;  2DUF A;  3SVC A;  1SR6 C;  2Z6Z A;  1KQM B;  1M46 A;  1MXE A;  4AR7 A;  3DF0 B;  2ARL A;  2L4I A;  2SAS A;  1KWO C;  1NCZ A;  2A52 B;  1S6C A;  3DD4 A;  2ISD A;  4OZD A;  3BUO B;  2PSR A;  1RMM A;  4W7F A;  3GEX A;  4H48 A;  3NF0 A;  1B7T Z;  2MLE C;  2JT8 A;  3CZ1 A;  5EB7 A;  4L12 A;  4ANJ A;  2IB6 A;  1SSE B;  2FWQ A;  4W6T A;  1EMF A;  1MUX A;  2ZMW A;  1BG1 A;  3DQF A;  5HBD A;  4Z4M A;  1GFL A;  1RTP 1;  1XFU O;  4L13 A;  3ED8 A;  3MGF A;  4LJD A;  3KO0 A;  2MJW B;  4XOV A;  4Q7U A;  3EG5 B;  3VIC A;  5G08 A;  1SL9 A;  4YBH B;  3CTN A;  1TTX A;  2Y5I A;  2ZO6 A;  1KYR A;  5DKQ A;  1K90 D;  3QME A;  3E5T A;  4W77 A;  1BR4 B;  1YJ2 A;  5EL2 A;  1L2O B;  2QEB A;  1B1G A;  2L0P A;  1GGW A;  2BBM A;  2LAP A;  1VRK A;  2GGM A;  3WHU B;  4OHS A;  1IWQ A;  4DUQ A;  5I2L A;  4B30 A;  3DPZ A;  1AVS A;  4CFR A;  2OS8 C;  3WHT B;  3PAT A;  1B4C A;  1DJX A;  3CZ0 A;  1IKU A;  4NDC A;  4AQI A;  3CGA A;  2ZN9 A;  2WIS A;  2V53 A;  1B8C A;  3PM8 A;  4IK8 A;  1SCM B;  1KP5 A;  1FI6 A;  5I8N A;  1K93 D;  3BJH A;  4QJ4 B;  1CV7 A;  1JBY A;  2V4E A;  2Z6Y A;  1N65 A;  5HYD A;  1NX2 A;  2JT0 A;  5H88 A;  1SY9 A;  1ZUZ A;  3R1P A;  1YVH A;  5FI6 A;  4I5L B;  2K7C A;  3KPX A;  1QLS A;  1KK7 Z;  3E5W A;  1RJV A;  1SNL A;  1Q4C A;  3DF0 A;  2P6B B;  1S5G Y;  1S3P A;  5CSI A;  4EUL A;  4W7D A;  1B9A A;  1YVL A;  4DXI A;  1NWD A;  3OHM B;  3S0F A;  5T3I A;  1J1D A;  1TCF A;  4A4B A;  1CM4 A;  5H87 A;  3BXC A;  3F45 A;  3B87 A;  2DD9 A;  1QXP A;  5FI2 A;  3SV5 A;  4HQ8 A;  5KTY A;  4FQT A;  1DJW A;  4RYW A;  3N7H A;  1H6R A;  1YUR A;  1MR8 A;  4CPV A;  3FS7 A;  5AAN A;  1W7S A;  4W73 A;  1YFP A;  4W6P A;  1OQP A;  3NEZ A;  3TZ1 A;  2JT3 A;  2C9J A;  2WHT A;  4ZF5 A;  1W9Z A;  2CBL A;  5DQM A;  2QRF A;  2VZX A;  2L51 A;  2H8Q A;  3ST2 A;  1G33 A;  1DC1 A;  1BFP A;  1NPQ A;  1F55 A;  3PM2 A;  5JOL A;  3DQU A;  3B86 A;  3SVO A;  1PSR A;  2KQ6 A;  4PE4 A;  3O4X A;  4HE4 A;  4ZF3 A;  2WCB A;  4ZBL A;  2DUI A;  2B3P A;  4JD9 A;  1OMR A;  3MSE B;  1RMP A;  4M2P A;  3S0G A;  4ZIN A;  2LP3 A;  3I5G B;  4N3D A;  3FE8 A;  2LHL A;  1RRX A;  1E8A A;  5CSJ A;  1W7I B;  1G7K A;  1B8L A;  2JNX A;  2A46 A;  1SPY A;  5DKR A;  1OXD A;  3CZ2 A;  2PQL A;  1MOV A;  1A29 A;  1XYD A;  1SL7 A;  1HT9 A;  1OOI X;  4GAO A;  2FOT A;  3B6X A;  2KBI A;  1C3Y A;  2E30 A;  3BUN B;  5JJG A;  2JPO A;  2M1K B;  1DJZ A;  2F3Y A;  1IRJ A;  1TN4 A;  2B1U A;  4GFT A;  4OCI A;  1KFX L;  3BX9 A;  3DQ5 A;  1CLB A;  2FJU B;  2MRD A;  1Y0V H;  1SMG A;  1K94 A;  2O2B A;  4WQ2 A;  5AFP A;  2KAV A;  4R6D A;  4KEX A;  1SBJ A;  1RMO A;  4B5Y A;  1WRL A;  3R72 A;  3CS1 A;  2H5O A;  1DVI A;  2GX2 A;  3S0A A;  3K1K A;  1MWN A;  4OR9 B;  5BT0 A;  3VRN A;  2GX0 A;  3U0N A;  1UHN A;  3SVB A;  3PN7 B;  1ZGP A;  4DKN A;  4H3L A;  4F7F A;  3DQ4 A;  3PJ7 A;  3PFV A;  1XK4 C;  4PPJ A;  2YE0 A;  2KI4 C;  3UFZ A;  4W7A A;  2Y1N A;  4HSZ A;  3GL4 A;  2WCJ A;  2QAC A;  4IK4 A;  1KK8 B;  1Q4D A;  3TS5 C;  2WUR A;  3BFA A;  2M49 