3EVRA

Crystal structure of calcium bound monomeric gcamp2
Total Genus 141
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
141
sequence length
411
structure length
397
Chain Sequence
DSSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNTRDQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
total genus 141
structure length 397
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evrA01
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evrA02
2GX2A 3BUWB 1JF0A 3SIBA 5T3IA 1WDCC 2AAOA 3PSRA 2JPTA 2KI4C 1UHJA 3PN7B 2LVJA 1N65A 1LKJA 3M22A 1RECA 1RWYA 1TRFA 1NCYA 2ZKMX 1UURA 3U0LA 1GJYA 3DPWA 2WISA 4CFRA 3LVDA 3AI4A 2CCMA 4IK4A 2QLEA 1BR4B 1A4PA 2NLNA 2A52B 3GK1A 3PFVA 2VZXA 2HPWA 1KWOB 1TIZA 3DQ1A 4CFQA 3NT9A 1DF0B 3E5WA 2Y5IA 1S36A 1ZUXA 2KGBC 2A47A 2EHBA 4MRYA 1BFPA 1YFPA 4HRHA 2BCXA 2M49B 2ARLA 2C9IA 4CPVA 5I2LA 1KSMA 3W1CA 1HQVA 4PDZA 2DUHA 4LQUA 3TMRA 1NX2A 2F3YA 2DUIA 2V4EB 3WNXB 1R6PA 3KPXA 5HKWA 2GW3A 1XO5A 1NX1A 1UWOA 1MXLC 2JC2A 4GGFA 3TDUA 5HYDA 1AJ5A 2OKWA 4OV2A 4RTCA 5CSNA 4OGSA 3FWCA 2HJOA 5LTQA 2P4MA 3DQLA 3DD4A 2H61C 3SVRA 1KQMC 4EDSA 2L5XB 1DT7B 2LMUA 1SL8A 1UHKA 1MUXA 5DTLA 3NEZA 4OKHA 4MLWA 3GK2A 2MA2A 4KF5A 3KHEA 3PJ5A 1A75A 5D7FA 2CXJA 4MSPA 2HGDA 3TZ1A 4W6RA 1SL7A 1LA3A 1KQVA 5H89A 3W1DA 2WNDA 3E5VA 3CR2A 3SVDA 1A03A 1JC0A 3SG4A 3MSEB 2QT2A 1QXPA 3CFFA 2WHSA 2K7BA 2G6YA 1QVIY 5HZOA 4YGBB 3O6BA 4B5YA 3O4YA 5DKQA 1KFXS 2Q6PA 2ZRSA 1S26D 3LS3A 2WURA 2EMNA 2M9GA 2K61A 3D10A 4B30B 3OGOA 4H48A 3LA1A 1SCVA 2QU1A 4PPLA 1YUSA 2LP3A 2M7NA 1EJ3A 4HRGA 2H6VA 3WXAA 2OTGC 1JWDA 2V4EC 5J3XA 2FJUB 4QJ5B 3EKHA 4PE1A 1JFKA 1QVIZ 1C7VA 4GGFC 1W7UA 3SVOA 4KPIA 3OB1B 3BXBA 3O2PA 4W6SA 2I18A 2F8PA 4PPJA 3FS7A 4HQ8A 1WLMA 3SSVA 1YRUB 1OSAA 3H1OA 4W6GA 2JQ6A 1BODA 1KFXL 4MRXA 3ZWHA 