3EVRA

Crystal structure of calcium bound monomeric gcamp2
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
411
structure length
397
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 141
structure length 397
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evrA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evrA02
2COLB 1AP4A 4KW4A 1QIVA 1HUYA 4W6AA 3NEDA 1H6RA 1ZACA 5J3XA 5LK4A 3SVEA 4W6LA 1OMVA 2K61A 1B8CA 1ZMZA 1CDNA 2ZFDA 4P1QA 1NWDA 1G8IA 1XFZO 4L12A 2M9GA 2C9IA 1YR5A 1S5GZ 1S1EA 3LSAA 3KO0A 2LVJA 4GGFC 3ST0A 4BDUA 3P8UA 1X02A 5AFPA 2KBIA 2G6EA 5DY6A 2QZ0A 2QLGA 2P6BB 3W1CA 5I8NA 1R6PA 1S6JA 4LQTA 1DJWA 1AK8A 3LVAA 3DQEA 4YGAA 2H5QA 4LJCA 1CDMA 1AJ5A 3ADFA 2CBLA 1Q4BA 2AWLA 2FWQA 1CLMA 4XJKB 4DUQA 1UISA 1OXEA 2EHBA 2KYCA 3SRYA 2H61A 1WLZA 4ANJA 1MWNA 4W73A 3DQ1A 1K90D 1XO5A 2RGIA 3JTDC 3O77A 2JULA 3CR5X 3JVTB 4W6HA 2HCGA 3CD9A 1PULA 5BQLA 4KEXA 2DOQA 5B8IB 1CKKA 2HQKA 4PPJA 2KAVA 2CXJA 2NLNA 1F8HA 2CNPA 1UHIA 4WQ2A 4B30A 1UWOA 4E68A 3PIBA 1JUOA 3WHTB 5DQBA 4KW8A 1OXDA 2V53A 1JC2A 4ETOA 4XYNA 5HZTA 4W6TA 3HCMA 5AANA 1NP8A 1YVLA 3CGLA 4IK4A 1RMOA 2GW4B 1N65A 3UG0A 1KK8B 2Z1OA 2KAXA 1TNXA 5LTPA 3I5FC 1CV7A 3BUMB 1ALVA 4U8DA 1YVHA 2G3OA 3NT9A 4YBHB 3BXKA 2IB6A 5K89A 4RTCA 4N1GA 3AAKA 3CS1A 3CB9A 2WSNA 5DTZA 2JC2A 3KEVA 3BOWB 2CTNA 1MOUA 1PRWA 1OXFA 1CDPA 4Q9XA 1LVCD 2KSPA 2GV5A 3ZUFA 1QV1A 2M7NA 4P76A 4M2PA 2WC8A 3O2PA 1LA0A 2HQ8A 2Q6PA 1W7TA 3GEXA 2O29A 3WLCA 1YUSA 3E5VA 4L13A 3FWBA 4HRGA 1B8RA 3TUYB 2PXSA 3CD1A 3U8AA 2ZO7A 5JOLA 1MXEA 3AKAA 4R1EA 1KFXS 2VRGA 2Y1NA 1DJXA 1DVIA 1QTXA 4W6DA 1SCMB 3CBEA 1EL4A 1J55A 1TTXA 2ICRA 4NWSA 2F3ZA 3U0LA 2ZO6A 5DTYA 3SV5A 1A03A 3BX9A 2Z6ZA 2P4MA 3SVSA 2HRSA 1KQMC 2BE6A 2K7DA 3BXAA 1KYRA 3DQOA 4AQIA 3O78A 1L2OC 4P5OE 4LW5A 4JPZB 4IK5A 3SG6A 1YX8A 2E6WA 4TNCA 1RRXA 4GNKB 4ORNA 3PJ5A 1N0YA 4W6MA 4ZB1A 3NSIA 5AQBB 3EVRA 2NXQA 3SS0A 4PE0A 4JC2A 4XOVA 4XJKA 3ED8A 4JEOA 2YE0A 3IR8A 1KK7Z 4IK3A 5EHUA 5BTTA 1LXFC 2JNFA 3D0YA 4JFGA 1EMGA 2JT3A 3BXBA 4W6BA 3DQ8A 1W7JB 3ICBA 2MHHA 3K1KA 4RYSA 1J1DA 1WDCC 2ZNDA 1GGZA 1BMOA 3SVUA 2KI4B 1NX2A 2K2FA 1QASA 1A29A 2DUEA 2HQZA 1NIWA 3LCPC 2CCMA 4B30B 2HFCA 4YRUA 4PE4A 2M8UA 2IE2A 5DPHA 1YX7A 3BUWB 2OTBA 4IZNA 2ZNEA 3DQ5A 1F09A 1IGVA 2VADA 3TDUA 3DVMA 3TMTA 3GOFA 3PJBA 1C7VA 1S26D 5H88A 2TN4A 3SVDA 1EMCA 3CR2A 2K0JA 3M0WA 2B3PA 2ZRSA 1TNPA 4ORCB 2KBMA 2KGRA 4CLNA 3OP0A 1F54A 1DTLA 3PM8A 1QXTA 3GJ1A 4JWQA 1SCMC 4ORAB 2BKHB 4DKNA 2FZUA 1ZUZA 2HGDA 3O4YA 1HQVA 3DQ7A 1TN4A 3PFVA 1XFXO 2DUGA 2LVIA 5HYDA 3NF0A 1UUSA 3EVVA 1V1GA 1CB1A 3DVJA 2JNXA 1KYPA 4PCWA 3RWAA 1BODA 1H4BA 3O6BA 1JF0A 1S6CA 1WRLA 5HZOA 2GX2A 5AEQA 1IJ5A 4YGEB 2WURA 2GW3A 3DQAA 1MXLC 3IF7A 5DPIA 3I5GB 1Q4EA 3SSLA 3DVKA 1G7KA 3SG5A 2SCPA 2PVBA 4J88A 1V1FA 2KAYA 4XVPA 2JQ6A 3BQ3A 1Q4CA 3LF4B 5CSNA 1IQ3A 1ZGQA 3VRQA 2M1KB 4OJ0A 4H48A 2WHTA 5HKZA 2DD7A 2OS8B 1ZUXA 2LLSA 2PASA 1ZGOA 2IOVA 1H8BA 2WCEA 3OSQA 1JBZA 2L51A 3SJSA 1HT9A 1XAEA 1H4UA 3CFFA 3E3RA 2OPOA 1M31A 3DQDA 5HZUA 1LA3A 2OTGB 3I5HB 1CTRA 3DQFA 3VK1A 1CFDA 2H5OA 4P2YB 1OOJA 3I19A 1KFUS 1XK4A 5EJUA 4W74A 2WCBA 2EMOA 1SKTA 3VRNA 2Q91A 4W69A 4IL1A 1RFJA 4I5JA 2KGBC 5DRFA 2MRDA 5HKWA 2YFPA 3I5IC 2H6VA 4OKHA 3F45A 2M97A 4ZIOA 1EMBA 3CGAA 1YHHA 1KFXL 1MR8A 3TZ1A 2MAZA 4A4CA 1QX7A 3SVCA 2BBMA 2JT0A 4I5LB 3FIAA 2PSRA 2H8QA 4N1FA 5KTYA 1XQMA 4MZJA 2ISDA 1SMGA 4B5YA 1G4YR 4LJDC 3OSRA 5FVGA 1XFWO 1BF5A 2K2AA 1BJFA 1G33A 4H47A 1K93D 3EVPA 4MBEA 3DQMA 1SNLA 1KYSA 3D0YB 4GGNA 2QLGB 5KU1A 1JF2A 2KQ6A 1PSRA 1XYDA 4I5KA 4I5NB 4GBAA 1DJZA 3NT3A 1NCYA 5DPGA 2H61C 4JGEA 1QATA 1W7IB 1DJGA 2LAPA 2ZRTA 4PHKA 2LP2A 4L9MA 1B9CA 4HQCA 2I2RE 3CLNA 2NCOA 3DQUA 1NYAA 1CDLA 1K9KA 2F2PA 3LL8B 4HQ9A 2OTGC 4DXOA 2M0RA 3DQ2A 1J1EA 1IH0A 2K8MB 1ALWA 1ZOTB 4YGCB 3ZNIA 4KA9A 1W7UA 3LS3A 1B8LA 1JBAA 3P28A 1A4PA 4GF6B 1FF1A 4ZF5A 3ZUJA 1XA9A 4OCIA 2KFGA 4LQUA 4ZCVA 2VVJA 4EN1A 4W6GA 2BE4A 4PE7A 4UPGA 4DIRA 1SPYA 2ZMUA 1S36A 4W6FA 4KAGA 2YDZA 4W6NA 4H3NA 5HW9A 3DF0A 3DQ3A 4PPKA 4M2OA 2L0PA 4GUKA 4ORBB 1JWDA 2I94A 3V3DA 4C0LA 1NX3A 4NDCA 1C07A 4CIDA 1B47A 1Z1QA 1YHGA 2ZN8A 3TDIA 1ZFSA 2IB5A 3U0NA 1PALA 3DQNA 2LNKA 5T3IA 2C9JA 4W7CA 2KDHA 2EMNA 1UP5A 3U0MA 4OHSA 3G9AA 2KI6C 4OVNF 3BYAA 2BL0C 1QYFA 3C1VA 1MQ1A 4Q7RA 4EMQA 2LCPA 2DUFA 1SRAA 5D7FA 2A56B 4W7EA 3DF0B 2KI4C 1SW8A 4IK9A 1IRJA 2AMIA 2MBXA 1RTP1 3LVCA 5CSJA 5AERA 2AUCA 5I2QA 1CFCA 5EB6A 1WLMA 5KSZA 2A47A 3SSPA 1KK7Y 3A8SA 1PVAA 3I5IB 5J2OA 5BPJA 1DJYA 2L2EA 2GX0A 3OX5A 4XOWA 2VVIA 5LTQA 2LMTA 3EK8A 2AWJA 3BUOB 3BOWA 3EK7A 1CNPA 2WHSA 1GQMA 1HCJA 2KOTA 2M49B 3I5HC 2LM5A 3M22A 3SG2A 2L50A 1Q73A 2JT8A 1C4FA 4CFQA 3EVUA 2DD9A 2H9WA 1B1GA 2WSOA 2KQYA 4ZFSA 3IQOA 1K9PA 3AI5A 1B7TZ 2A54B 2QLIA 1YJFA 3OGOA 4GGFA 2BL0B 4JRBA 4W7FA 1B4CA 2QPTA 4TZGA 1JFKA 2JRFA 4DS7A 2A50B 2FJUB 4W6PA 1MHOA 4W6UA 3ST3A 4MN0A 5FHVA 3DD4A 1EMFA 1S6ZA 1IG5A 1TNQA 2OTEA 4KW9A 2LUCA 2Q4UA 2MLEC 1TIZA 2AWMA 5EB7A 4PHJA 2LMVA 1MYWA 3E5TA 2KNEA 1WRZA 1J7QA 5ER4X 4Z4KA 1EG4A 3AAJA 3RLZA 3DQIA 3SSYA 4USLA 2JPTA 1EMKA 1BG1A 1QLSA 5DRGA 1KQMB 2DUHA 1TOPA 2WISA 3CTNA 4GPLB 4YI9A 4KPIA 3LLEA 3DQ9A 1YFPA 1CMFA 1Y0VH 3LVDA 1YURA 2PMYA 2PXWA 1IKUA 3SVNA 5AXIA 3AKBA 3I5FB 3M24A 4W76A 5DKQA 4W6JA 1GFLA 3PJ7A 2OS8C 3DQCA 2JOJA 1NX1A 2CT9A 2D8NA 1VRKA 4OR9B 1EH2A 3DPZA 2LVVA 4D1EA 4NDBA 4HREE 4NQGA 2L4IA 1RJVA 2G16B 1UHKA 1SL7A 1TCOB 4DXNA 2MLFC 4XL5A 4C0JA 4H3MA 2BECA 4QJ3B 2QACA 3WNXB 1M39A 1XFVO 2LHIA 4U2VA 4YI8A 4EDSA 1EMMA 5CSFA 1M63B 4I2YA 3OHMB 1YTZC 1OMRA 2WORA 1AVSA 1OZOA 1Q4AA 2KYFA 1BT6A 1ODBA 2PALA 3OB1B 2O2BA 1Y1XA 4W6SA 5DKNA 4MSPA 2ZN9A 2HPSA 2WIQA 2AWKA 3DQKA 2HGYA 1NCZA 3DQLA 1J7RA 3GB3A 1Y1UA 5D69A 1TCFA 5DU0A 1W7SA 4CPVA 1EMEA 1YUTA 4W6KA 1KP5A 2A46A 1BU3A 1RMPA 3DPXA 3DQ4A 2IS9A 2AH8A 4KF4A 2RH7A 4IK1A 1LKJA 2ZKMX 1CLLA 5HZSA 1WRKA 1NCXA 1BR4B 4OY4A 1CM4A 3JVTC 5BT0A 4EDOA 4KGFA 1LINA 2B3QA 4L1IA 3JTDB 1F4OA 4ICBA 2EMDA 1BOCA 1SYMA 1FI5A 2L4HA 4UTSA 3H1RA 2HJOA 4DCKA 1IJ6A 1DT7B 4QJ4B 1Q80A 1BFPA 1K8UA 5HBDA 3TUYC 3NSOA 3TDZA 1WDCB 2LANA 1K2HA 2JADA 5BTTB 3PN7B 5DTXA 2JTTA 3CR4X 4HQ8A 1M46A 1RROA 5KTGA 3D10A 1MOVA 2O5GA 4HE4A 1KSMA 4W7AA 2M1UA 3VRPA 3I5GC 3H4SE 1XVJA 3CZTX 1DF0B 4DRWA 2FCDA 1EMAA 3WCKA 2GGMA 2FL1A 1MUXA 4FTGA 2L5XB 4DXPA 3CWGA 1JBYA 3BUXB 1L2OB 1PK0D 1KSOA 2Z6YA 3TMRA 2SASA 1CM1A 4ZBLA 3BXCA 2G6XA 3U8PA 2JXCA 2JXLA 4W75A 5HLVA 4A4BA 2Q57A 3VHTB 2G6YA 1CFFA 1XK4C 4AR7A 2M3WA 5F9GA 4GOBA 3LK1A 5CPVA 1OMDA 2WCFA 4W77A 1NX0A 2VVHA 3SSHA 4R6BA 4BY5A 2LHLA 3VICA 1CMGA 1XSSA 5I2LA 2QT2A 1DJIA 1XFYO 4XGYA 4NDDA 1AUIB 3SSTA 3LA1A 4OQWA 2ZMWA 4MEWA 4TZAA 2BCXA 1RM9A 2LLTA 3UFZA 1C7WA 1KWOC 1EMLA 4HVFA 1EXRA 1QVIZ 1L7ZA 1FPWA 1Z1PA 3PALA 1GGXA 1J7PA 2QU1A 1FI6A 3DQJA 3IQQA 1UHJA 1DJHA 1GL4A 1Y1AA 2Y4QA 1DF0A 1K96A 2K7OA 2AAOA 2G3DB 4ZF3A 1Q4DA 1UHHA 2Z6XA 3KCSA 5JJGA 3GK1A 4W72A 2BBNA 4F0ZB 2AHAA 3U8CA 4KGEA 2F33A 2QLEA 3SG4A 4KF5A 3DQHA 1SCVA 1SL8A 3PN7C 2LLUA 4JF9A 3FS7A 1S5GY 3EKHA 2K7CA 1AJ4A 3BUNB 5FYXA 3WLDA 4LJDA 2G9BA 1F0BA 2BTJA 4Q9WA 1K95A 2H2KA 4JQ0D 4ZF4A 3W1DA 4BY4A 4FQOA 3LK0A 2DUIA 3ST4A 2M29A 2KHNA 1QS7A 4PFEA 2B1UA 5HGEA 2V4EC 4YGBB 1KWOB 5F6TA 5FVFA 3VRRA 2BKIB 4MZKA 5GQQC 5IBWA 1PSBA 2HETA 3SSKA 2I7AA 2QLHA 4GAOA 4MRXA 3KF9A 2Y5IA 5DTLA 4W7RA 1YUUA 2LP3A 3WXAA 3MSEB 1S3PA 1NPQA 2WOSA 1UHNA 4MVFA 1XA5A 2PRUA 1F71A 4N3DA 1U5IB 2WNDA 3HX4A 3A8RA 3E5WA 5FVIA 3EK4A 1SR6B 1K94A 1JSAA 3CFAA 3EKJA 1Y6WA 4AS8A 1A75A 3ZULA 2M7LA 2HQWA 2VZXA 1QYQA 1XMZA 3AKOA 1JC1A 4PALA 1NSHA 4ZINA 2JTZA 2G5ZB 1ZGPA 2MJWB 3IP2A 4GFTA 2NZ0A 2LV7A 2WHUA 2A4JA 5I2OA 2E30A 4MLWA 2GGZA 3NEZA 4IK8A 3A4UB 1KK8C 2F3YA 1AHRA 1B9AA 1RECA 3GK2A 3AI4A 2VAEA 3ST2A 1GJYA 3VROA 2LUXA 4C0KA 4PHMA 4PPLA 2V4EA 1SR6C 1F4QA 1DMOA 3OB2B 5HLOA 2A53B 5ER5A 2F8PA 2KI6D 5TNCA 4QJ5B 3PLFB 1QJTA 1YZWA 1KFUL 4PE1A 3NXAA 3GL4A 4RYWA 3ZTFA 2QRFA 2LMUA 2I18A 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 1M45A 2JWWA 2KFFA 3TS5C 3SG3A 1FBVA 5DQMA 3DPWA 4DXMA 1OZSA 4N5XA 1EJ3A 4W6IA 1QIWA 5H87A 4OV2A 4KF5C 1SY9A 4AOMA 5G08A 3RM1A 2V4EB 2EGDA 1SL9A 3NSKA 1KCYA 4Q7UA 1RK9A 2G2SB 4W7XA 2LC5A 1JC0A 1QV0A 1CFPA 1UURA 2H5PA 4Q7TA 1KQVA 2BCBA 1JFJA 1QYOA 4W6OA 2OKYA 1CLBA 4J89A 1BLQA 1IQ5A 3KPXA 1F70A 2R2IA 3SIBA 1QXPA 4YGDB 1RMMA 2O24A 4MZLA 3QRXA 1YRTB 4HSZA 5DKRA 3SVRA 4W6RA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1XFUO 1QY3A 4ZCUA 3SIAA 1DGVA 2Y1MA 4PHNA 4EULA 1SK6D 5CSIA 3PSRA 3PATA 4M2QA 3SVBA 1PVBA 2OKWA 1WY9A 1B7TY 2HF5A 5HKYA 2MA2A 1QLKA 4MRYA 2BCAA 1D1OA 2DDCA 4GESB 4DXQA 5EBJA 4R6DA 1FW4A 1OE9B 1OQPA 1K9UA 2JU0A 2OGRA 1QX2A 1IWQA 4H3LA 1S6IA 4DXIA 1YJ2A 3DVEA 1U5IA 4Q04A 4J8AA 4LJBA 3KHEA 3CFHA 2LE9B 3KCTA 1YHIA 1QX5B 2K7BA 1YRUB 3VHTA 2LVKA 2A48A 2Y0GA 4OGSA 3OX6A 2H5RA 3ZWHA 5H89A 3SVOA 3GJ2A 5EXUA 3GK4X 4PDZA 3K21A 2O60A 5EXCI 1F55A 1GGWA 2JZIA 1E8AA 1A75B 4WQ3A 3RWTA 2F2OA 3FWCA 3LF3A 2POXA 1EG3A 2HPWA 1N2DA 2DDDA 3SG7A 5EXBA 3SSVA 3WHUB 3DQ6A 3TS5B 3S05A 4HRHA 2KFHA 3U0KA 4W7DA 2EC6B 1MF8B 2NCPA 1DGUA 3NSLA 1NUBA 4W6CA 5LTRA 1A2XA 1QVIY 1RWYA 4DKMA 2FOTA 1TNWA 5PALA 3VGOA 2A52B 2YE1A 3MGFA 4WRIA 2ARLA 2L98A 4Z4MA 2OJKA 1OSAA 3H1OA 5DPJA