B;  1HCJ A;  4KGE A;  3P28 A;  1RRO A;  5HZO A;  4GOB A;  4KF5 A;  3S05 A;  2B3Q A;  2VVI A;  1QXT A;  3BXB A;  5EXC I;  1CM1 A;  4Z4K A;  2QU1 A;  1OMD A;  4NQG A;  1M39 A;  2H61 C;  1YR5 A;  1LIN A;  4AOM A;  5H89 A;  1QAT A;  4BY5 A;  5HZS A;  2G3O A;  2O60 A;  1K9P A;  3TDI A;  4JPZ B;  1XFV O;  3GK1 A;  1QV1 A;  3SS0 A;  4H3M A;  3W1C A;  2EMO A;  3KEV A;  3I5F C;  1PAL A;  4W7C A;  3VB1 A;  4OJ0 A;  4EMQ A;  1J7Q A;  2G3D B;  4DXN A;  3VRP A;  1BU3 A;  2Q6P A;  4W6M A;  3IF7 A;  1B7T Y;  3D10 A;  2M97 A;  1IG5 A;  2IE2 A;  3DQH A;  5B8I B;  3D73 A;  1Q80 A;  3FE6 A;  1L7Z A;  3M22 A;  2A4J A;  3K1E A;  3A8R A;  2ZFD A;  1OOJ A;  2WC6 A;  2DOQ A;  1CMF A;  4OVN F;  1Q4A A;  3SSP A;  1KSO A;  2IS9 A;  2HCG A;  2WC8 A;  2K7O A;  4F0Z B;  4Q9W A;  1WLZ A;  3JTD B;  1SCV A;  1EME A;  4M2Q A;  2I2R E;  2LUC A;  4AQJ A;  1KQM C;  1DJG A;  1YHG A;  3G9A A;  2JZI A;  1ZGQ A;  3S0B A;  4IK1 A;  1NX0 A;  3BUM B;  1WY9 A;  2H8V A;  2H9W A;  2K2F A;  2KFF A;  2QLG A;  2ERB A;  1OZO A;  3OB2 B;  1SRA A;  2O5G A;  3WLD A;  1QX5 B;  1ZUX A;  1CMG A;  2O29 A;  1IQ5 A;  2L2E A;  1QX7 A;  2LHI A;  4B30 B;  1LVC D;  2JQ6 A;  2YGU A;  3CZT X;  2FZU A;  4ICB A;  5DPH A;  3CWG A;  3CD1 A;  1K9K A;  5FVF A;  2WND A;  2QDI A;  3LF4 B;  2DUE A;  5DTL A;  3O2P A;  1DMO A;  1XFY O;  4C0L A;  3EKJ A;  2QPT A;  4DXP A;  3RZS A;  2KSP A;  4JFG A;  4JGE A;  4ORC B;  1CB1 A;  4IL1 A;  3CYZ A;  3SVU A;  3SVD A;  1EMM A;  1L2O C;  4LJC A;  4KW8 A;  3BFH A;  1KK7 Y;  1CNP A;  4H47 A;  1DJI A;  3OGO A;  2PMY A;  3BYA A;  3OX6 A;  2BE6 A;  5HKY A;  4CLN A;  4W6O A;  1NIW A;  3BUX B;  4YI8 A;  3GJ2 A;  3BQ3 A;  2NZ0 A;  2FJY A;  4INW A;  1OZS A;  4PPL A;  2ZO7 A;  3D74 A;  2HRS A;  4LW5 A;  3V3D A;  2M8U A;  3U8A A;  1QAS A;  2BL0 C;  1IIO A;  2MBX A;  3PJI A;  2PAL A;  1QX2 A;  2H5R A;  3IQQ A;  2LC5 A;  4CID A;  1SCM C;  5HKW A;  4GUK A;  1K9U A;  1NX1 A;  4W6A A;  3ZWH A;  4HQC A;  4W69 A;  4CFQ A;  2WHU A;  1PVA A;  3EK7 A;  1SW8 A;  4IK3 A;  3D75 A;  3LK0 A;  3NT9 A;  2BTJ A;  1JFK A;  2CT9 A;  1EMA A;  3NT3 A;  3OP0 A;  2G5Z B;  5EXU A;  1XFZ O;  1DEK A;  1DGV A;  5HZT A;  5J2O A;  1JC0 A;  4RYS A;  1XFR A;  2Y4Q A;  1DF0 A;  1JFJ A;  1K96 A;  3TUY B;  2O24 A;  4J8A A;  1JUO A;  3S0E A;  3O77 A;  5FI7 A;  3EVU A;  5ER4 X;  1BOD A;  2CCM A;  1XQM A;  2AWM A;  1LXF C;  2JU0 A;  1WRK A;  4W6F A;  2ZN8 A;  2G2B A;  4PE0 A;  2PXS A;  1REC A;  1CFC A;  4I2Y A;  1QV0 A;  3AAJ A;  5AER A;  2JOJ A;  4W6R A;  3DQC A;  2LUX A;  1BR1 B;  5ER5 A;  1B8R A;  2F2P A;  1WDC B;  3SSK A;  3DVE A;  3SIB A;  4U2V A;  2FCE A;  3OB1 B;  1EG3 A;  1TOP A;  1OOH A;  2K60 A;  2L4H A;  2JC2 A;  1JBZ A;  4UPG A;  1UHJ A;  3D77 A;  2A47 A;  5D69 A;  3DY9 A;  1UUS A;  2GW4 B;  2QEV A;  1YTZ C;  2LVV A;  2GTE A;  1EG4 A;  3ZUJ A;  3ZUF A;  1IH0 A;  4ZB1 A;  1OOG A;  1Q4B A;  1F09 A;  4GGF C;  1ZOT B;  1A2X A;  3TDZ A;  3PJ5 A;  4P2Y B;  4EDS A;  2ZND A;  3DQE A;  2WC5 A;  2HQW A;  2YFP A;  2CXJ A;  1CFF