3DQEA 1ZGQA 2LLUA 3NXAA 1YURA 1QYFA 5HKZA 2K7OA 2M3WA 1K8UA 2HGYA 2O5GA 1JF2A 3EKJA 2SASA 5FHVA 1F0BA 2ZMWA 4H3LA 2F2PA 4XJKB 4DXOA 4OHSA 3DQ4A 2LV7A 2BCBA 1JBAA 3RWTA 3ST0A 1OMDA 4Q7RA 1DJGA 5AFPA 1EL4A 5HZUA 5DTYA 2G3OA 2VVJA 3CS1A 1FI5A 5DPHA 3GOFA 4YBHB 1PVBA 1YHHA 3CR4X 3BOWA 1FF1A 2H61A 4MZLA 1QV0A 1YHIA 4BDUA 2DD9A 2A46A 1KYRA 3LK1A 4A4BA 1SKTA 4JQ0D 2BKIB 3DVKA 1ZMZA 1OXFA 2KI6C 5DRGA 1S3PA 4GPLB 2BE6A 1QTXA 4R6BA 2DOQA 4HE4A 2KFGA 1LINA 2I2RE 2HPSA 3DQMA 1S5GZ 1EMKA 1YHGA 1IKUA 4DKMA 4ZCUA 4Q9XA 2BE4A 1L2OB 1XK4A 2BBNA 2I94A 4EMQA 4ORBB 1Y6WA 1XMZA 2FWQA 1V1FA 1CB1A 4MN0A 1KK8B 3PJBA 3DQKA 1WRZA 1QATA 4Q9WA 3BX9A 2OKYA 4U8DA 5KTYA 2VVHA 1PSRA 1AK8A 4W74A 2F2OA 2DDCA 5F6TA 2LUCA 3S05A 4ICBA 3DQUA 1B8RA 3CD1A 1SCMC 1TN4A 1K9UA 3LL8B 1J1DA 4WRIA 4KW8A 1QJTA 3AAJA 4W77A 5DU0A 1F70A 4M2OA 4W6IA 2YE0A 2EMDA 2Z1OA 1SMGA 1NIWA 1XYDA 1RJVA 4GAOA 2ZN8A 2WCEA 1K94A 2IOVA 4HQ9A 2KI4B 1WDCB 1NWDA 2POXA 1L7ZA 5BQLA 1J7RA 1UHNA 4J88A 3DQAA 3GK4X 1EMEA 1QS7A 3PLFB 3EK7A 4MZKA 4TNCA 5DPGA 4C0KA 1IRJA 3BXKA 4PFEA 3JVTB 2E6WA 1XSSA 2H5OA 4KEXA 2AHAA 5FVFA 5FVIA 4IK8A 2PMYA 5B8IB 1C7WA 3GJ1A 3U0MA 1SYMA 2L51A 2ZO7A 1F55A 3DQFA 4GNKB 1PVAA 2G6XA 4F0ZB 2K8MB 1N0YA 1LA0A 1EMAA 2MJWB 1CMGA 3LF3A 1PALA 4IK9A 1GL4A 4DUQA 4ZB1A 1DJIA 3EVPA 2KI6D 4KAGA 3IQOA 4IZNA 4DXMA 2M1UA 1V1GA 4XL5A 2HFCA 2Q4UA 4W7FA 3DQ9A 2K2FA 3NSKA 1QX5B 4GGNA 4CLNA 5EJUA 4AS8A 3EK4A 3A8SA 2KQYA 4LQTA 1BU3A 2M7LA 4EULA 2DDDA 2KBIA 5HW9A 2NCPA 2HQKA 2ZRTA 5DPIA 2KDHA 2V4EA 3SG7A 5G08A 2JT8A 1KCYA 2G3DB 1B8LA 4LJBA 1Z1PA 4HREE 2OPOA 1NPQA 4P5OE 1YJ2A 1XK4C 3MGFA 5J2OA 1CFFA 1AJ4A 3EVVA 4R1EA 4BY4A 1RTP1 1H6RA 2AMIA 2LVIA 1K9KA 3CGAA 2DD7A 3LVAA 4JEOA 1JSAA 3OX6A 2K2AA 1EMLA 1YUTA 3DQ8A 4RYSA 1EMFA 4L12A 2AUCA 4M2PA 1SY9A 4M2QA 1TNXA 1B4CA 