3EVRA

Crystal structure of calcium bound monomeric gcamp2
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
411
structure length
397
Chain Sequence
b'DSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 141
structure length 397
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evrA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evrA02
2YE1A 1DJGA 2GV5A 1DGVA 3KCTA 5DU0A 4UPGA 3VRPA 1QASA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 1ZFSA 4W76A 1WRZA 4ZCVA 3KF9A 3D10A 2WSNA 4ZF3A 2OGRA 2HQWA 5CSFA 2KQ6A 3SSHA 2LAPA 4HQ9A 4OY4A 1YRUB 3SG4A 1CMFA 2O60A 3FS7A 4W6OA 4GPLB 2VAEA 5J3XA 4N3DA 5DKQA 3CGLA 1K94A 3I19A 2E6WA 3JTDB 3SVEA 1JFKA 1XK4C 3ST3A 4PHNA 3E5WA 4QJ3B 1RMOA 1CV7A 1OQPA 1V1FA 1KWOC 3AKAA 3CFFA 5I2OA 3DQJA 5BQLA 5KSZA 2AWLA 1W7JB 3DQ1A 2K7DA 4C0JA 1TCFA 3C1VA 3DQ7A 3LVAA 3SIBA 5TNCA 2BBMA 1M45A 4IK1A 2BECA 1SCMB 1M39A 2BL0C 1KFXL 1PK0D 4W6CA 2AUCA 3AI5A 2NLNA 2GGMA 2I94A 4M2QA 3SVOA 1E8AA 4W6AA 2F33A 4JWQA 5HKWA 1YVHA 1S1EA 3SS0A 2BE6A 3ED8A 4ORCB 2LVIA 4DIRA 1F4OA 3PM8A 4EULA 3SRYA 2M49B 3SIAA 3BX9A 1ZUXA 2EMDA 1S6CA 1TNQA 2G3OA 1RMMA 2K0JA 3ZULA 2LUCA 2M3WA 4W6DA 1KK8B 5EXBA 1QXPA 3I5GB 4JFGA 4YGDB 1BF5A 4W72A 1EMKA 3DQ6A 3BUMB 3EK4A 2KI4C 2WCFA 4PPJA 2KGRA 1K9PA 2ZRTA 5T3IA 5HBDA 1MOUA 3U0NA 3LK0A 2IOVA 4XJKB 1XFZO 2DDDA 3WLCA 3BXAA 1NCZA 1EL4A 3DD4A 1YX7A 3P8UA 1KFUS 2ZO7A 3TDUA 2VZXA 1K93D 4OGSA 2VRGA 2PMYA 3AI4A 1XAEA 1NP8A 1ODBA 2NCOA 1CB1A 1RMPA 4JPZB 4Q9XA 4BDUA 1NX2A 4EMQA 1FW4A 1TTXA 1EMMA 5DTLA 3LL8B 1GQMA 4DKMA 3DQ5A 1TOPA 1B7TZ 1IKUA 3WCKA 1SL8A 2L50A 1BR1B 1Q4EA 5EXUA 1RTP1 2JTZA 3W1CA 2DDCA 1SW8A 2JT3A 4U8DA 3VRRA 1J1DA 4ORBB 1IJ5A 3H1RA 4DXQA 4TZGA 1XO5A 4BY5A 1AHRA 1Q4AA 1N0YA 4Q04A 2Y1MA 3SG3A 4PFEA 1GGXA 2LCPA 1Q4DA 1LKJA 2HQKA 2V53A 1YJFA 5CPVA 2HGDA 5PALA 4JQ0D 1XFVO 2A47A 1DF0B 2HFCA 2Y0GA 3EVUA 1YX8A 1TNXA 3W1DA 3BUWB 4DCKA 2WURA 4Q9WA 1S5GZ 3PJ5A 1DJIA 1UP5A 5FVFA 2IE2A 2ISDA 2PXWA 1YFPA 3KCSA 2CTNA 3AKOA 1BJFA 2PALA 3VHTB 3CR4X 1FBVA 3SSTA 2CCMA 5LK4A 1QX2A 2JXCA 1SY9A 3DQEA 2LHIA 1YUUA 2HJOA 4NWSA 5KTYA 4M2PA 1YUSA 5HLVA 2FJUB 4L13A 3WNXB 4EDOA 5DRFA 1CDPA 4QJ4B 2CXJA 3DQHA 5K89A 1PRWA 3K1KA 4DXIA 2MLEC 2JNXA 3SSLA 4KAGA 3DQKA 4OQWA 4PPLA 2MHHA 1QV0A 4MZLA 1A75A 1HCJA 1JF2A 3ZWHA 1YZWA 3BUNB 4H47A 2PASA 3PJBA 2QRFA 3PIBA 4W7FA 4D1EA 1Z1PA 4DXPA 2V4EA 1F54A 2K8MB 1BLQA 4PE4A 1UHIA 1MR8A 4WQ2A 5CSJA 1MQ1A 4ZINA 3TUYC 3U8AA 2H5QA 3I5HC 2AWMA 3VROA 1U5IB 2KAYA 2G6YA 4TZAA 3OX5A 1SKTA 2WORA 4W7DA 1BU3A 2SASA 1KYRA 1WRLA 4I5JA 1XFXO 5DY6A 3PSRA 5D7FA 2M9GA 4CPVA 2AAOA 1DTLA 5HGEA 1J7PA 3U0KA 1U5IA 5DPIA 2WHTA 1DJYA 1G7KA 1A29A 4GOBA 3DVJA 3CFAA 2MAZA 1XVJA 1M46A 1SR6B 5H87A 3IP2A 1ALVA 4QJ5B 1KFUL 2ZNDA 1QIVA 2KBIA 2O24A 2H5PA 4DKNA 4JC2A 4FQOA 2D8NA 1J7OA 5H89A 4AQIA 1Q73A 1JC0A 1OZSA 1UURA 4Z4MA 5DRGA 1PSBA 1CMGA 3BXBA 3O77A 3TS5C 3CGAA 2WISA 1V1GA 3U8PA 2G9BA 1TIZA 3CZTX 3E5TA 1WRKA 2OTEA 2QT2A 4MZKA 4OHSA 2E30A 3NT9A 1ZGQA 4LJBA 2A52B 3DQMA 2LM5A 1K9KA 2FCEA 4KF5A 2ZMUA 3SVRA 3LA1A 3NF0A 2ICRA 5AERA 3LK1A 4ICBA 1ZMZA 2KHNA 1PULA 1G4YR 3GJ1A 2B1UA 2AH8A 1L2OB 4MEWA 3PN7C 1RK9A 1J1EA 1YUTA 1S6ZA 1B47A 3JVTB 2L0PA 2KQYA 2JULA 2QPTA 2GW3A 4HQ8A 1RRXA 1RFJA 2WC8A 3IQQA 1MYWA 3O2PA 4W6FA 4USLA 2POXA 4PE7A 4GF6B 1QJTA 4HRHA 2M29A 3TDIA 3VRQA 2HCGA 1B1GA 2Y5IA 4DS7A 2F3ZA 4W6LA 4FTGA 4I5LB 4PHJA 4P1QA 2ZMWA 1EMAA 3NXAA 5H88A 1QX5B 3AAKA 4JGEA 5JOLA 1UHJA 1TNPA 3LS3A 1QV1A 2I18A 3NT3A 4PCWA 4MBEA 1Q4CA 1NX0A 1JC1A 1J55A 1C7VA 1PSRA 1SL9A 2ZRSA 2VADA 5B8IB 4U2VA 1CLBA 4W6PA 3WHTB 3AKBA 4YI9A 1LXFC 1OSAA 3DPZA 1KYPA 1QLSA 3DVEA 2ARLA 4P76A 3O6BA 1TRFA 2NXQA 2AHAA 1K95A 1SBJA 2RH7A 4PDZA 4Q7RA 2IB5A 1AUIB 2R2IA 4YGBB 5D69A 4PHKA 3U8CA 4LJDC 1QS7A 2Q57A 2EMOA 4GGNA 1G33A 3HCMA 1XMZA 5G08A 1YR5A 2FZUA 3SG2A 1CFPA 5ER5A 4XL5A 3CB9A 5AEQA 3LLEA 2LLUA 3SVSA 4W7CA 2C9JA 3LSAA 3FWBA 4KA9A 2ZKMX 2VVHA 2Z6XA 1KSOA 4W6NA 4YBHB 1YRTB 2Q4UA 2HQ8A 1J7QA 2PSRA 1NX1A 1KK8C 1DJXA 4MRXA 2QLEA 1JC2A 1MF8B 4MLWA 4NQGA 4IK5A 2H5OA 1YHGA 4W6KA 3LCPC 1BR4B 4C0LA 1FPWA 2HETA 3BXKA 1DT7B 1QVIZ 1JBYA 2O5GA 4DUQA 4ANJA 2KYCA 1LA0A 1OXEA 5GQQC 2KI4B 2Y4QA 3SVUA 3GK4X 1LA3A 3DF0B 1QATA 1JUOA 2EHBA 1DJWA 3U0MA 4IK3A 3PJ7A 4L12A 4ZIOA 3I5FC 1KK7Z 1CM4A 1IQ5A 1K96A 2BBNA 5I2LA 1IQ3A 1K90D 1UUSA 2Z6YA 1SL7A 3E5VA 4XJKA 3WHUB 1F70A 2EGDA 2EC6C 3SSPA 1BOCA 4XVPA 2L4HA 1MOVA 5BTTB 3UFZA 1W7UA 1X02A 1PVBA 4H48A 3I5IB 1EG4A 4RTCA 2ZNEA 3DF0A 4HSZA 2DUGA 2P6BB 1G8IA 5ER4X 2G2BA 3DQIA 2O2BA 4H3NA 1NCYA 5DTZA 1GGZA 1EXRA 2Z6ZA 3DQFA 3IR8A 5DQMA 2OKYA 1XA9A 3E3RA 4W6MA 2LLTA 4XOWA 4H3LA 5BTTA 4CLNA 2A48A 1NX3A 3ST2A 1CDLA 3VGOA 4IL1A 4KGFA 4B5YA 1W7SA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 5HZUA 1CNPA 1QYQA 2KI6D 2LVKA 2EMNA 3SV5A 1F55A 5AFPA 1A2XA 5AQBB 4CIDA 4M2OA 4L1IA 2JC2A 4MRYA 3DQ9A 2KFGA 5EBJA 1MXEA 3DPXA 4W74A 4DXMA 1DF0A 1RECA 4PHMA 4R1EA 4NDBA 3SSKA 2QZ0A 1YJ2A 2I2RE 1B4CA 1RROA 4CFRA 1CKKA 5EB6A 1HT9A 4R6DA 1M63B 2V4EC 2H2KA 2O29A 5FYXA 2AWJA 1D1OA 3CLNA 1ZACA 4MSPA 5HZTA 3CWGA 4XGYA 3OX6A 3WXAA 2OTBA 2LC5A 1S3PA 2BCBA 3VHTA 1BODA 2JQ6A 1WLMA 4Z4KA 2KYFA 4ORNA 4YI8A 3CFHA 3LVDA 3EKJA 2KNEA 3SG6A 4L9MA 1IH0A 1KFXS 2WIQA 3BXCA 4ZCUA 2L98A 3UG0A 4W6SA 2GGZA 2OTGC 3BOWB 5HLOA 1XFUO 1C7WA 3M0WA 2K61A 3FIAA 4PPKA 3ADFA 2NCPA 4NDCA 5DTYA 4YGAA 2DUHA 1EH2A 2SCPA 2DD7A 2HGYA 3RM1A 3TUYB 4W6TA 4OVNF 4ETOA 1WDCB 2G3DB 3DQNA 3WLDA 2IS9A 1LVCD 3TMTA 3OB1B 2CBLA 5HZSA 2PRUA 1Q80A 2QLIA 2ZN9A 3FWCA 1RJVA 1B8CA 2QU1A 1B8RA 1CLMA 1IJ6A 4CFQA 2LVVA 4MVFA 1H4BA 1JBAA 3MSEB 2FCDA 3DQDA 1IGVA 1OXFA 1UHNA 3LF4B 1JBZA 3KHEA 1YTZC 4WQ3A 4XOVA 1SMGA 4KF5C 4W6GA 4LW5A 2OS8B 3DQ2A 2K2FA 3DQOA 5J2OA 1DMOA 3U0LA 1MUXA 3NSKA 4GFTA 2KFHA 1NYAA 3HX4A 4F0ZB 2YE0A 3CS1A 2ZFDA 2WHUA 2G16B 1PALA 3DQAA 4J89A 5F9GA 2VVJA 3SSYA 1UISA 2TN4A 3DQ8A 5HKZA 1C07A 1XYDA 3GK2A 4IZNA 2A56B 3VICA 2VVIA 4HE4A 1ZGPA 3RWAA 2K7BA 2JADA 3A8SA 2CNPA 4EDSA 5CSIA 3DVMA 4N1FA 3AAJA 4ZFSA 1UWOA 5JJGA 3NEDA 1PVAA 1RM9A 1GGWA 4J8AA 3EKHA 3KO0A 2JPTA 4PE1A 2A54B 2HQZA 4GBAA 4KEXA 1CFCA 2JTTA 3PFVA 3V3DA 1NCXA 5I2QA 3VK1A 3JVTC 2G2SB 5DPJA 1GFLA 1KQMB 5HYDA 2KAXA 4I5NB 2WSOA 4I5KA 1AJ5A 2LLSA 1F8HA 5KU1A 3OB2B 3CD1A 1QYOA 1F71A 3PN7B 3QRXA 1BMOA 3EVVA 4YGEB 2MA2A 4MN0A 2ZN8A 1A03A 3LVCA 4ZB1A 2K2AA 3CR5X 3O4YA 2KAVA 2LMTA 1S26D 1SYMA 2JZIA 2BKHB 4BY4A 2Y1NA 1LINA 2JT8A 4P5OE 3BUXB 3NEZA 1F4QA 4R6BA 5HZOA 2FWQA 4LQTA 3JTDC 1YHHA 2H6VA 2H61A 2L5XB 2Q91A 5HW9A 1CFFA 1K8UA 3MGFA 1OE9B 2JU0A 1FF1A 3H1OA 1HQVA 1Z1QA 1H4UA 4DXNA 4W73A 4GNKB 3ST4A 3TZ1A 3TMRA 2IB6A 2K7CA 3A8RA 2H5RA 4GGFA 2B3PA 1KWOB 1ZUZA 2JOJA 1SCMC 5FHVA 2H9WA 5CSNA 3NSIA 3RWTA 3IF7A 1L7ZA 4W6RA 5IBWA 1CFDA 1EMBA 5DPHA 3SJSA 2QLGB 2RGIA 2A53B 4W69A 2AMIA 1AVSA 1BT6A 1W7IB 3DQUA 1B8LA 2BL0B 5I8NA 1W7TA 4AS8A 1KCYA 4W6IA 4GESB 1XSSA 4OJ0A 3CR2A 3M22A 1SPYA 1XK4A 4UTSA 1AP4A 5FVGA 2MBXA 3PALA 2KDHA 4J88A 2GX2A 1H8BA 2LVJA 2KBMA 2LV7A 1KYSA 3ZTFA 3OGOA 3PATA 4GAOA 3I5GC 3OSRA 1CTRA 2QLGA 5F6TA 2YDZA 5KTGA 1JSAA 1KQVA 2L4IA 3BUOB 2LNKA 1QLKA 4DXOA 4LJDA 3M24A 3GEXA 2YFPA 5AXIA 3NSLA 4HRGA 1BG1A 1NIWA 2C9IA 1Q4BA 2F8PA 1QY3A 5DKNA 4W6BA 1Y1AA 4I2YA 2M0RA 2L51A 2ZO6A 2QACA 3PLFB 3GL4A 3DQ4A 1B9AA 1HUYA 2JRFA 2M97A 1NSHA 1QYFA 2KI6C 1DJZA 5LTPA 1OMDA 4NDDA 2JWWA 1Y1XA 1BFPA 2DUIA 1EMCA 3RLZA 1YHIA 1ALWA 1NPQA 4W6UA 1XA5A 1RWYA 3DQCA 4KW9A 3K21A 1WY9A 1M31A 4N1GA 1OMRA 2PXSA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 3I5IC 2G6XA 2I7AA 1XQMA 2MRDA 2K7OA 1EG3A 4Q7UA 1Y0VH 3IQOA 4KPIA 4W6JA 4W75A 3TDZA 1OXDA 2LANA 4ZF5A 2M8UA 2EC6B 4OV2A 2MJWB 4KW8A 3BYAA 3SG7A 5DPGA 4HQCA 1ZGOA 3NSOA 1VRKA 1S6JA 2WOSA 4A4CA 3P28A 1NUBA 2OPOA 2BCXA 2OJKA 3OP0A 3ZUFA 3GK1A 1QXTA 5HKYA 1EMGA 2NZ0A 2HPWA 1TN4A 4N5XA 4PE0A 1GJYA 1SNLA 3GJ2A 4H3MA 1QVIY 2G6EA 2JNFA 1XFYO 3GB3A 3D0YB 2DUFA 1KP5A 4JF9A 1CDNA 4ZF4A 4AOMA 2HPSA 4TNCA 4GUKA 2COLB 3SVCA 4LJCA 2B3QA 1EMEA 2JT0A 1C4FA 2L2EA 1J7RA 1KK7Y 2Z1OA 1B7TY 4AR7A 3A4UB 4B30B 3D0YA 1A75B 2GX0A 1IWQA 1B9CA 3DQLA 3KEVA 2JXLA 3S05A 1A4PA 1DJHA 5AANA 1GL4A 3EVPA 1S6IA 2V4EB 4OR9B 4W7EA 4P2YB 4YRUA 3ST0A 1CDMA 4W7XA 1QIWA 4YGCB 4C0KA 5EHUA 1AK8A 2G5ZB 2DD9A 1H6RA 4W7RA 2GW4B 1EMLA 3CTNA 2LP3A 4B30A 1K2HA 1OMVA 2F2OA 2KFFA 2A50B 2A46A 2CT9A 2BCAA 3SVNA 1NWDA 1IRJA 1S5GY 2OKWA 4KF4A 1K9UA 1N2DA 4RYSA 2AWKA 1SCVA 2WCEA 1WLZA 4KGEA 1XFWO 4ORAB 2OTGB 3DPWA 5BT0A 2BTJA 3I5HB 1DGUA 1SRAA 1WDCC 3CD9A 1S36A 1AJ4A 1IG5A 4JEOA 4OKHA 4OCIA 1DVIA 2BKIB 3BOWA 2A4JA 4IK8A 3GOFA 3ICBA 2LUXA 3H4SE 1F0BA 1CLLA 4IK9A 4HVFA 4ZBLA 1OZOA 5DTXA 2M1KB 1YVLA 1Y1UA 5DQBA 3DVKA 1ZOTB 1JWDA 2Q6PA 2MLFC 3OSQA 1SR6C 3SSVA 5FVIA 1KSMA 5LTQA 1QX7A 1TCOB 2F2PA 2OS8C 3EVRA 2LE9B 3VRNA 3SVDA 5LTRA 2H8QA 2LP2A 1UHHA 2F3YA 3BQ3A 2HRSA 2LMUA 1JF0A 2HF5A 2P4MA 2WNDA 1F09A 5DKRA 4EN1A 4XYNA 1QTXA 1CM1A 4A4BA 4IK4A 3OHMB 4KW4A 4E68A 3F45A 1R6PA 2M7LA 2BE4A 2M7NA 3EK8A 4RYWA 1JFJA 3KPXA 5EB7A 1R2UA 4JRBA 3TS5B 2QLHA 1YURA 3SG5A 2WHSA 3EK7A 2DUEA 3O78A 4LQUA 1N65A 1L2OC 4PALA 1SK6D 4W6HA 4W77A 1EMFA 4Q7TA 2LMVA 3SVBA 1TNWA 1FI5A 3ZUJA 1KQMC 2KOTA 3LF3A 1MHOA 3ZNIA 4AQJA 3CBEA 3G9AA 5EJUA 3DQ3A 4HREE 2LHLA 4W7AA 2H61C 5EXCI 2KGBC 2FL1A 2WCBA 2KSPA 2M1UA 2DOQA