A;  4W6U A;  2M9G A;  1IJ5 A;  4AS8 A;  2ZRS A;  3WNX B;  3ZUL A;  1OOF A;  3WLC A;  4DXO A;  1PSB A;  1TUJ A;  4GPL B;  1JC2 A;  4Q9X A;  2K0J A;  3SVS A;  3CFA A;  2TN4 A;  1EML A;  2G6Y A;  2MAZ A;  1FI5 A;  1FPW A;  4C0J A;  2KLD A;  4W6B A;  2ZMU A;  4MRX A;  5EB6 A;  2HET A;  4MSP A;  1F0B A;  2WOR A;  2M7N A;  4OKH A;  2AWJ A;  3KHE A;  1OSA A;  4W6N A;  3D78 A;  3AAK A;  1LKJ A;  3NED A;  4NDD A;  3A8S A;  1YUS A;  4I5K A;  2JTZ A;  2VRG A;  3RLZ A;  2VAE A;  2HQK A;  2CTN A;  5DQB A;  2G9B A;  5K89 A;  5EJU A;  2VAD A;  3I5I C;  1BLQ A;  2K7D A;  1DQE A;  2I7A A;  1GGZ A;  5FYX A;  3PIB A;  2JWW A;  1N0Y A;  5CPV A;  1S6I A;  2OGR A;  2PXW A;  1XFW O;  4BDU A;  3JVT B;  4IZN A;  2DD7 A;  4HQ9 A;  2HPS A;  4PHJ A;  1B9C A;  1QIW A;  2LM5 A;  3PN7 C;  5KSZ A;  3SG2 A;  2M3W A;  4PHM A;  3LVD A;  1GL4 A;  1EL4 A;  4USL A;  2ZRT A;  2WSO A;  3U0M A;  5DRG A;  1NCY A;  2H5P A;  1KK8 C;  5DY6 A;  2OKY A;  1LA3 A;  3TMR A;  1QYF A;  1KFU S;  3LK1 A;  3CR4 X;  1TNW A;  4PE1 A;  1N2D A;  1SL8 A;  1A03 A;  2POX A;  3DQD A;  2OTG C;  2WCM A;  4N5X A;  5DPJ A;  3GK2 A;  1KCY A;  1YUU A;  2EC6 C;  3NSI A;  3CR5 X;  3NSK A;  3D0Y B;  1FBV A;  4YGB B;  1S26 D;  1IJ6 A;  4XL5 A;  2L2C A;  1ORG A;  2Z6X A;  4KF4 A;  2YDZ A;  2LCP A;  4D1E A;  1XO5 A;  2WCF A;  4W74 A;  4PHK A;  3U0L A;  1PK0 D;  3WXA A;  4R1E A;  3O6B A;  4KGF A;  3E5V A;  4ORA B;  2NCP A;  1F54 A;  2H6V A;  2LVJ A;  5DPG A;  3FIA A;  5DRF A;  1OE9 B;  1U5I A;  4EDO A;  2QLG B;  1ALW A;  2KYC A;  3DQK A;  3WCK A;  4ORB B;  5AEQ A;  4UTS A;  1MXL C;  3VHT B;  5DTZ A;  1HUY A;  1V1F A;  3SS3 A;  3JTD C;  3AKA A;  3SG5 A;  1XA9 A;  1XSS A;  4PFE A;  3PSR A;  3SSL A;  2MHH A;  4LJD C;  3FWC A;  1LS8 A;  4IK5 A;  4W6G A;  1J55 A;  1MHO A;  3UO9 A;  3DZT A;  4INX A;  2BEC A;  5GQQ C;  2KI6 C;  3H1R A;  2BKH B;  4W6D A;  1S1E A;  4KPI A;  2Y0G A;  3M0W A;  3RM1 A;  3W1D A;  4DCK A;  2DUG A;  2QT2 A;  4GF6 B;  2L5Y A;  4W6C A;  1GJY A;  1CTR A;  2KFG A;  3LA1 A;  1AK8 A;  4ETO A;  4EN1 A;  1XFX O;  3LLE A;  1QS7 A;  4LQU A;  5BPJ A;  1AHR A;  1EXR A;  1R6P A;  5CSF A;  2PAS A;  3D0Y A;  2V4E C;  2BKI B;  1TWO A;  1ODB A;  4ZCV A;  1XVJ A;  1SKT A;  2KLE A;  3L4A A;  3ICB A;  3DQI A;  4W7E A;  1Y6W A;  3EKH A;  4W6S A;  2H5Q A;  1RWY A;  1H8B A;  3DVK A;  3SIA A;  1DF0 B;  2KI4 B;  1SK6 D;  1PRW A;  3M24 A;  1EMC A;  3EVP A;  1CDL A;  3HX4 A;  4DXM A;  1RK9 A;  4KW4 A;  3TS5 B;  2C9I A;  1QY3 A;  4P1Q A;  1GQM A;  2JUL A;  2IOV A;  2P71 A;  3DQ3 A;  3CD9 A;  4W6H A;  1F4O A;  2LLS A;  3DQA A;  2HF5 A;  2KNE A;  1KSM A;  3EK4 A;  2KI6 D;  1EMG A;  3VHT A;  4MBE A;  4XJK A;  3DQ6 A;  1OXF A;  2LE9 B;  2LMV A;  5EBJ A;  3ADF A;  1DEL A;  1Z1Q A;  4W7R A;  5DIC A;  2I18 A;  2BCA A;  2M1U A;  1KYS A;  3TUY C;  2ZNE A;  2AUC A;  2CNP A;  3VK1 A;  1ALV A;  2EMD A;  4MZJ A;  4HVF A;  1G4Y R;  1K8U A;  3R1O A;  3P8U A;  3IR8 A;  3L4L A;  3LS3 A;  4N1F A;  4MZL A;  2YE1 A;  1WDC C;  2HGD A;  2I94 A;  4GBA