1M45A 1ODBA 3OX5A 2F3ZA 3BUMB 1F54A 2WHUA 4I5KA 2A56B 2QRFA 3U8PA 4W73A 5KTGA 3G9AA 2O29A 1Y1UA 1EG3A 5I8NA 2G5ZB 2C9JA 1DTLA 2JXCA 3VRNA 1U5IA 2LE9B 4W72A 1TNWA 1Q4EA 2Q57A 3TS5B 3DVJA 3KEVA 3H1RA 4ANJA 4NDCA 1Q73A 1SR6C 2Z6XA 4ZF3A 3RM1A 3O77A 3D0YA 2KNEA 1A29A 4IK3A 3BQ3A 1K2HA 1NSHA 1MXEA 3IF7A 1SPYA 5H88A 2BECA 1IG5A 3IR8A 1ZUZA 3A8RA 1EMBA 3F45A 3DQ2A 2KSPA 3DQDA 4XVPA 5ER5A 5KU1A 3DQ6A 1HCJA 2FCEA 1Y0VH 2OS8C 3VICA 4IK1A 1G7KA 4W6NA 1XFXO 1KFUS 3DVEA 3M0WA 1ALWA 4OCIA 3JTDB 2AH8A 4W6KA 3LSAA 2B3PA 2PVBA 4W6MA 4W7EA 1CDPA 4MVFA 1WRLA 2ZMUA 2I7AA 5HGEA 1TNPA 4PCWA 1EMMA 5DQBA 1XA9A 3SG6A 4YI8A 1ALVA 3VHTB 1OZSA 2WSOA 1F09A 2CT9A 2ZN9A 1U5IB 1JBZA 2CNPA 1CTRA 3CWGA 4XYNA 2H2KA 4JWQA 1UHIA 3SSLA 5BPJA 5CSFA 1KYSA 4A4CA 3SSPA 4U2VA 1G33A 1B7TZ 1TOPA 3I5HB 2FZUA 1MWNA 4ORCB 3BUOB 1RMOA 4ORAB 2PXWA 2L4HA 4USLA 1OOJA 1SBJA 1KQMB 1X02A 4PHNA 4TZGA 4UTSA 3U0NA 5AEQA 3FWBA 3KCTA 3JVTC 1Y1AA 2DUEA 1HUYA 1IWQA 1FI6A 1NX0A 3SG2A 2HQ8A 1YTZC 2WC8A 3U8CA 2LC5A 1A75B 4EDOA 3SVUA 4YGCB 1CMFA 4HSZA 3SVNA 4W6PA 4EN1A 1JFJA 1AVSA 1JC2A 1F71A 1RM9A 2WHTA 2JU0A 1OXDA 4QJ4B 3TUYB 1N2DA 3DQOA 1ZFSA 1Q4DA 5DKRA 4AQJA 2AWLA 2Z6YA 1QIVA 1DJYA 2HETA 4Z4MA 3CZTX 3BUXB 1W7IB 4NWSA 1QYOA 1XFVO 4P2YB 5GQQC 1ZGOA 1CLMA 1SCMB 2LP2A 2M97A 4C0LA 1Q4BA 3SG5A 3SIAA 1C07A 1KWOC 1M46A 2YE1A 3DPZA 4P76A 4UPGA 4LW5A 4JPZB 1ZACA 2O60A 4DIRA 2ISDA 3U0KA 1SNLA 4LJDC 4HVFA 4JRBA 2M0RA 2IB5A 2G2SB 2H5RA 4J89A 3ZULA 2L4IA 3NEDA 1KK8C 3BXCA 5HBDA 3I19A 2G6EA 2G9BA 1CFPA 1FPWA 3GL4A 1PULA 5F9GA 4ZCVA 1FBVA 5I2QA 1RK9A 1YVLA 1MHOA 4ZF4A 5FYXA 1MYWA 1JBYA 1A2XA 5AXIA 3ZTFA 2D8NA 4AR7A 2OTGB 1SL9A 5EHUA 2A4JA 4DS7A 4XJKA 4N1FA 3IP2A 5DPJA 1QX7A 4DXPA 1W7TA 4DCKA 2GGMA 2PRUA 2BL0C 2GX0A 1NP8A 1YX8A 4PE0A 1BG1A 4B30A 2LMVA 2B1UA 2MBXA 3VROA 