chains in the Genus database with same CATH superfamily
2YE1A 1DJGA 2GV5A 1DGVA 3KCTA 5DU0A 4UPGA 3VRPA 1QASA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 1ZFSA 3B87A 4W76A 1WRZA 4ZCVA 3KF9A 3D10A 2WSNA 4ZF3A 2OGRA 2HQWA 5CSFA 2KQ6A 3SSHA 2LAPA 4HQ9A 4OY4A 1YRUB 3SG4A 1CMFA 2O60A 3FS7A 4W6OA 4GPLB 2VAEA 5J3XA 4N3DA 5DKQA 3CGLA 1K94A 3I19A 2E6WA 3JTDB 3SVEA 1JFKA 1XK4C 3ST3A 3NHIA 4PHNA 3E5WA 4QJ3B 1RMOA 1CV7A 1OQPA 1V1FA 1KWOC 3AKAA 3CFFA 5I2OA 3DQJA 5BQLA 5KSZA 2AWLA 1W7JB 3DQ1A 2K7DA 1DELA 4C0JA 1TCFA 3C1VA 3DQ7A 3LVAA 3SIBA 5TNCA 1Z4HA 2BBMA 3DXLA 2PYQA 1M45A 4IK1A 2BECA 1SCMB 1M39A 2BL0C 1KFXL 1PK0D 4W6CA 2AUCA 3AI5A 2NLNA 2GGMA 2I94A 4M2QA 3SVOA 1E8AA 4W6AA 2F33A 4JWQA 5HKWA 1YVHA 1S1EA 3SS0A 2BE6A 3ED8A 4ORCB 2LVIA 4DIRA 1F4OA 3PM8A 4EULA 3CYZA 3SRYA 2M49B 3SIAA 3BX9A 1ZUXA 2EMDA 1S6CA 1TNQA 2G3OA 1RMMA 2K0JA 3ZULA 2LUCA 2M3WA 4W6DA 1KK8B 5EXBA 1QXPA 3I5GB 4JFGA 4YGDB 1BF5A 4W72A 1EMKA 3DQ6A 3BUMB 3EK4A 2KI4C 2WCFA 3DY9A 4PPJA 2KGRA 1K9PA 2ZRTA 5T3IA 5HBDA 1MOUA 3U0NA 3LK0A 2IOVA 4XJKB 3V2LA 1XFZO 2DDDA 3WLCA 2PQLA 3BXAA 1NCZA 1EL4A 3DD4A 1YX7A 3P8UA 1KFUS 2ZO7A 3TDUA 2VZXA 3PJIA 5D3OA 1K93D 4OGSA 2VRGA 2PMYA 3AI4A 1XAEA 1NP8A 1ODBA 2NCOA 1CB1A 1RMPA 4JPZB 4Q9XA 4BDUA 1NX2A 4EMQA 1FW4A 1TTXA 1EMMA 5DTLA 3LL8B 1GQMA 4DKMA 3DQ5A 1TOPA 1DQEA 1B7TZ 1IKUA 3WCKA 1SL8A 2L50A 1BR1B 1Q4EA 5EXUA 1RTP1 2JTZA 3W1CA 2DDCA 1GM0A 1SW8A 2JT3A 4U8DA 3VRRA 1J1DA 4ORBB 1IJ5A 3H1RA 4DXQA 4TZGA 1XO5A 4BY5A 1AHRA 1Q4AA 3NHTA 1N0YA 4Q04A 2Y1MA 3SG3A 4PFEA 1GGXA 2LCPA 1Q4DA 1LKJA 2HQKA 2V53A 1YJFA 5CPVA 2HGDA 5PALA 4JQ0D 1XFVO 2A47A 1DF0B 2HFCA 2Y0GA 3EVUA 1C3YA 1YX8A 1TNXA 3W1DA 3BUWB 3R1OA 4DCKA 2WURA 4Q9WA 1S5GZ 3PJ5A 1DJIA 2P70A 1UP5A 5FVFA 4JD9A 2IE2A 2P71A 2ISDA 2PXWA 1YFPA 3KCSA 3D73A 2CTNA 3AKOA 1BJFA 2PALA 3VHTB 3CR4X 1FBVA 3R1VA 3SSTA 2CCMA 5LK4A 1QX2A 2JXCA 1SY9A 3DQEA 2LHIA 1YUUA 2HJOA 4NWSA 5KTYA 4M2PA 1YUSA 5HLVA 2FJUB 4L13A 3WNXB 4EDOA 5DRFA 1CDPA 4QJ4B 2CXJA 3DQHA 5K89A 1PRWA 3K1KA 4DXIA 2MLEC 2JNXA 3CZ2A 3SSLA 4KAGA 3DQKA 4OQWA 4PPLA 2MHHA 2WC6A 1QV0A 4MZLA 1A75A 1HCJA 1JF2A 3ZWHA 1YZWA 3BUNB 4H47A 3VB1A 2PASA 3PJBA 2QRFA 3PIBA 1SSEB 4W7FA 4D1EA 1Z1PA 4DXPA 2V4EA 1F54A 2K8MB 1BLQA 4PE4A 1UHIA 1MR8A 2QEHA 4WQ2A 5CSJA 1MQ1A 4ZINA 3TUYC 3U8AA 2H5QA 3I5HC 2AWMA 3VROA 1U5IB 3QMEA 3EG5B 2KAYA 2G6YA 4TZAA 3OX5A 1SKTA 2WORA 4W7DA 1BU3A 2SASA 1KYRA 1WRLA 4I5JA 1XFXO 5DY6A 3PSRA 5D7FA 2M9GA 4CPVA 2AAOA 3CZ1A 1DTLA 5HGEA 1J7PA 3U0KA 1U5IA 5DPIA 2WHTA 1DJYA 1G7KA 1A29A 4GOBA 3DVJA 3CFAA 2MAZA 1XVJA 1M46A 1SR6B 5H87A 3IP2A 1ALVA 4QJ5B 1KFUL 2ZNDA 1QIVA 3D77A 2KBIA 2O24A 3B88A 2H5PA 4DKNA 4JC2A 4FQOA 2D8NA 1J7OA 5H89A 3L47A 4AQIA 1Q73A 1JC0A 1OZSA 1UURA 4Z4MA 5DRGA 1PSBA 4INXA 1CMGA 3BXBA 3O77A 3TS5C 3CGAA 1TWOA 2WISA 1V1GA 3U8PA 2G9BA 1TIZA 3CZTX 3E5TA 1WRKA 2OTEA 2QT2A 4MZKA 4OHSA 2E30A 3NT9A 1ZGQA 4LJBA 2A52B 1Z2CB 3DQMA 2LM5A 1K9KA 2FCEA 4KF5A 2ZMUA 3SVRA 3LA1A 3NF0A 2ICRA 5AERA 2KLEA 3LK1A 4ICBA 1ZMZA 2KHNA 1PULA 1G4YR 3GJ1A 2B1UA 2AH8A 1L2OB 4MEWA 3PN7C 1RK9A 1J1EA 1YUTA 1S6ZA 1B47A 3BJHA 3JVTB 2L0PA 2KQYA 2JULA 2QPTA 2GW3A 4HQ8A 1RRXA 1RFJA 2WC8A 3IQQA 1MYWA 3O2PA 4W6FA 4USLA 2POXA 4PE7A 4GF6B 1QJTA 4HRHA 2M29A 3TDIA 3VRQA 2HCGA 1B1GA 2Y5IA 4DS7A 2F3ZA 4W6LA 4FTGA 4I5LB 4PHJA 4P1QA 2ZMWA 1EMAA 3NXAA 5H88A 1QX5B 3L4LA 3AAKA 4JGEA 5JOLA 1UHJA 1TNPA 3LS3A 1QV1A 2I18A 3NT3A 4PCWA 4MBEA 1Q4CA 1NX0A 1JC1A 1J55A 1C7VA 1PSRA 1SL9A 2ZRSA 2VADA 1IIOA 5B8IB 4U2VA 1CLBA 4W6PA 3WHTB 3AKBA 4YI9A 1LXFC 1OSAA 3D76A 3DPZA 1KYPA 1QLSA 3DVEA 2ARLA 4P76A 2WCHA 3O6BA 1TRFA 2NXQA 2AHAA 1K95A 1SBJA 2RH7A 4PDZA 4Q7RA 2IB5A 1AUIB 2R2IA 4YGBB 5D69A 3IVTA 4PHKA 3U8CA 4KYNA 4LJDC 1QS7A 2Q57A 2EMOA 4GGNA 1G33A 3HCMA 1XMZA 5G08A 1YR5A 2FZUA 3SG2A 2H8VA 1CFPA 5ER5A 4XL5A 3CB9A 5AEQA 3LLEA 2LLUA 3CDNA 3SVSA 4W7CA 2C9JA 3LSAA 3FWBA 4KA9A 2ZKMX 2VVHA 2BNXA 1KSOA 2Z6XA 4W6NA 4YBHB 1YRTB 2Q4UA 2HQ8A 1J7QA 2PSRA 1NX1A 1KK8C 1DJXA 4MRXA 2QLEA 1JC2A 1MF8B 4MLWA 4NQGA 4IK5A 2H5OA 1YHGA 1OOIX 4W6KA 3LCPC 1BR4B 4C0LA 1FPWA 2HETA 3BXKA 1DT7B 1QVIZ 1JBYA 2O5GA 4DUQA 4F7FA 3S0DA 4ANJA 2KYCA 1LA0A 1OXEA 5GQQC 2KI4B 2Y4QA 3SVUA 2YGUA 3GK4X 1LA3A 5I94A 3DF0B 1QATA 1JUOA 2EHBA 1DJWA 3U0MA 4IK3A 3PJ7A 1XFRA 4L12A 4ZIOA 3I5FC 1KK7Z 1CM4A 1IQ5A 1K96A 2BBNA 5I2LA 1IQ3A 1K90D 1UUSA 2Z6YA 1SL7A 3E5VA 4XJKA 3WHUB 1F70A 2EGDA 2EC6C 3SSPA 1BOCA 4XVPA 2L4HA 1MOVA 5BTTB 3UFZA 1W7UA 1X02A 1PVBA 4H48A 3I5IB 1EG4A 4RTCA 2ZNEA 3DF0A 4HSZA 2DUGA 2P6BB 1G8IA 5ER4X 2G2BA 3DQIA 2O2BA 4H3NA 1NCYA 5DTZA 3S0FA 1GGZA 1EXRA 2Z6ZA 3DQFA 3IR8A 5DQMA 2OKYA 1XA9A 3E3RA 4W6MA 2LLTA 3OBVA 4XOWA 4H3LA 3CABA 3FE9A 5BTTA 4CLNA 2A48A 1NX3A 3ST2A 1CDLA 3VGOA 4IL1A 4KGFA 4B5YA 1W7SA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 5HZUA 1CNPA 1QYQA 2KI6D 2LVKA 2EMNA 3SV5A 1F55A 5AFPA 1A2XA 5AQBB 3B6XA 4CIDA 4M2OA 4L1IA 2JC2A 4MRYA 3DQ9A 2KFGA 5EBJA 1MXEA 3DPXA 4W74A 4DXMA 1DF0A 1RECA 4PHMA 4R1EA 4NDBA 3SSKA 2QZ0A 1YJ2A 1OOHA 2I2RE 1B4CA 1RROA 4CFRA 1CKKA 5EB6A 1HT9A 4R6DA 1M63B 2V4EC 2H2KA 2O29A 5FYXA 2AWJA 1D1OA 3CLNA 1ZACA 4MSPA 5HZTA 3CWGA 4XGYA 3OX6A 3WXAA 2OTBA 2LC5A 1S3PA 2BCBA 3VHTA 1BODA 2JQ6A 1WLMA 3D78A 4Z4KA 2KYFA 4ORNA 4YI8A 2JPOA 3CFHA 3LVDA 3EKJA 2KNEA 3SG6A 3CZ0A 4L9MA 1IH0A 2K60A 1KFXS 2WIQA 2L5YA 3BXCA 4ZCUA 2L98A 3UG0A 4W6SA 2GGZA 2OTGC 3BOWB 5HLOA 1XFUO 1C7WA 3M0WA 2K61A 3FIAA 4PPKA 3ADFA 2NCPA 4NDCA 5DTYA 5DICA 2WC5A 4YGAA 2DUHA 1TUZA 1EH2A 2SCPA 2DD7A 2HGYA 3RM1A 3TUYB 4W6TA 4OVNF 4ETOA 2WCJA 1WDCB 2G3DB 3DQNA 3WLDA 2IS9A 5FI6A 1LVCD 2BAPA 3TMTA 3OB1B 2CBLA 5HZSA 2PRUA 1Q80A 2QLIA 2ZN9A 3FWCA 1RJVA 1B8CA 2QU1A 1B8RA 1CLMA 1IJ6A 4CFQA 2LVVA 4MVFA 1H4BA 1JBAA 3MSEB 2FCDA 3DQDA 1IGVA 1OXFA 1UHNA 3LF4B 1JBZA 3KHEA 1YTZC 2WCLA 4WQ3A 4XOVA 1SMGA 4KF5C 3SS3A 4W6GA 4LW5A 1LS8A 2OS8B 3DQ2A 2K2FA 3DQOA 4PT1A 5J2OA 1DMOA 3U0LA 1MUXA 1QWVA 1T14A 3NSKA 4GFTA 2KFHA 1NYAA 3HX4A 4F0ZB 2YE0A 3CS1A 2ZFDA 2WHUA 2G16B 1PALA 3DQAA 4J89A 5F9GA 2VVJA 3SSYA 1UISA 2TN4A 3DQ8A 1C07A 5HKZA 1XYDA 3GK2A 3Q8IA 2A56B 4IZNA 3VICA 2VVIA 4HE4A 1ZGPA 3RWAA 2K7BA 2JADA 3A8SA 2CNPA 4EDSA 5CSIA 3DVMA 4N1FA 3AAJA 4ZFSA 1UWOA 5JJGA 3NEDA 1PVAA 1RM9A 1GGWA 4J8AA 3EKHA 3KO0A 2JPTA 4PE1A 2A54B 2HQZA 4GBAA 4KEXA 4OZDA 1CFCA 2JTTA 3PFVA 3V3DA 1NCXA 5I2QA 3VK1A 3JVTC 2G2SB 5DPJA 1GFLA 1KQMB 5HYDA 2KAXA 4I5NB 2WSOA 4I5KA 1AJ5A 2LLSA 1F8HA 5KU1A 3OB2B 3CD1A 1QYOA 1F71A 3PN7B 3QRXA 1BMOA 3R72A 3EVVA 3S0GA 4YGEB 2MA2A 4MN0A 1P28A 2ZN8A 1A03A 3LVCA 4ZB1A 2K2AA 3CR5X 3O4YA 2KAVA 2LMTA 2QEOA 3FE6A 1S26D 1SYMA 2JZIA 2BKHB 4BY4A 2Y1NA 1LINA 2JT8A 4P5OE 3BUXB 3NEZA 1F4QA 2QEBA 4R6BA 5FI2A 5HZOA 2FWQA 3OGNA 3JTDC 4LQTA 1YHHA 2H6VA 2H61A 2L5XB 2Q91A 5HW9A 1CFFA 1K8UA 3MGFA 1OE9B 2JU0A 1FF1A 3H1OA 1HQVA 1Z1QA 1H4UA 3BFHA 4DXNA 1OW4A 4W73A 4GNKB 3ST4A 3TZ1A 3TMRA 2IB6A 2K7CA 3A8RA 2L2CA 2H5RA 4GGFA 2B3PA 1KWOB 1ZUZA 2JOJA 1SCMC 5FHVA 3FE8A 2H9WA 5CSNA 3BFBA 3NSIA 3RWTA 3IF7A 2FJYA 1L7ZA 4W6RA 5IBWA 1CFDA 1EMBA 5DPHA 3SJSA 2QLGB 2RGIA 2A53B 4W69A 1DC1A 3K1EA 2AMIA 1AVSA 1BT6A 1W7IB 3DQUA 1B8LA 2BL0B 5I8NA 1W7TA 4AS8A 1KCYA 4W6IA 4GESB 1XSSA 4OJ0A 3CR2A 3M22A 1SPYA 1XK4A 4UTSA 1AP4A 3UO9A 5FVGA 3PM2A 2MBXA 3PALA 2KDHA 4J88A 2GX2A 1H8BA 2LVJA 2KBMA 2LV7A 1KYSA 3ZTFA 3OGOA 3PATA 4GAOA 3I5GC 3OSRA 4IJ7A 1CTRA 2QLGA 5F6TA 2YDZA 5KTGA 1JSAA 1KQVA 2L4IA 3BUOB 2LNKA 1QLKA 4DXOA 4LJDA 3M24A 3GEXA 2KPHA 2YFPA 5AXIA 3NSLA 4HRGA 1BG1A 1NIWA 2C9IA 1Q4BA 2F8PA 3B86A 1QY3A 5DKNA 4W6BA 1Y1AA 5FI7A 4I2YA 2M0RA 2L51A 2ZO6A 2QACA 3PLFB 3GL4A 2QEVA 3DQ4A 1B9AA 1HUYA 2JRFA 2M97A 1NSHA 1QYFA 2KI6C 1DJZA 5LTPA 3O4XA 1OMDA 1OOGA 4NDDA 2JWWA 1Y1XA 1BFPA 2DUIA 1EMCA 3RLZA 1YHIA 1ALWA 1NPQA 4W6UA 1XA5A 1RWYA 3DQCA 4KW9A 3K21A 1WY9A 1M31A 4N1GA 1OMRA 2PXSA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 3I5IC 2G6XA 2I7AA 1XQMA 2MRDA 2K7OA 1EG3A 4Q7UA 1Y0VH 3IQOA 4KPIA 4W6JA 4W75A 3TDZA 1OXDA 2LANA 4ZF5A 2M8UA 2EC6B 4OV2A 2MJWB 3UNWA 4KW8A 3BYAA 3SG7A 5DPGA 4HQCA 1ZGOA 3NSOA 1VRKA 1S6JA 