chains in the Genus database with same CATH superfamily
2COLB 1AP4A 4KW4A 1QIVA 1HUYA 4W6AA 3NEDA 1H6RA 1ZACA 3L4LA 5J3XA 5LK4A 3SVEA 4W6LA 1OMVA 2K61A 1B8CA 1ZMZA 1CDNA 2ZFDA 4P1QA 1NWDA 1G8IA 1XFZO 4L12A 2M9GA 2C9IA 1YR5A 1S5GZ 1S1EA 3LSAA 3KO0A 2WCMA 2LVJA 4GGFC 3ST0A 4BDUA 3P8UA 1X02A 5AFPA 2KBIA 2G6EA 5DY6A 2QZ0A 2QLGA 2P6BB 3W1CA 5I8NA 1R6PA 1S6JA 3VB1A 4LQTA 1DJWA 1AK8A 3LVAA 3DQEA 4YGAA 2H5QA 4LJCA 1CDMA 1AJ5A 3ADFA 2CBLA 2GTEA 1Q4BA 2AWLA 2FWQA 1CLMA 4XJKB 4DUQA 1UISA 3B88A 1OXEA 2EHBA 1W9ZA 2KYCA 3SRYA 2H61A 1WLZA 4ANJA 1MWNA 4W73A 3DQ1A 1K90D 1XO5A 2RGIA 3JTDC 3O77A 2JULA 3CR5X 3JVTB 4IJ7A 4W6HA 2HCGA 3CD9A 1PULA 5BQLA 4KEXA 2DOQA 5B8IB 1CKKA 2HQKA 3IVTA 4PPJA 2KAVA 2CXJA 2NLNA 1F8HA 2CNPA 1UHIA 1C3ZA 4WQ2A 4B30A 1UWOA 4E68A 1TWOA 3PIBA 1JUOA 3WHTB 5DQBA 4KW8A 1OXDA 2V53A 1JC2A 4ETOA 3DYEA 4XYNA 5HZTA 4W6TA 3HCMA 5AANA 1NP8A 1YVLA 3CGLA 4IK4A 2WCJA 1RMOA 2GW4B 1N65A 3UG0A 1KK8B 2Z1OA 2KAXA 1TNXA 5LTPA 3I5FC 1CV7A 3BUMB 3D73A 3FE9A 1ALVA 4U8DA 1YVHA 2G3OA 3NT9A 4YBHB 3BXKA 2IB6A 5K89A 4RTCA 4N1GA 3AAKA 3CS1A 3CB9A 2WSNA 5DTZA 2JC2A 3KEVA 3BOWB 2CTNA 1MOUA 1PRWA 1OXFA 1CDPA 4Q9XA 1LVCD 2KSPA 2GV5A 3ZUFA 1QV1A 3CYZA 2M7NA 4P76A 1DEKA 4M2PA 1LS8A 2WC8A 3O2PA 1LA0A 2HQ8A 2Q6PA 1W7TA 3GEXA 2O29A 3WLCA 1YUSA 3E5VA 3RZSA 4L13A 3FWBA 4HRGA 1B8RA 3TUYB 2PXSA 3CD1A 3U8AA 2ZO7A 5JOLA 1MXEA 3AKAA 4R1EA 1KFXS 2VRGA 2Y1NA 1DJXA 1DVIA 1QTXA 4W6DA 1SCMB 3CBEA 1EL4A 1T14A 1J55A 4JKTA 1TTXA 2ICRA 4NWSA 2F3ZA 3U0LA 2ZO6A 5DTYA 3SV5A 1A03A 3BX9A 2Z6ZA 2P4MA 3SVSA 2HRSA 1KQMC 2BE6A 2K7DA 3BXAA 1KYRA 3DQOA 4AQIA 3O78A 1L2OC 4P5OE 4LW5A 4JPZB 4IK5A 3SG6A 1YX8A 2E6WA 4TNCA 1RRXA 4GNKB 4ORNA 3PJ5A 1N0YA 3S0AA 4W6MA 4ZB1A 3NSIA 5AQBB 3EVRA 2NXQA 3SS0A 4PE0A 4JC2A 1OOFA 4XOVA 4XJKA 3R1VA 3ED8A 4JEOA 2YE0A 3IR8A 1KK7Z 4IK3A 5EHUA 5BTTA 1LXFC 2JNFA 4JFGA 3D0YA 1EMGA 2JT3A 3BXBA 4W6BA 3DQ8A 1W7JB 3ICBA 2MHHA 3K1KA 4RYSA 1J1DA 1WDCC 2ZNDA 1GGZA 1BMOA 3SVUA 2KI4B 1NX2A 2K2FA 1QASA 1A29A 3FE8A 2DUEA 2HQZA 1NIWA 3LCPC 2CCMA 2HFCA 4B30B 4YRUA 4PE4A 2M8UA 2IE2A 5DPHA 1YX7A 3BUWB 2OTBA 4IZNA 2ZNEA 3DQ5A 1F09A 1IGVA 2P71A 1ORGA 2VADA 3CZ1A 3TDUA 3DVMA 3TMTA 3GOFA 3PJBA 1C7VA 1S26D 5H88A 2TN4A 3SVDA 3CZ2A 1EMCA 3CR2A 2K0JA 3M0WA 2B3PA 2ZRSA 1TNPA 4ORCB 2KBMA 2KGRA 3OGNA 4CLNA 3OP0A 1F54A 3BJHA 1DTLA 3PM8A 1QXTA 3GJ1A 4JWQA 1SCMC 4ORAB 2BKHB 4DKNA 2FZUA 1ZUZA 2HGDA 3O4YA 1HQVA 3DQ7A 1TN4A 3PFVA 1XFXO 2DUGA 2LVIA 5HYDA 3NF0A 1UUSA 3EVVA 1V1GA 1CB1A 3DVJA 2JNXA 1KYPA 4PCWA 3RWAA 1BODA 1H4BA 3O6BA 1JF0A 3L47A 1S6CA 1WRLA 5HZOA 2GX2A 5AEQA 1IJ5A 4YGEB 2WURA 2GW3A 3DQAA 1MXLC 2WCLA 3B86A 3IF7A 5DPIA 3I5GB 1Q4EA 3SSLA 3DVKA 1G7KA 3SG5A 2SCPA 2PVBA 4J88A 1V1FA 2KAYA 4XVPA 2JQ6A 3BQ3A 1Q4CA 3LF4B 5CSNA 1IQ3A 1ZGQA 3VRQA 2M1KB 4OJ0A 2KLEA 4H48A 2WHTA 5HKZA 3DZTA 2DD7A 2OS8B 1ZUXA 2LLSA 2PASA 1ZGOA 2IOVA 1H8BA 2WCEA 3OSQA 1JBZA 2L51A 3SJSA 1HT9A 1XAEA 1H4UA 3D78A 3CFFA 3E3RA 2OPOA 1M31A 3DQDA 5HZUA 1LA3A 2OTGB 3I5HB 1TUJA 1CTRA 3DQFA 3VK1A 1CFDA 2H5OA 4P2YB 1OOJA 3I19A 5D3OA 1KFUS 1XK4A 5EJUA 4W74A 2WCBA 2EMOA 1SKTA 3VRNA 2Q91A 4W69A 4IL1A 1RFJA 4I5JA 2KGBC 5DRFA 2MRDA 5HKWA 2YFPA 4INXA 3I5IC 2H6VA 4OKHA 3F45A 2M97A 4ZIOA 1EMBA 3CGAA 1YHHA 1KFXL 1MR8A 3TZ1A 3S0FA 2MAZA 4A4CA 1QX7A 3SVCA 2BBMA 2JT0A 4I5LB 3FIAA 2PSRA 3Q8IA 2H8QA 4N1FA 5KTYA 1XQMA 4MZJA 2ISDA 1SMGA 4B5YA 1G4YR 4LJDC 3OSRA 5FVGA 1XFWO 4KYNA 1BF5A 2K2AA 2WCKA 1BJFA 1G33A 4H47A 1K93D 3EVPA 4MBEA 3DQMA 1SNLA 1KYSA 3S0EA 3D0YB 4GGNA 3S0BA 2QLGB 5KU1A 1JF2A 2KQ6A 1PSRA 1XYDA 4I5KA 4I5NB 4GBAA 1DJZA 3NT3A 1NCYA 3UNWA 5DPGA 2H61C 1TUZA 4JGEA 1QATA 1W7IB 3QMEA 1IIOA 1DJGA 2LAPA 2ZRTA 4PHKA 2LP2A 4F7FA 4L9MA 1B9CA 4HQCA 2I2RE 3V2LA 3CLNA 2NCOA 3DQUA 1NYAA 1CDLA 1K9KA 2F2PA 3LL8B 4HQ9A 2OTGC 4DXOA 1GM0A 2M0RA 3DQ2A 1J1EA 1IH0A 2K8MB 1ALWA 1ZOTB 4YGCB 3ZNIA 4KA9A 1W7UA 3LS3A 1B8LA 1JBAA 3P28A 1A4PA 4GF6B 1FF1A 4ZF5A 3ZUJA 1XA9A 4OCIA 2KFGA 4LQUA 4ZCVA 2VVJA 4EN1A 4W6GA 2BE4A 4PE7A 4UPGA 4DIRA 1SPYA 2ZMUA 1S36A 4W6FA 4KAGA 2YDZA 4W6NA 4H3NA 5HW9A 3DF0A 5FI6A 3DQ3A 4PPKA 2K60A 4M2OA 2L0PA 4GUKA 4ORBB 1JWDA 2I94A 3V3DA 4C0LA 1NX3A 4NDCA 1C07A 4CIDA 1B47A 1Z1QA 1YHGA 2ZN8A 3TDIA 5HL1A 1ZFSA 2IB5A 3U0NA 1PALA 3DQNA 2LNKA 5T3IA 2C9JA 4W7CA 2KDHA 2EMNA 1UP5A 3BFBA 3U0MA 4OHSA 3G9AA 3B7AA 2KI6C 3O4XA 4OVNF 3BYAA 1C3YA 2BL0C 1QYFA 3C1VA 1MQ1A 4Q7RA 4EMQA 1OOIX 2LCPA 2DUFA 1SRAA 3SS3A 5D7FA 2A56B 4W7EA 3DF0B 2KI4C 1SW8A 4IK9A 1IRJA 2AMIA 2MBXA 1RTP1 3LVCA 5CSJA 5AERA 2AUCA 5I2QA 1CFCA 5EB6A 3NHIA 1WLMA 5KSZA 2A47A 3SSPA 1KK7Y 3A8SA 1PVAA 3I5IB 5J2OA 5BPJA 1DJYA 2L2EA 2GX0A 3OX5A 4XOWA 2VVIA 2BAPA 2WC5A 5LTQA 2LMTA 3EK8A 2AWJA 3BUOB 3BOWA 3EK7A 1CNPA 2WHSA 1GQMA 1HCJA 2KOTA 2M49B 3I5HC 2LM5A 3M22A 3SG2A 2L50A 2L2CA 1Q73A 2JT8A 1C4FA 4CFQA 3EVUA 2DD9A 2H9WA 1B1GA 2WSOA 2KQYA 4ZFSA 3IQOA 1K9PA 3AI5A 1B7TZ 2A54B 2QLIA 1YJFA 3OGOA 4GGFA 2BL0B 4JRBA 4W7FA 1B4CA 2QPTA 4TZGA 1JFKA 2JRFA 4DS7A 2A50B 2FJUB 4W6PA 1MHOA 4W6UA 3ST3A 4MN0A 5FHVA 3DD4A 1EMFA 1S6ZA 1IG5A 1TNQA 2OTEA 4KW9A 2LUCA 2Q4UA 2MLEC 1TIZA 2AWMA 5EB7A 4PHJA 2LMVA 1MYWA 3E5TA 2KNEA 1WRZA 1J7QA 5ER4X 4Z4KA 1EG4A 3AAJA 3RLZA 1DC1A 1XFRA 3D77A 3DQIA 3SSYA 4USLA 2JPTA 1EMKA 1BG1A 1QLSA 5DRGA 1KQMB 2DUHA 1TOPA 2WISA 3CTNA 4GPLB 1Z2CB 4YI9A 4KPIA 3LLEA 3DQ9A 1YFPA 1CMFA 1Y0VH 3LVDA 1YURA 2PMYA 2PXWA 1IKUA 3SVNA 5AXIA 3AKBA 3I5FB 3M24A 4W76A 5DKQA 4W6JA 1GFLA 3PJ7A 2OS8C 3DQCA 2JOJA 1NX1A 2H8VA 2CT9A 2D8NA 1VRKA 2L5YA 4OR9B 1EH2A 3DPZA 2LVVA 4D1EA 4NDBA 4HREE 4NQGA 2L4IA 1RJVA 2G16B 1UHKA 1SL7A 1TCOB 2JPOA 4DXNA 2MLFC 4XL5A 2PYQA 3R1PA 4C0JA 4H3MA 2BECA 4QJ3B 2QACA 3WNXB 1M39A 1XFVO 2LHIA 4U2VA 4YI8A 4EDSA 1EMMA 5CSFA 1M63B 4I2YA 3OHMB 1YTZC 1OMRA 2WORA 1AVSA 1OZOA 1Q4AA 2KYFA 1BT6A 3UO9A 1ODBA 2PALA 3OB1B 2O2BA 3R1OA 1Y1XA 3NHTA 4INWA 4W6SA 3FE6A 5DKNA 4MSPA 2ZN9A 2HPSA 2WIQA 2AWKA 3DQKA 2HGYA 1NCZA 3DQLA 1J7RA 3GB3A 2WCHA 1Y1UA 5D69A 1TCFA 5DU0A 1W7SA 4CPVA 1EMEA 1YUTA 4W6KA 1KP5A 2A46A 1BU3A 1RMPA 3DPXA 3DQ4A 2IS9A 2AH8A 4KF4A 2RH7A 4IK1A 1LKJA 2ZKMX 1CLLA 5HZSA 1WRKA 1NCXA 1BR4B 4OY4A 1CM4A 3JVTC 5BT0A 4EDOA 4KGFA 1LINA 2B3QA 4L1IA 3JTDB 1F4OA 3PJIA 4ICBA 2EMDA 1BOCA 3CDNA 3DXLA 1SYMA 1FI5A 2L4HA 4UTSA 3H1RA 2HJOA 4DCKA 1IJ6A 1DT7B 4QJ4B 1Q80A 1BFPA 1K8UA 5HBDA 3TUYC 2WC6A 3N7HA 3NSOA 3TDZA 1WDCB 3R72A 2LANA 1K2HA 2JADA 5BTTB 3PN7B 5DTXA 2JTTA 3CR4X 4HQ8A 1M46A 1RROA 5KTGA 3D10A 1MOVA 2O5GA 4HE4A 1KSMA 4W7AA 2M1UA 3VRPA 3I5GC 3H4SE 1XVJA 3CZTX 1DF0B 2YGUA 4DRWA 2FCDA 1EMAA 1SSEB 3WCKA 2GGMA 2FL1A 1MUXA 4FTGA 2L5XB 4DXPA 2PQLA 3CWGA 1JBYA 3BUXB 1L2OB 1PK0D 1KSOA 2Z6YA 3TMRA 2SASA 1CM1A 4ZBLA 3BXCA 2G6XA 3U8PA 2JXCA 2JXLA 4W75A 5HLVA 4A4BA 2Q57A 3VHTB 1Z4HA 2G6YA 1CFFA 3CZ0A 1XK4C 5I94A 4AR7A 2M3WA 5F9GA 4GOBA 3LK1A 5CPVA 1OMDA 2WCFA 4W77A 1NX0A 2VVHA 3SSHA 4R6BA 4BY5A 2LHLA 3VICA 1CMGA 1XSSA 5I2LA 2QT2A 1DJIA 1XFYO 4XGYA 4NDDA 1OOGA 1AUIB 3SSTA 3LA1A 4OQWA 2ZMWA 4MEWA 3K1EA 4TZAA 2BCXA 1RM9A 2LLTA 3UFZA 1C7WA 2KPHA 1KWOC 2QDIA 1EMLA 4HVFA 1EXRA 1QVIZ 1L7ZA 1FPWA 1Z1PA 3PALA 1GGXA 1J7PA 2QU1A 1FI6A 3DQJA 3IQQA 1UHJA 1DJHA 1GL4A 1Y1AA 2Y4QA 1DF0A 1K96A 2K7OA 2AAOA 2G3DB 2P70A 4ZF3A 1Q4DA 1UHHA 2Z6XA 3KCSA 5JJGA 3GK1A 4W72A 2BBNA 4F0ZB 2AHAA 5FI7A 3U8CA 4KGEA 2F33A 2QLEA 3SG4A 4KF5A 3B87A 3DQHA 1SCVA 1SL8A 3PN7C 2LLUA 4JF9A 3FS7A 1S5GY 3EKHA 3B6XA 2K7CA 1AJ4A 5EL2A 3BUNB 5FYXA 3WLDA 4LJDA 2G9BA 1F0BA 2ERBA 2BTJA 4Q9WA 1K95A 2H2KA 4JQ0D 4ZF4A 3W1DA 4BY4A 4FQOA 3LK0A 2DUIA 3ST4A 2M29A 2KHNA 1QS7A 5FI2A 4PFEA 2B1UA 5HGEA 2V4EC 4YGBB 1KWOB 5F6TA 5FVFA 3VRRA 2BKIB 4MZKA 5GQQC 5IBWA 1PSBA 3S0DA 2HETA 3SSKA 2I7AA 2QLHA 4GAOA 2QEBA 4MRXA 3KF9A 2Y5IA 3D74A 5DTLA 4W7RA 1YUUA 2LP3A 3WXAA 3MSEB 1S3PA 1NPQA 2WOSA 1UHNA 4MVFA 1XA5A 2PRUA 1F71A 4N3DA 1U5IB 2WNDA 3HX4A 3A8RA 3E5WA 5FVIA 3EK4A 1SR6B 1K94A 1JSAA 3CFAA 3EKJA 1Y6WA 4AS8A 1A75A 3D75A 3ZULA 2M7LA 2HQWA 2VZXA 1QYQA 1XMZA 3AKOA 1JC1A 4PALA 1NSHA 4ZINA 2JTZA 2G5ZB 1ZGPA 2QEHA 2MJWB 3IP2A 4GFTA 2NZ0A 2LV7A 2WHUA 4PT1A 2A4JA 5I2OA 2E30A 4MLWA 5DICA 2GGZA 3NEZA 4IK8A 3A4UB 1KK8C 2F3YA 1AHRA 