1W7SA 1K9PA 3DQ5A 2ICRA 2JNFA 4L13A 5HLVA 1QY3A 2ZFDA 1OZOA 4OJ0A 4MBEA 1EMCA 1OXEA 4IL1A 3I5FC 1JUOA 2JXLA 2VAEA 3SJSA 5FVGA 1MQ1A 5DKNA 5LK4A 4JF9A 2PALA 4PHJA 5EXUA 2M29A 2EGDA 4W7DA 1CKKA 5HKYA 3SSKA 2RGIA 3EK8A 5HZSA 4P1QA 1D1OA 2LUXA 1MOUA 2H5QA 4W6DA 1YVHA 2JRFA 4OR9B 2EC6C 2NXQA 1CDNA 4W6HA 1K93D 2L0PA 2H9WA 1ZGPA 1G8IA 3VHTA 4ZIOA 3DF0B 2B3QA 1UUSA 3TDIA 5EB7A 1GGXA 1HT9A 3I5GB 4CIDA 4ZINA 3CLNA 1SRAA 5EBJA 5AANA 1XA5A 4YRUA 1NCZA 2BL0B 1QIWA 4BY5A 3DQHA 1WRKA 1IQ3A 4H3NA 3DQ7A 4N3DA 1Q4AA 1F8HA 2OS8B 2K0JA 1B7TY 4W75A 1MR8A 3HCMA 2JADA 1XVJA 1UP5A 3WCKA 4XGYA 2EMOA 1M31A 4GESB 2YFPA 1AHRA 3QRXA 2JNXA 3ZUFA 2WORA 4H47A 4JFGA 4W76A 1CM1A 1DJHA 3NT3A 2LLSA 3VRRA 3TUYC 2LCPA 3CTNA 2TN4A 3GB3A 4GFTA 3U8AA 2KYCA 5LTRA 2H8QA 4W6CA 1EXRA 1XFUO 1RMMA 5DTZA 2BBMA 4WQ3A 1PRWA 1XFZO 2WCBA 2O24A 2M8UA 1E8AA 1JC1A 2G16B 1XFWO 1B8CA 1S6JA 5LTPA 3ZNIA 3WLDA 1DGUA 5JOLA 4I5LB 1RRXA 4QJ3B 4DXNA 4JC2A 2CBLA 3PN7C 2R2IA 1TNQA 3SV5A 1YRTB 2LLTA 4NDDA 4PE7A 5AQBB 2Y1NA 1S6ZA 1CNPA 3CGLA 4KF5C 4TZAA 2LHIA 4YGDB 3AKBA 4Q7UA 4NQGA 3GJ2A 2Y0GA 1M39A 1EH2A 2A54B 3PJ7A 1QX2A 2KOTA 5PALA 2Z6ZA 2WCFA 2AWMA 2JT3A 2MAZA 4I2YA 1S6CA 2QLGB 5TNCA 3WLCA 4PHKA 3CFAA 2QLGA 3RLZA 1F4QA 1CLLA 2JOJA 3OSRA 3WHTB 1M63B 3JTDC 1DGVA 3PM8A 3I5HC 1KSOA 1R2UA 3BOWB 2QLIA 1B1GA 1QLSA 2FCDA 1BF5A 1Q80A 2BTJA 2O2BA 2KHNA 3M24A 1DJWA 1AP4A 1H4BA 1NYAA 2RH7A 2QZ0A 1G4YR 2HQZA 4RYWA 2KAYA 1AUIB 4W7AA 4DXQA 2MLFC 1K95A 5KSZA 4XOWA 4W69A 3CBEA 4J8AA 3LCPC 4I5JA 3SRYA 2JTTA 5EXCI 3UG0A 4KGEA 1QLKA 2LM5A 2KFHA 5HLOA 2JTZA 4OY4A 3ZUJA 2MRDA 4LJDA 2KBMA 2NZ0A 4W6LA 1NCXA 1J1EA 2MLEC 1IGVA 4YGAA 2HCGA 3GEXA 1DJZA 3V3DA 5HZTA 1LVCD 4GBAA 4W7CA 4N1GA 3SVBA 2BKHB 3VRQA 1CDLA 3AKOA 2PXSA 1Y1XA 2DUFA 1KK7Z 5CPVA 2KQ6A 1CLBA 1EG4A 3ED8A 3LF4B 3BXAA 