2WOSA 4A4CA 3P28A 1NUBA 2OPOA 2BCXA 2OJKA 3OP0A 3ZUFA 3DZTA 3GK1A 1QXTA 5HKYA 1EMGA 2NZ0A 2HPWA 1TN4A 4N5XA 4PE0A 1GJYA 1SNLA 3GJ2A 4H3MA 1QVIY 2G6EA 2JNFA 1XFYO 1TUJA 3GB3A 3D0YB 2DUFA 1KP5A 4JF9A 1CDNA 4ZF4A 4AOMA 2HPSA 4TNCA 3R1PA 4GUKA 2COLB 3SVCA 4LJCA 2B3QA 4INWA 1EMEA 2JT0A 1C4FA 2L2EA 1W9ZA 1J7RA 1KK7Y 2Z1OA 1B7TY 4AR7A 3A4UB 4B30B 3D0YA 1A75B 2GX0A 1IWQA 1B9CA 3DQLA 3KEVA 2JXLA 3S05A 1A4PA 1DJHA 5AANA 1GL4A 3EVPA 1S6IA 2V4EB 1DEKA 4OR9B 4W7EA 4P2YB 4YRUA 3ST0A 1CDMA 4W7XA 1QIWA 4YGCB 4C0KA 5EHUA 2ERBA 1AK8A 2G5ZB 2DD9A 3SS5A 1H6RA 4W7RA 2GW4B 1EMLA 3CTNA 2LP3A 4B30A 1K2HA 4JKTA 1OMVA 2F2OA 2KFFA 2A50B 2A46A 2CT9A 2BCAA 3SVNA 1NWDA 1IRJA 1S5GY 2OKWA 4KF4A 1K9UA 1N2DA 4RYSA 2AWKA 1SCVA 2WCEA 1WLZA 4KGEA 1XFWO 4ORAB 1C3ZA 3B7AA 2OTGB 3DPWA 5BT0A 2BTJA 3I5HB 1DGUA 1OOFA 1SRAA 1WDCC 2KLDA 3CD9A 1S36A 1AJ4A 1IG5A 4JEOA 4OKHA 4OCIA 1DVIA 3RZSA 2BKIB 3BOWA 2A4JA 4IK8A 3GOFA 3ICBA 2LUXA 3H4SE 1F0BA 1CLLA 4IK9A 4HVFA 4ZBLA 1OZOA 5DTXA 2M1KB 1YVLA 3S0BA 3SS4A 1Y1UA 5DQBA 3DVKA 1ZOTB 1JWDA 2Q6PA 2MLFC 4FQTA 3NGVA 3OSQA 3S0EA 1SR6C 3SSVA 3S0AA 5FVIA 1KSMA 5LTQA 1QX7A 1TCOB 2F2PA 2OS8C 3EVRA 2LE9B 5EL2A 3VRNA 3SVDA 5LTRA 2H8QA 2LP2A 1UHHA 2F3YA 3BQ3A 2HRSA 2LMUA 1JF0A 2HF5A 2P4MA 2WNDA 1F09A 5DKRA 2QDIA 4EN1A 4XYNA 1QTXA 1CM1A 4A4BA 4IK4A 3OHMB 4KW4A 4E68A 3F45A 1R6PA 2M7LA 2BE4A 2M7NA 3EK8A 4RYWA 3N7HA 1JFJA 3KPXA 5EB7A 1R2UA 3DYEA 4JRBA 3TS5B 2QLHA 1YURA 2WCKA 3SG5A 2WHSA 3EK7A 2DUEA 3O78A 3L4AA 4LQUA 1N65A 1L2OC 4PALA 1SK6D 4W6HA 4W77A 1EMFA 4Q7TA 2LMVA 3SVBA 1TNWA 3BFAA 1FI5A 3ZUJA 1KQMC 2KOTA 3LF3A 2GTEA 1MHOA 3ZNIA 4AQJA 3CBEA 3G9AA 3D75A 5EJUA 3DQ3A 4HREE 2LHLA 4W7AA 5HL1A 2H61C 5EXCI 2KGBC 2FL1A 2WCBA 2KSPA 1ORGA 2WCMA 2M1UA 3D74A 2DOQA
chains in the Genus database with same CATH topology
2YE1A 1DJGA 2GV5A 1DGVA 3KCTA 5DU0A 4UPGA 3VRPA 1QASA 2PVBA 1FI6A 5BPJA 4DRWA 4GGFC 1ZFSA 4W76A 1WRZA 4ZCVA 3KF9A 3D10A 2WSNA 4ZF3A 2OGRA 2HQWA 5CSFA 2KQ6A 3SSHA 2LAPA 4HQ9A 4OY4A 1YRUB 3SG4A 1CMFA 2O60A 3FS7A 4W6OA 4GPLB 2VAEA 5J3XA 4N3DA 5DKQA 3CGLA 1K94A 3I19A 2E6WA 3JTDB 3SVEA 1JFKA 1XK4C 3ST3A 4PHNA 3E5WA 4QJ3B 1RMOA 1CV7A 1OQPA 1V1FA 1KWOC 3AKAA 3CFFA 5I2OA 3DQJA 5BQLA 5KSZA 2AWLA 1W7JB 3DQ1A 2K7DA 4C0JA 1TCFA 3C1VA 3DQ7A 3LVAA 3SIBA 5TNCA 2BBMA 1M45A 4IK1A 2BECA 1SCMB 1M39A 2BL0C 1KFXL 1PK0D 4W6CA 2AUCA 3AI5A 2NLNA 2GGMA 2I94A 4M2QA 3SVOA 1E8AA 4W6AA 2F33A 4JWQA 5HKWA 1YVHA 1S1EA 3SS0A 2BE6A 3ED8A 4ORCB 2LVIA 4DIRA 1F4OA 3PM8A 4EULA 3SRYA 2M49B 3SIAA 3BX9A 1ZUXA 2EMDA 1S6CA 1TNQA 2G3OA 1RMMA 2K0JA 3ZULA 2LUCA 2M3WA 4W6DA 1KK8B 5EXBA 1QXPA 3I5GB 4JFGA 4YGDB 1BF5A 4W72A 1EMKA 3DQ6A 3BUMB 3EK4A 2KI4C 2WCFA 4PPJA 2KGRA 1K9PA 2ZRTA 5T3IA 5HBDA 1MOUA 3U0NA 3LK0A 2IOVA 4XJKB 1XFZO 2DDDA 3WLCA 3BXAA 1NCZA 1EL4A 3DD4A 1YX7A 3P8UA 1KFUS 2ZO7A 3TDUA 2VZXA 1K93D 4OGSA 2VRGA 2PMYA 3AI4A 1XAEA 1NP8A 1ODBA 2NCOA 1CB1A 1RMPA 4JPZB 4Q9XA 4BDUA 1NX2A 4EMQA 1FW4A 1TTXA 1EMMA 5DTLA 3LL8B 1GQMA 4DKMA 3DQ5A 1TOPA 1B7TZ 1IKUA 3WCKA 1SL8A 2L50A 1BR1B 1Q4EA 5EXUA 1RTP1 2JTZA 3W1CA 2DDCA 1SW8A 2JT3A 4U8DA 3VRRA 1J1DA 4ORBB 1IJ5A 3H1RA 4DXQA 4TZGA 1XO5A 4BY5A 1AHRA 1Q4AA 1N0YA 4Q04A 2Y1MA 3SG3A 4PFEA 1GGXA 2LCPA 1Q4DA 1LKJA 2HQKA 2V53A 1YJFA 5CPVA 2HGDA 5PALA 4JQ0D 1XFVO 2A47A 1DF0B 2HFCA 2Y0GA 3EVUA 1YX8A 1TNXA 3W1DA 3BUWB 4DCKA 2WURA 4Q9WA 1S5GZ 3PJ5A 1DJIA 1UP5A 5FVFA 2IE2A 2ISDA 2PXWA 1YFPA 3KCSA 2CTNA 3AKOA 1BJFA 2PALA 3VHTB 3CR4X 1FBVA 3SSTA 2CCMA 5LK4A 1QX2A 2JXCA 1SY9A 3DQEA 2LHIA 1YUUA 2HJOA 4NWSA 5KTYA 4M2PA 1YUSA 5HLVA 2FJUB 4L13A 3WNXB 4EDOA 5DRFA 1CDPA 4QJ4B 2CXJA 3DQHA 5K89A 1PRWA 3K1KA 4DXIA 2MLEC 2JNXA 3SSLA 4KAGA 3DQKA 4OQWA 4PPLA 2MHHA 1QV0A 4MZLA 1A75A 1HCJA 1JF2A 3ZWHA 1YZWA 3BUNB 4H47A 2PASA 3PJBA 2QRFA 3PIBA 4W7FA 4D1EA 1Z1PA 4DXPA 2V4EA 1F54A 2K8MB 1BLQA 4PE4A 1UHIA 1MR8A 4WQ2A 5CSJA 1MQ1A 4ZINA 3TUYC 3U8AA 2H5QA 3I5HC 2AWMA 3VROA 1U5IB 2KAYA 2G6YA 4TZAA 3OX5A 1SKTA 2WORA 4W7DA 1BU3A 2SASA 1KYRA 1WRLA 4I5JA 1XFXO 5DY6A 3PSRA 5D7FA 2M9GA 4CPVA 2AAOA 1DTLA 5HGEA 1J7PA 3U0KA 1U5IA 5DPIA 2WHTA 1DJYA 1G7KA 1A29A 4GOBA 3DVJA 3CFAA 2MAZA 1XVJA 1M46A 1SR6B 5H87A 3IP2A 1ALVA 4QJ5B 1KFUL 2ZNDA 1QIVA 2KBIA 2O24A 2H5PA 4DKNA 4JC2A 4FQOA 2D8NA 1J7OA 5H89A 4AQIA 1Q73A 1JC0A 1OZSA 1UURA 4Z4MA 5DRGA 1PSBA 1CMGA 3BXBA 3O77A 3TS5C 3CGAA 2WISA 1V1GA 3U8PA 2G9BA 1TIZA 3CZTX 3E5TA 1WRKA 2OTEA 2QT2A 4MZKA 4OHSA 2E30A 3NT9A 1ZGQA 4LJBA 2A52B 3DQMA 2LM5A 1K9KA 2FCEA 4KF5A 2ZMUA 3SVRA 3LA1A 3NF0A 2ICRA 5AERA 3LK1A 4ICBA 1ZMZA 2KHNA 1PULA 1G4YR 3GJ1A 2B1UA 2AH8A 1L2OB 4MEWA 3PN7C 1RK9A 1J1EA 1YUTA 1S6ZA 1B47A 3JVTB 2L0PA 2KQYA 2JULA 2QPTA 2GW3A 4HQ8A 1RRXA 1RFJA 2WC8A 3IQQA 1MYWA 3O2PA 4W6FA 4USLA 2POXA 4PE7A 4GF6B 1QJTA 4HRHA 2M29A 3TDIA 3VRQA 2HCGA 1B1GA 2Y5IA 4DS7A 2F3ZA 4W6LA 4FTGA 4I5LB 4PHJA 4P1QA 2ZMWA 1EMAA 3NXAA 5H88A 1QX5B 3AAKA 4JGEA 5JOLA 1UHJA 1TNPA 3LS3A 1QV1A 2I18A 3NT3A 4PCWA 4MBEA 1Q4CA 1NX0A 1JC1A 1J55A 1C7VA 1PSRA 1SL9A 2ZRSA 2VADA 5B8IB 4U2VA 1CLBA 4W6PA 3WHTB 3AKBA 4YI9A 1LXFC 1OSAA 3DPZA 1KYPA 1QLSA 3DVEA 2ARLA 4P76A 3O6BA 1TRFA 2NXQA 2AHAA 1K95A 1SBJA 2RH7A 4PDZA 4Q7RA 2IB5A 1AUIB 2R2IA 4YGBB 5D69A 4PHKA 3U8CA 4LJDC 1QS7A 2Q57A 2EMOA 4GGNA 1G33A 3HCMA 1XMZA 5G08A 1YR5A 2FZUA 3SG2A 1CFPA 5ER5A 4XL5A 3CB9A 5AEQA 3LLEA 2LLUA 3SVSA 4W7CA 2C9JA 3LSAA 3FWBA 4KA9A 2ZKMX 2VVHA 2Z6XA 1KSOA 4W6NA 4YBHB 1YRTB 2Q4UA 2HQ8A 1J7QA 2PSRA 1NX1A 1KK8C 1DJXA 4MRXA 2QLEA 1JC2A 1MF8B 4MLWA 4NQGA 4IK5A 2H5OA 1YHGA 4W6KA 3LCPC 1BR4B 4C0LA 1FPWA 2HETA 3BXKA 1DT7B 1QVIZ 1JBYA 2O5GA 4DUQA 4ANJA 2KYCA 1LA0A 1OXEA 5GQQC 2KI4B 2Y4QA 3SVUA 3GK4X 1LA3A 3DF0B 1QATA 1JUOA 2EHBA 1DJWA 3U0MA 4IK3A 3PJ7A 4L12A 4ZIOA 3I5FC 1KK7Z 1CM4A 1IQ5A 1K96A 2BBNA 5I2LA 1IQ3A 1K90D 1UUSA 2Z6YA 1SL7A 3E5VA 4XJKA 3WHUB 1F70A 2EGDA 2EC6C 3SSPA 1BOCA 4XVPA 2L4HA 1MOVA 5BTTB 3UFZA 1W7UA 1X02A 1PVBA 4H48A 3I5IB 1EG4A 4RTCA 2ZNEA 3DF0A 4HSZA 2DUGA 2P6BB 1G8IA 5ER4X 2G2BA 3DQIA 2O2BA 4H3NA 1NCYA 5DTZA 1GGZA 1EXRA 2Z6ZA 3DQFA 3IR8A 5DQMA 2OKYA 1XA9A 3E3RA 4W6MA 2LLTA 4XOWA 4H3LA 5BTTA 4CLNA 2A48A 1NX3A 3ST2A 1CDLA 3VGOA 4IL1A 4KGFA 4B5YA 1W7SA 1EJ3A 1MXLC 1MWNA 1OOJA 2FOTA 5HZUA 1CNPA 1QYQA 2KI6D 2LVKA 2EMNA 3SV5A 1F55A 5AFPA 1A2XA 5AQBB 4CIDA 4M2OA 4L1IA 2JC2A 4MRYA 3DQ9A 2KFGA 5EBJA 1MXEA 3DPXA 4W74A 4DXMA 1DF0A 1RECA 4PHMA 4R1EA 4NDBA 3SSKA 2QZ0A 1YJ2A 2I2RE 1B4CA 1RROA 4CFRA 1CKKA 5EB6A 1HT9A 4R6DA 1M63B 2V4EC 2H2KA 2O29A 5FYXA 2AWJA 1D1OA 3CLNA 1ZACA 4MSPA 5HZTA 3CWGA 4XGYA 3OX6A 3WXAA 2OTBA 2LC5A 1S3PA 2BCBA 3VHTA 1BODA 2JQ6A 1WLMA 4Z4KA 2KYFA 4ORNA 4YI8A 3CFHA 3LVDA 3EKJA 2KNEA 3SG6A 4L9MA 1IH0A 1KFXS 2WIQA 3BXCA 4ZCUA 2L98A 3UG0A 4W6SA 2GGZA 2OTGC 3BOWB 5HLOA 1XFUO 1C7WA 3M0WA 2K61A 3FIAA 4PPKA 3ADFA 2NCPA 4NDCA 5DTYA 4YGAA 2DUHA 1EH2A 2SCPA 2DD7A 2HGYA 3RM1A 3TUYB 4W6TA 4OVNF 4ETOA 1WDCB 2G3DB 3DQNA 3WLDA 2IS9A 1LVCD 3TMTA 3OB1B 2CBLA 5HZSA 2PRUA 1Q80A 2QLIA 2ZN9A 3FWCA 1RJVA 1B8CA 2QU1A 1B8RA 1CLMA 1IJ6A 4CFQA 2LVVA 4MVFA 1H4BA 1JBAA 3MSEB 2FCDA 3DQDA 1IGVA 1OXFA 1UHNA 3LF4B 1JBZA 3KHEA 1YTZC 4WQ3A 4XOVA 1SMGA 4KF5C 4W6GA 4LW5A 2OS8B 3DQ2A 2K2FA 3DQOA 5J2OA 1DMOA 3U0LA 1MUXA 3NSKA 4GFTA 2KFHA 1NYAA 3HX4A 4F0ZB 2YE0A 3CS1A 2ZFDA 2WHUA 2G16B 1PALA 3DQAA 4J89A 5F9GA 2VVJA 3SSYA 1UISA 2TN4A 3DQ8A 5HKZA 1C07A 1XYDA 3GK2A 4IZNA 2A56B 3VICA 2VVIA 4HE4A 1ZGPA 3RWAA 2K7BA 2JADA 3A8SA 2CNPA 4EDSA 5CSIA 3DVMA 4N1FA 3AAJA 4ZFSA 1UWOA 5JJGA 3NEDA 1PVAA 1RM9A 1GGWA 4J8AA 3EKHA 3KO0A 2JPTA 4PE1A 2A54B 2HQZA 4GBAA 4KEXA 1CFCA 2JTTA 3PFVA 3V3DA 1NCXA 5I2QA 3VK1A 3JVTC 2G2SB 5DPJA 1GFLA 1KQMB 5HYDA 2KAXA 4I5NB 2WSOA 4I5KA 1AJ5A 2LLSA 1F8HA 5KU1A 3OB2B 3CD1A 1QYOA 1F71A 3PN7B 3QRXA 1BMOA 3EVVA 4YGEB 2MA2A 4MN0A 2ZN8A 1A03A 3LVCA 4ZB1A 2K2AA 3CR5X 3O4YA 2KAVA 2LMTA 1S26D 1SYMA 2JZIA 2BKHB 4BY4A 2Y1NA 1LINA 2JT8A 4P5OE 3BUXB 3NEZA 1F4QA 4R6BA 5HZOA 2FWQA 4LQTA 3JTDC 1YHHA 2H6VA 2H61A 2L5XB 2Q91A 5HW9A 1CFFA 1K8UA 3MGFA 1OE9B 2JU0A 1FF1A 3H1OA 1HQVA 1Z1QA 1H4UA 4DXNA 4W73A 4GNKB 3ST4A 3TZ1A 3TMRA 2IB6A 2K7CA 3A8RA 2H5RA 4GGFA 2B3PA 1KWOB 1ZUZA 2JOJA 1SCMC 5FHVA 2H9WA 5CSNA 3NSIA 3RWTA 3IF7A 1L7ZA 4W6RA 5IBWA 1CFDA 1EMBA 5DPHA 3SJSA 2QLGB 2RGIA 2A53B 4W69A 2AMIA 1AVSA 1BT6A 1W7IB 3DQUA 1B8LA 2BL0B 5I8NA 1W7TA 4AS8A 1KCYA 4W6IA 4GESB 1XSSA 4OJ0A 3CR2A 3M22A 1SPYA 1XK4A 4UTSA 1AP4A 5FVGA 2MBXA 3PALA 2KDHA 4J88A 2GX2A 1H8BA 2LVJA 2KBMA 2LV7A 1KYSA 3ZTFA 3OGOA 3PATA 4GAOA 3I5GC 3OSRA 1CTRA 2QLGA 5F6TA 2YDZA 5KTGA 1JSAA 1KQVA 2L4IA 3BUOB 2LNKA 1QLKA 4DXOA 4LJDA 3M24A 3GEXA 2YFPA 5AXIA 3NSLA 4HRGA 1BG1A 1NIWA 2C9IA 1Q4BA 2F8PA 1QY3A 5DKNA 4W6BA 1Y1AA 4I2YA 2M0RA 2L51A 2ZO6A 2QACA 3PLFB 3GL4A 3DQ4A 