3NGVA 1B9AA 1RECA 3GK2A 3AI4A 2VAEA 3ST2A 1GJYA 3VROA 2LUXA 4C0KA 4PHMA 4PPLA 2V4EA 1SR6C 1F4QA 1DQEA 1DMOA 3OB2B 5HLOA 2A53B 5ER5A 2F8PA 2KI6D 3EG5B 3S0GA 5TNCA 4QJ5B 3PLFB 1QJTA 1YZWA 1KFUL 4PE1A 3NXAA 3GL4A 4RYWA 3ZTFA 2QRFA 2LMUA 2I18A 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 3D76A 4FQTA 1M45A 2JWWA 2KFFA 3TS5C 3SG3A 1FBVA 1OOHA 5DQMA 3DPWA 4DXMA 1OZSA 1OW4A 4N5XA 1EJ3A 4W6IA 1QIWA 5H87A 4OV2A 4KF5C 3BFAA 1SY9A 3PM2A 4AOMA 5G08A 3RM1A 2V4EB 2EGDA 1SL9A 3NSKA 1KCYA 4Q7UA 1RK9A 3BFHA 2G2SB 4W7XA 2LC5A 1JC0A 1QV0A 1CFPA 1UURA 2H5PA 4Q7TA 1KQVA 2BNXA 2BCBA 4JD9A 1JFJA 1QYOA 4W6OA 2OKYA 1CLBA 4J89A 1DELA 1BLQA 1IQ5A 3KPXA 1F70A 2R2IA 3SIBA 1QXPA 4YGDB 1RMMA 2O24A 4MZLA 3QRXA 1YRTB 2FJYA 4HSZA 5DKRA 3SVRA 3DY9A 4W6RA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1XFUO 1QY3A 4ZCUA 3SIAA 1DGVA 2Y1MA 4PHNA 4EULA 1SK6D 5CSIA 3PSRA 3PATA 4M2QA 3SVBA 1PVBA 3CABA 2OKWA 1WY9A 1B7TY 2HF5A 5HKYA 2MA2A 1QLKA 4MRYA 2BCAA 1P28A 1D1OA 2DDCA 4GESB 4DXQA 5EBJA 4R6DA 1FW4A 3OBVA 1OE9B 1OQPA 1K9UA 2JU0A 2OGRA 1QX2A 1IWQA 4H3LA 1S6IA 4DXIA 1YJ2A 3DVEA 1U5IA 4Q04A 4J8AA 4LJBA 3KHEA 3CFHA 1QWVA 2LE9B 3KCTA 1YHIA 2QEOA 1QX5B 2K7BA 1YRUB 3VHTA 2LVKA 2A48A 2Y0GA 4OGSA 3OX6A 2H5RA 3SS5A 3ZWHA 5H89A 3SVOA 3GJ2A 5EXUA 3GK4X 4PDZA 3K21A 2O60A 5EXCI 1F55A 1GGWA 2JZIA 1E8AA 2KLDA 1A75B 4WQ3A 3RWTA 2F2OA 3FWCA 4OZDA 3LF3A 2POXA 1EG3A 2HPWA 1N2DA 2DDDA 3SG7A 5EXBA 3SSVA 3WHUB 3DQ6A 3TS5B 3S05A 4HRHA 2KFHA 3U0KA 4W7DA 2EC6B 1MF8B 2NCPA 1DGUA 3NSLA 1NUBA 3SS4A 4W6CA 2QEVA 5LTRA 1A2XA 1QVIY 1RWYA 4DKMA 2FOTA 1TNWA 5PALA 3VGOA 2A52B 2YE1A 3MGFA 3L4AA 4WRIA 2ARLA 2L98A 4Z4MA 2OJKA 1OSAA 3H1OA 5DPJA
chains in the Genus database with same CATH topology
2COLB 1AP4A 4KW4A 1QIVA 1HUYA 4W6AA 3NEDA 1H6RA 1ZACA 5J3XA 5LK4A 3SVEA 4W6LA 1OMVA 2K61A 1B8CA 1ZMZA 1CDNA 2ZFDA 4P1QA 1NWDA 1G8IA 1XFZO 4L12A 2M9GA 2C9IA 1YR5A 1S5GZ 1S1EA 3LSAA 3KO0A 2LVJA 4GGFC 3ST0A 4BDUA 3P8UA 1X02A 5AFPA 2KBIA 2G6EA 5DY6A 2QZ0A 2QLGA 2P6BB 3W1CA 5I8NA 1R6PA 1S6JA 4LQTA 1DJWA 1AK8A 3LVAA 3DQEA 4YGAA 2H5QA 4LJCA 1CDMA 1AJ5A 3ADFA 2CBLA 1Q4BA 2AWLA 2FWQA 1CLMA 4XJKB 4DUQA 1UISA 1OXEA 2EHBA 2KYCA 3SRYA 2H61A 1WLZA 4ANJA 1MWNA 4W73A 3DQ1A 1K90D 1XO5A 2RGIA 3JTDC 3O77A 2JULA 3CR5X 3JVTB 4W6HA 2HCGA 3CD9A 1PULA 5BQLA 4KEXA 2DOQA 5B8IB 1CKKA 2HQKA 4PPJA 2KAVA 2CXJA 2NLNA 1F8HA 2CNPA 1UHIA 4WQ2A 4B30A 1UWOA 4E68A 3PIBA 1JUOA 3WHTB 5DQBA 4KW8A 1OXDA 2V53A 1JC2A 4ETOA 4XYNA 5HZTA 4W6TA 3HCMA 5AANA 1NP8A 1YVLA 3CGLA 4IK4A 1RMOA 2GW4B 1N65A 3UG0A 1KK8B 2Z1OA 2KAXA 1TNXA 5LTPA 3I5FC 1CV7A 3BUMB 1ALVA 4U8DA 1YVHA 2G3OA 3NT9A 4YBHB 3BXKA 2IB6A 5K89A 4RTCA 4N1GA 3AAKA 3CS1A 3CB9A 2WSNA 5DTZA 2JC2A 3KEVA 3BOWB 2CTNA 1MOUA 1PRWA 1OXFA 1CDPA 4Q9XA 1LVCD 2KSPA 2GV5A 3ZUFA 1QV1A 2M7NA 4P76A 4M2PA 2WC8A 3O2PA 1LA0A 2HQ8A 2Q6PA 1W7TA 3GEXA 2O29A 3WLCA 1YUSA 3E5VA 4L13A 3FWBA 4HRGA 1B8RA 3TUYB 2PXSA 3CD1A 3U8AA 2ZO7A 5JOLA 1MXEA 3AKAA 4R1EA 1KFXS 2VRGA 2Y1NA 1DJXA 1DVIA 1QTXA 4W6DA 1SCMB 3CBEA 1EL4A 1J55A 1TTXA 2ICRA 4NWSA 2F3ZA 3U0LA 2ZO6A 5DTYA 3SV5A 1A03A 3BX9A 2Z6ZA 2P4MA 3SVSA 2HRSA 1KQMC 2BE6A 2K7DA 3BXAA 1KYRA 3DQOA 4AQIA 3O78A 1L2OC 4P5OE 4LW5A 4JPZB 4IK5A 3SG6A 1YX8A 2E6WA 4TNCA 1RRXA 4GNKB 4ORNA 3PJ5A 1N0YA 4W6MA 4ZB1A 3NSIA 5AQBB 3EVRA 2NXQA 3SS0A 4PE0A 4JC2A 4XOVA 4XJKA 3ED8A 4JEOA 2YE0A 3IR8A 1KK7Z 4IK3A 5EHUA 5BTTA 1LXFC 2JNFA 3D0YA 4JFGA 1EMGA 2JT3A 3BXBA 4W6BA 3DQ8A 1W7JB 3ICBA 2MHHA 3K1KA 4RYSA 1J1DA 1WDCC 2ZNDA 1GGZA 1BMOA 3SVUA 2KI4B 1NX2A 2K2FA 1QASA 1A29A 2DUEA 2HQZA 1NIWA 3LCPC 2CCMA 4B30B 2HFCA 4YRUA 4PE4A 2M8UA 2IE2A 5DPHA 1YX7A 3BUWB 2OTBA 4IZNA 2ZNEA 3DQ5A 1F09A 1IGVA 2VADA 3TDUA 3DVMA 3TMTA 3GOFA 3PJBA 1C7VA 1S26D 5H88A 2TN4A 3SVDA 1EMCA 3CR2A 2K0JA 3M0WA 2B3PA 2ZRSA 1TNPA 4ORCB 2KBMA 2KGRA 4CLNA 3OP0A 1F54A 1DTLA 3PM8A 1QXTA 3GJ1A 4JWQA 1SCMC 4ORAB 2BKHB 4DKNA 2FZUA 1ZUZA 2HGDA 3O4YA 1HQVA 3DQ7A 1TN4A 3PFVA 1XFXO 2DUGA 2LVIA 5HYDA 3NF0A 1UUSA 3EVVA 1V1GA 1CB1A 3DVJA 2JNXA 1KYPA 4PCWA 3RWAA 1BODA 1H4BA 3O6BA 1JF0A 1S6CA 1WRLA 5HZOA 2GX2A 5AEQA 1IJ5A 4YGEB 2WURA 2GW3A 3DQAA 1MXLC 3IF7A 5DPIA 3I5GB 1Q4EA 3SSLA 3DVKA 1G7KA 3SG5A 2SCPA 2PVBA 4J88A 1V1FA 2KAYA 4XVPA 2JQ6A 3BQ3A 1Q4CA 3LF4B 5CSNA 1IQ3A 1ZGQA 3VRQA 2M1KB 4OJ0A 4H48A 2WHTA 5HKZA 2DD7A 2OS8B 1ZUXA 2LLSA 2PASA 1ZGOA 2IOVA 1H8BA 2WCEA 3OSQA 1JBZA 2L51A 3SJSA 1HT9A 1XAEA 1H4UA 3CFFA 3E3RA 2OPOA 1M31A 3DQDA 5HZUA 1LA3A 2OTGB 3I5HB 1CTRA 3DQFA 3VK1A 1CFDA 2H5OA 4P2YB 1OOJA 3I19A 1KFUS 1XK4A 5EJUA 4W74A 2WCBA 2EMOA 1SKTA 3VRNA 2Q91A 4W69A 4IL1A 1RFJA 4I5JA 2KGBC 5DRFA 2MRDA 5HKWA 2YFPA 3I5IC 2H6VA 4OKHA 3F45A 2M97A 4ZIOA 1EMBA 3CGAA 1YHHA 1KFXL 1MR8A 3TZ1A 2MAZA 4A4CA 1QX7A 3SVCA 2BBMA 2JT0A 4I5LB 3FIAA 2PSRA 2H8QA 4N1FA 5KTYA 1XQMA 4MZJA 2ISDA 1SMGA 4B5YA 1G4YR 4LJDC 3OSRA 5FVGA 1XFWO 1BF5A 2K2AA 1BJFA 1G33A 4H47A 1K93D 3EVPA 4MBEA 3DQMA 1SNLA 1KYSA 3D0YB 4GGNA 2QLGB 5KU1A 1JF2A 2KQ6A 1PSRA 1XYDA 4I5KA 4I5NB 4GBAA 1DJZA 3NT3A 1NCYA 5DPGA 2H61C 4JGEA 1QATA 1W7IB 1DJGA 2LAPA 2ZRTA 4PHKA 2LP2A 4L9MA 1B9CA 4HQCA 2I2RE 3CLNA 2NCOA 3DQUA 1NYAA 1CDLA 1K9KA 2F2PA 3LL8B 4HQ9A 2OTGC 4DXOA 2M0RA 3DQ2A 1J1EA 1IH0A 2K8MB 1ALWA 1ZOTB 4YGCB 3ZNIA 4KA9A 1W7UA 3LS3A 1B8LA 1JBAA 3P28A 1A4PA 4GF6B 1FF1A 4ZF5A 3ZUJA 1XA9A 4OCIA 2KFGA 4LQUA 4ZCVA 2VVJA 4EN1A 4W6GA 2BE4A 4PE7A 4UPGA 4DIRA 1SPYA 2ZMUA 1S36A 4W6FA 4KAGA 2YDZA 4W6NA 4H3NA 5HW9A 3DF0A 3DQ3A 4PPKA 4M2OA 2L0PA 4GUKA 4ORBB 1JWDA 2I94A 3V3DA 4C0LA 1NX3A 4NDCA 1C07A 4CIDA 1B47A 1Z1QA 1YHGA 2ZN8A 3TDIA 1ZFSA 2IB5A 3U0NA 1PALA 3DQNA 2LNKA 5T3IA 2C9JA 4W7CA 2KDHA 2EMNA 1UP5A 3U0MA 4OHSA 3G9AA 2KI6C 4OVNF 3BYAA 2BL0C 1QYFA 3C1VA 1MQ1A 4Q7RA 4EMQA 2LCPA 2DUFA 1SRAA 5D7FA 2A56B 4W7EA 3DF0B 2KI4C 1SW8A 4IK9A 1IRJA 2AMIA 2MBXA 1RTP1 3LVCA 5CSJA 5AERA 2AUCA 5I2QA 1CFCA 5EB6A 1WLMA 5KSZA 2A47A 3SSPA 1KK7Y 3A8SA 1PVAA 3I5IB 5J2OA 5BPJA 1DJYA 2L2EA 2GX0A 3OX5A 4XOWA 2VVIA 5LTQA 2LMTA 3EK8A 2AWJA 3BUOB 3BOWA 3EK7A 1CNPA 2WHSA 1GQMA 1HCJA 2KOTA 2M49B 3I5HC 2LM5A 3M22A 3SG2A 2L50A 1Q73A 2JT8A 1C4FA 4CFQA 3EVUA 2DD9A 2H9WA 1B1GA 2WSOA 2KQYA 4ZFSA 3IQOA 1K9PA 3AI5A 1B7TZ 2A54B 2QLIA 1YJFA 3OGOA 4GGFA 2BL0B 4JRBA 4W7FA 1B4CA 2QPTA 4TZGA 1JFKA 2JRFA 4DS7A 2A50B 2FJUB 4W6PA 1MHOA 4W6UA 3ST3A 4MN0A 5FHVA 3DD4A 1EMFA 1S6ZA 1IG5A 1TNQA 2OTEA 4KW9A 2LUCA 2Q4UA 2MLEC 1TIZA 2AWMA 5EB7A 4PHJA 2LMVA 1MYWA 3E5TA 2KNEA 1WRZA 1J7QA 5ER4X 4Z4KA 1EG4A 3AAJA 3RLZA 3DQIA 3SSYA 4USLA 2JPTA 1EMKA 1BG1A 1QLSA 5DRGA 1KQMB 2DUHA 1TOPA 2WISA 3CTNA 4GPLB 4YI9A 4KPIA 3LLEA 3DQ9A 1YFPA 1CMFA 1Y0VH 3LVDA 1YURA 2PMYA 2PXWA 1IKUA 3SVNA 5AXIA 3AKBA 3I5FB 3M24A 4W76A 5DKQA 4W6JA 1GFLA 3PJ7A 2OS8C 3DQCA 2JOJA 1NX1A 2CT9A 2D8NA 1VRKA 4OR9B 1EH2A 3DPZA 2LVVA 4D1EA 4NDBA 4HREE 4NQGA 2L4IA 1RJVA 2G16B 1UHKA 1SL7A 1TCOB 4DXNA 2MLFC 4XL5A 4C0JA 4H3MA 2BECA 4QJ3B 2QACA 3WNXB 1M39A 1XFVO 2LHIA 4U2VA 4YI8A 4EDSA 1EMMA 5CSFA 1M63B 4I2YA 3OHMB 1YTZC 1OMRA 2WORA 1AVSA 1OZOA 1Q4AA 2KYFA 1BT6A 1ODBA 2PALA 3OB1B 2O2BA 1Y1XA 4W6SA 5DKNA 4MSPA 2ZN9A 2HPSA 2WIQA 2AWKA 3DQKA 2HGYA 1NCZA 3DQLA 1J7RA 3GB3A 1Y1UA 5D69A 1TCFA 5DU0A 1W7SA 4CPVA 1EMEA 1YUTA 4W6KA 1KP5A 2A46A 1BU3A 1RMPA 3DPXA 3DQ4A 2IS9A 2AH8A 4KF4A 2RH7A 4IK1A 1LKJA 2ZKMX 1CLLA 5HZSA 1WRKA 1NCXA 1BR4B 4OY4A 1CM4A 3JVTC 5BT0A 4EDOA 4KGFA 1LINA 2B3QA 4L1IA 3JTDB 1F4OA 4ICBA 2EMDA 1BOCA 1SYMA 1FI5A 2L4HA 4UTSA 3H1RA 2HJOA 4DCKA 1IJ6A 1DT7B 4QJ4B 1Q80A 1BFPA 1K8UA 5HBDA 3TUYC 3NSOA 3TDZA 1WDCB 2LANA 1K2HA 2JADA 5BTTB 3PN7B 5DTXA 2JTTA 3CR4X 4HQ8A 1M46A 1RROA 5KTGA 3D10A 1MOVA 2O5GA 4HE4A 1KSMA 4W7AA 2M1UA 3VRPA 3I5GC 3H4SE 1XVJA 3CZTX 1DF0B 4DRWA 2FCDA 1EMAA 3WCKA 2GGMA 2FL1A 1MUXA 4FTGA 2L5XB 4DXPA 3CWGA 1JBYA 3BUXB 1L2OB 1PK0D 1KSOA 2Z6YA 3TMRA 2SASA 1CM1A 4ZBLA 3BXCA 2G6XA 3U8PA 2JXCA 2JXLA 4W75A 5HLVA 4A4BA 2Q57A 3VHTB 2G6YA 1CFFA 1XK4C 4AR7A 2M3WA 5F9GA 4GOBA 3LK1A 5CPVA 1OMDA 2WCFA 4W77A 1NX0A 2VVHA 3SSHA 4R6BA 4BY5A 2LHLA 3VICA 1CMGA 1XSSA 5I2LA 2QT2A 1DJIA 1XFYO 4XGYA 4NDDA 1AUIB 3SSTA 3LA1A 4OQWA 2ZMWA 4MEWA 4TZAA 2BCXA 1RM9A 2LLTA 3UFZA 1C7WA 1KWOC 1EMLA 4HVFA 1EXRA 1QVIZ 1L7ZA 1FPWA 1Z1PA 3PALA 1GGXA 1J7PA 2QU1A 1FI6A 3DQJA 3IQQA 1UHJA 1DJHA 1GL4A 1Y1AA 2Y4QA 1DF0A 1K96A 2K7OA 2AAOA 2G3DB 4ZF3A 1Q4DA 1UHHA 2Z6XA 3KCSA 5JJGA 3GK1A 4W72A 2BBNA 4F0ZB 2AHAA 3U8CA 4KGEA 2F33A 2QLEA 3SG4A 4KF5A 3DQHA 1SCVA 1SL8A 3PN7C 2LLUA 4JF9A 3FS7A 1S5GY 3EKHA 2K7CA 1AJ4A 3BUNB 5FYXA 3WLDA 4LJDA 2G9BA 1F0BA 2BTJA 4Q9WA 1K95A 2H2KA 4JQ0D 4ZF4A 3W1DA 4BY4A 4FQOA 3LK0A 2DUIA 3ST4A 2M29A 2KHNA 1QS7A 4PFEA 2B1UA 5HGEA 2V4EC 4YGBB 1KWOB 5F6TA 5FVFA 3VRRA 2BKIB 4MZKA 5GQQC 5IBWA 1PSBA 2HETA 