1RMPA 3DVMA 2WIQA 3KF9A 3TS5C 3NF0A 2GGZA 2K7DA 4W7XA 1GGWA 1TTXA 3OSQA 1Q4CA 3LK0A 3NSIA 2AWJA 4JGEA 4ZFSA 1QV1A 2DUGA 4KGFA 1EMGA 3SSYA 3NSLA 1IH0A 5DTXA 1F4OA 4MEWA 1K96A 4E68A 1B47A 4W6AA 3AAKA 3WHUB 4ORNA 3SS0A 5D69A 1BOCA 2OGRA 2L98A 3SG3A 2AWKA 1B9AA 3I5IB 2PSRA 4FTGA 4KW4A 1QASA 3ADFA 1W7JB 4LJCA 1XQMA 1OQPA 4H3MA 1MF8B 1S5GY 4OVNF 2VRGA 4L9MA 1MOVA 1CFCA 1IJ5A 4ETOA 4AQIA 1SW8A 1RFJA 3VK1A 1YX7A 1BMOA 1DJXA 3DQJA 4W7RA 1B9CA 4D1EA 5DY6A 1UISA 2F33A 1SK6D 4I5NB 2ZNEA 4ZF5A 3E3RA 4PPKA 4N5XA 1VRKA 3EVUA 3ST2A 3D0YB 1DMOA 2YDZA 4PE4A 3AKAA 3LVCA 2WOSA 3I5IC 2QLHA 1IJ6A 1DVIA 1GGZA 3UFZA 1XFYO 5BTTA 2QPTA 4ZBLA 1BJFA 5IBWA 1YJFA 3OHMB 3O78A 3BUNB 4W6FA 1KP5A 2V53A 3DPXA 1J55A 1BT6A 1QXTA 3CD9A 3ICBA 2VADA 4AOMA 4IK5A 3KO0A 3DQIA 2KFFA 2LAPA 3DF0A 2GV5A 3CB9A 1BR1B 3PATA 3P28A 3OP0A 4MZJA 4FQOA 4GF6B 3C1VA 5H87A 1CV7A 2FOTA 1SR6B 3CR5X 1IQ5A 3SVSA 4C0JA 5CSIA 3K21A 2KGRA 1YZWA 2LMTA 4R6DA 4KW9A 4Q04A 2JULA 1ZOTB 4PALA 1OMVA 1NUBA 3VGOA 5AERA 1CFDA 3PIBA 2G2BA 5EB6A 2PASA 3BYAA 1GQMA 3DQCA 1S1EA 2BCAA 2NCOA 5CSJA 5BTTB 2A53B 2Y4QA 1TCOB 1Z1QA 2Q91A 3SVCA 5DRFA 1KYPA 1PSBA 4NDBA 4W6TA 1OMRA 1J7PA 1QYQA 3TDZA 2A50B 4GOBA 1FW4A 2HF5A 1TCFA 2IB6A 1J7QA 2K7CA 3RWAA 4DXIA 3VRPA 5JJGA 1PK0D 2Y1MA 4W6JA 1LXFC 3OB2B 4DKNA 2MHHA 1L2OC 2ZNDA 1KFUL 3NSOA 1BLQA 3KCSA 2LANA 1RROA 4W6OA 3P8UA 2GW4B 1CDMA 4DRWA 1CM4A 3CFHA 4W6UA 4XOVA 1YUUA 3LLEA 2LNKA 2H5PA 2JZIA 3TMTA 2KAVA 3A4UB 2VVIA 2JT0A 3EVRA 4KF4A 3AI5A 2OTBA 2M1KB 2LVVA 5ER4X 4YGEB 3I5GC 3DQ3A 3H4SE 1WLZA 3ST3A 2OTEA 4WQ2A 3SSTA 2L2EA 2ZO6A 2KYFA 4PHMA 2L50A 3SSHA 3SVEA 3DQNA 2SCPA 2KAXA 2EC6B 3E5TA 3PALA 2A48A 4GUKA 1NX3A 3ST4A 2FL1A 4Z4KA 1H8BA 2HQWA 3FIAA 2COLB 1OE9B 2JWWA 4YI9A 4W6BA 2LVKA 5EXBA 1C4FA 2WSNA 1H4UA 1YR5A 2IE2A 4KA9A 2P6BB 1KK7Y 5K89A 3I5FB 4Q7TA 3K1KA 3HX4A 1WY9A 5I2OA 2OJKA 2CTNA 2QACA 2E30A 1S6IA 3IQQA 1DF0A 1XAEA 2IS9A 4OQWA 4HQCA 1GFLA 1J7OA 2HRSA 5BT0A 4L1IA 1UHHA 5DQMA 2LHLA 1K90D