1B9AA 1HUYA 2JRFA 2M97A 1NSHA 1QYFA 2KI6C 1DJZA 5LTPA 1OMDA 4NDDA 2JWWA 1Y1XA 1BFPA 2DUIA 1EMCA 3RLZA 1YHIA 1ALWA 1NPQA 4W6UA 1XA5A 1RWYA 3DQCA 4KW9A 3K21A 1WY9A 1M31A 4N1GA 1OMRA 2PXSA 1UHKA 3I5FB 1Y6WA 4MZJA 4WRIA 3I5IC 2G6XA 2I7AA 1XQMA 2MRDA 2K7OA 1EG3A 4Q7UA 1Y0VH 3IQOA 4KPIA 4W6JA 4W75A 3TDZA 1OXDA 2LANA 4ZF5A 2M8UA 2EC6B 4OV2A 2MJWB 4KW8A 3BYAA 3SG7A 5DPGA 4HQCA 1ZGOA 3NSOA 1VRKA 1S6JA 2WOSA 4A4CA 3P28A 1NUBA 2OPOA 2BCXA 2OJKA 3OP0A 3ZUFA 3GK1A 1QXTA 5HKYA 1EMGA 2NZ0A 2HPWA 1TN4A 4N5XA 4PE0A 1GJYA 1SNLA 3GJ2A 4H3MA 1QVIY 2G6EA 2JNFA 1XFYO 3GB3A 3D0YB 2DUFA 1KP5A 4JF9A 1CDNA 4ZF4A 4AOMA 2HPSA 4TNCA 4GUKA 2COLB 3SVCA 4LJCA 2B3QA 1EMEA 2JT0A 1C4FA 2L2EA 1J7RA 1KK7Y 2Z1OA 1B7TY 4AR7A 3A4UB 4B30B 3D0YA 1A75B 2GX0A 1IWQA 1B9CA 3DQLA 3KEVA 2JXLA 3S05A 1A4PA 1DJHA 5AANA 1GL4A 3EVPA 1S6IA 2V4EB 4OR9B 4W7EA 4P2YB 4YRUA 3ST0A 1CDMA 4W7XA 1QIWA 4YGCB 4C0KA 5EHUA 1AK8A 2G5ZB 2DD9A 1H6RA 4W7RA 2GW4B 1EMLA 3CTNA 2LP3A 4B30A 1K2HA 1OMVA 2F2OA 2KFFA 2A50B 2A46A 2CT9A 2BCAA 3SVNA 1NWDA 1IRJA 1S5GY 2OKWA 4KF4A 1K9UA 1N2DA 4RYSA 2AWKA 1SCVA 2WCEA 1WLZA 4KGEA 1XFWO 4ORAB 2OTGB 3DPWA 5BT0A 2BTJA 3I5HB 1DGUA 1SRAA 1WDCC 3CD9A 1S36A 1AJ4A 1IG5A 4JEOA 4OKHA 4OCIA 1DVIA 2BKIB 3BOWA 2A4JA 4IK8A 3GOFA 3ICBA 2LUXA 3H4SE 1F0BA 1CLLA 4IK9A 4HVFA 4ZBLA 1OZOA 5DTXA 2M1KB 1YVLA 1Y1UA 5DQBA 3DVKA 1ZOTB 1JWDA 2Q6PA 2MLFC 3OSQA 1SR6C 3SSVA 5FVIA 1KSMA 5LTQA 1QX7A 1TCOB 2F2PA 2OS8C 3EVRA 2LE9B 3VRNA 3SVDA 5LTRA 2H8QA 2LP2A 1UHHA 2F3YA 3BQ3A 2HRSA 2LMUA 1JF0A 2HF5A 2P4MA 2WNDA 1F09A 5DKRA 4EN1A 4XYNA 1QTXA 1CM1A 4A4BA 4IK4A 3OHMB 4KW4A 4E68A 3F45A 1R6PA 2M7LA 2BE4A 2M7NA 3EK8A 4RYWA 1JFJA 3KPXA 5EB7A 1R2UA 4JRBA 3TS5B 2QLHA 1YURA 3SG5A 2WHSA 3EK7A 2DUEA 3O78A 4LQUA 1N65A 1L2OC 4PALA 1SK6D 4W6HA 4W77A 1EMFA 4Q7TA 2LMVA 3SVBA 1TNWA 1FI5A 3ZUJA 1KQMC 2KOTA 3LF3A 1MHOA 3ZNIA 4AQJA 3CBEA 3G9AA 5EJUA 3DQ3A 4HREE 2LHLA 4W7AA 2H61C 5EXCI 2KGBC 2FL1A 2WCBA 2KSPA 2M1UA 2DOQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YE1 A;  1DJG A;  2GV5 A;  1DGV A;  3KCT A;  5DU0 A;  4UPG A;  3VRP A;  1QAS A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  1ZFS A;  4W76 A;  1WRZ A;  4ZCV A;  3KF9 A;  3D10 A;  2WSN A;  4ZF3 A;  2OGR A;  2HQW A;  5CSF A;  2KQ6 A;  3SSH A;  2LAP A;  4HQ9 A;  4OY4 A;  1YRU B;  3SG4 A;  1CMF A;  2O60 A;  3FS7 A;  4W6O A;  4GPL B;  2VAE A;  5J3X A;  4N3D A;  5DKQ A;  3CGL A;  1K94 A;  3I19 A;  2E6W A;  3JTD B;  3SVE A;  1JFK A;  1XK4 C;  3ST3 A;  4PHN A;  3E5W A;  4QJ3 B;  1RMO A;  1CV7 A;  1OQP A;  1V1F A;  1KWO C;  3AKA A;  3CFF A;  5I2O A;  3DQJ A;  5BQL A;  5KSZ A;  2AWL A;  1W7J B;  3DQ1 A;  2K7D A;  4C0J A;  1TCF A;  3C1V A;  3DQ7 A;  3LVA A;  3SIB A;  5TNC A;  2BBM A;  1M45 A;  4IK1 A;  2BEC A;  1SCM B;  1M39 A;  2BL0 C;  1KFX L;  1PK0 D;  4W6C A;  2AUC A;  3AI5 A;  2NLN A;  2GGM A;  2I94 A;  4M2Q A;  3SVO A;  1E8A A;  4W6A A;  2F33 A;  4JWQ A;  5HKW A;  1YVH A;  1S1E A;  3SS0 A;  2BE6 A;  3ED8 A;  4ORC B;  2LVI A;  4DIR A;  1F4O A;  3PM8 A;  4EUL A;  3SRY A;  2M49 B;  3SIA A;  3BX9 A;  1ZUX A;  2EMD A;  1S6C A;  1TNQ A;  2G3O A;  1RMM A;  2K0J A;  3ZUL A;  2LUC A;  2M3W A;  4W6D A;  1KK8 B;  5EXB A;  1QXP A;  3I5G B;  4JFG A;  4YGD B;  1BF5 A;  4W72 A;  1EMK A;  3DQ6 A;  3BUM B;  3EK4 A;  2KI4 C;  2WCF A;  4PPJ A;  2KGR A;  1K9P A;  2ZRT A;  5T3I A;  5HBD A;  1MOU A;  3U0N A;  3LK0 A;  2IOV A;  4XJK B;  1XFZ O;  2DDD A;  3WLC A;  3BXA A;  1NCZ A;  1EL4 A;  3DD4 A;  1YX7 A;  3P8U A;  1KFU S;  2ZO7 A;  3TDU A;  2VZX A;  1K93 D;  4OGS A;  2VRG A;  2PMY A;  3AI4 A;  1XAE A;  1NP8 A;  1ODB A;  2NCO A;  1CB1 A;  1RMP A;  4JPZ B;  4Q9X A;  4BDU A;  1NX2 A;  4EMQ A;  1FW4 A;  1TTX A;  1EMM A;  5DTL A;  3LL8 B;  1GQM A;  4DKM A;  3DQ5 A;  1TOP A;  1B7T Z;  1IKU A;  3WCK A;  1SL8 A;  2L50 A;  1BR1 B;  1Q4E A;  5EXU A;  1RTP 1;  2JTZ A;  3W1C A;  2DDC A;  1SW8 A;  2JT3 A;  4U8D A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  3H1R A;  4DXQ A;  4TZG A;  1XO5 A;  4BY5 A;  1AHR A;  1Q4A A;  1N0Y A;  4Q04 A;  2Y1M A;  3SG3 A;  4PFE A;  1GGX A;  2LCP A;  1Q4D A;  1LKJ A;  2HQK A;  2V53 A;  1YJF A;  5CPV A;  2HGD A;  5PAL A;  4JQ0 D;  1XFV O;  2A47 A;  1DF0 B;  2HFC A;  2Y0G A;  3EVU A;  1YX8 A;  1TNX A;  3W1D A;  3BUW B;  4DCK A;  2WUR A;  4Q9W A;  1S5G Z;  3PJ5 A;  1DJI A;  1UP5 A;  5FVF A;  2IE2 A;  2ISD A;  2PXW A;  1YFP A;  3KCS A;  2CTN A;  3AKO A;  1BJF A;  2PAL A;  3VHT B;  3CR4 X;  1FBV A;  3SST A;  2CCM A;  5LK4 A;  1QX2 A;  2JXC A;  1SY9 A;  3DQE A;  2LHI A;  1YUU A;  2HJO A;  4NWS A;  5KTY A;  4M2P A;  1YUS A;  5HLV A;  2FJU B;  4L13 A;  3WNX B;  4EDO A;  5DRF A;  1CDP A;  4QJ4 B;  2CXJ A;  3DQH A;  5K89 A;  1PRW A;  3K1K A;  4DXI A;  2MLE C;  2JNX A;  3SSL A;  4KAG A;  3DQK A;  4OQW A;  4PPL A;  2MHH A;  1QV0 A;  4MZL A;  1A75 A;  1HCJ A;  1JF2 A;  3ZWH A;  1YZW A;  3BUN B;  4H47 A;  2PAS A;  3PJB A;  2QRF A;  3PIB A;  4W7F A;  4D1E A;  1Z1P A;  4DXP A;  2V4E A;  1F54 A;  2K8M B;  1BLQ A;  4PE4 A;  1UHI A;  1MR8 A;  4WQ2 A;  5CSJ A;  1MQ1 A;  4ZIN A;  3TUY C;  3U8A A;  2H5Q A;  3I5H C;  2AWM A;  3VRO A;  1U5I B;  2KAY A;  2G6Y A;  4TZA A;  3OX5 A;  1SKT A;  2WOR A;  4W7D A;  1BU3 A;  2SAS A;  1KYR A;  1WRL A;  4I5J A;  1XFX O;  5DY6 A;  3PSR A;  5D7F A;  2M9G A;  4CPV A;  2AAO A;  1DTL A;  5HGE A;  1J7P A;  3U0K A;  1U5I A;  5DPI A;  2WHT A;  1DJY A;  1G7K A;  1A29 A;  4GOB A;  3DVJ A;  3CFA A;  2MAZ A;  1XVJ A;  1M46 A;  1SR6 B;  5H87 A;  3IP2 A;  1ALV A;  4QJ5 B;  1KFU L;  2ZND A;  1QIV A;  2KBI A;  2O24 A;  2H5P A;  4DKN A;  4JC2 A;  4FQO A;  2D8N A;  1J7O A;  5H89 A;  4AQI A;  1Q73 A;  1JC0 A;  1OZS A;  1UUR A;  4Z4M A;  5DRG A;  1PSB A;  1CMG A;  3BXB A;  3O77 A;  3TS5 C;  3CGA A;  2WIS A;  1V1G A;  3U8P A;  2G9B A;  1TIZ A;  3CZT X;  3E5T A;  1WRK A;  2OTE A;  2QT2 A;  4MZK A;  4OHS A;  2E30 A;  3NT9 A;  1ZGQ A;  4LJB A;  2A52 B;  3DQM A;  2LM5 A;  1K9K A;  2FCE A;  4KF5 A;  2ZMU A;  3SVR A;  3LA1 A;  3NF0 A;  2ICR A;  5AER A;  3LK1 A;  4ICB A;  1ZMZ A;  2KHN A;  1PUL A;  1G4Y R;  3GJ1 A;  2B1U A;  2AH8 A;  1L2O B;  4MEW A;  3PN7 C;  1RK9 A;  1J1E A;  1YUT A;  1S6Z A;  1B47 A;  3JVT B;  2L0P A;  2KQY A;  2JUL A;  2QPT A;  2GW3 A;  4HQ8 A;  1RRX A;  1RFJ A;  2WC8 A;  3IQQ A;  1MYW A;  3O2P A;  4W6F A;  4USL A;  2POX A;  4PE7 A;  4GF6 B;  1QJT A;  4HRH A;  2M29 A;  3TDI A;  3VRQ A;  2HCG A;  1B1G A;  2Y5I A;  4DS7 A;  2F3Z A;  4W6L A;  4FTG A;  4I5L B;  4PHJ A;  4P1Q A;  2ZMW A;  1EMA A;  3NXA A;  5H88 A;  1QX5 B;  3AAK A;  4JGE A;  5JOL A;  1UHJ A;  1TNP A;  3LS3 A;  1QV1 A;  2I18 A;  3NT3 A;  4PCW A;  4MBE A;  1Q4C A;  1NX0 A;  1JC1 A;  1J55 A;  1C7V A;  1PSR A;  1SL9 A;  2ZRS A;  2VAD A;  5B8I B;  4U2V A;  1CLB A;  4W6P A;  3WHT B;  3AKB A;  4YI9 A;  1LXF C;  1OSA A;  3DPZ A;  1KYP A;  1QLS A;  3DVE A;  2ARL A;  4P76 A;  3O6B A;  1TRF A;  2NXQ A;  2AHA A;  1K95 A;  1SBJ A;  2RH7 A;  4PDZ A;  4Q7R A;  2IB5 A;  1AUI B;  2R2I A;  4YGB B;  5D69 A;  4PHK A;  3U8C A;  4LJD C;  1QS7 A;  2Q57 A;  2EMO A;  4GGN A;  1G33 A;  3HCM A;  1XMZ A;  5G08 A;  1YR5 A;  2FZU A;  3SG2 A;  1CFP A;  5ER5 A;  4XL5 A;  3CB9 A;  5AEQ A;  3LLE A;  2LLU A;  3SVS A;  4W7C A;  2C9J A;  3LSA A;  3FWB A;  4KA9 A;  2ZKM X;  2VVH A;  2Z6X A;  1KSO A;  4W6N A;  4YBH B;  1YRT B;  2Q4U A;  2HQ8 A;  1J7Q A;  2PSR A;  1NX1 A;  1KK8 C;  1DJX A;  4MRX A;  2QLE A;  1JC2 A;  1MF8 B;  4MLW A;  4NQG A;  4IK5 A;  2H5O A;  1YHG A;  4W6K A;  3LCP C;  1BR4 B;  4C0L A;  1FPW A;  2HET A;  3BXK A;  1DT7 B;  1QVI Z;  1JBY A;  2O5G A;  4DUQ A;  4ANJ A;  2KYC A;  1LA0 A;  1OXE A;  5GQQ C;  2KI4 B;  2Y4Q A;  3SVU A;  3GK4 X;  1LA3 A;  3DF0 B;  1QAT A;  1JUO A;  2EHB A;  1DJW A;  3U0M A;  4IK3 A;  3PJ7 A;  4L12 A;  4ZIO A;  3I5F C;  1KK7 Z;  1CM4 A;  1IQ5 A;  1K96 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  1UUS A;  2Z6Y A;  1SL7 A;  3E5V A;  4XJK A;  3WHU B;  1F70 A;  2EGD A;  2EC6 C;  3SSP A;  1BOC A;  4XVP A;  2L4H A;  1MOV A;  5BTT B;  3UFZ A;  1W7U A;  1X02 A;  1PVB A;  4H48 A;  3I5I B;  1EG4 A;  4RTC A;  2ZNE A;  3DF0 A;  4HSZ A;  2DUG A;  2P6B B;  1G8I A;  5ER4 X;  2G2B A;  3DQI A;  2O2B A;  4H3N A;  1NCY A;  5DTZ A;  1GGZ A;  1EXR A;  2Z6Z A;  3DQF A;  3IR8 A;  5DQM A;  2OKY A;  1XA9 A;  3E3R A;  4W6M A;  2LLT A;  4XOW A;  4H3L A;  5BTT A;  4CLN A;  2A48 A;  1NX3 A;  3ST2 A;  1CDL A;  3VGO A;  4IL1 A;  4KGF A;  4B5Y A;  1W7S A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  5HZU A;  1CNP A;  1QYQ A;  2KI6 D;  2LVK A;  2EMN A;  3SV5 A;  