A;  3DQ2 A;  1F4Q A;  1TUZ A;  1YUT A;  4YGA A;  1GM0 A;  4DS7 A;  4PAL A;  1JC1 A;  2OTE A;  2KDH A;  2K2A A;  3DQO A;  2FCD A;  1M45 A;  4TZG A;  3SG6 A;  2Z1O A;  3KCS A;  1DTL A;  1Z4H A;  3SSV A;  1C7W A;  2A48 A;  4MVF A;  5PAL A;  2MLF C;  1TIZ A;  4PE7 A;  3CAB A;  1AP4 A;  2JAD A;  1YX7 A;  1NP8 A;  2F3Z A;  4OGS A;  1KFU L;  1TNQ A;  1MYW A;  4MRY A;  4J88 A;  2LNK A;  2EHB A;  2R2I A;  4ZIO A;  4RTC A;  1QJT A;  1EJ3 A;  1IGV A;  1BOC A;  3DQL A;  1XK4 A;  2M7L A;  4ORN A;  2KPH A;  3VRR A;  1IQ3 A;  2HFC A;  5HZU A;  3DVJ A;  2LMU A;  3VRQ A;  3NHT A;  1T14 A;  3NHI A;  3OX5 A;  2PRU A;  1MOU A;  1M63 B;  4I5J A;  3I5H B;  2DUH A;  3ST0 A;  1EH2 A;  3VGO A;  2KGB C;  3BOW A;  1J7O A;  5BTT A;  2EGD A;  5LTQ A;  4M2O A;  2VVH A;  2A54 B;  2H61 A;  2WCH A;  1UHK A;  4JWQ A;  4FQO A;  1OXE A;  3B7A A;  1C4F A;  3UNW A;  1W7U A;  4A4C A;  3DQ8 A;  1QVI Z;  3GB3 A;  1DJY A;  4MN0 A;  3AI4 A;  4GES B;  4TZA A;  4BY4 A;  5HGE A;  1AUI B;  3SSY A;  2K8M B;  2BCB A;  1CDN A;  4KF5 C;  1S6Z A;  5DTY A;  3ZTF A;  5F9G A;  4DRW A;  2QLE A;  1SR6 B;  3FE9 A;  2A56 B;  3CDN A;  4OY4 A;  1NYA A;  3H1O A;  3JVT C;  3LF3 A;  1YHH A;  2BBN A;  1KWO B;  5F6T A;  3U0K A;  3RWA A;  1V1G A;  1EMK A;  3DPX A;  1CLL A;  4ZCU A;  2BCX A;  3DQM A;  2BL0 B;  2L50 A;  2JRF A;  5DU0 A;  2WHS A;  5EHU A;  2COL B;  1Y1A A;  5DKN A;  4KA9 A;  5TNC A;  1K2H A;  4HRE E;  3I5G C;  1P28 A;  3NSL A;  2PYQ A;  3IP2 A;  1B47 A;  2RH7 A;  3DQ7 A;  2NLN A;  2QEH A;  3SG7 A;  1R2U A;  3NGV A;  4QJ5 B;  2KBM A;  5DTX A;  4U8D A;  1AJ4 A;  1F71 A;  5AXI A;  1U5I B;  1C7V A;  1H4U A;  2LVI A;  3DPW A;  4YGC B;  2LV7 A;  3TDU A;  2JXL A;  2KAX A;  4OQW A;  3NXA A;  5CSN A;  1WRZ A;  1EMB A;  1A75 B;  3GJ1 A;  2GW3 A;  5FVI A;  4C0K A;  3DQ1 A;  2M29 A;  3LVC A;  4NWS A;  2JPT A;  5D3O A;  4XGY A;  3DXL A;  1H4B A;  3SVE A;  1ZAC A;  2Y1M A;  4PPK A;  3VRO A;  4DIR A;  3UG0 A;  1NCX A;  2G16 B;  2JNF A;  3OBV A;  4YI9 A; 
#chains in the Genus database with same CATH homology
 1LA0 A;  4I5N B;  4W6I A;  1XAE A;  1W7T A;  1M31 A;  4XVP A;  4LJB A;  3DVM A;  1QYQ A;  2NCO A;  2OS8 B;  2AAO A;  3TMT A;  4FTG A;  2A50 B;  2KFH A;  2KAY A;  5EXB A;  2VVJ A;  2WOS A;  2G2S B;  5HLO A;  2F8P A;  4P5O E;  2DDD A;  2SCP A;  1UWO A;  1YHI A;  3LSA A;  4Q04 A;  2HQ8 A;  5IBW A;  1TNP A;  1QTX A;  2OKW A;  1J7P A;  2LVK A;  2ZKM X;  1CLM A;  5FVG A;  1RM9 A;  4IK9 A;  3OSR A;  1UHI A;  3CFF A;  3LL8 B;  4PCW A;  4W75 A;  4JF9 A;  1UIS A;  2L98 A;  3DQN A;  2HGY A;  4KAG A;  5AQB B;  2KQY A;  2QZ0 A;  3AKO A;  4J89 A;  2OJK A;  3I19 A;  3SVR A;  2LP2 A;  5HW9 A;  3PJB A;  3BUW B;  3SG3 A;  2WCE A;  3PAL A;  1PUL A;  3ST3 A;  1MF8 B;  1TRF A;  4ZFS A;  3KCT A;  4W7X A;  3OSQ A;  3SST A;  1Y1U A;  3AI5 A;  3U8C A;  4DKM A;  4NDB A;  2LLT A;  1JWD A;  4HRG A;  5DPI A;  2RGI A;  2K7B A;  4L9M A;  4MLW A;  3O4Y A;  2HQZ A;  4P76 A;  2H2K A;  2HJO A;  3I5I B;  4JQ0 D;  3LVA A;  4PDZ A;  1Q73 A;  2AWK