3SSKA 2I7AA 2QLHA 4GAOA 4MRXA 3KF9A 2Y5IA 5DTLA 4W7RA 1YUUA 2LP3A 3WXAA 3MSEB 1S3PA 1NPQA 2WOSA 1UHNA 4MVFA 1XA5A 2PRUA 1F71A 4N3DA 1U5IB 2WNDA 3HX4A 3A8RA 3E5WA 5FVIA 3EK4A 1SR6B 1K94A 1JSAA 3CFAA 3EKJA 1Y6WA 4AS8A 1A75A 3ZULA 2M7LA 2HQWA 2VZXA 1QYQA 1XMZA 3AKOA 1JC1A 4PALA 1NSHA 4ZINA 2JTZA 2G5ZB 1ZGPA 2MJWB 3IP2A 4GFTA 2NZ0A 2LV7A 2WHUA 2A4JA 5I2OA 2E30A 4MLWA 2GGZA 3NEZA 4IK8A 3A4UB 1KK8C 2F3YA 1AHRA 1B9AA 1RECA 3GK2A 3AI4A 2VAEA 3ST2A 1GJYA 3VROA 2LUXA 4C0KA 4PHMA 4PPLA 2V4EA 1SR6C 1F4QA 1DMOA 3OB2B 5HLOA 2A53B 5ER5A 2F8PA 2KI6D 5TNCA 4QJ5B 3PLFB 1QJTA 1YZWA 1KFUL 4PE1A 3NXAA 3GL4A 4RYWA 3ZTFA 2QRFA 2LMUA 2I18A 1J7OA 1TRFA 2EC6C 4CFRA 2G2BA 1M45A 2JWWA 2KFFA 3TS5C 3SG3A 1FBVA 5DQMA 3DPWA 4DXMA 1OZSA 4N5XA 1EJ3A 4W6IA 1QIWA 5H87A 4OV2A 4KF5C 1SY9A 4AOMA 5G08A 3RM1A 2V4EB 2EGDA 1SL9A 3NSKA 1KCYA 4Q7UA 1RK9A 2G2SB 4W7XA 2LC5A 1JC0A 1QV0A 1CFPA 1UURA 2H5PA 4Q7TA 1KQVA 2BCBA 1JFJA 1QYOA 4W6OA 2OKYA 1CLBA 4J89A 1BLQA 1IQ5A 3KPXA 1F70A 2R2IA 3SIBA 1QXPA 4YGDB 1RMMA 2O24A 4MZLA 3QRXA 1YRTB 4HSZA 5DKRA 3SVRA 4W6RA 4AQJA 1BR1B 2FCEA 1R2UA 1SBJA 1XFUO 1QY3A 4ZCUA 3SIAA 1DGVA 2Y1MA 4PHNA 4EULA 1SK6D 5CSIA 3PSRA 3PATA 4M2QA 3SVBA 1PVBA 2OKWA 1WY9A 1B7TY 2HF5A 5HKYA 2MA2A 1QLKA 4MRYA 2BCAA 1D1OA 2DDCA 4GESB 4DXQA 5EBJA 4R6DA 1FW4A 1OE9B 1OQPA 1K9UA 2JU0A 2OGRA 1QX2A 1IWQA 4H3LA 1S6IA 4DXIA 1YJ2A 3DVEA 1U5IA 4Q04A 4J8AA 4LJBA 3KHEA 3CFHA 2LE9B 3KCTA 1YHIA 1QX5B 2K7BA 1YRUB 3VHTA 2LVKA 2A48A 2Y0GA 4OGSA 3OX6A 2H5RA 3ZWHA 5H89A 3SVOA 3GJ2A 5EXUA 3GK4X 4PDZA 3K21A 2O60A 5EXCI 1F55A 1GGWA 2JZIA 1E8AA 1A75B 4WQ3A 3RWTA 2F2OA 3FWCA 3LF3A 2POXA 1EG3A 2HPWA 1N2DA 2DDDA 3SG7A 5EXBA 3SSVA 3WHUB 3DQ6A 3TS5B 3S05A 4HRHA 2KFHA 3U0KA 4W7DA 2EC6B 1MF8B 2NCPA 1DGUA 3NSLA 1NUBA 4W6CA 5LTRA 1A2XA 1QVIY 1RWYA 4DKMA 2FOTA 1TNWA 5PALA 3VGOA 2A52B 2YE1A 3MGFA 4WRIA 2ARLA 2L98A 4Z4MA 2OJKA 1OSAA 3H1OA 5DPJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2COL B;  1AP4 A;  4KW4 A;  1QIV A;  1HUY A;  4W6A A;  3NED A;  1H6R A;  1ZAC A;  5J3X A;  5LK4 A;  3SVE A;  4W6L A;  1OMV A;  2K61 A;  1B8C A;  1ZMZ A;  1CDN A;  2ZFD A;  4P1Q A;  1NWD A;  1G8I A;  1XFZ O;  4L12 A;  2M9G A;  2C9I A;  1YR5 A;  1S5G Z;  1S1E A;  3LSA A;  3KO0 A;  2LVJ A;  4GGF C;  3ST0 A;  4BDU A;  3P8U A;  1X02 A;  5AFP A;  2KBI A;  2G6E A;  5DY6 A;  2QZ0 A;  2QLG A;  2P6B B;  3W1C A;  5I8N A;  1R6P A;  1S6J A;  4LQT A;  1DJW A;  1AK8 A;  3LVA A;  3DQE A;  4YGA A;  2H5Q A;  4LJC A;  1CDM A;  1AJ5 A;  3ADF A;  2CBL A;  1Q4B A;  2AWL A;  2FWQ A;  1CLM A;  4XJK B;  4DUQ A;  1UIS A;  1OXE A;  2EHB A;  2KYC A;  3SRY A;  2H61 A;  1WLZ A;  4ANJ A;  1MWN A;  4W73 A;  3DQ1 A;  1K90 D;  1XO5 A;  2RGI A;  3JTD C;  3O77 A;  2JUL A;  3CR5 X;  3JVT B;  4W6H A;  2HCG A;  3CD9 A;  1PUL A;  5BQL A;  4KEX A;  2DOQ A;  5B8I B;  1CKK A;  2HQK A;  4PPJ A;  2KAV A;  2CXJ A;  2NLN A;  1F8H A;  2CNP A;  1UHI A;  4WQ2 A;  4B30 A;  1UWO A;  4E68 A;  3PIB A;  1JUO A;  3WHT B;  5DQB A;  4KW8 A;  1OXD A;  2V53 A;  1JC2 A;  4ETO A;  4XYN A;  5HZT A;  4W6T A;  3HCM A;  5AAN A;  1NP8 A;  1YVL A;  3CGL A;  4IK4 A;  1RMO A;  2GW4 B;  1N65 A;  3UG0 A;  1KK8 B;  2Z1O A;  2KAX A;  1TNX A;  5LTP A;  3I5F C;  1CV7 A;  3BUM B;  1ALV A;  4U8D A;  1YVH A;  2G3O A;  3NT9 A;  4YBH B;  3BXK A;  2IB6 A;  5K89 A;  4RTC A;  4N1G A;  3AAK A;  3CS1 A;  3CB9 A;  2WSN A;  5DTZ A;  2JC2 A;  3KEV A;  3BOW B;  2CTN A;  1MOU A;  1PRW A;  1OXF A;  1CDP A;  4Q9X A;  1LVC D;  2KSP A;  2GV5 A;  3ZUF A;  1QV1 A;  2M7N A;  4P76 A;  4M2P A;  2WC8 A;  3O2P A;  1LA0 A;  2HQ8 A;  2Q6P A;  1W7T A;  3GEX A;  2O29 A;  3WLC A;  1YUS A;  3E5V A;  4L13 A;  3FWB A;  4HRG A;  1B8R A;  3TUY B;  2PXS A;  3CD1 A;  3U8A A;  2ZO7 A;  5JOL A;  1MXE A;  3AKA A;  4R1E A;  1KFX S;  2VRG A;  2Y1N A;  1DJX A;  1DVI A;  1QTX A;  4W6D A;  1SCM B;  3CBE A;  1EL4 A;  1J55 A;  1TTX A;  2ICR A;  4NWS A;  2F3Z A;  3U0L A;  2ZO6 A;  5DTY A;  3SV5 A;  1A03 A;  3BX9 A;  2Z6Z A;  2P4M A;  3SVS A;  2HRS A;  1KQM C;  2BE6 A;  2K7D A;  3BXA A;  1KYR A;  3DQO A;  4AQI A;  3O78 A;  1L2O C;  4P5O E;  4LW5 A;  4JPZ B;  4IK5 A;  3SG6 A;  1YX8 A;  2E6W A;  4TNC A;  1RRX A;  4GNK B;  4ORN A;  3PJ5 A;  1N0Y A;  4W6M A;  4ZB1 A;  3NSI A;  5AQB B;  3EVR A;  2NXQ A;  3SS0 A;  4PE0 A;  4JC2 A;  4XOV A;  4XJK A;  3ED8 A;  4JEO A;  2YE0 A;  3IR8 A;  1KK7 Z;  4IK3 A;  5EHU A;  5BTT A;  1LXF C;  2JNF A;  3D0Y A;  4JFG A;  1EMG A;  2JT3 A;  3BXB A;  4W6B A;  3DQ8 A;  1W7J B;  3ICB A;  2MHH A;  3K1K A;  4RYS A;  1J1D A;  1WDC C;  2ZND A;  1GGZ A;  1BMO A;  3SVU A;  2KI4 B;  1NX2 A;  2K2F A;  1QAS A;  1A29 A;  2DUE A;  2HQZ A;  1NIW A;  3LCP C;  2CCM A;  4B30 B;  2HFC A;  4YRU A;  4PE4 A;  2M8U A;  2IE2 A;  5DPH A;  1YX7 A;  3BUW B;  2OTB A;  4IZN A;  2ZNE A;  3DQ5 A;  1F09 A;  1IGV A;  2VAD A;  3TDU A;  3DVM A;  3TMT A;  3GOF A;  3PJB A;  1C7V A;  1S26 D;  5H88 A;  2TN4 A;  3SVD A;  1EMC A;  3CR2 A;  2K0J A;  3M0W A;  2B3P A;  2ZRS A;  1TNP A;  4ORC B;  2KBM A;  2KGR A;  4CLN A;  3OP0 A;  1F54 A;  1DTL A;  3PM8 A;  1QXT A;  3GJ1 A;  4JWQ A;  1SCM C;  4ORA B;  2BKH B;  4DKN A;  2FZU A;  1ZUZ A;  2HGD A;  3O4Y A;  1HQV A;  3DQ7 A;  1TN4 A;  3PFV A;  1XFX O;  2DUG A;  2LVI A;  5HYD A;  3NF0 A;  1UUS A;  3EVV A;  1V1G A;  1CB1 A;  3DVJ A;  2JNX A;  1KYP A;  4PCW A;  3RWA A;  1BOD A;  1H4B A;  3O6B A;  1JF0 A;  1S6C A;  1WRL A;  5HZO A;  2GX2 A;  5AEQ A;  1IJ5 A;  4YGE B;  2WUR A;  2GW3 A;  3DQA A;  1MXL C;  3IF7 A;  5DPI A;  3I5G B;  1Q4E A;  3SSL A;  3DVK A;  1G7K A;  3SG5 A;  2SCP A;  2PVB A;  4J88 A;  1V1F A;  2KAY A;  4XVP A;  2JQ6 A;  3BQ3 A;  1Q4C A;  3LF4 B;  5CSN A;  1IQ3 A;  1ZGQ A;  3VRQ A;  2M1K B;  4OJ0 A;  4H48 A;  2WHT A;  5HKZ A;  2DD7 A;  2OS8 B;  1ZUX A;  2LLS A;  2PAS A;  1ZGO A;  2IOV A;  1H8B A;  2WCE A;  3OSQ A;  1JBZ A;  2L51 A;  3SJS A;  1HT9 A;  1XAE A;  1H4U A;  3CFF A;  3E3R A;  2OPO A;  1M31 A;  3DQD A;  5HZU A;  1LA3 A;  2OTG B;  3I5H B;  1CTR A;  3DQF A;  3VK1 A;  1CFD A;  2H5O A;  4P2Y B;  1OOJ A;  3I19 A;  1KFU S;  1XK4 A;  5EJU A;  4W74 A;  2WCB A;  2EMO A;  1SKT A;  3VRN A;  2Q91 A;  4W69 A;  4IL1 A;  1RFJ A;  4I5J A;  2KGB C;  5DRF A;  2MRD A;  5HKW A;  2YFP A;  3I5I C;  2H6V A;  4OKH A;  3F45 A;  2M97 A;  4ZIO A;  1EMB A;  3CGA A;  1YHH A;  1KFX L;  1MR8 A;  3TZ1 A;  2MAZ A;  4A4C A;  1QX7 A;  3SVC A;  2BBM A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  2H8Q A;  4N1F A;  5KTY A;  1XQM A;  4MZJ A;  2ISD A;  1SMG A;  4B5Y A;  1G4Y R;  4LJD C;  3OSR A;  5FVG A;  1XFW O;  1BF5 A;  2K2A A;  1BJF A;  1G33 A;  4H47 A;  1K93 D;  3EVP A;  4MBE A;  3DQM A;  1SNL A;  1KYS A;  3D0Y B;  4GGN A;  2QLG B;  5KU1 A;  1JF2 A;  2KQ6 A;  1PSR A;  1XYD A;  4I5K A;  4I5N B;  4GBA A;  1DJZ A;  3NT3 A;  1NCY A;  5DPG A;  2H61 C;  4JGE A;  1QAT A;  1W7I B;  1DJG A;  2LAP A;  2ZRT A;  4PHK A;  2LP2 A;  4L9M A;  1B9C A;  4HQC A;  2I2R E;  3CLN A;  2NCO A;  3DQU A;  1NYA A;  1CDL A;  1K9K A;  2F2P A;  3LL8 B;  4HQ9 A;  2OTG C;  4DXO A;  2M0R A;  3DQ2 A;  1J1E A;  1IH0 A;  2K8M B;  1ALW A;  1ZOT B;  4YGC B;  3ZNI A;  4KA9 A;  1W7U A;  3LS3 A;  1B8L A;  1JBA A;  3P28 A;  1A4P A;  4GF6 B;  1FF1 A;  4ZF5 A;  3ZUJ A;  1XA9 A;  4OCI A;  2KFG A;  4LQU A;  4ZCV A;  2VVJ A;  4EN1 A;  4W6G A;  2BE4 A;  4PE7 A;  4UPG A;  4DIR A;  1SPY A;  2ZMU A;  1S36 A;  4W6F A;  4KAG A;  2YDZ A;  4W6N A;  4H3N A;  5HW9 A;  3DF0 A;  3DQ3 A;  4PPK A;  4M2O A;  2L0P A;  4GUK A;  4ORB B;  1JWD A;  2I94 A;  3V3D A;  4C0L A;  1NX3 A;  4NDC A;  1C07 A;  4CID A;  1B47 A;  1Z1Q A;  1YHG A;  2ZN8 A;  3TDI A;  1ZFS A;  2IB5 A;  3U0N A;  1PAL A;  3DQN A;  2LNK A;  5T3I A;  2C9J A;  4W7C A;  2KDH A;  2EMN A;  1UP5 A;  3U0M A;  4OHS A;  3G9A A;  2KI6 C;  4OVN F;  3BYA A;  2BL0 C;  1QYF A;  3C1V A;  1MQ1 A;  4Q7R A;  4EMQ A;  2LCP A;  2DUF A;  1SRA A;  5D7F A;  2A56 B;  4W7E A;  3DF0 B;  2KI4 C;  1SW8 A;  4IK9 A;  1IRJ A;  2AMI A;  2MBX A;  1RTP 1;  3LVC A;  5CSJ A;  5AER A;  2AUC A;  5I2Q A;  1CFC A;  5EB6 A;  1WLM A;  5KSZ A;  2A47 A;  3SSP A;  1KK7 Y;  3A8S A;  1PVA A;  3I5I B;  5J2O A;  5BPJ A;  1DJY A;  2L2E A;  2GX0 A;  3OX5 A;  4XOW A;  2VVI A;  5LTQ A;  2LMT A;  3EK8 A;  2AWJ A;  3BUO B;  3BOW A;  3EK7 A;  1CNP A;  2WHS A;  1GQM A;  1HCJ A;  2KOT A;  2M49 B;  3I5H C;  2LM5 A;  3M22 A;  3SG2 A;  2L50 A;  1Q73 A;  2JT8 A;  1C4F A;  4CFQ A;  3EVU A;  2DD9 A;  2H9W A;  1B1G A;  2WSO A;  2KQY A;  4ZFS A;  3IQO A;  1K9P A;  3AI5 A;  1B7T Z;  2A54 B;  2QLI A;  1YJF A;  3OGO A;  4GGF A;  2BL0 B;  4JRB A;  4W7F