1F55 A;  5AFP A;  1A2X A;  5AQB B;  4CID A;  4M2O A;  4L1I A;  2JC2 A;  4MRY A;  3DQ9 A;  2KFG A;  5EBJ A;  1MXE A;  3DPX A;  4W74 A;  4DXM A;  1DF0 A;  1REC A;  4PHM A;  4R1E A;  4NDB A;  3SSK A;  2QZ0 A;  1YJ2 A;  2I2R E;  1B4C A;  1RRO A;  4CFR A;  1CKK A;  5EB6 A;  1HT9 A;  4R6D A;  1M63 B;  2V4E C;  2H2K A;  2O29 A;  5FYX A;  2AWJ A;  1D1O A;  3CLN A;  1ZAC A;  4MSP A;  5HZT A;  3CWG A;  4XGY A;  3OX6 A;  3WXA A;  2OTB A;  2LC5 A;  1S3P A;  2BCB A;  3VHT A;  1BOD A;  2JQ6 A;  1WLM A;  4Z4K A;  2KYF A;  4ORN A;  4YI8 A;  3CFH A;  3LVD A;  3EKJ A;  2KNE A;  3SG6 A;  4L9M A;  1IH0 A;  1KFX S;  2WIQ A;  3BXC A;  4ZCU A;  2L98 A;  3UG0 A;  4W6S A;  2GGZ A;  2OTG C;  3BOW B;  5HLO A;  1XFU O;  1C7W A;  3M0W A;  2K61 A;  3FIA A;  4PPK A;  3ADF A;  2NCP A;  4NDC A;  5DTY A;  4YGA A;  2DUH A;  1EH2 A;  2SCP A;  2DD7 A;  2HGY A;  3RM1 A;  3TUY B;  4W6T A;  4OVN F;  4ETO A;  1WDC B;  2G3D B;  3DQN A;  3WLD A;  2IS9 A;  1LVC D;  3TMT A;  3OB1 B;  2CBL A;  5HZS A;  2PRU A;  1Q80 A;  2QLI A;  2ZN9 A;  3FWC A;  1RJV A;  1B8C A;  2QU1 A;  1B8R A;  1CLM A;  1IJ6 A;  4CFQ A;  2LVV A;  4MVF A;  1H4B A;  1JBA A;  3MSE B;  2FCD A;  3DQD A;  1IGV A;  1OXF A;  1UHN A;  3LF4 B;  1JBZ A;  3KHE A;  1YTZ C;  4WQ3 A;  4XOV A;  1SMG A;  4KF5 C;  4W6G A;  4LW5 A;  2OS8 B;  3DQ2 A;  2K2F A;  3DQO A;  5J2O A;  1DMO A;  3U0L A;  1MUX A;  3NSK A;  4GFT A;  2KFH A;  1NYA A;  3HX4 A;  4F0Z B;  2YE0 A;  3CS1 A;  2ZFD A;  2WHU A;  2G16 B;  1PAL A;  3DQA A;  4J89 A;  5F9G A;  2VVJ A;  3SSY A;  1UIS A;  2TN4 A;  3DQ8 A;  5HKZ A;  1C07 A;  1XYD A;  3GK2 A;  4IZN A;  2A56 B;  3VIC A;  2VVI A;  4HE4 A;  1ZGP A;  3RWA A;  2K7B A;  2JAD A;  3A8S A;  2CNP A;  4EDS A;  5CSI A;  3DVM A;  4N1F A;  3AAJ A;  4ZFS A;  1UWO A;  5JJG A;  3NED A;  1PVA A;  1RM9 A;  1GGW A;  4J8A A;  3EKH A;  3KO0 A;  2JPT A;  4PE1 A;  2A54 B;  2HQZ A;  4GBA A;  4KEX A;  1CFC A;  2JTT A;  3PFV A;  3V3D A;  1NCX A;  5I2Q A;  3VK1 A;  3JVT C;  2G2S B;  5DPJ A;  1GFL A;  1KQM B;  5HYD A;  2KAX A;  4I5N B;  2WSO A;  4I5K A;  1AJ5 A;  2LLS A;  1F8H A;  5KU1 A;  3OB2 B;  3CD1 A;  1QYO A;  1F71 A;  3PN7 B;  3QRX A;  1BMO A;  3EVV A;  4YGE B;  2MA2 A;  4MN0 A;  2ZN8 A;  1A03 A;  3LVC A;  4ZB1 A;  2K2A A;  3CR5 X;  3O4Y A;  2KAV A;  2LMT A;  1S26 D;  1SYM A;  2JZI A;  2BKH B;  4BY4 A;  2Y1N A;  1LIN A;  2JT8 A;  4P5O E;  3BUX B;  3NEZ A;  1F4Q A;  4R6B A;  5HZO A;  2FWQ A;  4LQT A;  3JTD C;  1YHH A;  2H6V A;  2H61 A;  2L5X B;  2Q91 A;  5HW9 A;  1CFF A;  1K8U A;  3MGF A;  1OE9 B;  2JU0 A;  1FF1 A;  3H1O A;  1HQV A;  1Z1Q A;  1H4U A;  4DXN A;  4W73 A;  4GNK B;  3ST4 A;  3TZ1 A;  3TMR A;  2IB6 A;  2K7C A;  3A8R A;  2H5R A;  4GGF A;  2B3P A;  1KWO B;  1ZUZ A;  2JOJ A;  1SCM C;  5FHV A;  2H9W A;  5CSN A;  3NSI A;  3RWT A;  3IF7 A;  1L7Z A;  4W6R A;  5IBW A;  1CFD A;  1EMB A;  5DPH A;  3SJS A;  2QLG B;  2RGI A;  2A53 B;  4W69 A;  2AMI A;  1AVS A;  1BT6 A;  1W7I B;  3DQU A;  1B8L A;  2BL0 B;  5I8N A;  1W7T A;  4AS8 A;  1KCY A;  4W6I A;  4GES B;  1XSS A;  4OJ0 A;  3CR2 A;  3M22 A;  1SPY A;  1XK4 A;  4UTS A;  1AP4 A;  5FVG A;  2MBX A;  3PAL A;  2KDH A;  4J88 A;  2GX2 A;  1H8B A;  2LVJ A;  2KBM A;  2LV7 A;  1KYS A;  3ZTF A;  3OGO A;  3PAT A;  4GAO A;  3I5G C;  3OSR A;  1CTR A;  2QLG A;  5F6T A;  2YDZ A;  5KTG A;  1JSA A;  1KQV A;  2L4I A;  3BUO B;  2LNK A;  1QLK A;  4DXO A;  4LJD A;  3M24 A;  3GEX A;  2YFP A;  5AXI A;  3NSL A;  4HRG A;  1BG1 A;  1NIW A;  2C9I A;  1Q4B A;  2F8P A;  1QY3 A;  5DKN A;  4W6B A;  1Y1A A;  4I2Y A;  2M0R A;  2L51 A;  2ZO6 A;  2QAC A;  3PLF B;  3GL4 A;  3DQ4 A;  1B9A A;  1HUY A;  2JRF A;  2M97 A;  1NSH A;  1QYF A;  2KI6 C;  1DJZ A;  5LTP A;  1OMD A;  4NDD A;  2JWW A;  1Y1X A;  1BFP A;  2DUI A;  1EMC A;  3RLZ A;  1YHI A;  1ALW A;  1NPQ A;  4W6U A;  1XA5 A;  1RWY A;  3DQC A;  4KW9 A;  3K21 A;  1WY9 A;  1M31 A;  4N1G A;  1OMR A;  2PXS A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  3I5I C;  2G6X A;  2I7A A;  1XQM A;  2MRD A;  2K7O A;  1EG3 A;  4Q7U A;  1Y0V H;  3IQO A;  4KPI A;  4W6J A;  4W75 A;  3TDZ A;  1OXD A;  2LAN A;  4ZF5 A;  2M8U A;  2EC6 B;  4OV2 A;  2MJW B;  4KW8 A;  3BYA A;  3SG7 A;  5DPG A;  4HQC A;  1ZGO A;  3NSO A;  1VRK A;  1S6J A;  2WOS A;  4A4C A;  3P28 A;  1NUB A;  2OPO A;  2BCX A;  2OJK A;  3OP0 A;  3ZUF A;  3GK1 A;  1QXT A;  5HKY A;  1EMG A;  2NZ0 A;  2HPW A;  1TN4 A;  4N5X A;  4PE0 A;  1GJY A;  1SNL A;  3GJ2 A;  4H3M A;  1QVI Y;  2G6E A;  2JNF A;  1XFY O;  3GB3 A;  3D0Y B;  2DUF A;  1KP5 A;  4JF9 A;  1CDN A;  4ZF4 A;  4AOM A;  2HPS A;  4TNC A;  4GUK A;  2COL B;  3SVC A;  4LJC A;  2B3Q A;  1EME A;  2JT0 A;  1C4F A;  2L2E A;  1J7R A;  1KK7 Y;  2Z1O A;  1B7T Y;  4AR7 A;  3A4U B;  4B30 B;  3D0Y A;  1A75 B;  2GX0 A;  1IWQ A;  1B9C A;  3DQL A;  3KEV A;  2JXL A;  3S05 A;  1A4P A;  1DJH A;  5AAN A;  1GL4 A;  3EVP A;  1S6I A;  2V4E B;  4OR9 B;  4W7E A;  4P2Y B;  4YRU A;  3ST0 A;  1CDM A;  4W7X A;  1QIW A;  4YGC B;  4C0K A;  5EHU A;  1AK8 A;  2G5Z B;  2DD9 A;  1H6R A;  4W7R A;  2GW4 B;  1EML A;  3CTN A;  2LP3 A;  4B30 A;  1K2H A;  1OMV A;  2F2O A;  2KFF A;  2A50 B;  2A46 A;  2CT9 A;  2BCA A;  3SVN A;  1NWD A;  1IRJ A;  1S5G Y;  2OKW A;  4KF4 A;  1K9U A;  1N2D A;  4RYS A;  2AWK A;  1SCV A;  2WCE A;  1WLZ A;  4KGE A;  1XFW O;  4ORA B;  2OTG B;  3DPW A;  5BT0 A;  2BTJ A;  3I5H B;  1DGU A;  1SRA A;  1WDC C;  3CD9 A;  1S36 A;  1AJ4 A;  1IG5 A;  4JEO A;  4OKH A;  4OCI A;  1DVI A;  2BKI B;  3BOW A;  2A4J A;  4IK8 A;  3GOF A;  3ICB A;  2LUX A;  3H4S E;  1F0B A;  1CLL A;  4IK9 A;  4HVF A;  4ZBL A;  1OZO A;  5DTX A;  2M1K B;  1YVL A;  1Y1U A;  5DQB A;  3DVK A;  1ZOT B;  1JWD A;  2Q6P A;  2MLF C;  3OSQ A;  1SR6 C;  3SSV A;  5FVI A;  1KSM A;  5LTQ A;  1QX7 A;  1TCO B;  2F2P A;  2OS8 C;  3EVR A;  2LE9 B;  3VRN A;  3SVD A;  5LTR A;  2H8Q A;  2LP2 A;  1UHH A;  2F3Y A;  3BQ3 A;  2HRS A;  2LMU A;  1JF0 A;  2HF5 A;  2P4M A;  2WND A;  1F09 A;  5DKR A;  4EN1 A;  4XYN A;  1QTX A;  1CM1 A;  4A4B A;  4IK4 A;  3OHM B;  4KW4 A;  4E68 A;  3F45 A;  1R6P A;  2M7L A;  2BE4 A;  2M7N A;  3EK8 A;  4RYW A;  1JFJ A;  3KPX A;  5EB7 A;  1R2U A;  4JRB A;  3TS5 B;  2QLH A;  1YUR A;  3SG5 A;  2WHS A;  3EK7 A;  2DUE A;  3O78 A;  4LQU A;  1N65 A;  1L2O C;  4PAL A;  1SK6 D;  4W6H A;  4W77 A;  1EMF A;  4Q7T A;  2LMV A;  3SVB A;  1TNW A;  1FI5 A;  3ZUJ A;  1KQM C;  2KOT A;  3LF3 A;  1MHO A;  3ZNI A;  4AQJ A;  3CBE A;  3G9A A;  5EJU A;  3DQ3 A;  4HRE E;  2LHL A;  4W7A A;  2H61 C;  5EXC I;  2KGB C;  2FL1 A;  2WCB A;  2KSP A;  2M1U A;  2DOQ A; 
#chains in the Genus database with same CATH topology
 2YE1 A;  1DJG A;  2GV5 A;  1DGV A;  3KCT A;  5DU0 A;  4UPG A;  3VRP A;  1QAS A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  1ZFS A;  3B87 A;  4W76 A;  1WRZ A;  4ZCV A;  3KF9 A;  3D10 A;  2WSN A;  4ZF3 A;  2OGR A;  2HQW A;  5CSF A;  2KQ6 A;  3SSH A;  2LAP A;  4HQ9 A;  4OY4 A;  1YRU B;  3SG4 A;  1CMF A;  2O60 A;  3FS7 A;  4W6O A;  4GPL B;  2VAE A;  5J3X A;  4N3D A;  5DKQ A;  3CGL A;  1K94 A;  3I19 A;  2E6W A;  3JTD B;  3SVE A;  1JFK A;  1XK4 C;  3ST3 A;  3NHI A;  4PHN A;  3E5W A;  4QJ3 B;  1RMO A;  1CV7 A;  1OQP A;  1V1F A;  1KWO C;  3AKA A;  3CFF A;  5I2O A;  3DQJ A;  5BQL A;  5KSZ A;  2AWL A;  1W7J B;  3DQ1 A;  2K7D A;  1DEL A;  4C0J A;  1TCF A;  3C1V A;  3DQ7 A;  3LVA A;  3SIB A;  5TNC A;  1Z4H A;  2BBM A;  3DXL A;  2PYQ A;  1M45 A;  4IK1 A;  2BEC A;  1SCM B;  1M39 A;  2BL0 C;  1KFX L;  1PK0 D;  4W6C A;  2AUC A;  3AI5 A;  2NLN A;  2GGM A;  2I94 A;  4M2Q A;  3SVO A;  1E8A A;  4W6A A;  2F33 A;  4JWQ A;  5HKW A;  1YVH A;  1S1E A;  3SS0 A;  2BE6 A;  3ED8 A;  4ORC B;  2LVI A;  4DIR A;  1F4O A;  3PM8 A;  4EUL A;  3CYZ A;  3SRY A;  2M49 B;  3SIA A;  3BX9 A;  1ZUX A;  2EMD A;  1S6C A;  1TNQ A;  2G3O A;  1RMM A;  2K0J A;  3ZUL A;  2LUC A;  2M3W A;  4W6D A;  1KK8 B;  5EXB A;  1QXP A;  3I5G B;  4JFG A;  4YGD B;  1BF5 A;  4W72 A;  1EMK A;  3DQ6 A;  3BUM B;  3EK4 A;  2KI4 C;  2WCF A;  3DY9 A;  4PPJ A;  2KGR A;  1K9P A;  2ZRT A;  5T3I A;  5HBD A;  1MOU A;  3U0N A;  3LK0 A;  2IOV A;  4XJK B;  3V2L A;  1XFZ O;  2DDD A;  3WLC A;  2PQL A;  3BXA A;  1NCZ A;  1EL4 A;  3DD4 A;  1YX7 A;  3P8U A;  1KFU S;  2ZO7 A;  3TDU A;  2VZX A;  3PJI A;  5D3O A;  1K93 D;  4OGS A;  2VRG A;  2PMY A;  3AI4 A;  1XAE A;  1NP8 A;  1ODB A;  2NCO A;  1CB1 A;  1RMP A;  4JPZ B;  4Q9X A;  4BDU A;  1NX2 A;  4EMQ A;  1FW4 A;  1TTX A;  1EMM A;  5DTL A;  3LL8 B;  1GQM A;  4DKM A;  3DQ5 A;  1TOP A;  1DQE A;  1B7T Z;  1IKU A;  3WCK A;  1SL8 A;  