A;  1A75 A;  2OPO A;  4XYN A;  2GGZ A;  4GNK B;  1SYM A;  4WQ3 A;  1XMZ A;  1ZFS A;  1JF2 A;  4Q7T A;  3CR2 A;  4W6L A;  4YRU A;  1S5G Z;  2WSN A;  1Q4E A;  3E3R A;  2D8N A;  1QIV A;  3U8P A;  1FW4 A;  3O78 A;  4XJK B;  4JC2 A;  3BXK A;  4W72 A;  1BF5 A;  1TNX A;  1NSH A;  2QLI A;  1GGX A;  4W76 A;  4W6J A;  3H4S E;  4PHN A;  3BXA A;  1WLM A;  3CFH A;  4MEW A;  2WIQ A;  1QLK A;  1JF0 A;  1KYP A;  2ICR A;  4E68 A;  2G6E A;  3A4U B;  2M0R A;  3EK8 A;  4TNC A;  3C1V A;  1RFJ A;  1CDM A;  2OTG B;  2G6X A;  2PVB A;  2KHN A;  2P4M A;  2EC6 B;  2Q91 A;  3SJS A;  1YZW A;  4GGF A;  3SSH A;  2F2O A;  3ZNI A;  4KW9 A;  1X02 A;  4HRH A;  4GGN A;  1K95 A;  4W6K A;  2E6W A;  3SRY A;  2LLU A;  2NXQ A;  2AWL A;  5KU1 A;  1QYO A;  2DDC A;  2IB5 A;  2HPW A;  2K61 A;  2GV5 A;  2F33 A;  2L5X B;  1UUR A;  3AKB A;  1YJF A;  4Q7R A;  1A4P A;  2AMI A;  4LQT A;  1Z1P A;  5LK4 A;  4R6B A;  5HKZ A;  4WRI A;  1NUB A;  3PLF B;  3KF9 A;  2JTT A;  3ST4 A;  1UP5 A;  1CFD A;  1D1O A;  1FF1 A;  1BT6 A;  2FL1 A;  5I2O A;  1CFP A;  3QRX A;  2Q4U A;  1DGU A;  2KYF A;  1CDP A;  1ZGO A;  4DXQ A;  1G8I A;  1YRT B;  4L1I A;  1C07 A;  3RWT A;  2JXC A;  3SG4 A;  1YX8 A;  3IQO A;  3CGL A;  2EMN A;  1S36 A;  3HCM A;  1JBA A;  1AJ5 A;  5LTR A;  5LTP A;  3NSO A;  1UHH A;  3BOW B;  5BTT B;  1QVI Y;  3GK4 X;  5D7F A;  1OMV A;  1F70 A;  3EVV A;  2KOT A;  4YGE B;  3DQ9 A;  5KTG A;  1YRU B;  5FHV A;  2AH8 A;  2MA2 A;  1S6J A;  2Q57 A;  4MZK A;  1J1E A;  1Y1X A;  1BJF A;  1J7R A;  1PVB A;  1XA5 A;  3CLN A;  1NX3 A;  4OV2 A;  2A53 B;  3I5F B;  1JSA A;  3GOF A;  2AHA A;  3FWB A;  1W7J B;  1ZMZ A;  3CB9 A;  5HLV A;  1MQ1 A;  3I5H C;  1KFX S;  1HQV A;  3LCP C;  4YGD B;  2LAN A;  4JRB A;  1F8H A;  4JEO A;  3DQJ A;  2LMT A;  1CKK A;  2QLH A;  3K21 A;  1TCO B;  3EVR A;  1KQV A;  4ZF4 A;  4XOW A;  4N1G A;  1DJH A;  3SVN A;  5J3X A;  2V4E B;  4QJ3 B;  1BMO A;  2OTB A;  5BQL A;  3CBE A;  2KGR A;  5I2Q A;  1DT7 B;  2BE4 A;  4H3N A;  2DUF A;  3SVC A;  1SR6 C;  2Z6Z A;  1KQM B;  1M46 A;  1MXE A;  4AR7 A;  3DF0 B;  2ARL A;  2L4I A;  2SAS A;  1KWO C;  1NCZ A;  2A52 B;  1S6C A;  3DD4 A;  2ISD A;  3BUO B;  2PSR A;  1RMM A;  4W7F A;  3GEX A;  4H48 A;  3NF0 A;  1B7T Z;  2MLE C;  2JT8 A;  5EB7 A;  4L12 A;  4ANJ A;  2IB6 A;  2FWQ A;  4W6T A;  1EMF A;  1MUX A;  2ZMW A;  1BG1 A;  3DQF A;  5HBD A;  4Z4M A;  1GFL A;  1RTP 1;  1XFU O;  4L13 A;  3ED8 A;  3MGF A;  4LJD A;  3KO0 A;  2MJW B;  4XOV A;  4Q7U A;  3VIC A;  5G08 A;  1SL9 A;  4YBH B;  3CTN A;  1TTX A;  2Y5I A;  2ZO6 A;  1KYR A;  5DKQ A;  1K90 D;  3E5T A;  4W77 A;  1BR4 B;  1YJ2 A;  1L2O B;  1B1G A;  2L0P A;  1GGW A;  2BBM A;  2LAP A;  1VRK A;  2GGM A;  3WHU B;  4OHS A;  1IWQ A;  4DUQ A;  5I2L A;  4B30 A;  3DPZ A;  1AVS A;  4CFR A;  2OS8 C;  3WHT B;  3PAT A;  1B4C A;  1DJX A;  1IKU A;  4NDC A;  4AQI A;  3CGA A;  2ZN9 A;  2WIS A;  2V53 A;  1B8C A;  3PM8 A;  4IK8 A;  1SCM B;  1KP5 A;  1FI6 A;  5I8N A;  1K93 D;  4QJ4 B;  1CV7 A;  1JBY A;  2V4E A;  2Z6Y A;  1N65 A;  5HYD