A;  1B4C A;  2QPT A;  4TZG A;  1JFK A;  2JRF A;  4DS7 A;  2A50 B;  2FJU B;  4W6P A;  1MHO A;  4W6U A;  3ST3 A;  4MN0 A;  5FHV A;  3DD4 A;  1EMF A;  1S6Z A;  1IG5 A;  1TNQ A;  2OTE A;  4KW9 A;  2LUC A;  2Q4U A;  2MLE C;  1TIZ A;  2AWM A;  5EB7 A;  4PHJ A;  2LMV A;  1MYW A;  3E5T A;  2KNE A;  1WRZ A;  1J7Q A;  5ER4 X;  4Z4K A;  1EG4 A;  3AAJ A;  3RLZ A;  3DQI A;  3SSY A;  4USL A;  2JPT A;  1EMK A;  1BG1 A;  1QLS A;  5DRG A;  1KQM B;  2DUH A;  1TOP A;  2WIS A;  3CTN A;  4GPL B;  4YI9 A;  4KPI A;  3LLE A;  3DQ9 A;  1YFP A;  1CMF A;  1Y0V H;  3LVD A;  1YUR A;  2PMY A;  2PXW A;  1IKU A;  3SVN A;  5AXI A;  3AKB A;  3I5F B;  3M24 A;  4W76 A;  5DKQ A;  4W6J A;  1GFL A;  3PJ7 A;  2OS8 C;  3DQC A;  2JOJ A;  1NX1 A;  2CT9 A;  2D8N A;  1VRK A;  4OR9 B;  1EH2 A;  3DPZ A;  2LVV A;  4D1E A;  4NDB A;  4HRE E;  4NQG A;  2L4I A;  1RJV A;  2G16 B;  1UHK A;  1SL7 A;  1TCO B;  4DXN A;  2MLF C;  4XL5 A;  4C0J A;  4H3M A;  2BEC A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  1XFV O;  2LHI A;  4U2V A;  4YI8 A;  4EDS A;  1EMM A;  5CSF A;  1M63 B;  4I2Y A;  3OHM B;  1YTZ C;  1OMR A;  2WOR A;  1AVS A;  1OZO A;  1Q4A A;  2KYF A;  1BT6 A;  1ODB A;  2PAL A;  3OB1 B;  2O2B A;  1Y1X A;  4W6S A;  5DKN A;  4MSP A;  2ZN9 A;  2HPS A;  2WIQ A;  2AWK A;  3DQK A;  2HGY A;  1NCZ A;  3DQL A;  1J7R A;  3GB3 A;  1Y1U A;  5D69 A;  1TCF A;  5DU0 A;  1W7S A;  4CPV A;  1EME A;  1YUT A;  4W6K A;  1KP5 A;  2A46 A;  1BU3 A;  1RMP A;  3DPX A;  3DQ4 A;  2IS9 A;  2AH8 A;  4KF4 A;  2RH7 A;  4IK1 A;  1LKJ A;  2ZKM X;  1CLL A;  5HZS A;  1WRK A;  1NCX A;  1BR4 B;  4OY4 A;  1CM4 A;  3JVT C;  5BT0 A;  4EDO A;  4KGF A;  1LIN A;  2B3Q A;  4L1I A;  3JTD B;  1F4O A;  4ICB A;  2EMD A;  1BOC A;  1SYM A;  1FI5 A;  2L4H A;  4UTS A;  3H1R A;  2HJO A;  4DCK A;  1IJ6 A;  1DT7 B;  4QJ4 B;  1Q80 A;  1BFP A;  1K8U A;  5HBD A;  3TUY C;  3NSO A;  3TDZ A;  1WDC B;  2LAN A;  1K2H A;  2JAD A;  5BTT B;  3PN7 B;  5DTX A;  2JTT A;  3CR4 X;  4HQ8 A;  1M46 A;  1RRO A;  5KTG A;  3D10 A;  1MOV A;  2O5G A;  4HE4 A;  1KSM A;  4W7A A;  2M1U A;  3VRP A;  3I5G C;  3H4S E;  1XVJ A;  3CZT X;  1DF0 B;  4DRW A;  2FCD A;  1EMA A;  3WCK A;  2GGM A;  2FL1 A;  1MUX A;  4FTG A;  2L5X B;  4DXP A;  3CWG A;  1JBY A;  3BUX B;  1L2O B;  1PK0 D;  1KSO A;  2Z6Y A;  3TMR A;  2SAS A;  1CM1 A;  4ZBL A;  3BXC A;  2G6X A;  3U8P A;  2JXC A;  2JXL A;  4W75 A;  5HLV A;  4A4B A;  2Q57 A;  3VHT B;  2G6Y A;  1CFF A;  1XK4 C;  4AR7 A;  2M3W A;  5F9G A;  4GOB A;  3LK1 A;  5CPV A;  1OMD A;  2WCF A;  4W77 A;  1NX0 A;  2VVH A;  3SSH A;  4R6B A;  4BY5 A;  2LHL A;  3VIC A;  1CMG A;  1XSS A;  5I2L A;  2QT2 A;  1DJI A;  1XFY O;  4XGY A;  4NDD A;  1AUI B;  3SST A;  3LA1 A;  4OQW A;  2ZMW A;  4MEW A;  4TZA A;  2BCX A;  1RM9 A;  2LLT A;  3UFZ A;  1C7W A;  1KWO C;  1EML A;  4HVF A;  1EXR A;  1QVI Z;  1L7Z A;  1FPW A;  1Z1P A;  3PAL A;  1GGX A;  1J7P A;  2QU1 A;  1FI6 A;  3DQJ A;  3IQQ A;  1UHJ A;  1DJH A;  1GL4 A;  1Y1A A;  2Y4Q A;  1DF0 A;  1K96 A;  2K7O A;  2AAO A;  2G3D B;  4ZF3 A;  1Q4D A;  1UHH A;  2Z6X A;  3KCS A;  5JJG A;  3GK1 A;  4W72 A;  2BBN A;  4F0Z B;  2AHA A;  3U8C A;  4KGE A;  2F33 A;  2QLE A;  3SG4 A;  4KF5 A;  3DQH A;  1SCV A;  1SL8 A;  3PN7 C;  2LLU A;  4JF9 A;  3FS7 A;  1S5G Y;  3EKH A;  2K7C A;  1AJ4 A;  3BUN B;  5FYX A;  3WLD A;  4LJD A;  2G9B A;  1F0B A;  2BTJ A;  4Q9W A;  1K95 A;  2H2K A;  4JQ0 D;  4ZF4 A;  3W1D A;  4BY4 A;  4FQO A;  3LK0 A;  2DUI A;  3ST4 A;  2M29 A;  2KHN A;  1QS7 A;  4PFE A;  2B1U A;  5HGE A;  2V4E C;  4YGB B;  1KWO B;  5F6T A;  5FVF A;  3VRR A;  2BKI B;  4MZK A;  5GQQ C;  5IBW A;  1PSB A;  2HET A;  3SSK A;  2I7A A;  2QLH A;  4GAO A;  4MRX A;  3KF9 A;  2Y5I A;  5DTL A;  4W7R A;  1YUU A;  2LP3 A;  3WXA A;  3MSE B;  1S3P A;  1NPQ A;  2WOS A;  1UHN A;  4MVF A;  1XA5 A;  2PRU A;  1F71 A;  4N3D A;  1U5I B;  2WND A;  3HX4 A;  3A8R A;  3E5W A;  5FVI A;  3EK4 A;  1SR6 B;  1K94 A;  1JSA A;  3CFA A;  3EKJ A;  1Y6W A;  4AS8 A;  1A75 A;  3ZUL A;  2M7L A;  2HQW A;  2VZX A;  1QYQ A;  1XMZ A;  3AKO A;  1JC1 A;  4PAL A;  1NSH A;  4ZIN A;  2JTZ A;  2G5Z B;  1ZGP A;  2MJW B;  3IP2 A;  4GFT A;  2NZ0 A;  2LV7 A;  2WHU A;  2A4J A;  5I2O A;  2E30 A;  4MLW A;  2GGZ A;  3NEZ A;  4IK8 A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  1B9A A;  1REC A;  3GK2 A;  3AI4 A;  2VAE A;  3ST2 A;  1GJY A;  3VRO A;  2LUX A;  4C0K A;  4PHM A;  4PPL A;  2V4E A;  1SR6 C;  1F4Q A;  1DMO A;  3OB2 B;  5HLO A;  2A53 B;  5ER5 A;  2F8P A;  2KI6 D;  5TNC A;  4QJ5 B;  3PLF B;  1QJT A;  1YZW A;  1KFU L;  4PE1 A;  3NXA A;  3GL4 A;  4RYW A;  3ZTF A;  2QRF A;  2LMU A;  2I18 A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  1M45 A;  2JWW A;  2KFF A;  3TS5 C;  3SG3 A;  1FBV A;  5DQM A;  3DPW A;  4DXM A;  1OZS A;  4N5X A;  1EJ3 A;  4W6I A;  1QIW A;  5H87 A;  4OV2 A;  4KF5 C;  1SY9 A;  4AOM A;  5G08 A;  3RM1 A;  2V4E B;  2EGD A;  1SL9 A;  3NSK A;  1KCY A;  4Q7U A;  1RK9 A;  2G2S B;  4W7X A;  2LC5 A;  1JC0 A;  1QV0 A;  1CFP A;  1UUR A;  2H5P A;  4Q7T A;  1KQV A;  2BCB A;  1JFJ A;  1QYO A;  4W6O A;  2OKY A;  1CLB A;  4J89 A;  1BLQ A;  1IQ5 A;  3KPX A;  1F70 A;  2R2I A;  3SIB A;  1QXP A;  4YGD B;  1RMM A;  2O24 A;  4MZL A;  3QRX A;  1YRT B;  4HSZ A;  5DKR A;  3SVR A;  4W6R A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1XFU O;  1QY3 A;  4ZCU A;  3SIA A;  1DGV A;  2Y1M A;  4PHN A;  4EUL A;  1SK6 D;  5CSI A;  3PSR A;  3PAT A;  4M2Q A;  3SVB A;  1PVB A;  2OKW A;  1WY9 A;  1B7T Y;  2HF5 A;  5HKY A;  2MA2 A;  1QLK A;  4MRY A;  2BCA A;  1D1O A;  2DDC A;  4GES B;  4DXQ A;  5EBJ A;  4R6D A;  1FW4 A;  1OE9 B;  1OQP A;  1K9U A;  2JU0 A;  2OGR A;  1QX2 A;  1IWQ A;  4H3L A;  1S6I A;  4DXI A;  1YJ2 A;  3DVE A;  1U5I A;  4Q04 A;  4J8A A;  4LJB A;  3KHE A;  3CFH A;  2LE9 B;  3KCT A;  1YHI A;  1QX5 B;  2K7B A;  1YRU B;  3VHT A;  2LVK A;  2A48 A;  2Y0G A;  4OGS A;  3OX6 A;  2H5R A;  3ZWH A;  5H89 A;  3SVO A;  3GJ2 A;  5EXU A;  3GK4 X;  4PDZ A;  3K21 A;  2O60 A;  5EXC I;  1F55 A;  1GGW A;  2JZI A;  1E8A A;  1A75 B;  4WQ3 A;  3RWT A;  2F2O A;  3FWC A;  3LF3 A;  2POX A;  1EG3 A;  2HPW A;  1N2D A;  2DDD A;  3SG7 A;  5EXB A;  3SSV A;  3WHU B;  3DQ6 A;  3TS5 B;  3S05 A;  4HRH A;  2KFH A;  3U0K A;  4W7D A;  2EC6 B;  1MF8 B;  2NCP A;  1DGU A;  3NSL A;  1NUB A;  4W6C A;  5LTR A;  1A2X A;  1QVI Y;  1RWY A;  4DKM A;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  2A52 B;  2YE1 A;  3MGF A;  4WRI A;  2ARL A;  2L98 A;  4Z4M A;  2OJK A;  1OSA A;  3H1O A;  5DPJ A; 
#chains in the Genus database with same CATH topology
 2COL B;  1AP4 A;  4KW4 A;  1QIV A;  1HUY A;  4W6A A;  3NED A;  1H6R A;  1ZAC A;  3L4L A;  5J3X A;  5LK4 A;  3SVE A;  4W6L A;  1OMV A;  2K61 A;  1B8C A;  1ZMZ A;  1CDN A;  2ZFD A;  4P1Q A;  1NWD A;  1G8I A;  1XFZ O;  4L12 A;  2M9G A;  2C9I A;  1YR5 A;  1S5G Z;  1S1E A;  3LSA A;  3KO0 A;  2WCM A;  2LVJ A;  4GGF C;  3ST0 A;  4BDU A;  3P8U A;  1X02 A;  5AFP A;  2KBI A;  2G6E A;  5DY6 A;  2QZ0 A;  2QLG A;  2P6B B;  3W1C A;  5I8N A;  1R6P A;  1S6J A;  3VB1 A;  4LQT A;  1DJW A;  1AK8 A;  3LVA A;  3DQE A;  4YGA A;  2H5Q A;  4LJC A;  1CDM A;  1AJ5 A;  3ADF A;  2CBL A;  2GTE A;  1Q4B A;  2AWL A;  2FWQ A;  1CLM A;  4XJK B;  4DUQ A;  1UIS A;  3B88 A;  1OXE A;  2EHB A;  1W9Z A;  2KYC A;  3SRY A;  2H61 A;  1WLZ A;  4ANJ A;  1MWN A;  4W73 A;  3DQ1 A;  1K90 D;  1XO5 A;  2RGI A;  3JTD C;  3O77 A;  2JUL A;  3CR5 X;  3JVT B;  4IJ7 A;  4W6H A;  2HCG A;  3CD9 A;  1PUL A;  5BQL A;  4KEX A;  2DOQ A;  5B8I B;  1CKK A;  2HQK A;  3IVT A;  4PPJ A;  2KAV A;  2CXJ A;  2NLN A;  1F8H A;  2CNP A;  1UHI A;  1C3Z A;  4WQ2 A;  4B30 A;  1UWO A;  4E68 A;  1TWO A;  3PIB A;  1JUO A;  3WHT B;  5DQB A;  4KW8 A;  1OXD A;  2V53 A;  1JC2 A;  4ETO A;  3DYE A;  4XYN A;  5HZT A;  4W6T A;  3HCM A;  5AAN A;  1NP8 A;  1YVL A;  3CGL A;  4IK4 A;  2WCJ A;  1RMO A;  2GW4 B;  1N65 A;  3UG0 A;  1KK8 B;  2Z1O A;  2KAX A;  1TNX A;  5LTP A;  3I5F C;  1CV7 A;  3BUM B;  3D73 A;  3FE9 A;  1ALV A;  4U8D A;  1YVH A;  2G3O A;  3NT9 A;  4YBH B;  3BXK A;  2IB6 A;  5K89 A;  4RTC A;  4N1G A;  3AAK A;  3CS1 A;  3CB9 A;  2WSN A;  5DTZ A;  2JC2 A;  3KEV A;  3BOW B;  2CTN A;  1MOU A;  1PRW A;  1OXF A;  1CDP A;  4Q9X A;  1LVC D;  2KSP A;  2GV5 A;  3ZUF A;  1QV1 A;  3CYZ A;  2M7N A;  4P76 A;  1DEK A;  4M2P A;  1LS8 A;  2WC8 A;  3O2P A;  1LA0 A;  2HQ8 A;  2Q6P A;  1W7T A;  3GEX A;  2O29 A;  3WLC A;  1YUS A;  3E5V A;  3RZS A;  4L13 A;  3FWB A;  4HRG A;  1B8R A;  3TUY B;  2PXS A;  3CD1 A;  3U8A A;  2ZO7 A;  5JOL