2L50 A;  1BR1 B;  1Q4E A;  5EXU A;  1RTP 1;  2JTZ A;  3W1C A;  2DDC A;  1GM0 A;  1SW8 A;  2JT3 A;  4U8D A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  3H1R A;  4DXQ A;  4TZG A;  1XO5 A;  4BY5 A;  1AHR A;  1Q4A A;  3NHT A;  1N0Y A;  4Q04 A;  2Y1M A;  3SG3 A;  4PFE A;  1GGX A;  2LCP A;  1Q4D A;  1LKJ A;  2HQK A;  2V53 A;  1YJF A;  5CPV A;  2HGD A;  5PAL A;  4JQ0 D;  1XFV O;  2A47 A;  1DF0 B;  2HFC A;  2Y0G A;  3EVU A;  1C3Y A;  1YX8 A;  1TNX A;  3W1D A;  3BUW B;  3R1O A;  4DCK A;  2WUR A;  4Q9W A;  1S5G Z;  3PJ5 A;  1DJI A;  2P70 A;  1UP5 A;  5FVF A;  4JD9 A;  2IE2 A;  2P71 A;  2ISD A;  2PXW A;  1YFP A;  3KCS A;  3D73 A;  2CTN A;  3AKO A;  1BJF A;  2PAL A;  3VHT B;  3CR4 X;  1FBV A;  3R1V A;  3SST A;  2CCM A;  5LK4 A;  1QX2 A;  2JXC A;  1SY9 A;  3DQE A;  2LHI A;  1YUU A;  2HJO A;  4NWS A;  5KTY A;  4M2P A;  1YUS A;  5HLV A;  2FJU B;  4L13 A;  3WNX B;  4EDO A;  5DRF A;  1CDP A;  4QJ4 B;  2CXJ A;  3DQH A;  5K89 A;  1PRW A;  3K1K A;  4DXI A;  2MLE C;  2JNX A;  3CZ2 A;  3SSL A;  4KAG A;  3DQK A;  4OQW A;  4PPL A;  2MHH A;  2WC6 A;  1QV0 A;  4MZL A;  1A75 A;  1HCJ A;  1JF2 A;  3ZWH A;  1YZW A;  3BUN B;  4H47 A;  3VB1 A;  2PAS A;  3PJB A;  2QRF A;  3PIB A;  1SSE B;  4W7F A;  4D1E A;  1Z1P A;  4DXP A;  2V4E A;  1F54 A;  2K8M B;  1BLQ A;  4PE4 A;  1UHI A;  1MR8 A;  2QEH A;  4WQ2 A;  5CSJ A;  1MQ1 A;  4ZIN A;  3TUY C;  3U8A A;  2H5Q A;  3I5H C;  2AWM A;  3VRO A;  1U5I B;  3QME A;  3EG5 B;  2KAY A;  2G6Y A;  4TZA A;  3OX5 A;  1SKT A;  2WOR A;  4W7D A;  1BU3 A;  2SAS A;  1KYR A;  1WRL A;  4I5J A;  1XFX O;  5DY6 A;  3PSR A;  5D7F A;  2M9G A;  4CPV A;  2AAO A;  3CZ1 A;  1DTL A;  5HGE A;  1J7P A;  3U0K A;  1U5I A;  5DPI A;  2WHT A;  1DJY A;  1G7K A;  1A29 A;  4GOB A;  3DVJ A;  3CFA A;  2MAZ A;  1XVJ A;  1M46 A;  1SR6 B;  5H87 A;  3IP2 A;  1ALV A;  4QJ5 B;  1KFU L;  2ZND A;  1QIV A;  3D77 A;  2KBI A;  2O24 A;  3B88 A;  2H5P A;  4DKN A;  4JC2 A;  4FQO A;  2D8N A;  1J7O A;  5H89 A;  3L47 A;  4AQI A;  1Q73 A;  1JC0 A;  1OZS A;  1UUR A;  4Z4M A;  5DRG A;  1PSB A;  4INX A;  1CMG A;  3BXB A;  3O77 A;  3TS5 C;  3CGA A;  1TWO A;  2WIS A;  1V1G A;  3U8P A;  2G9B A;  1TIZ A;  3CZT X;  3E5T A;  1WRK A;  2OTE A;  2QT2 A;  4MZK A;  4OHS A;  2E30 A;  3NT9 A;  1ZGQ A;  4LJB A;  2A52 B;  1Z2C B;  3DQM A;  2LM5 A;  1K9K A;  2FCE A;  4KF5 A;  2ZMU A;  3SVR A;  3LA1 A;  3NF0 A;  2ICR A;  5AER A;  2KLE A;  3LK1 A;  4ICB A;  1ZMZ A;  2KHN A;  1PUL A;  1G4Y R;  3GJ1 A;  2B1U A;  2AH8 A;  1L2O B;  4MEW A;  3PN7 C;  1RK9 A;  1J1E A;  1YUT A;  1S6Z A;  1B47 A;  3BJH A;  3JVT B;  2L0P A;  2KQY A;  2JUL A;  2QPT A;  2GW3 A;  4HQ8 A;  1RRX A;  1RFJ A;  2WC8 A;  3IQQ A;  1MYW A;  3O2P A;  4W6F A;  4USL A;  2POX A;  4PE7 A;  4GF6 B;  1QJT A;  4HRH A;  2M29 A;  3TDI A;  3VRQ A;  2HCG A;  1B1G A;  2Y5I A;  4DS7 A;  2F3Z A;  4W6L A;  4FTG A;  4I5L B;  4PHJ A;  4P1Q A;  2ZMW A;  1EMA A;  3NXA A;  5H88 A;  1QX5 B;  3L4L A;  3AAK A;  4JGE A;  5JOL A;  1UHJ A;  1TNP A;  3LS3 A;  1QV1 A;  2I18 A;  3NT3 A;  4PCW A;  4MBE A;  1Q4C A;  1NX0 A;  1JC1 A;  1J55 A;  1C7V A;  1PSR A;  1SL9 A;  2ZRS A;  2VAD A;  1IIO A;  5B8I B;  4U2V A;  1CLB A;  4W6P A;  3WHT B;  3AKB A;  4YI9 A;  1LXF C;  1OSA A;  3D76 A;  3DPZ A;  1KYP A;  1QLS A;  3DVE A;  2ARL A;  4P76 A;  2WCH A;  3O6B A;  1TRF A;  2NXQ A;  2AHA A;  1K95 A;  1SBJ A;  2RH7 A;  4PDZ A;  4Q7R A;  2IB5 A;  1AUI B;  2R2I A;  4YGB B;  5D69 A;  3IVT A;  4PHK A;  3U8C A;  4KYN A;  4LJD C;  1QS7 A;  2Q57 A;  2EMO A;  4GGN A;  1G33 A;  3HCM A;  1XMZ A;  5G08 A;  1YR5 A;  2FZU A;  3SG2 A;  2H8V A;  1CFP A;  5ER5 A;  4XL5 A;  3CB9 A;  5AEQ A;  3LLE A;  2LLU A;  3CDN A;  3SVS A;  4W7C A;  2C9J A;  3LSA A;  3FWB A;  4KA9 A;  2ZKM X;  2VVH A;  2BNX A;  1KSO A;  2Z6X A;  4W6N A;  4YBH B;  1YRT B;  2Q4U A;  2HQ8 A;  1J7Q A;  2PSR A;  1NX1 A;  1KK8 C;  1DJX A;  4MRX A;  2QLE A;  1JC2 A;  1MF8 B;  4MLW A;  4NQG A;  4IK5 A;  2H5O A;  1YHG A;  1OOI X;  4W6K A;  3LCP C;  1BR4 B;  4C0L A;  1FPW A;  2HET A;  3BXK A;  1DT7 B;  1QVI Z;  1JBY A;  2O5G A;  4DUQ A;  4F7F A;  3S0D A;  4ANJ A;  2KYC A;  1LA0 A;  1OXE A;  5GQQ C;  2KI4 B;  2Y4Q A;  3SVU A;  2YGU A;  3GK4 X;  1LA3 A;  5I94 A;  3DF0 B;  1QAT A;  1JUO A;  2EHB A;  1DJW A;  3U0M A;  4IK3 A;  3PJ7 A;  1XFR A;  4L12 A;  4ZIO A;  3I5F C;  1KK7 Z;  1CM4 A;  1IQ5 A;  1K96 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  1UUS A;  2Z6Y A;  1SL7 A;  3E5V A;  4XJK A;  3WHU B;  1F70 A;  2EGD A;  2EC6 C;  3SSP A;  1BOC A;  4XVP A;  2L4H A;  1MOV A;  5BTT B;  3UFZ A;  1W7U A;  1X02 A;  1PVB A;  4H48 A;  3I5I B;  1EG4 A;  4RTC A;  2ZNE A;  3DF0 A;  4HSZ A;  2DUG A;  2P6B B;  1G8I A;  5ER4 X;  2G2B A;  3DQI A;  2O2B A;  4H3N A;  1NCY A;  5DTZ A;  3S0F A;  1GGZ A;  1EXR A;  2Z6Z A;  3DQF A;  3IR8 A;  5DQM A;  2OKY A;  1XA9 A;  3E3R A;  4W6M A;  2LLT A;  3OBV A;  4XOW A;  4H3L A;  3CAB A;  3FE9 A;  5BTT A;  4CLN A;  2A48 A;  1NX3 A;  3ST2 A;  1CDL A;  3VGO A;  4IL1 A;  4KGF A;  4B5Y A;  1W7S A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  5HZU A;  1CNP A;  1QYQ A;  2KI6 D;  2LVK A;  2EMN A;  3SV5 A;  1F55 A;  5AFP A;  1A2X A;  5AQB B;  3B6X A;  4CID A;  4M2O A;  4L1I A;  2JC2 A;  4MRY A;  3DQ9 A;  2KFG A;  5EBJ A;  1MXE A;  3DPX A;  4W74 A;  4DXM A;  1DF0 A;  1REC A;  4PHM A;  4R1E A;  4NDB A;  3SSK A;  2QZ0 A;  1YJ2 A;  1OOH A;  2I2R E;  1B4C A;  1RRO A;  4CFR A;  1CKK A;  5EB6 A;  1HT9 A;  4R6D A;  1M63 B;  2V4E C;  2H2K A;  2O29 A;  5FYX A;  2AWJ A;  1D1O A;  3CLN A;  1ZAC A;  4MSP A;  5HZT A;  3CWG A;  4XGY A;  3OX6 A;  3WXA A;  2OTB A;  2LC5 A;  1S3P A;  2BCB A;  3VHT A;  1BOD A;  2JQ6 A;  1WLM A;  3D78 A;  4Z4K A;  2KYF A;  4ORN A;  4YI8 A;  2JPO A;  3CFH A;  3LVD A;  3EKJ A;  2KNE A;  3SG6 A;  3CZ0 A;  4L9M A;  1IH0 A;  2K60 A;  1KFX S;  2WIQ A;  2L5Y A;  3BXC A;  4ZCU A;  2L98 A;  3UG0 A;  4W6S A;  2GGZ A;  2OTG C;  3BOW B;  5HLO A;  1XFU O;  1C7W A;  3M0W A;  2K61 A;  3FIA A;  4PPK A;  3ADF A;  2NCP A;  4NDC A;  5DTY A;  5DIC A;  2WC5 A;  4YGA A;  2DUH A;  1TUZ A;  1EH2 A;  2SCP A;  2DD7 A;  2HGY A;  3RM1 A;  3TUY B;  4W6T A;  4OVN F;  4ETO A;  2WCJ A;  1WDC B;  2G3D B;  3DQN A;  3WLD A;  2IS9 A;  5FI6 A;  1LVC D;  2BAP A;  3TMT A;  3OB1 B;  2CBL A;  5HZS A;  2PRU A;  1Q80 A;  2QLI A;  2ZN9 A;  3FWC A;  1RJV A;  1B8C A;  2QU1 A;  1B8R A;  1CLM A;  1IJ6 A;  4CFQ A;  2LVV A;  4MVF A;  1H4B A;  1JBA A;  3MSE B;  2FCD A;  3DQD A;  1IGV A;  1OXF A;  1UHN A;  3LF4 B;  1JBZ A;  3KHE A;  1YTZ C;  2WCL A;  4WQ3 A;  4XOV A;  1SMG A;  4KF5 C;  3SS3 A;  4W6G A;  4LW5 A;  1LS8 A;  2OS8 B;  3DQ2 A;  2K2F A;  3DQO A;  4PT1 A;  5J2O A;  1DMO A;  3U0L A;  1MUX A;  1QWV A;  1T14 A;  3NSK A;  4GFT A;  2KFH A;  1NYA A;  3HX4 A;  4F0Z B;  2YE0 A;  3CS1 A;  2ZFD A;  2WHU A;  2G16 B;  1PAL A;  3DQA A;  4J89 A;  5F9G A;  2VVJ A;  3SSY A;  1UIS A;  2TN4 A;  3DQ8 A;  1C07 A;  5HKZ A;  1XYD A;  3GK2 A;  3Q8I A;  2A56 B;  4IZN A;  3VIC A;  2VVI A;  4HE4 A;  1ZGP A;  3RWA A;  2K7B A;  2JAD A;  3A8S A;  2CNP A;  4EDS A;  5CSI A;  3DVM A;  4N1F A;  3AAJ A;  4ZFS A;  1UWO A;  5JJG A;  3NED A;  1PVA A;  1RM9 A;  1GGW A;  4J8A A;  3EKH A;  3KO0 A;  2JPT A;  4PE1 A;  2A54 B;  2HQZ A;  4GBA A;  4KEX A;  4OZD A;  1CFC A;  2JTT A;  3PFV A;  3V3D A;  1NCX A;  5I2Q A;  3VK1 A;  3JVT C;  2G2S B;  5DPJ A;  1GFL A;  1KQM B;  5HYD A;  2KAX A;  4I5N B;  2WSO A;  4I5K A;  1AJ5 A;  2LLS A;  1F8H A;  5KU1 A;  3OB2 B;  3CD1 A;  1QYO A;  1F71 A;  3PN7 B;  3QRX A;  1BMO A;  3R72 A;  3EVV A;  3S0G A;  4YGE B;  2MA2 A;  4MN0 A;  1P28 A;  2ZN8 A;  1A03 A;  3LVC A;  4ZB1 A;  2K2A A;  3CR5 X;  3O4Y A;  2KAV A;  2LMT A;  2QEO A;  3FE6 A;  1S26 D;  1SYM A;  2JZI A;  2BKH B;  4BY4 A;  2Y1N A;  1LIN A;  2JT8 A;  4P5O E;  3BUX B;  3NEZ A;  1F4Q A;  2QEB A;  4R6B A;  5FI2 A;  5HZO A;  2FWQ A;  3OGN A;  3JTD C;  4LQT A;  1YHH A;  2H6V A;  2H61 A;  2L5X B;  2Q91 A;  5HW9 A;  1CFF A;  1K8U A;  3MGF A;  1OE9 B;  2JU0 A;  1FF1 A;  3H1O A;  1HQV A;  1Z1Q A;  1H4U A;  3BFH A;  4DXN A;  1OW4 A;  4W73 A;  4GNK B;  3ST4 A;  3TZ1 A;  3TMR A;  2IB6 A;  2K7C A;  3A8R A;  2L2C A;  2H5R A;  4GGF A;  2B3P A;  1KWO B;  1ZUZ A;  2JOJ A;  1SCM C;  5FHV A;  3FE8 A;  2H9W A;  5CSN A;  3BFB A;  3NSI A;  3RWT A;  3IF7 A;  2FJY A;  1L7Z A;  4W6R A;  5IBW A;  1CFD A;  1EMB A;  5DPH A;  3SJS A;  2QLG B;  2RGI A;  2A53 B;  4W69 A;  1DC1 A;  3K1E A;  2AMI A;  1AVS A;  1BT6 A;  1W7I B;  3DQU A;  1B8L A;  2BL0 B;  5I8N A;  1W7T A;  4AS8 A;  1KCY A;  4W6I A;  