A;  1NX2 A;  2JT0 A;  5H88 A;  1SY9 A;  1ZUZ A;  1YVH A;  4I5L B;  2K7C A;  3KPX A;  1QLS A;  1KK7 Z;  3E5W A;  1RJV A;  1SNL A;  1Q4C A;  3DF0 A;  2P6B B;  1S5G Y;  1S3P A;  5CSI A;  4EUL A;  4W7D A;  1B9A A;  1YVL A;  4DXI A;  1NWD A;  3OHM B;  5T3I A;  1J1D A;  1TCF A;  4A4B A;  1CM4 A;  5H87 A;  3BXC A;  3F45 A;  2DD9 A;  1QXP A;  3SV5 A;  4HQ8 A;  5KTY A;  1DJW A;  4RYW A;  1H6R A;  1YUR A;  1MR8 A;  4CPV A;  3FS7 A;  5AAN A;  1W7S A;  4W73 A;  1YFP A;  4W6P A;  1OQP A;  3NEZ A;  3TZ1 A;  2JT3 A;  2C9J A;  2WHT A;  4ZF5 A;  2CBL A;  5DQM A;  2QRF A;  2VZX A;  2L51 A;  2H8Q A;  3ST2 A;  1G33 A;  1BFP A;  1NPQ A;  1F55 A;  5JOL A;  3DQU A;  3SVO A;  1PSR A;  2KQ6 A;  4PE4 A;  4HE4 A;  4ZF3 A;  2WCB A;  4ZBL A;  2DUI A;  2B3P A;  1OMR A;  3MSE B;  1RMP A;  4M2P A;  4ZIN A;  2LP3 A;  3I5G B;  4N3D A;  2LHL A;  1RRX A;  1E8A A;  5CSJ A;  1W7I B;  1G7K A;  1B8L A;  2JNX A;  2A46 A;  1SPY A;  5DKR A;  1OXD A;  1MOV A;  1A29 A;  1XYD A;  1SL7 A;  1HT9 A;  4GAO A;  2FOT A;  2KBI A;  2E30 A;  3BUN B;  5JJG A;  2M1K B;  1DJZ A;  2F3Y A;  1IRJ A;  1TN4 A;  2B1U A;  4GFT A;  4OCI A;  1KFX L;  3BX9 A;  3DQ5 A;  1CLB A;  2FJU B;  2MRD A;  1Y0V H;  1SMG A;  1K94 A;  2O2B A;  4WQ2 A;  5AFP A;  2KAV A;  4R6D A;  4KEX A;  1SBJ A;  1RMO A;  4B5Y A;  1WRL A;  3CS1 A;  2H5O A;  1DVI A;  2GX2 A;  3K1K A;  1MWN A;  4OR9 B;  5BT0 A;  3VRN A;  2GX0 A;  3U0N A;  1UHN A;  3SVB A;  3PN7 B;  1ZGP A;  4DKN A;  4H3L A;  3DQ4 A;  3PJ7 A;  3PFV A;  1XK4 C;  4PPJ A;  2YE0 A;  2KI4 C;  3UFZ A;  4W7A A;  2Y1N A;  4HSZ A;  3GL4 A;  2QAC A;  4IK4 A;  1KK8 B;  1Q4D A;  3TS5 C;  2WUR A;  2M49 B;  1HCJ A;  4KGE A;  3P28 A;  1RRO A;  5HZO A;  4GOB A;  4KF5 A;  3S05 A;  2B3Q A;  2VVI A;  1QXT A;  3BXB A;  5EXC I;  1CM1 A;  4Z4K A;  2QU1 A;  1OMD A;  4NQG A;  1M39 A;  2H61 C;  1YR5 A;  1LIN A;  4AOM A;  5H89 A;  1QAT A;  4BY5 A;  5HZS A;  2G3O A;  2O60 A;  1K9P A;  3TDI A;  4JPZ B;  1XFV O;  3GK1 A;  1QV1 A;  3SS0 A;  4H3M A;  3W1C A;  2EMO A;  3KEV A;  3I5F C;  1PAL A;  4W7C A;  4OJ0 A;  4EMQ A;  1J7Q A;  2G3D B;  4DXN A;  3VRP A;  1BU3 A;  2Q6P A;  4W6M A;  3IF7 A;  1B7T Y;  3D10 A;  2M97 A;  1IG5 A;  2IE2 A;  3DQH A;  5B8I B;  1Q80 A;  1L7Z A;  3M22 A;  2A4J A;  3A8R A;  2ZFD A;  1OOJ A;  2DOQ A;  1CMF A;  4OVN F;  1Q4A A;  3SSP A;  1KSO A;  2IS9 A;  2HCG A;  2WC8 A;  2K7O A;  4F0Z B;  4Q9W A;  1WLZ A;  3JTD B;  1SCV A;  1EME A;  4M2Q A;  2I2R E;  2LUC A;  4AQJ A;  1KQM C;  1DJG A;  1YHG A;  3G9A A;  2JZI A;  1ZGQ A;  4IK1 A;  1NX0 A;  3BUM B;  1WY9 A;  2H9W A;  2K2F A;  2KFF A;  2QLG A;  1OZO A;  3OB2 B;  1SRA A;  2O5G A;  3WLD A;  1QX5 B;  1ZUX A;  1CMG A;  2O29 A;  1IQ5 A;  2L2E A;  1QX7 A;  2LHI A;  4B30 B;  1LVC D;  2JQ6 A;  3CZT X;  2FZU A;  4ICB A;  5DPH A;  3CWG A;  3CD1 A;  1K9K A;  5FVF A;  2WND A;  3LF4 B;  2DUE A;  5DTL A;  3O2P A;  1DMO A;  1XFY O;  4C0L A;  3EKJ A;  2QPT A;  4DXP A;  2KSP A;  4JFG A;  4JGE A;  4ORC B;  1CB1 A;  4IL1 A;  3SVU A;  3SVD A;  1EMM A;  1L2O