A;  1MXE A;  3AKA A;  4R1E A;  1KFX S;  2VRG A;  2Y1N A;  1DJX A;  1DVI A;  1QTX A;  4W6D A;  1SCM B;  3CBE A;  1EL4 A;  1T14 A;  1J55 A;  4JKT A;  1TTX A;  2ICR A;  4NWS A;  2F3Z A;  3U0L A;  2ZO6 A;  5DTY A;  3SV5 A;  1A03 A;  3BX9 A;  2Z6Z A;  2P4M A;  3SVS A;  2HRS A;  1KQM C;  2BE6 A;  2K7D A;  3BXA A;  1KYR A;  3DQO A;  4AQI A;  3O78 A;  1L2O C;  4P5O E;  4LW5 A;  4JPZ B;  4IK5 A;  3SG6 A;  1YX8 A;  2E6W A;  4TNC A;  1RRX A;  4GNK B;  4ORN A;  3PJ5 A;  1N0Y A;  3S0A A;  4W6M A;  4ZB1 A;  3NSI A;  5AQB B;  3EVR A;  2NXQ A;  3SS0 A;  4PE0 A;  4JC2 A;  1OOF A;  4XOV A;  4XJK A;  3R1V A;  3ED8 A;  4JEO A;  2YE0 A;  3IR8 A;  1KK7 Z;  4IK3 A;  5EHU A;  5BTT A;  1LXF C;  2JNF A;  4JFG A;  3D0Y A;  1EMG A;  2JT3 A;  3BXB A;  4W6B A;  3DQ8 A;  1W7J B;  3ICB A;  2MHH A;  3K1K A;  4RYS A;  1J1D A;  1WDC C;  2ZND A;  1GGZ A;  1BMO A;  3SVU A;  2KI4 B;  1NX2 A;  2K2F A;  1QAS A;  1A29 A;  3FE8 A;  2DUE A;  2HQZ A;  1NIW A;  3LCP C;  2CCM A;  2HFC A;  4B30 B;  4YRU A;  4PE4 A;  2M8U A;  2IE2 A;  5DPH A;  1YX7 A;  3BUW B;  2OTB A;  4IZN A;  2ZNE A;  3DQ5 A;  1F09 A;  1IGV A;  2P71 A;  1ORG A;  2VAD A;  3CZ1 A;  3TDU A;  3DVM A;  3TMT A;  3GOF A;  3PJB A;  1C7V A;  1S26 D;  5H88 A;  2TN4 A;  3SVD A;  3CZ2 A;  1EMC A;  3CR2 A;  2K0J A;  3M0W A;  2B3P A;  2ZRS A;  1TNP A;  4ORC B;  2KBM A;  2KGR A;  3OGN A;  4CLN A;  3OP0 A;  1F54 A;  3BJH A;  1DTL A;  3PM8 A;  1QXT A;  3GJ1 A;  4JWQ A;  1SCM C;  4ORA B;  2BKH B;  4DKN A;  2FZU A;  1ZUZ A;  2HGD A;  3O4Y A;  1HQV A;  3DQ7 A;  1TN4 A;  3PFV A;  1XFX O;  2DUG A;  2LVI A;  5HYD A;  3NF0 A;  1UUS A;  3EVV A;  1V1G A;  1CB1 A;  3DVJ A;  2JNX A;  1KYP A;  4PCW A;  3RWA A;  1BOD A;  1H4B A;  3O6B A;  1JF0 A;  3L47 A;  1S6C A;  1WRL A;  5HZO A;  2GX2 A;  5AEQ A;  1IJ5 A;  4YGE B;  2WUR A;  2GW3 A;  3DQA A;  1MXL C;  2WCL A;  3B86 A;  3IF7 A;  5DPI A;  3I5G B;  1Q4E A;  3SSL A;  3DVK A;  1G7K A;  3SG5 A;  2SCP A;  2PVB A;  4J88 A;  1V1F A;  2KAY A;  4XVP A;  2JQ6 A;  3BQ3 A;  1Q4C A;  3LF4 B;  5CSN A;  1IQ3 A;  1ZGQ A;  3VRQ A;  2M1K B;  4OJ0 A;  2KLE A;  4H48 A;  2WHT A;  5HKZ A;  3DZT A;  2DD7 A;  2OS8 B;  1ZUX A;  2LLS A;  2PAS A;  1ZGO A;  2IOV A;  1H8B A;  2WCE A;  3OSQ A;  1JBZ A;  2L51 A;  3SJS A;  1HT9 A;  1XAE A;  1H4U A;  3D78 A;  3CFF A;  3E3R A;  2OPO A;  1M31 A;  3DQD A;  5HZU A;  1LA3 A;  2OTG B;  3I5H B;  1TUJ A;  1CTR A;  3DQF A;  3VK1 A;  1CFD A;  2H5O A;  4P2Y B;  1OOJ A;  3I19 A;  5D3O A;  1KFU S;  1XK4 A;  5EJU A;  4W74 A;  2WCB A;  2EMO A;  1SKT A;  3VRN A;  2Q91 A;  4W69 A;  4IL1 A;  1RFJ A;  4I5J A;  2KGB C;  5DRF A;  2MRD A;  5HKW A;  2YFP A;  4INX A;  3I5I C;  2H6V A;  4OKH A;  3F45 A;  2M97 A;  4ZIO A;  1EMB A;  3CGA A;  1YHH A;  1KFX L;  1MR8 A;  3TZ1 A;  3S0F A;  2MAZ A;  4A4C A;  1QX7 A;  3SVC A;  2BBM A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  3Q8I A;  2H8Q A;  4N1F A;  5KTY A;  1XQM A;  4MZJ A;  2ISD A;  1SMG A;  4B5Y A;  1G4Y R;  4LJD C;  3OSR A;  5FVG A;  1XFW O;  4KYN A;  1BF5 A;  2K2A A;  2WCK A;  1BJF A;  1G33 A;  4H47 A;  1K93 D;  3EVP A;  4MBE A;  3DQM A;  1SNL A;  1KYS A;  3S0E A;  3D0Y B;  4GGN A;  3S0B A;  2QLG B;  5KU1 A;  1JF2 A;  2KQ6 A;  1PSR A;  1XYD A;  4I5K A;  4I5N B;  4GBA A;  1DJZ A;  3NT3 A;  1NCY A;  3UNW A;  5DPG A;  2H61 C;  1TUZ A;  4JGE A;  1QAT A;  1W7I B;  3QME A;  1IIO A;  1DJG A;  2LAP A;  2ZRT A;  4PHK A;  2LP2 A;  4F7F A;  4L9M A;  1B9C A;  4HQC A;  2I2R E;  3V2L A;  3CLN A;  2NCO A;  3DQU A;  1NYA A;  1CDL A;  1K9K A;  2F2P A;  3LL8 B;  4HQ9 A;  2OTG C;  4DXO A;  1GM0 A;  2M0R A;  3DQ2 A;  1J1E A;  1IH0 A;  2K8M B;  1ALW A;  1ZOT B;  4YGC B;  3ZNI A;  4KA9 A;  1W7U A;  3LS3 A;  1B8L A;  1JBA A;  3P28 A;  1A4P A;  4GF6 B;  1FF1 A;  4ZF5 A;  3ZUJ A;  1XA9 A;  4OCI A;  2KFG A;  4LQU A;  4ZCV A;  2VVJ A;  4EN1 A;  4W6G A;  2BE4 A;  4PE7 A;  4UPG A;  4DIR A;  1SPY A;  2ZMU A;  1S36 A;  4W6F A;  4KAG A;  2YDZ A;  4W6N A;  4H3N A;  5HW9 A;  3DF0 A;  5FI6 A;  3DQ3 A;  4PPK A;  2K60 A;  4M2O A;  2L0P A;  4GUK A;  4ORB B;  1JWD A;  2I94 A;  3V3D A;  4C0L A;  1NX3 A;  4NDC A;  1C07 A;  4CID A;  1B47 A;  1Z1Q A;  1YHG A;  2ZN8 A;  3TDI A;  5HL1 A;  1ZFS A;  2IB5 A;  3U0N A;  1PAL A;  3DQN A;  2LNK A;  5T3I A;  2C9J A;  4W7C A;  2KDH A;  2EMN A;  1UP5 A;  3BFB A;  3U0M A;  4OHS A;  3G9A A;  3B7A A;  2KI6 C;  3O4X A;  4OVN F;  3BYA A;  1C3Y A;  2BL0 C;  1QYF A;  3C1V A;  1MQ1 A;  4Q7R A;  4EMQ A;  1OOI X;  2LCP A;  2DUF A;  1SRA A;  3SS3 A;  5D7F A;  2A56 B;  4W7E A;  3DF0 B;  2KI4 C;  1SW8 A;  4IK9 A;  1IRJ A;  2AMI A;  2MBX A;  1RTP 1;  3LVC A;  5CSJ A;  5AER A;  2AUC A;  5I2Q A;  1CFC A;  5EB6 A;  3NHI A;  1WLM A;  5KSZ A;  2A47 A;  3SSP A;  1KK7 Y;  3A8S A;  1PVA A;  3I5I B;  5J2O A;  5BPJ A;  1DJY A;  2L2E A;  2GX0 A;  3OX5 A;  4XOW A;  2VVI A;  2BAP A;  2WC5 A;  5LTQ A;  2LMT A;  3EK8 A;  2AWJ A;  3BUO B;  3BOW A;  3EK7 A;  1CNP A;  2WHS A;  1GQM A;  1HCJ A;  2KOT A;  2M49 B;  3I5H C;  2LM5 A;  3M22 A;  3SG2 A;  2L50 A;  2L2C A;  1Q73 A;  2JT8 A;  1C4F A;  4CFQ A;  3EVU A;  2DD9 A;  2H9W A;  1B1G A;  2WSO A;  2KQY A;  4ZFS A;  3IQO A;  1K9P A;  3AI5 A;  1B7T Z;  2A54 B;  2QLI A;  1YJF A;  3OGO A;  4GGF A;  2BL0 B;  4JRB A;  4W7F A;  1B4C A;  2QPT A;  4TZG A;  1JFK A;  2JRF A;  4DS7 A;  2A50 B;  2FJU B;  4W6P A;  1MHO A;  4W6U A;  3ST3 A;  4MN0 A;  5FHV A;  3DD4 A;  1EMF A;  1S6Z A;  1IG5 A;  1TNQ A;  2OTE A;  4KW9 A;  2LUC A;  2Q4U A;  2MLE C;  1TIZ A;  2AWM A;  5EB7 A;  4PHJ A;  2LMV A;  1MYW A;  3E5T A;  2KNE A;  1WRZ A;  1J7Q A;  5ER4 X;  4Z4K A;  1EG4 A;  3AAJ A;  3RLZ A;  1DC1 A;  1XFR A;  3D77 A;  3DQI A;  3SSY A;  4USL A;  2JPT A;  1EMK A;  1BG1 A;  1QLS A;  5DRG A;  1KQM B;  2DUH A;  1TOP A;  2WIS A;  3CTN A;  4GPL B;  1Z2C B;  4YI9 A;  4KPI A;  3LLE A;  3DQ9 A;  1YFP A;  1CMF A;  1Y0V H;  3LVD A;  1YUR A;  2PMY A;  2PXW A;  1IKU A;  3SVN A;  5AXI A;  3AKB A;  3I5F B;  3M24 A;  4W76 A;  5DKQ A;  4W6J A;  1GFL A;  3PJ7 A;  2OS8 C;  3DQC A;  2JOJ A;  1NX1 A;  2H8V A;  2CT9 A;  2D8N A;  1VRK A;  2L5Y A;  4OR9 B;  1EH2 A;  3DPZ A;  2LVV A;  4D1E A;  4NDB A;  4HRE E;  4NQG A;  2L4I A;  1RJV A;  2G16 B;  1UHK A;  1SL7 A;  1TCO B;  2JPO A;  4DXN A;  2MLF C;  4XL5 A;  2PYQ A;  3R1P A;  4C0J A;  4H3M A;  2BEC A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  1XFV O;  2LHI A;  4U2V A;  4YI8 A;  4EDS A;  1EMM A;  5CSF A;  1M63 B;  4I2Y A;  3OHM B;  1YTZ C;  1OMR A;  2WOR A;  1AVS A;  1OZO A;  1Q4A A;  2KYF A;  1BT6 A;  3UO9 A;  1ODB A;  2PAL A;  3OB1 B;  2O2B A;  3R1O A;  1Y1X A;  3NHT A;  4INW A;  4W6S A;  3FE6 A;  5DKN A;  4MSP A;  2ZN9 A;  2HPS A;  2WIQ A;  2AWK A;  3DQK A;  2HGY A;  1NCZ A;  3DQL A;  1J7R A;  3GB3 A;  2WCH A;  1Y1U A;  5D69 A;  1TCF A;  5DU0 A;  1W7S A;  4CPV A;  1EME A;  1YUT A;  4W6K A;  1KP5 A;  2A46 A;  1BU3 A;  1RMP A;  3DPX A;  3DQ4 A;  2IS9 A;  2AH8 A;  4KF4 A;  2RH7 A;  4IK1 A;  1LKJ A;  2ZKM X;  1CLL A;  5HZS A;  1WRK A;  1NCX A;  1BR4 B;  4OY4 A;  1CM4 A;  3JVT C;  5BT0 A;  4EDO A;  4KGF A;  1LIN A;  2B3Q A;  4L1I A;  3JTD B;  1F4O A;  3PJI A;  4ICB A;  2EMD A;  1BOC A;  3CDN A;  3DXL A;  1SYM A;  1FI5 A;  2L4H A;  4UTS A;  3H1R A;  2HJO A;  4DCK A;  1IJ6 A;  1DT7 B;  4QJ4 B;  1Q80 A;  1BFP A;  1K8U A;  5HBD A;  3TUY C;  2WC6 A;  3N7H A;  3NSO A;  3TDZ A;  1WDC B;  3R72 A;  2LAN A;  1K2H A;  2JAD A;  5BTT B;  3PN7 B;  5DTX A;  2JTT A;  3CR4 X;  4HQ8 A;  1M46 A;  1RRO A;  5KTG A;  3D10 A;  1MOV A;  2O5G A;  4HE4 A;  1KSM A;  4W7A A;  2M1U A;  3VRP A;  3I5G C;  3H4S E;  1XVJ A;  3CZT X;  1DF0 B;  2YGU A;  4DRW A;  2FCD A;  1EMA A;  1SSE B;  3WCK A;  2GGM A;  2FL1 A;  1MUX A;  4FTG A;  2L5X B;  4DXP A;  2PQL A;  3CWG A;  1JBY A;  3BUX B;  1L2O B;  1PK0 D;  1KSO A;  2Z6Y A;  3TMR A;  2SAS A;  1CM1 A;  4ZBL A;  3BXC A;  2G6X A;  3U8P A;  2JXC A;  2JXL A;  4W75 A;  5HLV A;  4A4B A;  2Q57 A;  3VHT B;  1Z4H A;  2G6Y A;  1CFF A;  3CZ0 A;  1XK4 C;  5I94 A;  4AR7 A;  2M3W A;  5F9G A;  4GOB A;  3LK1 A;  5CPV A;  1OMD A;  2WCF A;  4W77 A;  1NX0 A;  2VVH A;  3SSH A;  4R6B A;  4BY5 A;  2LHL A;  3VIC A;  1CMG A;  1XSS A;  5I2L A;  2QT2 A;  1DJI A;  1XFY O;  4XGY A;  4NDD A;  1OOG A;  1AUI B;  3SST A;  3LA1 A;  4OQW A;  2ZMW A;  4MEW A;  3K1E A;  4TZA A;  2BCX A;  1RM9 A;  2LLT A;  3UFZ A;  1C7W A;  2KPH A;  1KWO C;  2QDI A;  1EML A;  4HVF A;  1EXR A;  1QVI Z;  1L7Z A;  1FPW A;  1Z1P A;  3PAL A;  1GGX A;  1J7P A;  2QU1 A;  1FI6 A;  3DQJ A;  3IQQ A;  1UHJ A;  1DJH A;  1GL4 A;  1Y1A A;  2Y4Q