4GES B;  1XSS A;  4OJ0 A;  3CR2 A;  3M22 A;  1SPY A;  1XK4 A;  4UTS A;  1AP4 A;  3UO9 A;  5FVG A;  3PM2 A;  2MBX A;  3PAL A;  2KDH A;  4J88 A;  2GX2 A;  1H8B A;  2LVJ A;  2KBM A;  2LV7 A;  1KYS A;  3ZTF A;  3OGO A;  3PAT A;  4GAO A;  3I5G C;  3OSR A;  4IJ7 A;  1CTR A;  2QLG A;  5F6T A;  2YDZ A;  5KTG A;  1JSA A;  1KQV A;  2L4I A;  3BUO B;  2LNK A;  1QLK A;  4DXO A;  4LJD A;  3M24 A;  3GEX A;  2KPH A;  2YFP A;  5AXI A;  3NSL A;  4HRG A;  1BG1 A;  1NIW A;  2C9I A;  1Q4B A;  2F8P A;  3B86 A;  1QY3 A;  5DKN A;  4W6B A;  1Y1A A;  5FI7 A;  4I2Y A;  2M0R A;  2L51 A;  2ZO6 A;  2QAC A;  3PLF B;  3GL4 A;  2QEV A;  3DQ4 A;  1B9A A;  1HUY A;  2JRF A;  2M97 A;  1NSH A;  1QYF A;  2KI6 C;  1DJZ A;  5LTP A;  3O4X A;  1OMD A;  1OOG A;  4NDD A;  2JWW A;  1Y1X A;  1BFP A;  2DUI A;  1EMC A;  3RLZ A;  1YHI A;  1ALW A;  1NPQ A;  4W6U A;  1XA5 A;  1RWY A;  3DQC A;  4KW9 A;  3K21 A;  1WY9 A;  1M31 A;  4N1G A;  1OMR A;  2PXS A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  3I5I C;  2G6X A;  2I7A A;  1XQM A;  2MRD A;  2K7O A;  1EG3 A;  4Q7U A;  1Y0V H;  3IQO A;  4KPI A;  4W6J A;  4W75 A;  3TDZ A;  1OXD A;  2LAN A;  4ZF5 A;  2M8U A;  2EC6 B;  4OV2 A;  2MJW B;  3UNW A;  4KW8 A;  3BYA A;  3SG7 A;  5DPG A;  4HQC A;  1ZGO A;  3NSO A;  1VRK A;  1S6J A;  2WOS A;  4A4C A;  3P28 A;  1NUB A;  2OPO A;  2BCX A;  2OJK A;  3OP0 A;  3ZUF A;  3DZT A;  3GK1 A;  1QXT A;  5HKY A;  1EMG A;  2NZ0 A;  2HPW A;  1TN4 A;  4N5X A;  4PE0 A;  1GJY A;  1SNL A;  3GJ2 A;  4H3M A;  1QVI Y;  2G6E A;  2JNF A;  1XFY O;  1TUJ A;  3GB3 A;  3D0Y B;  2DUF A;  1KP5 A;  4JF9 A;  1CDN A;  4ZF4 A;  4AOM A;  2HPS A;  4TNC A;  3R1P A;  4GUK A;  2COL B;  3SVC A;  4LJC A;  2B3Q A;  4INW A;  1EME A;  2JT0 A;  1C4F A;  2L2E A;  1W9Z A;  1J7R A;  1KK7 Y;  2Z1O A;  1B7T Y;  4AR7 A;  3A4U B;  4B30 B;  3D0Y A;  1A75 B;  2GX0 A;  1IWQ A;  1B9C A;  3DQL A;  3KEV A;  2JXL A;  3S05 A;  1A4P A;  1DJH A;  5AAN A;  1GL4 A;  3EVP A;  1S6I A;  2V4E B;  1DEK A;  4OR9 B;  4W7E A;  4P2Y B;  4YRU A;  3ST0 A;  1CDM A;  4W7X A;  1QIW A;  4YGC B;  4C0K A;  5EHU A;  2ERB A;  1AK8 A;  2G5Z B;  2DD9 A;  3SS5 A;  1H6R A;  4W7R A;  2GW4 B;  1EML A;  3CTN A;  2LP3 A;  4B30 A;  1K2H A;  4JKT A;  1OMV A;  2F2O A;  2KFF A;  2A50 B;  2A46 A;  2CT9 A;  2BCA A;  3SVN A;  1NWD A;  1IRJ A;  1S5G Y;  2OKW A;  4KF4 A;  1K9U A;  1N2D A;  4RYS A;  2AWK A;  1SCV A;  2WCE A;  1WLZ A;  4KGE A;  1XFW O;  4ORA B;  1C3Z A;  3B7A A;  2OTG B;  3DPW A;  5BT0 A;  2BTJ A;  3I5H B;  1DGU A;  1OOF A;  1SRA A;  1WDC C;  2KLD A;  3CD9 A;  1S36 A;  1AJ4 A;  1IG5 A;  4JEO A;  4OKH A;  4OCI A;  1DVI A;  3RZS A;  2BKI B;  3BOW A;  2A4J A;  4IK8 A;  3GOF A;  3ICB A;  2LUX A;  3H4S E;  1F0B A;  1CLL A;  4IK9 A;  4HVF A;  4ZBL A;  1OZO A;  5DTX A;  2M1K B;  1YVL A;  3S0B A;  3SS4 A;  1Y1U A;  5DQB A;  3DVK A;  1ZOT B;  1JWD A;  2Q6P A;  2MLF C;  4FQT A;  3NGV A;  3OSQ A;  3S0E A;  1SR6 C;  3SSV A;  3S0A A;  5FVI A;  1KSM A;  5LTQ A;  1QX7 A;  1TCO B;  2F2P A;  2OS8 C;  3EVR A;  2LE9 B;  5EL2 A;  3VRN A;  3SVD A;  5LTR A;  2H8Q A;  2LP2 A;  1UHH A;  2F3Y A;  3BQ3 A;  2HRS A;  2LMU A;  1JF0 A;  2HF5 A;  2P4M A;  2WND A;  1F09 A;  5DKR A;  2QDI A;  4EN1 A;  4XYN A;  1QTX A;  1CM1 A;  4A4B A;  4IK4 A;  3OHM B;  4KW4 A;  4E68 A;  3F45 A;  1R6P A;  2M7L A;  2BE4 A;  2M7N A;  3EK8 A;  4RYW A;  3N7H A;  1JFJ A;  3KPX A;  5EB7 A;  1R2U A;  3DYE A;  4JRB A;  3TS5 B;  2QLH A;  1YUR A;  2WCK A;  3SG5 A;  2WHS A;  3EK7 A;  2DUE A;  3O78 A;  3L4A A;  4LQU A;  1N65 A;  1L2O C;  4PAL A;  1SK6 D;  4W6H A;  4W77 A;  1EMF A;  4Q7T A;  2LMV A;  3SVB A;  1TNW A;  3BFA A;  1FI5 A;  3ZUJ A;  1KQM C;  2KOT A;  3LF3 A;  2GTE A;  1MHO A;  3ZNI A;  4AQJ A;  3CBE A;  3G9A A;  3D75 A;  5EJU A;  3DQ3 A;  4HRE E;  2LHL A;  4W7A A;  5HL1 A;  2H61 C;  5EXC I;  2KGB C;  2FL1 A;  2WCB A;  2KSP A;  1ORG A;  2WCM A;  2M1U A;  3D74 A;  2DOQ A; 
#chains in the Genus database with same CATH homology
 2YE1 A;  1DJG A;  2GV5 A;  1DGV A;  3KCT A;  5DU0 A;  4UPG A;  3VRP A;  1QAS A;  2PVB A;  1FI6 A;  5BPJ A;  4DRW A;  4GGF C;  1ZFS A;  4W76 A;  1WRZ A;  4ZCV A;  3KF9 A;  3D10 A;  2WSN A;  4ZF3 A;  2OGR A;  2HQW A;  5CSF A;  2KQ6 A;  3SSH A;  2LAP A;  4HQ9 A;  4OY4 A;  1YRU B;  3SG4 A;  1CMF A;  2O60 A;  3FS7 A;  4W6O A;  4GPL B;  2VAE A;  5J3X A;  4N3D A;  5DKQ A;  3CGL A;  1K94 A;  3I19 A;  2E6W A;  3JTD B;  3SVE A;  1JFK A;  1XK4 C;  3ST3 A;  4PHN A;  3E5W A;  4QJ3 B;  1RMO A;  1CV7 A;  1OQP A;  1V1F A;  1KWO C;  3AKA A;  3CFF A;  5I2O A;  3DQJ A;  5BQL A;  5KSZ A;  2AWL A;  1W7J B;  3DQ1 A;  2K7D A;  4C0J A;  1TCF A;  3C1V A;  3DQ7 A;  3LVA A;  3SIB A;  5TNC A;  2BBM A;  1M45 A;  4IK1 A;  2BEC A;  1SCM B;  1M39 A;  2BL0 C;  1KFX L;  1PK0 D;  4W6C A;  2AUC A;  3AI5 A;  2NLN A;  2GGM A;  2I94 A;  4M2Q A;  3SVO A;  1E8A A;  4W6A A;  2F33 A;  4JWQ A;  5HKW A;  1YVH A;  1S1E A;  3SS0 A;  2BE6 A;  3ED8 A;  4ORC B;  2LVI A;  4DIR A;  1F4O A;  3PM8 A;  4EUL A;  3SRY A;  2M49 B;  3SIA A;  3BX9 A;  1ZUX A;  2EMD A;  1S6C A;  1TNQ A;  2G3O A;  1RMM A;  2K0J A;  3ZUL A;  2LUC A;  2M3W A;  4W6D A;  1KK8 B;  5EXB A;  1QXP A;  3I5G B;  4JFG A;  4YGD B;  1BF5 A;  4W72 A;  1EMK A;  3DQ6 A;  3BUM B;  3EK4 A;  2KI4 C;  2WCF A;  4PPJ A;  2KGR A;  1K9P A;  2ZRT A;  5T3I A;  5HBD A;  1MOU A;  3U0N A;  3LK0 A;  2IOV A;  4XJK B;  1XFZ O;  2DDD A;  3WLC A;  3BXA A;  1NCZ A;  1EL4 A;  3DD4 A;  1YX7 A;  3P8U A;  1KFU S;  2ZO7 A;  3TDU A;  2VZX A;  1K93 D;  4OGS A;  2VRG A;  2PMY A;  3AI4 A;  1XAE A;  1NP8 A;  1ODB A;  2NCO A;  1CB1 A;  1RMP A;  4JPZ B;  4Q9X A;  4BDU A;  1NX2 A;  4EMQ A;  1FW4 A;  1TTX A;  1EMM A;  5DTL A;  3LL8 B;  1GQM A;  4DKM A;  3DQ5 A;  1TOP A;  1B7T Z;  1IKU A;  3WCK A;  1SL8 A;  2L50 A;  1BR1 B;  1Q4E A;  5EXU A;  1RTP 1;  2JTZ A;  3W1C A;  2DDC A;  1SW8 A;  2JT3 A;  4U8D A;  3VRR A;  1J1D A;  4ORB B;  1IJ5 A;  3H1R A;  4DXQ A;  4TZG A;  1XO5 A;  4BY5 A;  1AHR A;  1Q4A A;  1N0Y A;  4Q04 A;  2Y1M A;  3SG3 A;  4PFE A;  1GGX A;  2LCP A;  1Q4D A;  1LKJ A;  2HQK A;  2V53 A;  1YJF A;  5CPV A;  2HGD A;  5PAL A;  4JQ0 D;  1XFV O;  2A47 A;  1DF0 B;  2HFC A;  2Y0G A;  3EVU A;  1YX8 A;  1TNX A;  3W1D A;  3BUW B;  4DCK A;  2WUR A;  4Q9W A;  1S5G Z;  3PJ5 A;  1DJI A;  1UP5 A;  5FVF A;  2IE2 A;  2ISD A;  2PXW A;  1YFP A;  3KCS A;  2CTN A;  3AKO A;  1BJF A;  2PAL A;  3VHT B;  3CR4 X;  1FBV A;  3SST A;  2CCM A;  5LK4 A;  1QX2 A;  2JXC A;  1SY9 A;  3DQE A;  2LHI A;  1YUU A;  2HJO A;  4NWS A;  5KTY A;  4M2P A;  1YUS A;  5HLV A;  2FJU B;  4L13 A;  3WNX B;  4EDO A;  5DRF A;  1CDP A;  4QJ4 B;  2CXJ A;  3DQH A;  5K89 A;  1PRW A;  3K1K A;  4DXI A;  2MLE C;  2JNX A;  3SSL A;  4KAG A;  3DQK A;  4OQW A;  4PPL A;  2MHH A;  1QV0 A;  4MZL A;  1A75 A;  1HCJ A;  1JF2 A;  3ZWH A;  1YZW A;  3BUN B;  4H47 A;  2PAS A;  3PJB A;  2QRF A;  3PIB A;  4W7F A;  4D1E A;  1Z1P A;  4DXP A;  2V4E A;  1F54 A;  2K8M B;  1BLQ A;  4PE4 A;  1UHI A;  1MR8 A;  4WQ2 A;  5CSJ A;  1MQ1 A;  4ZIN A;  3TUY C;  3U8A A;  2H5Q A;  3I5H C;  2AWM A;  3VRO A;  1U5I B;  2KAY A;  2G6Y A;  4TZA A;  3OX5 A;  1SKT A;  2WOR A;  4W7D A;  1BU3 A;  2SAS A;  1KYR A;  1WRL A;  4I5J A;  1XFX O;  5DY6 A;  3PSR A;  5D7F A;  2M9G A;  4CPV A;  2AAO A;  1DTL A;  5HGE A;  1J7P A;  3U0K A;  1U5I A;  5DPI A;  2WHT A;  1DJY A;  1G7K A;  1A29 A;  4GOB A;  3DVJ A;  3CFA A;  2MAZ A;  1XVJ A;  1M46 A;  1SR6 B;  5H87 A;  3IP2 A;  1ALV A;  4QJ5 B;  1KFU L;  2ZND A;  1QIV A;  2KBI A;  2O24 A;  2H5P A;  4DKN A;  4JC2 A;  4FQO A;  2D8N A;  1J7O A;  5H89 A;  4AQI A;  1Q73 A;  1JC0 A;  1OZS A;  1UUR A;  4Z4M A;  5DRG A;  1PSB A;  1CMG A;  3BXB A;  3O77 A;  3TS5 C;  3CGA A;  2WIS A;  1V1G A;  3U8P A;  2G9B A;  1TIZ A;  3CZT X;  3E5T A;  1WRK A;  2OTE A;  2QT2 A;  4MZK A;  4OHS A;  2E30 A;  3NT9 A;  1ZGQ A;  4LJB A;  2A52 B;  3DQM A;  2LM5 A;  1K9K A;  2FCE A;  4KF5 A;  2ZMU A;  3SVR A;  3LA1 A;  3NF0 A;  2ICR A;  5AER A;  3LK1 A;  4ICB A;  1ZMZ A;  2KHN A;  1PUL A;  1G4Y R;  3GJ1 A;  2B1U A;  2AH8 A;  1L2O B;  4MEW A;  3PN7 C;  1RK9 A;  1J1E A;  1YUT A;  1S6Z A;  1B47 A;  3JVT B;  2L0P A;  2KQY A;  2JUL A;  2QPT A;  2GW3 A;  4HQ8 A;  1RRX A;  1RFJ A;  2WC8 A;  3IQQ A;  1MYW A;  3O2P A;  4W6F A;  4USL A;  2POX A;  4PE7 A;  4GF6 B;  1QJT A;  4HRH A;  2M29 A;  3TDI A;  3VRQ A;  2HCG A;  1B1G A;  2Y5I A;  4DS7 A;  2F3Z A;  4W6L A;  4FTG A;  4I5L B;  4PHJ A;  4P1Q A;  2ZMW A;  1EMA A;  3NXA A;  5H88 A;  1QX5 B;  3AAK A;  4JGE A;  5JOL A;  1UHJ A;  1TNP A;  3LS3 A;  1QV1 A;  