chains in the Genus database with same CATH superfamily
2GX2A 3BUWB 1JF0A 3SIBA 5T3IA 1WDCC 2AAOA 3PSRA 2JPTA 2KI4C 1UHJA 3PN7B 2LVJA 1N65A 3R1OA 1LKJA 3M22A 1RECA 1RWYA 1TRFA 1NCYA 2ZKMX 3IVTA 2KPHA 1UURA 3U0LA 3FE6A 1GJYA 3DPWA 2WISA 4CFRA 3NHIA 3LVDA 3AI4A 3BFAA 2CCMA 4IK4A 2QLEA 1BR4B 1A4PA 2NLNA 2A52B 3GK1A 3PFVA 2VZXA 2HPWA 1KWOB 1TIZA 3DQ1A 4CFQA 3NT9A 1DF0B 3E5WA 2Y5IA 1S36A 1ZUXA 2KGBC 2A47A 2EHBA 3SS4A 4MRYA 1BFPA 1YFPA 4HRHA 2BCXA 2M49B 2ARLA 2C9IA 4CPVA 2QDIA 5I2LA 1KSMA 3W1CA 1HQVA 4PDZA 2DUHA 4LQUA 3TMRA 1NX2A 2F3YA 2DUIA 2V4EB 3WNXB 1R6PA 3KPXA 5HKWA 2GW3A 3NHTA 1XO5A 1NX1A 1UWOA 1MXLC 3PJIA 2JC2A 4GGFA 3TDUA 5HYDA 1AJ5A 2OKWA 4OV2A 4RTCA 5CSNA 4OGSA 3FWCA 2HJOA 5LTQA 1OW4A 2WC5A 2P4MA 3DQLA 3DD4A 1DQEA 2H61C 3SVRA 1KQMC 4EDSA 2L5XB 1DT7B 2LMUA 1DEKA 1SL8A 1UHKA 3L47A 1MUXA 5DTLA 3NEZA 4OKHA 4MLWA 3GK2A 2MA2A 3R72A 4KF5A 3KHEA 3PJ5A 3B87A 1A75A 5D7FA 2CXJA 4MSPA 2HGDA 3TZ1A 4W6RA 1SL7A 1LA3A 1KQVA 5H89A 3W1DA 2WNDA 3E5VA 3CR2A 3SVDA 1A03A 1JC0A 3SG4A 3MSEB 2QT2A 1QXPA 3CFFA 2WHSA 2K7BA 2G6YA 3BFBA 1QVIY 5HZOA 4YGBB 3O6BA 4B5YA 3O4YA 5DKQA 1KFXS 2Q6PA 2ZRSA 1S26D 2K60A 3LS3A 2WURA 2EMNA 2M9GA 2K61A 3D10A 4B30B 3OGOA 4H48A 3LA1A 1SCVA 2QU1A 4PPLA 1YUSA 1DELA 3B7AA 2LP3A 2M7NA 1EJ3A 4HRGA 2H6VA 3WXAA 2OTGC 4IJ7A 1JWDA 2V4EC 5J3XA 2FJUB 4QJ5B 3EKHA 4PE1A 1JFKA 1QVIZ 1C7VA 1OOGA 4GGFC 1W7UA 3SVOA 4KPIA 3OB1B 3BXBA 3O2PA 4W6SA 2I18A 3SS3A 2F8PA 4PPJA 3FS7A 4HQ8A 1WLMA 3SSVA 1YRUB 1OSAA 3S0GA 3H1OA 1Z2CB 4W6GA 2JQ6A 1BODA 1KFXL 4MRXA 3ZWHA 3DQEA 1ZGQA 2LLUA 3NXAA 1YURA 1QYFA 5HKZA 2K7OA 2M3WA 2L2CA 1K8UA 2HGYA 2O5GA 1JF2A 