C;  4LJC A;  4KW8 A;  1KK7 Y;  1CNP A;  4H47 A;  1DJI A;  3OGO A;  2PMY A;  3BYA A;  3OX6 A;  2BE6 A;  5HKY A;  4CLN A;  4W6O A;  1NIW A;  3BUX B;  4YI8 A;  3GJ2 A;  3BQ3 A;  2NZ0 A;  1OZS A;  4PPL A;  2ZO7 A;  2HRS A;  4LW5 A;  3V3D A;  2M8U A;  3U8A A;  1QAS A;  2BL0 C;  2MBX A;  2PAL A;  1QX2 A;  2H5R A;  3IQQ A;  2LC5 A;  4CID A;  1SCM C;  5HKW A;  4GUK A;  1K9U A;  1NX1 A;  4W6A A;  3ZWH A;  4HQC A;  4W69 A;  4CFQ A;  2WHU A;  1PVA A;  3EK7 A;  1SW8 A;  4IK3 A;  3LK0 A;  3NT9 A;  2BTJ A;  1JFK A;  2CT9 A;  1EMA A;  3NT3 A;  3OP0 A;  2G5Z B;  5EXU A;  1XFZ O;  1DGV A;  5HZT A;  5J2O A;  1JC0 A;  4RYS A;  2Y4Q A;  1DF0 A;  1JFJ A;  1K96 A;  3TUY B;  2O24 A;  4J8A A;  1JUO A;  3O77 A;  3EVU A;  5ER4 X;  1BOD A;  2CCM A;  1XQM A;  2AWM A;  1LXF C;  2JU0 A;  1WRK A;  4W6F A;  2ZN8 A;  2G2B A;  4PE0 A;  2PXS A;  1REC A;  1CFC A;  4I2Y A;  1QV0 A;  3AAJ A;  5AER A;  2JOJ A;  4W6R A;  3DQC A;  2LUX A;  1BR1 B;  5ER5 A;  1B8R A;  2F2P A;  1WDC B;  3SSK A;  3DVE A;  3SIB A;  4U2V A;  2FCE A;  3OB1 B;  1EG3 A;  1TOP A;  2L4H A;  2JC2 A;  1JBZ A;  4UPG A;  1UHJ A;  2A47 A;  5D69 A;  1UUS A;  2GW4 B;  1YTZ C;  2LVV A;  1EG4 A;  3ZUJ A;  3ZUF A;  1IH0 A;  4ZB1 A;  1Q4B A;  1F09 A;  4GGF C;  1ZOT B;  1A2X A;  3TDZ A;  3PJ5 A;  4P2Y B;  4EDS A;  2ZND A;  3DQE A;  2HQW A;  2YFP A;  2CXJ A;  1CFF A;  4W6U A;  2M9G A;  1IJ5 A;  4AS8 A;  2ZRS A;  3WNX B;  3ZUL A;  3WLC A;  4DXO A;  1PSB A;  4GPL B;  1JC2 A;  4Q9X A;  2K0J A;  3SVS A;  3CFA A;  2TN4 A;  1EML A;  2G6Y A;  2MAZ A;  1FI5 A;  1FPW A;  4C0J A;  4W6B A;  2ZMU A;  4MRX A;  5EB6 A;  2HET A;  4MSP A;  1F0B A;  2WOR A;  2M7N A;  4OKH A;  2AWJ A;  3KHE A;  1OSA A;  4W6N A;  3AAK A;  1LKJ A;  3NED A;  4NDD A;  3A8S A;  1YUS A;  4I5K A;  2JTZ A;  2VRG A;  3RLZ A;  2VAE A;  2HQK A;  2CTN A;  5DQB A;  2G9B A;  5K89 A;  5EJU A;  2VAD A;  3I5I C;  1BLQ A;  2K7D A;  2I7A A;  1GGZ A;  5FYX A;  3PIB A;  2JWW A;  1N0Y A;  5CPV A;  1S6I A;  2OGR A;  2PXW A;  1XFW O;  4BDU A;  3JVT B;  4IZN A;  2DD7 A;  4HQ9 A;  2HPS A;  4PHJ A;  1B9C A;  1QIW A;  2LM5 A;  3PN7 C;  5KSZ A;  3SG2 A;  2M3W A;  4PHM A;  3LVD A;  1GL4 A;  1EL4 A;  4USL A;  2ZRT A;  2WSO A;  3U0M A;  5DRG A;  1NCY A;  2H5P A;  1KK8 C;  5DY6 A;  2OKY A;  1LA3 A;  3TMR A;  1QYF A;  1KFU S;  3LK1 A;  3CR4 X;  1TNW A;  4PE1 A;  1N2D A;  1SL8 A;  1A03 A;  2POX A;  3DQD A;  2OTG C;  4N5X A;  5DPJ A;  3GK2 A;  1KCY A;  1YUU A;  2EC6 C;  3NSI A;  3CR5 X;  3NSK A;  3D0Y B;  1FBV A;  4YGB B;  1S26 D;  1IJ6 A;  4XL5 A;  2Z6X A;  4KF4 A;  2YDZ A;  2LCP A;  4D1E A;  1XO5 A;  2WCF A;  4W74 A;  4PHK A;  3U0L A;  1PK0 D;  3WXA A;  4R1E A;  3O6B A;  4KGF A;  3E5V A;  4ORA B;  2NCP A;  1F54 A;  2H6V A;  2LVJ A;  5DPG A;  3FIA A;  5DRF A;  1OE9 B;  1U5I A;  4EDO A;  2QLG B;  1ALW A;  2KYC A;  3DQK A;  3WCK A;  4ORB B;  5AEQ A;  4UTS A;  1MXL C;  3VHT B;  5DTZ A;  1HUY A;  1V1F A;  3JTD C;  3AKA A;  3SG5 A;  1XA9 A;  1XSS A;  4PFE A;  3PSR A;  3SSL A;  2MHH A;  4LJD C;  3FWC