2I18 A;  3NT3 A;  4PCW A;  4MBE A;  1Q4C A;  1NX0 A;  1JC1 A;  1J55 A;  1C7V A;  1PSR A;  1SL9 A;  2ZRS A;  2VAD A;  5B8I B;  4U2V A;  1CLB A;  4W6P A;  3WHT B;  3AKB A;  4YI9 A;  1LXF C;  1OSA A;  3DPZ A;  1KYP A;  1QLS A;  3DVE A;  2ARL A;  4P76 A;  3O6B A;  1TRF A;  2NXQ A;  2AHA A;  1K95 A;  1SBJ A;  2RH7 A;  4PDZ A;  4Q7R A;  2IB5 A;  1AUI B;  2R2I A;  4YGB B;  5D69 A;  4PHK A;  3U8C A;  4LJD C;  1QS7 A;  2Q57 A;  2EMO A;  4GGN A;  1G33 A;  3HCM A;  1XMZ A;  5G08 A;  1YR5 A;  2FZU A;  3SG2 A;  1CFP A;  5ER5 A;  4XL5 A;  3CB9 A;  5AEQ A;  3LLE A;  2LLU A;  3SVS A;  4W7C A;  2C9J A;  3LSA A;  3FWB A;  4KA9 A;  2ZKM X;  2VVH A;  2Z6X A;  1KSO A;  4W6N A;  4YBH B;  1YRT B;  2Q4U A;  2HQ8 A;  1J7Q A;  2PSR A;  1NX1 A;  1KK8 C;  1DJX A;  4MRX A;  2QLE A;  1JC2 A;  1MF8 B;  4MLW A;  4NQG A;  4IK5 A;  2H5O A;  1YHG A;  4W6K A;  3LCP C;  1BR4 B;  4C0L A;  1FPW A;  2HET A;  3BXK A;  1DT7 B;  1QVI Z;  1JBY A;  2O5G A;  4DUQ A;  4ANJ A;  2KYC A;  1LA0 A;  1OXE A;  5GQQ C;  2KI4 B;  2Y4Q A;  3SVU A;  3GK4 X;  1LA3 A;  3DF0 B;  1QAT A;  1JUO A;  2EHB A;  1DJW A;  3U0M A;  4IK3 A;  3PJ7 A;  4L12 A;  4ZIO A;  3I5F C;  1KK7 Z;  1CM4 A;  1IQ5 A;  1K96 A;  2BBN A;  5I2L A;  1IQ3 A;  1K90 D;  1UUS A;  2Z6Y A;  1SL7 A;  3E5V A;  4XJK A;  3WHU B;  1F70 A;  2EGD A;  2EC6 C;  3SSP A;  1BOC A;  4XVP A;  2L4H A;  1MOV A;  5BTT B;  3UFZ A;  1W7U A;  1X02 A;  1PVB A;  4H48 A;  3I5I B;  1EG4 A;  4RTC A;  2ZNE A;  3DF0 A;  4HSZ A;  2DUG A;  2P6B B;  1G8I A;  5ER4 X;  2G2B A;  3DQI A;  2O2B A;  4H3N A;  1NCY A;  5DTZ A;  1GGZ A;  1EXR A;  2Z6Z A;  3DQF A;  3IR8 A;  5DQM A;  2OKY A;  1XA9 A;  3E3R A;  4W6M A;  2LLT A;  4XOW A;  4H3L A;  5BTT A;  4CLN A;  2A48 A;  1NX3 A;  3ST2 A;  1CDL A;  3VGO A;  4IL1 A;  4KGF A;  4B5Y A;  1W7S A;  1EJ3 A;  1MXL C;  1MWN A;  1OOJ A;  2FOT A;  5HZU A;  1CNP A;  1QYQ A;  2KI6 D;  2LVK A;  2EMN A;  3SV5 A;  1F55 A;  5AFP A;  1A2X A;  5AQB B;  4CID A;  4M2O A;  4L1I A;  2JC2 A;  4MRY A;  3DQ9 A;  2KFG A;  5EBJ A;  1MXE A;  3DPX A;  4W74 A;  4DXM A;  1DF0 A;  1REC A;  4PHM A;  4R1E A;  4NDB A;  3SSK A;  2QZ0 A;  1YJ2 A;  2I2R E;  1B4C A;  1RRO A;  4CFR A;  1CKK A;  5EB6 A;  1HT9 A;  4R6D A;  1M63 B;  2V4E C;  2H2K A;  2O29 A;  5FYX A;  2AWJ A;  1D1O A;  3CLN A;  1ZAC A;  4MSP A;  5HZT A;  3CWG A;  4XGY A;  3OX6 A;  3WXA A;  2OTB A;  2LC5 A;  1S3P A;  2BCB A;  3VHT A;  1BOD A;  2JQ6 A;  1WLM A;  4Z4K A;  2KYF A;  4ORN A;  4YI8 A;  3CFH A;  3LVD A;  3EKJ A;  2KNE A;  3SG6 A;  4L9M A;  1IH0 A;  1KFX S;  2WIQ A;  3BXC A;  4ZCU A;  2L98 A;  3UG0 A;  4W6S A;  2GGZ A;  2OTG C;  3BOW B;  5HLO A;  1XFU O;  1C7W A;  3M0W A;  2K61 A;  3FIA A;  4PPK A;  3ADF A;  2NCP A;  4NDC A;  5DTY A;  4YGA A;  2DUH A;  1EH2 A;  2SCP A;  2DD7 A;  2HGY A;  3RM1 A;  3TUY B;  4W6T A;  4OVN F;  4ETO A;  1WDC B;  2G3D B;  3DQN A;  3WLD A;  2IS9 A;  1LVC D;  3TMT A;  3OB1 B;  2CBL A;  5HZS A;  2PRU A;  1Q80 A;  2QLI A;  2ZN9 A;  3FWC A;  1RJV A;  1B8C A;  2QU1 A;  1B8R A;  1CLM A;  1IJ6 A;  4CFQ A;  2LVV A;  4MVF A;  1H4B A;  1JBA A;  3MSE B;  2FCD A;  3DQD A;  1IGV A;  1OXF A;  1UHN A;  3LF4 B;  1JBZ A;  3KHE A;  1YTZ C;  4WQ3 A;  4XOV A;  1SMG A;  4KF5 C;  4W6G A;  4LW5 A;  2OS8 B;  3DQ2 A;  2K2F A;  3DQO A;  5J2O A;  1DMO A;  3U0L A;  1MUX A;  3NSK A;  4GFT A;  2KFH A;  1NYA A;  3HX4 A;  4F0Z B;  2YE0 A;  3CS1 A;  2ZFD A;  2WHU A;  2G16 B;  1PAL A;  3DQA A;  4J89 A;  5F9G A;  2VVJ A;  3SSY A;  1UIS A;  2TN4 A;  3DQ8 A;  5HKZ A;  1C07 A;  1XYD A;  3GK2 A;  4IZN A;  2A56 B;  3VIC A;  2VVI A;  4HE4 A;  1ZGP A;  3RWA A;  2K7B A;  2JAD A;  3A8S A;  2CNP A;  4EDS A;  5CSI A;  3DVM A;  4N1F A;  3AAJ A;  4ZFS A;  1UWO A;  5JJG A;  3NED A;  1PVA A;  1RM9 A;  1GGW A;  4J8A A;  3EKH A;  3KO0 A;  2JPT A;  4PE1 A;  2A54 B;  2HQZ A;  4GBA A;  4KEX A;  1CFC A;  2JTT A;  3PFV A;  3V3D A;  1NCX A;  5I2Q A;  3VK1 A;  3JVT C;  2G2S B;  5DPJ A;  1GFL A;  1KQM B;  5HYD A;  2KAX A;  4I5N B;  2WSO A;  4I5K A;  1AJ5 A;  2LLS A;  1F8H A;  5KU1 A;  3OB2 B;  3CD1 A;  1QYO A;  1F71 A;  3PN7 B;  3QRX A;  1BMO A;  3EVV A;  4YGE B;  2MA2 A;  4MN0 A;  2ZN8 A;  1A03 A;  3LVC A;  4ZB1 A;  2K2A A;  3CR5 X;  3O4Y A;  2KAV A;  2LMT A;  1S26 D;  1SYM A;  2JZI A;  2BKH B;  4BY4 A;  2Y1N A;  1LIN A;  2JT8 A;  4P5O E;  3BUX B;  3NEZ A;  1F4Q A;  4R6B A;  5HZO A;  2FWQ A;  4LQT A;  3JTD C;  1YHH A;  2H6V A;  2H61 A;  2L5X B;  2Q91 A;  5HW9 A;  1CFF A;  1K8U A;  3MGF A;  1OE9 B;  2JU0 A;  1FF1 A;  3H1O A;  1HQV A;  1Z1Q A;  1H4U A;  4DXN A;  4W73 A;  4GNK B;  3ST4 A;  3TZ1 A;  3TMR A;  2IB6 A;  2K7C A;  3A8R A;  2H5R A;  4GGF A;  2B3P A;  1KWO B;  1ZUZ A;  2JOJ A;  1SCM C;  5FHV A;  2H9W A;  5CSN A;  3NSI A;  3RWT A;  3IF7 A;  1L7Z A;  4W6R A;  5IBW A;  1CFD A;  1EMB A;  5DPH A;  3SJS A;  2QLG B;  2RGI A;  2A53 B;  4W69 A;  2AMI A;  1AVS A;  1BT6 A;  1W7I B;  3DQU A;  1B8L A;  2BL0 B;  5I8N A;  1W7T A;  4AS8 A;  1KCY A;  4W6I A;  4GES B;  1XSS A;  4OJ0 A;  3CR2 A;  3M22 A;  1SPY A;  1XK4 A;  4UTS A;  1AP4 A;  5FVG A;  2MBX A;  3PAL A;  2KDH A;  4J88 A;  2GX2 A;  1H8B A;  2LVJ A;  2KBM A;  2LV7 A;  1KYS A;  3ZTF A;  3OGO A;  3PAT A;  4GAO A;  3I5G C;  3OSR A;  1CTR A;  2QLG A;  5F6T A;  2YDZ A;  5KTG A;  1JSA A;  1KQV A;  2L4I A;  3BUO B;  2LNK A;  1QLK A;  4DXO A;  4LJD A;  3M24 A;  3GEX A;  2YFP A;  5AXI A;  3NSL A;  4HRG A;  1BG1 A;  1NIW A;  2C9I A;  1Q4B A;  2F8P A;  1QY3 A;  5DKN A;  4W6B A;  1Y1A A;  4I2Y A;  2M0R A;  2L51 A;  2ZO6 A;  2QAC A;  3PLF B;  3GL4 A;  3DQ4 A;  1B9A A;  1HUY A;  2JRF A;  2M97 A;  1NSH A;  1QYF A;  2KI6 C;  1DJZ A;  5LTP A;  1OMD A;  4NDD A;  2JWW A;  1Y1X A;  1BFP A;  2DUI A;  1EMC A;  3RLZ A;  1YHI A;  1ALW A;  1NPQ A;  4W6U A;  1XA5 A;  1RWY A;  3DQC A;  4KW9 A;  3K21 A;  1WY9 A;  1M31 A;  4N1G A;  1OMR A;  2PXS A;  1UHK A;  3I5F B;  1Y6W A;  4MZJ A;  4WRI A;  3I5I C;  2G6X A;  2I7A A;  1XQM A;  2MRD A;  2K7O A;  1EG3 A;  4Q7U A;  1Y0V H;  3IQO A;  4KPI A;  4W6J A;  4W75 A;  3TDZ A;  1OXD A;  2LAN A;  4ZF5 A;  2M8U A;  2EC6 B;  4OV2 A;  2MJW B;  4KW8 A;  3BYA A;  3SG7 A;  5DPG A;  4HQC A;  1ZGO A;  3NSO A;  1VRK A;  1S6J A;  2WOS A;  4A4C A;  3P28 A;  1NUB A;  2OPO A;  2BCX A;  2OJK A;  3OP0 A;  3ZUF A;  3GK1 A;  1QXT A;  5HKY A;  1EMG A;  2NZ0 A;  2HPW A;  1TN4 A;  4N5X A;  4PE0 A;  1GJY A;  1SNL A;  3GJ2 A;  4H3M A;  1QVI Y;  2G6E A;  2JNF A;  1XFY O;  3GB3 A;  3D0Y B;  2DUF A;  1KP5 A;  4JF9 A;  1CDN A;  4ZF4 A;  4AOM A;  2HPS A;  4TNC A;  4GUK A;  2COL B;  3SVC A;  4LJC A;  2B3Q A;  1EME A;  2JT0 A;  1C4F A;  2L2E A;  1J7R A;  1KK7 Y;  2Z1O A;  1B7T Y;  4AR7 A;  3A4U B;  4B30 B;  3D0Y A;  1A75 B;  2GX0 A;  1IWQ A;  1B9C A;  3DQL A;  3KEV A;  2JXL A;  3S05 A;  1A4P A;  1DJH A;  5AAN A;  1GL4 A;  3EVP A;  1S6I A;  2V4E B;  4OR9 B;  4W7E A;  4P2Y B;  4YRU A;  3ST0 A;  1CDM A;  4W7X A;  1QIW A;  4YGC B;  4C0K A;  5EHU A;  1AK8 A;  2G5Z B;  2DD9 A;  1H6R A;  4W7R A;  2GW4 B;  1EML A;  3CTN A;  2LP3 A;  4B30 A;  1K2H A;  1OMV A;  2F2O A;  2KFF A;  2A50 B;  2A46 A;  2CT9 A;  2BCA A;  3SVN A;  1NWD A;  1IRJ A;  1S5G Y;  2OKW A;  4KF4 A;  1K9U A;  1N2D A;  4RYS A;  2AWK A;  1SCV A;  2WCE A;  1WLZ A;  4KGE A;  1XFW O;  4ORA B;  2OTG B;  3DPW A;  5BT0 A;  2BTJ A;  3I5H B;  1DGU A;  1SRA A;  1WDC C;  3CD9 A;  1S36 A;  1AJ4 A;  1IG5 A;  4JEO A;  4OKH A;  4OCI A;  1DVI A;  2BKI B;  3BOW A;  2A4J A;  4IK8 A;  3GOF A;  3ICB A;  2LUX A;  3H4S E;  1F0B A;  1CLL A;  4IK9 A;  4HVF A;  4ZBL A;  1OZO A;  5DTX A;  2M1K B;  1YVL A;  1Y1U A;  5DQB A;  3DVK A;  1ZOT B;  1JWD A;  2Q6P A;  2MLF C;  3OSQ A;  1SR6 C;  3SSV A;  5FVI A;  1KSM A;  5LTQ A;  1QX7 A;  1TCO B;  2F2P A;  2OS8 C;  3EVR A;  2LE9 B;  3VRN A;  3SVD A;  5LTR A;  2H8Q A;  2LP2 A;  1UHH A;  2F3Y A;  3BQ3 A;  2HRS A;  2LMU A;  1JF0 A;  2HF5 A;  2P4M A;  2WND A;  1F09 A;  5DKR A;  4EN1 A;  4XYN A;  1QTX A;  1CM1 A;  4A4B A;  4IK4 A;  3OHM B;  4KW4 A;  4E68 A;  3F45 A;  1R6P A;  2M7L A;  2BE4 A;  2M7N A;  3EK8 A;  4RYW A;  1JFJ A;  3KPX A;  5EB7 A;  1R2U A;  4JRB A;  3TS5 B;  2QLH A;  1YUR A;  3SG5 A;  2WHS A;  3EK7 A;  2DUE A;  3O78 A;  4LQU A;  1N65 A;  1L2O C;  4PAL A;  1SK6 D;  4W6H A;  4W77 A;  1EMF A;  4Q7T A;  2LMV A;  3SVB A;  1TNW A;  1FI5 A;  3ZUJ A;  1KQM C;  2KOT A;  3LF3 A;  1MHO A;  3ZNI A;  4AQJ A;  3CBE A;  3G9A A;  5EJU A;  3DQ3 A;  4HRE E;  2LHL A;  4W7A A;  2H61 C;  5EXC I;  2KGB C;  2FL1 A;  2WCB A;  2KSP A;  2M1U A;  2DOQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...