5FI6A 1IIOA 3EKJA 2SASA 5FHVA 1F0BA 3D77A 2ZMWA 4H3LA 2F2PA 4XJKB 4DXOA 3VB1A 4OHSA 3DQ4A 4JD9A 2LV7A 2BCBA 1JBAA 3RWTA 3ST0A 1OMDA 4Q7RA 1DJGA 5AFPA 1EL4A 5HZUA 5DTYA 2G3OA 2VVJA 2PYQA 3CS1A 1FI5A 5DPHA 3B86A 3GOFA 4YBHB 1PVBA 1YHHA 3CR4X 1OOHA 3BOWA 1FF1A 2H61A 4MZLA 1QV0A 1YHIA 4BDUA 2DD9A 2A46A 1KYRA 3LK1A 4A4BA 1SKTA 4JQ0D 2BKIB 3DVKA 1ZMZA 1OXFA 2KI6C 2BNXA 5DRGA 1S3PA 4GPLB 2BE6A 1QTXA 4R6BA 2DOQA 4HE4A 2KFGA 1LINA 2I2RE 2HPSA 3DQMA 1S5GZ 1EMKA 1YHGA 1IKUA 4DKMA 4ZCUA 4Q9XA 2BE4A 1L2OB 1XK4A 2BBNA 2I94A 3D76A 4EMQA 4ORBB 3CABA 3DYEA 1Y6WA 1XMZA 2FWQA 1V1FA 1CB1A 4MN0A 1KK8B 4F7FA 3PJBA 3DQKA 1WRZA 1QATA 3B88A 4Q9WA 3BX9A 2OKYA 4U8DA 3D73A 5KTYA 3S0AA 2VVHA 1PSRA 1AK8A 4W74A 2F2OA 2DDCA 5F6TA 2LUCA 2ERBA 3S05A 4ICBA 3DQUA 1B8RA 3CD1A 1SCMC 1TN4A 1K9UA 3LL8B 1J1DA 4WRIA 4KW8A 1QJTA 3AAJA 4W77A 5DU0A 1F70A 4M2OA 4W6IA 2YE0A 2EMDA 2Z1OA 1SMGA 1NIWA 1XYDA 1RJVA 4GAOA 2ZN8A 2WCEA 1K94A 2IOVA 4HQ9A 2KI4B 3DY9A 1WDCB 1NWDA 2POXA 1L7ZA 5BQLA 1J7RA 1UHNA 4J88A 3DQAA 3GK4X 1EMEA 1QS7A 3PLFB 3EK7A 4MZKA 4TNCA 5DPGA 4C0KA 1IRJA 3BXKA 4PFEA 3JVTB 2E6WA 1XSSA 2H5OA 1TUJA 4KEXA 2AHAA 5FVFA 5FVIA 4IK8A 2PMYA 5B8IB 1C7WA 3GJ1A 3U0MA 1SYMA 2L51A 3CYZA 2ZO7A 1F55A 3DQFA 4GNKB 1PVAA 2G6XA 4F0ZB 2K8MB 1N0YA 1LA0A 1EMAA 2MJWB 1CMGA 3LF3A 1PALA 4IK9A 1GL4A 4DUQA 4ZB1A 1DJIA 3EVPA 2KI6D 1C3ZA 4KAGA 3IQOA 4IZNA 4DXMA 2M1UA 1V1GA 4XL5A 2HFCA 2Q4UA 4W7FA 3DQ9A 2K2FA 3NSKA 1QX5B 4GGNA 4CLNA 5EJUA 4AS8A 3EK4A 3A8SA 3NGVA 2KQYA 4LQTA 1BU3A 2M7LA 4EULA 2DDDA 2KBIA 5HW9A 2NCPA 3BJHA 2HQKA 2ZRTA 5DPIA 2KDHA 2V4EA 3SG7A 5G08A 2JT8A 2WC6A 1KCYA 2G3DB 1B8LA 4LJBA 1Z1PA 4HREE 2OPOA 1NPQA 4P5OE 1YJ2A 1XK4C 3MGFA 5J2OA 2QEOA 1CFFA 1AJ4A 3EVVA 4R1EA 4BY4A 1RTP1 1H6RA 5FI2A 2AMIA 2LVIA 1K9KA 3CGAA 2DD7A 3LVAA 4JEOA 1JSAA 3OX6A 