A;  4IK5 A;  4W6G A;  1J55 A;  1MHO A;  2BEC A;  5GQQ C;  2KI6 C;  3H1R A;  2BKH B;  4W6D A;  1S1E A;  4KPI A;  2Y0G A;  3M0W A;  3RM1 A;  3W1D A;  4DCK A;  2DUG A;  2QT2 A;  4GF6 B;  4W6C A;  1GJY A;  1CTR A;  2KFG A;  3LA1 A;  1AK8 A;  4ETO A;  4EN1 A;  1XFX O;  3LLE A;  1QS7 A;  4LQU A;  5BPJ A;  1AHR A;  1EXR A;  1R6P A;  5CSF A;  2PAS A;  3D0Y A;  2V4E C;  2BKI B;  1ODB A;  4ZCV A;  1XVJ A;  1SKT A;  3ICB A;  3DQI A;  4W7E A;  1Y6W A;  3EKH A;  4W6S A;  2H5Q A;  1RWY A;  1H8B A;  3DVK A;  3SIA A;  1DF0 B;  2KI4 B;  1SK6 D;  1PRW A;  3M24 A;  1EMC A;  3EVP A;  1CDL A;  3HX4 A;  4DXM A;  1RK9 A;  4KW4 A;  3TS5 B;  2C9I A;  1QY3 A;  4P1Q A;  1GQM A;  2JUL A;  2IOV A;  3DQ3 A;  3CD9 A;  4W6H A;  1F4O A;  2LLS A;  3DQA A;  2HF5 A;  2KNE A;  1KSM A;  3EK4 A;  2KI6 D;  1EMG A;  3VHT A;  4MBE A;  4XJK A;  3DQ6 A;  1OXF A;  2LE9 B;  2LMV A;  5EBJ A;  3ADF A;  1Z1Q A;  4W7R A;  2I18 A;  2BCA A;  2M1U A;  1KYS A;  3TUY C;  2ZNE A;  2AUC A;  2CNP A;  3VK1 A;  1ALV A;  2EMD A;  4MZJ A;  4HVF A;  1G4Y R;  1K8U A;  3P8U A;  3IR8 A;  3LS3 A;  4N1F A;  4MZL A;  2YE1 A;  1WDC C;  2HGD A;  2I94 A;  4GBA A;  3DQ2 A;  1F4Q A;  1YUT A;  4YGA A;  4DS7 A;  4PAL A;  1JC1 A;  2OTE A;  2KDH A;  2K2A A;  3DQO A;  2FCD A;  1M45 A;  4TZG A;  3SG6 A;  2Z1O A;  3KCS A;  1DTL A;  3SSV A;  1C7W A;  2A48 A;  4MVF A;  5PAL A;  2MLF C;  1TIZ A;  4PE7 A;  1AP4 A;  2JAD A;  1YX7 A;  1NP8 A;  2F3Z A;  4OGS A;  1KFU L;  1TNQ A;  1MYW A;  4MRY A;  4J88 A;  2LNK A;  2EHB A;  2R2I A;  4ZIO A;  4RTC A;  1QJT A;  1EJ3 A;  1IGV A;  1BOC A;  3DQL A;  1XK4 A;  2M7L A;  4ORN A;  3VRR A;  1IQ3 A;  2HFC A;  5HZU A;  3DVJ A;  2LMU A;  3VRQ A;  3OX5 A;  2PRU A;  1MOU A;  1M63 B;  4I5J A;  3I5H B;  2DUH A;  3ST0 A;  1EH2 A;  3VGO A;  2KGB C;  3BOW A;  1J7O A;  5BTT A;  2EGD A;  5LTQ A;  4M2O A;  2VVH A;  2A54 B;  2H61 A;  1UHK A;  4JWQ A;  4FQO A;  1OXE A;  1C4F A;  1W7U A;  4A4C A;  3DQ8 A;  1QVI Z;  3GB3 A;  1DJY A;  4MN0 A;  3AI4 A;  4GES B;  4TZA A;  4BY4 A;  5HGE A;  1AUI B;  3SSY A;  2K8M B;  2BCB A;  1CDN A;  4KF5 C;  1S6Z A;  5DTY A;  3ZTF A;  5F9G A;  4DRW A;  2QLE A;  1SR6 B;  2A56 B;  4OY4 A;  1NYA A;  3H1O A;  3JVT C;  3LF3 A;  1YHH A;  2BBN A;  1KWO B;  5F6T A;  3U0K A;  3RWA A;  1V1G A;  1EMK A;  3DPX A;  1CLL A;  4ZCU A;  2BCX A;  3DQM A;  2BL0 B;  2L50 A;  2JRF A;  5DU0 A;  2WHS A;  5EHU A;  2COL B;  1Y1A A;  5DKN A;  4KA9 A;  5TNC A;  1K2H A;  4HRE E;  3I5G C;  3NSL A;  3IP2 A;  1B47 A;  2RH7 A;  3DQ7 A;  2NLN A;  3SG7 A;  1R2U A;  4QJ5 B;  2KBM A;  5DTX A;  4U8D A;  1AJ4 A;  1F71 A;  5AXI A;  1U5I B;  1C7V A;  1H4U A;  2LVI A;  3DPW A;  4YGC B;  2LV7 A;  3TDU A;  2JXL A;  2KAX A;  4OQW A;  3NXA A;  5CSN A;  1WRZ A;  1EMB A;  1A75 B;  3GJ1 A;  2GW3 A;  5FVI A;  4C0K A;  3DQ1 A;  2M29 A;  3LVC A;  4NWS A;  2JPT A;  4XGY A;  1H4B A;  3SVE A;  1ZAC A;  2Y1M A;  4PPK A;  3VRO A;  4DIR A;  3UG0 A;  1NCX A;  2G16 B;  2JNF A;  4YI9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...