A;  1DF0 A;  1K96 A;  2K7O A;  2AAO A;  2G3D B;  2P70 A;  4ZF3 A;  1Q4D A;  1UHH A;  2Z6X A;  3KCS A;  5JJG A;  3GK1 A;  4W72 A;  2BBN A;  4F0Z B;  2AHA A;  5FI7 A;  3U8C A;  4KGE A;  2F33 A;  2QLE A;  3SG4 A;  4KF5 A;  3B87 A;  3DQH A;  1SCV A;  1SL8 A;  3PN7 C;  2LLU A;  4JF9 A;  3FS7 A;  1S5G Y;  3EKH A;  3B6X A;  2K7C A;  1AJ4 A;  5EL2 A;  3BUN B;  5FYX A;  3WLD A;  4LJD A;  2G9B A;  1F0B A;  2ERB A;  2BTJ A;  4Q9W A;  1K95 A;  2H2K A;  4JQ0 D;  4ZF4 A;  3W1D A;  4BY4 A;  4FQO A;  3LK0 A;  2DUI A;  3ST4 A;  2M29 A;  2KHN A;  1QS7 A;  5FI2 A;  4PFE A;  2B1U A;  5HGE A;  2V4E C;  4YGB B;  1KWO B;  5F6T A;  5FVF A;  3VRR A;  2BKI B;  4MZK A;  5GQQ C;  5IBW A;  1PSB A;  3S0D A;  2HET A;  3SSK A;  2I7A A;  2QLH A;  4GAO A;  2QEB A;  4MRX A;  3KF9 A;  2Y5I A;  3D74 A;  5DTL A;  4W7R A;  1YUU A;  2LP3 A;  3WXA A;  3MSE B;  1S3P A;  1NPQ A;  2WOS A;  1UHN A;  4MVF A;  1XA5 A;  2PRU A;  1F71 A;  4N3D A;  1U5I B;  2WND A;  3HX4 A;  3A8R A;  3E5W A;  5FVI A;  3EK4 A;  1SR6 B;  1K94 A;  1JSA A;  3CFA A;  3EKJ A;  1Y6W A;  4AS8 A;  1A75 A;  3D75 A;  3ZUL A;  2M7L A;  2HQW A;  2VZX A;  1QYQ A;  1XMZ A;  3AKO A;  1JC1 A;  4PAL A;  1NSH A;  4ZIN A;  2JTZ A;  2G5Z B;  1ZGP A;  2QEH A;  2MJW B;  3IP2 A;  4GFT A;  2NZ0 A;  2LV7 A;  2WHU A;  4PT1 A;  2A4J A;  5I2O A;  2E30 A;  4MLW A;  5DIC A;  2GGZ A;  3NEZ A;  4IK8 A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  3NGV A;  1B9A A;  1REC A;  3GK2 A;  3AI4 A;  2VAE A;  3ST2 A;  1GJY A;  3VRO A;  2LUX A;  4C0K A;  4PHM A;  4PPL A;  2V4E A;  1SR6 C;  1F4Q A;  1DQE A;  1DMO A;  3OB2 B;  5HLO A;  2A53 B;  5ER5 A;  2F8P A;  2KI6 D;  3EG5 B;  3S0G A;  5TNC A;  4QJ5 B;  3PLF B;  1QJT A;  1YZW A;  1KFU L;  4PE1 A;  3NXA A;  3GL4 A;  4RYW A;  3ZTF A;  2QRF A;  2LMU A;  2I18 A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  3D76 A;  4FQT A;  1M45 A;  2JWW A;  2KFF A;  3TS5 C;  3SG3 A;  1FBV A;  1OOH A;  5DQM A;  3DPW A;  4DXM A;  1OZS A;  1OW4 A;  4N5X A;  1EJ3 A;  4W6I A;  1QIW A;  5H87 A;  4OV2 A;  4KF5 C;  3BFA A;  1SY9 A;  3PM2 A;  4AOM A;  5G08 A;  3RM1 A;  2V4E B;  2EGD A;  1SL9 A;  3NSK A;  1KCY A;  4Q7U A;  1RK9 A;  3BFH A;  2G2S B;  4W7X A;  2LC5 A;  1JC0 A;  1QV0 A;  1CFP A;  1UUR A;  2H5P A;  4Q7T A;  1KQV A;  2BNX A;  2BCB A;  4JD9 A;  1JFJ A;  1QYO A;  4W6O A;  2OKY A;  1CLB A;  4J89 A;  1DEL A;  1BLQ A;  1IQ5 A;  3KPX A;  1F70 A;  2R2I A;  3SIB A;  1QXP A;  4YGD B;  1RMM A;  2O24 A;  4MZL A;  3QRX A;  1YRT B;  2FJY A;  4HSZ A;  5DKR A;  3SVR A;  3DY9 A;  4W6R A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1XFU O;  1QY3 A;  4ZCU A;  3SIA A;  1DGV A;  2Y1M A;  4PHN A;  4EUL A;  1SK6 D;  5CSI A;  3PSR A;  3PAT A;  4M2Q A;  3SVB A;  1PVB A;  3CAB A;  2OKW A;  1WY9 A;  1B7T Y;  2HF5 A;  5HKY A;  2MA2 A;  1QLK A;  4MRY A;  2BCA A;  1P28 A;  1D1O A;  2DDC A;  4GES B;  4DXQ A;  5EBJ A;  4R6D A;  1FW4 A;  3OBV A;  1OE9 B;  1OQP A;  1K9U A;  2JU0 A;  2OGR A;  1QX2 A;  1IWQ A;  4H3L A;  1S6I A;  4DXI A;  1YJ2 A;  3DVE A;  1U5I A;  4Q04 A;  4J8A A;  4LJB A;  3KHE A;  3CFH A;  1QWV A;  2LE9 B;  3KCT A;  1YHI A;  2QEO A;  1QX5 B;  2K7B A;  1YRU B;  3VHT A;  2LVK A;  2A48 A;  2Y0G A;  4OGS A;  3OX6 A;  2H5R A;  3SS5 A;  3ZWH A;  5H89 A;  3SVO A;  3GJ2 A;  5EXU A;  3GK4 X;  4PDZ A;  3K21 A;  2O60 A;  5EXC I;  1F55 A;  1GGW A;  2JZI A;  1E8A A;  2KLD A;  1A75 B;  4WQ3 A;  3RWT A;  2F2O A;  3FWC A;  4OZD A;  3LF3 A;  2POX A;  1EG3 A;  2HPW A;  1N2D A;  2DDD A;  3SG7 A;  5EXB A;  3SSV A;  3WHU B;  3DQ6 A;  3TS5 B;  3S05 A;  4HRH A;  2KFH A;  3U0K A;  4W7D A;  2EC6 B;  1MF8 B;  2NCP A;  1DGU A;  3NSL A;  1NUB A;  3SS4 A;  4W6C A;  2QEV A;  5LTR A;  1A2X A;  1QVI Y;  1RWY A;  4DKM A;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  2A52 B;  2YE1 A;  3MGF A;  3L4A A;  4WRI A;  2ARL A;  2L98 A;  4Z4M A;  2OJK A;  1OSA A;  3H1O A;  5DPJ A; 
#chains in the Genus database with same CATH homology
 2COL B;  1AP4 A;  4KW4 A;  1QIV A;  1HUY A;  4W6A A;  3NED A;  1H6R A;  1ZAC A;  5J3X A;  5LK4 A;  3SVE A;  4W6L A;  1OMV A;  2K61 A;  1B8C A;  1ZMZ A;  1CDN A;  2ZFD A;  4P1Q A;  1NWD A;  1G8I A;  1XFZ O;  4L12 A;  2M9G A;  2C9I A;  1YR5 A;  1S5G Z;  1S1E A;  3LSA A;  3KO0 A;  2LVJ A;  4GGF C;  3ST0 A;  4BDU A;  3P8U A;  1X02 A;  5AFP A;  2KBI A;  2G6E A;  5DY6 A;  2QZ0 A;  2QLG A;  2P6B B;  3W1C A;  5I8N A;  1R6P A;  1S6J A;  4LQT A;  1DJW A;  1AK8 A;  3LVA A;  3DQE A;  4YGA A;  2H5Q A;  4LJC A;  1CDM A;  1AJ5 A;  3ADF A;  2CBL A;  1Q4B A;  2AWL A;  2FWQ A;  1CLM A;  4XJK B;  4DUQ A;  1UIS A;  1OXE A;  2EHB A;  2KYC A;  3SRY A;  2H61 A;  1WLZ A;  4ANJ A;  1MWN A;  4W73 A;  3DQ1 A;  1K90 D;  1XO5 A;  2RGI A;  3JTD C;  3O77 A;  2JUL A;  3CR5 X;  3JVT B;  4W6H A;  2HCG A;  3CD9 A;  1PUL A;  5BQL A;  4KEX A;  2DOQ A;  5B8I B;  1CKK A;  2HQK A;  4PPJ A;  2KAV A;  2CXJ A;  2NLN A;  1F8H A;  2CNP A;  1UHI A;  4WQ2 A;  4B30 A;  1UWO A;  4E68 A;  3PIB A;  1JUO A;  3WHT B;  5DQB A;  4KW8 A;  1OXD A;  2V53 A;  1JC2 A;  4ETO A;  4XYN A;  5HZT A;  4W6T A;  3HCM A;  5AAN A;  1NP8 A;  1YVL A;  3CGL A;  4IK4 A;  1RMO A;  2GW4 B;  1N65 A;  3UG0 A;  1KK8 B;  2Z1O A;  2KAX A;  1TNX A;  5LTP A;  3I5F C;  1CV7 A;  3BUM B;  1ALV A;  4U8D A;  1YVH A;  2G3O A;  3NT9 A;  4YBH B;  3BXK A;  2IB6 A;  5K89 A;  4RTC A;  4N1G A;  3AAK A;  3CS1 A;  3CB9 A;  2WSN A;  5DTZ A;  2JC2 A;  3KEV A;  3BOW B;  2CTN A;  1MOU A;  1PRW A;  1OXF A;  1CDP A;  4Q9X A;  1LVC D;  2KSP A;  2GV5 A;  3ZUF A;  1QV1 A;  2M7N A;  4P76 A;  4M2P A;  2WC8 A;  3O2P A;  1LA0 A;  2HQ8 A;  2Q6P A;  1W7T A;  3GEX A;  2O29 A;  3WLC A;  1YUS A;  3E5V A;  4L13 A;  3FWB A;  4HRG A;  1B8R A;  3TUY B;  2PXS A;  3CD1 A;  3U8A A;  2ZO7 A;  5JOL A;  1MXE A;  3AKA A;  4R1E A;  1KFX S;  2VRG A;  2Y1N A;  1DJX A;  1DVI A;  1QTX A;  4W6D A;  1SCM B;  3CBE A;  1EL4 A;  1J55 A;  1TTX A;  2ICR A;  4NWS A;  2F3Z A;  3U0L A;  2ZO6 A;  5DTY A;  3SV5 A;  1A03 A;  3BX9 A;  2Z6Z A;  2P4M A;  3SVS A;  2HRS A;  1KQM C;  2BE6 A;  2K7D A;  3BXA A;  1KYR A;  3DQO A;  4AQI A;  3O78 A;  1L2O C;  4P5O E;  4LW5 A;  4JPZ B;  4IK5 A;  3SG6 A;  1YX8 A;  2E6W A;  4TNC A;  1RRX A;  4GNK B;  4ORN A;  3PJ5 A;  1N0Y A;  4W6M A;  4ZB1 A;  3NSI A;  5AQB B;  3EVR A;  2NXQ A;  3SS0 A;  4PE0 A;  4JC2 A;  4XOV A;  4XJK A;  3ED8 A;  4JEO A;  2YE0 A;  3IR8 A;  1KK7 Z;  4IK3 A;  5EHU A;  5BTT A;  1LXF C;  2JNF A;  3D0Y A;  4JFG A;  1EMG A;  2JT3 A;  3BXB A;  4W6B A;  3DQ8 A;  1W7J B;  3ICB A;  2MHH A;  3K1K A;  4RYS A;  1J1D A;  1WDC C;  2ZND A;  1GGZ A;  1BMO A;  3SVU A;  2KI4 B;  1NX2 A;  2K2F A;  1QAS A;  1A29 A;  2DUE A;  2HQZ A;  1NIW A;  3LCP C;  2CCM A;  4B30 B;  2HFC A;  4YRU A;  4PE4 A;  2M8U A;  2IE2 A;  5DPH A;  1YX7 A;  3BUW B;  2OTB A;  4IZN A;  2ZNE A;  3DQ5 A;  1F09 A;  1IGV A;  2VAD A;  3TDU A;  3DVM A;  3TMT A;  3GOF A;  3PJB A;  1C7V A;  1S26 D;  5H88 A;  2TN4 A;  3SVD A;  1EMC A;  3CR2 A;  2K0J A;  3M0W A;  2B3P A;  2ZRS A;  1TNP A;  4ORC B;  2KBM A;  2KGR A;  4CLN A;  3OP0 A;  1F54 A;  1DTL A;  3PM8 A;  1QXT A;  3GJ1 A;  4JWQ A;  1SCM C;  4ORA B;  2BKH B;  4DKN A;  2FZU A;  1ZUZ A;  2HGD A;  3O4Y A;  1HQV A;  3DQ7 A;  1TN4 A;  3PFV A;  1XFX O;  2DUG A;  2LVI A;  5HYD A;  3NF0 A;  1UUS A;  3EVV A;  1V1G A;  1CB1 A;  3DVJ A;  2JNX A;  1KYP A;  4PCW A;  3RWA A;  1BOD A;  1H4B A;  3O6B A;  1JF0 A;  1S6C A;  1WRL A;  5HZO A;  2GX2 A;  5AEQ A;  1IJ5 A;  4YGE B;  2WUR A;  2GW3 A;  3DQA A;  1MXL C;  3IF7 A;  5DPI A;  3I5G B;  1Q4E A;  3SSL A;  3DVK A;  1G7K A;  3SG5 A;  2SCP A;  2PVB A;  4J88 A;  1V1F A;  2KAY A;  4XVP A;  2JQ6 A;  3BQ3 A;  1Q4C A;  3LF4 B;  5CSN A;  1IQ3 A;  1ZGQ A;  3VRQ A;  2M1K B;  4OJ0 A;  4H48 A;  2WHT A;  5HKZ A;  2DD7 A;  2OS8 B;  1ZUX A;  2LLS A;  2PAS A;  1ZGO A;  2IOV A;  1H8B A;  2WCE A;  3OSQ A;  1JBZ A;  2L51 A;  3SJS A;  1HT9 A;  1XAE A;  1H4U A;  3CFF A;  3E3R A;  2OPO A;  1M31 A;  3DQD A;  5HZU A;  1LA3 A;  2OTG B;  3I5H B;  1CTR A;  3DQF A;  3VK1 A;  1CFD A;  2H5O A;  4P2Y B;  1OOJ A;  3I19 A;  1KFU S;  1XK4 A;  5EJU A;  4W74 A;  2WCB A;  2EMO A;  1SKT A;  3VRN A;  2Q91 A;  4W69 A;  4IL1 A;  1RFJ A;  4I5J A;  2KGB C;  5DRF A;  2MRD A;  5HKW A;  2YFP A;  3I5I C;  2H6V A;  4OKH A;  3F45 A;  2M97 A;  4ZIO A;  1EMB A;  3CGA A;  1YHH A;  1KFX L;  1MR8 A;  3TZ1 A;  2MAZ A;  4A4C A;  1QX7 A;  3SVC A;  2BBM A;  2JT0 A;  4I5L B;  3FIA A;  2PSR A;  2H8Q A;  4N1F A;  5KTY A;  1XQM A;  4MZJ A;  2ISD A;  1SMG A;  4B5Y A;  1G4Y R;  4LJD C;  3OSR A;  5FVG A;  1XFW O;  1BF5 A;  2K2A A;  1BJF A;  1G33 A;  4H47 A;  1K93 D;  3EVP A;  4MBE A;  3DQM A;  1SNL A;  1KYS A;  3D0Y B;  4GGN A;  2QLG B;  5KU1 A;  1JF2 A;  2KQ6 A;  1PSR A;  1XYD A;  4I5K A;  4I5N B;  4GBA A;  1DJZ A;  3NT3 A;  1NCY A;  5DPG A;  2H61 C;  4JGE A;  1QAT A;  1W7I B;  1DJG A;  2LAP A;  2ZRT A;  4PHK A;  2LP2 A;  4L9M A;  1B9C A;  4HQC A;  2I2R E;  3CLN A;  2NCO A;  3DQU A;  1NYA A;  1CDL A;  1K9K A;  2F2P A;  3LL8 B;  4HQ9 A;  2OTG C;  4DXO A;  2M0R A;  3DQ2 A;  1J1E A;  1IH0 A;  2K8M B;  1ALW A;  1ZOT B;  4YGC B;  3ZNI A;  4KA9 A;  1W7U A;  3LS3 A;  1B8L A;  1JBA A;  3P28 A;  1A4P A;  4GF6 B;  1FF1 A;  4ZF5 A;  3ZUJ A;  1XA9 A;  4OCI A;  2KFG A;  4LQU A;  4ZCV A;  2VVJ A;  4EN1 A;  4W6G A;  2BE4 A;  4PE7 A;  4UPG A;  4DIR A;  1SPY A;  2ZMU A;  1S36 A;  4W6F A;  4KAG A;  2YDZ A;  4W6N A;  4H3N A;  5HW9 A;  3DF0 A;  3DQ3 A;  4PPK A;  4M2O A;  2L0P A;  4GUK A;  4ORB B;  1JWD A;  2I94 A;  3V3D A;  4C0L A;  1NX3 A;  4NDC A;  1C07 A;  4CID A;  1B47 A;  1Z1Q A;  1YHG A;  2ZN8 A;  3TDI A;  1ZFS A;  2IB5 A;  3U0N A;  1PAL A;  3DQN A;  2LNK A;  5T3I A;  2C9J A;  4W7C A;  2KDH A;  2EMN A;  1UP5 A;  3U0M A;  4OHS A;  3G9A A;  2KI6 C;  4OVN F;  3BYA A;  2BL0 C;  1QYF A;  3C1V A;  1MQ1 A;  4Q7R A;  4EMQ A;  2LCP A;  2DUF A;  1SRA A;  5D7F A;  2A56 B;  4W7E A;  3DF0 B;  2KI4 C;  1SW8 A;  4IK9 A;  1IRJ A;  2AMI A;  2MBX A;  1RTP 1;  3LVC A;  5CSJ A;  5AER A;  2AUC A;  5I2Q A;  1CFC A;  5EB6 A;  1WLM A;  5KSZ A;  2A47 A;  3SSP A;  1KK7 Y;  3A8S A;  1PVA A;  3I5I B;  5J2O A;  5BPJ A;  1DJY A;  2L2E A;  2GX0 A;  3OX5 A;  4XOW A;  2VVI A;  5LTQ A;  2LMT A;  3EK8 A;  2AWJ A;  3BUO B;  3BOW A;  3EK7 A;  1CNP A;  2WHS A;  1GQM A;  1HCJ A;  2KOT A;  2M49 B;  3I5H C;  2LM5 A;  3M22 A;  3SG2 A;  2L50 A;  1Q73 A;  2JT8 A;  1C4F A;  4CFQ A;  3EVU A;  2DD9 A;  2H9W A;  1B1G A;  2WSO A;  2KQY A;  4ZFS A;  3IQO A;  1K9P A;  3AI5 A;  1B7T Z;  2A54 B;  2QLI A;  1YJF A;  3OGO A;  4GGF A;  2BL0 B;  4JRB A;  4W7F A;  1B4C A;  2QPT A;  4TZG A;  1JFK A;  2JRF A;  4DS7 A;  2A50 B;  2FJU B;  4W6P A;  1MHO A;  4W6U A;  3ST3 A;  4MN0 A;  5FHV A;  3DD4 A;  1EMF A;  1S6Z A;  1IG5 A;  1TNQ A;  2OTE A;  4KW9 A;  2LUC A;  2Q4U A;  2MLE C;  1TIZ A;  2AWM A;  5EB7 A;  4PHJ A;  2LMV A;  1MYW A;  3E5T A;  2KNE A;  1WRZ A;  1J7Q A;  5ER4 X;  4Z4K A;  1EG4 A;  3AAJ A;  3RLZ A;  3DQI A;  3SSY A;  4USL A;  2JPT A;  1EMK A;  1BG1 A;  1QLS A;  5DRG A;  1KQM B;  2DUH A;  1TOP A;  2WIS A;  3CTN A;  4GPL B;  4YI9 A;  4KPI A;  3LLE A;  3DQ9 A;  1YFP A;  1CMF A;  1Y0V H;  3LVD A;  1YUR A;  2PMY A;  2PXW A;  1IKU A;  3SVN A;  5AXI A;  3AKB A;  3I5F B;  3M24 A;  4W76 A;  5DKQ A;  4W6J A;  1GFL A;  3PJ7 A;  2OS8 C;  3DQC A;  2JOJ A;  1NX1 A;  2CT9 A;  2D8N A;  1VRK A;  4OR9 B;  1EH2 A;  3DPZ A;  2LVV A;  4D1E A;  4NDB A;  4HRE E;  4NQG A;  2L4I A;  1RJV A;  2G16 B;  1UHK A;  1SL7 A;  1TCO B;  4DXN A;  2MLF C;  4XL5 A;  4C0J A;  4H3M A;  2BEC A;  4QJ3 B;  2QAC A;  3WNX B;  1M39 A;  1XFV O;  2LHI A;  4U2V A;  4YI8 A;  4EDS A;  1EMM A;  5CSF A;  1M63 B;  4I2Y A;  3OHM B;  1YTZ C;  1OMR A;  2WOR A;  1AVS A;  1OZO A;  1Q4A A;  2KYF A;  1BT6 A;  1ODB A;  2PAL A;  3OB1 B;  2O2B A;  1Y1X A;  4W6S A;  5DKN A;  4MSP A;  2ZN9 A;  2HPS A;  2WIQ A;  2AWK A;  3DQK A;  2HGY A;  1NCZ A;  3DQL A;  1J7R A;  3GB3 A;  1Y1U A;  5D69 A;  1TCF A;  5DU0 A;  1W7S A;  4CPV A;  1EME A;  1YUT A;  4W6K A;  1KP5 A;  2A46 A;  1BU3 A;  1RMP A;  3DPX A;  3DQ4 A;  2IS9 A;  2AH8 A;  4KF4 A;  2RH7 A;  4IK1 A;  1LKJ A;  2ZKM X;  1CLL A;  5HZS A;  1WRK A;  1NCX A;  1BR4 B;  4OY4 A;  1CM4 A;  3JVT C;  5BT0 A;  4EDO A;  4KGF A;  1LIN A;  2B3Q A;  4L1I A;  3JTD B;  1F4O A;  4ICB A;  2EMD A;  1BOC A;  1SYM A;  1FI5 A;  2L4H A;  4UTS A;  3H1R A;  2HJO A;  4DCK A;  1IJ6 A;  1DT7 B;  4QJ4 B;  1Q80 A;  1BFP A;  1K8U A;  5HBD A;  3TUY C;  3NSO A;  3TDZ A;  1WDC B;  2LAN A;  1K2H A;  2JAD A;  5BTT B;  3PN7 B;  5DTX A;  2JTT A;  3CR4 X;  4HQ8 A;  1M46 A;  1RRO A;  5KTG A;  3D10 A;  1MOV A;  2O5G A;  4HE4 A;  1KSM A;  4W7A A;  2M1U A;  3VRP A;  3I5G C;  3H4S E;  1XVJ A;  3CZT X;  1DF0 B;  4DRW A;  2FCD A;  1EMA A;  3WCK A;  2GGM A;  2FL1 A;  1MUX A;  4FTG A;  2L5X B;  4DXP A;  3CWG A;  1JBY A;  3BUX B;  1L2O B;  1PK0 D;  1KSO A;  2Z6Y A;  3TMR A;  2SAS A;  1CM1 A;  4ZBL A;  3BXC A;  2G6X A;  3U8P A;  2JXC A;  2JXL A;  4W75 A;  5HLV A;  4A4B A;  2Q57 A;  3VHT B;  2G6Y A;  1CFF A;  1XK4 C;  4AR7 A;  2M3W A;  5F9G A;  4GOB A;  3LK1 A;  5CPV A;  1OMD A;  2WCF A;  4W77 A;  1NX0 A;  2VVH A;  3SSH A;  4R6B A;  4BY5 A;  2LHL A;  3VIC A;  1CMG A;  1XSS A;  5I2L A;  2QT2 A;  1DJI A;  1XFY O;  4XGY A;  4NDD A;  1AUI B;  3SST A;  3LA1 A;  4OQW A;  2ZMW A;  4MEW A;  4TZA A;  2BCX A;  1RM9 A;  2LLT A;  3UFZ A;  1C7W A;  1KWO C;  1EML A;  4HVF A;  1EXR A;  1QVI Z;  1L7Z A;  1FPW A;  1Z1P A;  3PAL A;  1GGX A;  1J7P A;  2QU1 A;  1FI6 A;  3DQJ A;  3IQQ A;  1UHJ A;  1DJH A;  1GL4 A;  1Y1A A;  2Y4Q A;  1DF0 A;  1K96 A;  2K7O A;  2AAO A;  2G3D B;  4ZF3 A;  1Q4D A;  1UHH A;  2Z6X A;  3KCS A;  5JJG A;  3GK1 A;  4W72 A;  2BBN A;  4F0Z B;  2AHA A;  3U8C A;  4KGE A;  2F33 A;  2QLE A;  3SG4 A;  4KF5 A;  3DQH A;  1SCV A;  1SL8 A;  3PN7 C;  2LLU A;  4JF9 A;  3FS7 A;  1S5G Y;  3EKH A;  2K7C A;  1AJ4 A;  3BUN B;  5FYX A;  3WLD A;  4LJD A;  2G9B A;  1F0B A;  2BTJ A;  4Q9W A;  1K95 A;  2H2K A;  4JQ0 D;  4ZF4 A;  3W1D A;  4BY4 A;  4FQO A;  3LK0 A;  2DUI A;  3ST4 A;  2M29 A;  2KHN A;  1QS7 A;  4PFE A;  2B1U A;  5HGE A;  2V4E C;  4YGB B;  1KWO B;  5F6T A;  5FVF A;  3VRR A;  2BKI B;  4MZK A;  5GQQ C;  5IBW A;  1PSB A;  2HET A;  3SSK A;  2I7A A;  2QLH A;  4GAO A;  4MRX A;  3KF9 A;  2Y5I A;  5DTL A;  4W7R A;  1YUU A;  2LP3 A;  3WXA A;  3MSE B;  1S3P A;  1NPQ A;  2WOS A;  1UHN A;  4MVF A;  1XA5 A;  2PRU A;  1F71 A;  4N3D A;  1U5I B;  2WND A;  3HX4 A;  3A8R A;  3E5W A;  5FVI A;  3EK4 A;  1SR6 B;  1K94 A;  1JSA A;  3CFA A;  3EKJ A;  1Y6W A;  4AS8 A;  1A75 A;  3ZUL A;  2M7L A;  2HQW A;  2VZX A;  1QYQ A;  1XMZ A;  3AKO A;  1JC1 A;  4PAL A;  1NSH A;  4ZIN A;  2JTZ A;  2G5Z B;  1ZGP A;  2MJW B;  3IP2 A;  4GFT A;  2NZ0 A;  2LV7 A;  2WHU A;  2A4J A;  5I2O A;  2E30 A;  4MLW A;  2GGZ A;  3NEZ A;  4IK8 A;  3A4U B;  1KK8 C;  2F3Y A;  1AHR A;  1B9A A;  1REC A;  3GK2 A;  3AI4 A;  2VAE A;  3ST2 A;  1GJY A;  3VRO A;  2LUX A;  4C0K A;  4PHM A;  4PPL A;  2V4E A;  1SR6 C;  1F4Q A;  1DMO A;  3OB2 B;  5HLO A;  2A53 B;  5ER5 A;  2F8P A;  2KI6 D;  5TNC A;  4QJ5 B;  3PLF B;  1QJT A;  1YZW A;  1KFU L;  4PE1 A;  3NXA A;  3GL4 A;  4RYW A;  3ZTF A;  2QRF A;  2LMU A;  2I18 A;  1J7O A;  1TRF A;  2EC6 C;  4CFR A;  2G2B A;  1M45 A;  2JWW A;  2KFF A;  3TS5 C;  3SG3 A;  1FBV A;  5DQM A;  3DPW A;  4DXM A;  1OZS A;  4N5X A;  1EJ3 A;  4W6I A;  1QIW A;  5H87 A;  4OV2 A;  4KF5 C;  1SY9 A;  4AOM A;  5G08 A;  3RM1 A;  2V4E B;  2EGD A;  1SL9 A;  3NSK A;  1KCY A;  4Q7U A;  1RK9 A;  2G2S B;  4W7X A;  2LC5 A;  1JC0 A;  1QV0 A;  1CFP A;  1UUR A;  2H5P A;  4Q7T A;  1KQV A;  2BCB A;  1JFJ A;  1QYO A;  4W6O A;  2OKY A;  1CLB A;  4J89 A;  1BLQ A;  1IQ5 A;  3KPX A;  1F70 A;  2R2I A;  3SIB A;  1QXP A;  4YGD B;  1RMM A;  2O24 A;  4MZL A;  3QRX A;  1YRT B;  4HSZ A;  5DKR A;  3SVR A;  4W6R A;  4AQJ A;  1BR1 B;  2FCE A;  1R2U A;  1SBJ A;  1XFU O;  1QY3 A;  4ZCU A;  3SIA A;  1DGV A;  2Y1M A;  4PHN A;  4EUL A;  1SK6 D;  5CSI A;  3PSR A;  3PAT A;  4M2Q A;  3SVB A;  1PVB A;  2OKW A;  1WY9 A;  1B7T Y;  2HF5 A;  5HKY A;  2MA2 A;  1QLK A;  4MRY A;  2BCA A;  1D1O A;  2DDC A;  4GES B;  4DXQ A;  5EBJ A;  4R6D A;  1FW4 A;  1OE9 B;  1OQP A;  1K9U A;  2JU0 A;  2OGR A;  1QX2 A;  1IWQ A;  4H3L A;  1S6I A;  4DXI A;  1YJ2 A;  3DVE A;  1U5I A;  4Q04 A;  4J8A A;  4LJB A;  3KHE A;  3CFH A;  2LE9 B;  3KCT A;  1YHI A;  1QX5 B;  2K7B A;  1YRU B;  3VHT A;  2LVK A;  2A48 A;  2Y0G A;  4OGS A;  3OX6 A;  2H5R A;  3ZWH A;  5H89 A;  3SVO A;  3GJ2 A;  5EXU A;  3GK4 X;  4PDZ A;  3K21 A;  2O60 A;  5EXC I;  1F55 A;  1GGW A;  2JZI A;  1E8A A;  1A75 B;  4WQ3 A;  3RWT A;  2F2O A;  3FWC A;  3LF3 A;  2POX A;  1EG3 A;  2HPW A;  1N2D A;  2DDD A;  3SG7 A;  5EXB A;  3SSV A;  3WHU B;  3DQ6 A;  3TS5 B;  3S05 A;  4HRH A;  2KFH A;  3U0K A;  4W7D A;  2EC6 B;  1MF8 B;  2NCP A;  1DGU A;  3NSL A;  1NUB A;  4W6C A;  5LTR A;  1A2X A;  1QVI Y;  1RWY A;  4DKM A;  2FOT A;  1TNW A;  5PAL A;  3VGO A;  2A52 B;  2YE1 A;  3MGF A;  4WRI A;  2ARL A;  2L98 A;  4Z4M A;  2OJK A;  1OSA A;  3H1O A;  5DPJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...