2K2AA 1EMLA 1YUTA 3DQ8A 4RYSA 1EMFA 3S0FA 4L12A 2AUCA 4M2PA 3D74A 1SY9A 4M2QA 1TNXA 1B4CA 1M45A 1ODBA 3OX5A 2F3ZA 3BUMB 5I94A 1F54A 2WHUA 4I5KA 2A56B 2QRFA 1T14A 3U8PA 4W73A 3N7HA 5KTGA 3G9AA 2O29A 1Y1UA 1EG3A 5I8NA 2WCJA 2G5ZB 2C9JA 1DTLA 2JXCA 3VRNA 1U5IA 2LE9B 4W72A 1TNWA 1Q4EA 2Q57A 3TS5B 3DVJA 3KEVA 3H1RA 4ANJA 4NDCA 1Q73A 1SR6C 2Z6XA 4ZF3A 3RM1A 3QMEA 3O77A 3D0YA 2KNEA 1A29A 4IK3A 3BQ3A 2JPOA 5DICA 1K2HA 1NSHA 1MXEA 3IF7A 1SPYA 5H88A 2BECA 1IG5A 3IR8A 1ZUZA 3A8RA 1EMBA 3F45A 4OZDA 3DQ2A 2KSPA 3DQDA 4XVPA 5ER5A 5KU1A 3DQ6A 1HCJA 2FCEA 1Y0VH 2OS8C 3VICA 4IK1A 1G7KA 4W6NA 1XFXO 1KFUS 3DVEA 3M0WA 1ALWA 4OCIA 3JTDB 2AH8A 4W6KA 3LSAA 2B3PA 2PVBA 4W6MA 4W7EA 1CDPA 4MVFA 1WRLA 2ZMUA 2I7AA 5HGEA 1TNPA 2WCLA 4PCWA 1EMMA 5DQBA 1XA9A 3UNWA 3SG6A 4YI8A 1ALVA 3VHTB 1OZSA 2WSOA 1F09A 2CT9A 2ZN9A 1U5IB 1JBZA 2CNPA 1CTRA 3CWGA 4XYNA 2H2KA 4JWQA 1UHIA 3SSLA 5BPJA 5CSFA 1KYSA 1TWOA 4A4CA 3SSPA 4U2VA 1G33A 1B7TZ 1TOPA 3I5HB 2FZUA 3S0EA 1MWNA 3R1PA 4ORCB 3BUOB 1RMOA 4ORAB 2PXWA 2L4HA 3OGNA 4USLA 1OOJA 1SBJA 1KQMB 1X02A 1C3YA 3K1EA 4PHNA 4TZGA 3OBVA 4UTSA 3U0NA 1P28A 5AEQA 3FWBA 3KCTA 3JVTC 3B6XA 1Y1AA 2DUEA 1HUYA 1IWQA 1FI6A 1NX0A 3SG2A 2HQ8A 1YTZC 2WC8A 3U8CA 2LC5A 1A75B 2H8VA 4EDOA 3SVUA 4YGCB 1CMFA 4HSZA 3SVNA 4W6PA 4EN1A 1JFJA 1AVSA 1JC2A 1F71A 1RM9A 2WHTA 2JU0A 1OXDA 4QJ4B 3TUYB 1N2DA 3DQOA 1ZFSA 1Q4DA 5DKRA 4AQJA 2AWLA 3PM2A 2Z6YA 1QIVA 1DJYA 2HETA 4Z4MA 3CZTX 3BUXB 1W7IB 4NWSA 1QYOA 1XFVO 4P2YB 5GQQC 1ZGOA 1CLMA 1SCMB 2LP2A 2M97A 4C0LA 1Q4BA 3S0BA 3SG5A 3SIAA 1C07A 1KWOC 1M46A 2WCMA 2YE1A 3DPZA 4P76A 4UPGA 4LW5A 4JPZB 1ZACA 2O60A 4DIRA 2ISDA 3U0KA 1SNLA 4LJDC 4HVFA 4JRBA 2M0RA 2IB5A 2G2SB 2H5RA 4J89A 3ZULA 2L4IA 3NEDA 1KK8C 2WCKA 3BXCA 3CZ1A 5HBDA 3I19A 2G6EA 2G9BA 1CFPA 1FPWA 3GL4A 1PULA 5F9GA 4ZCVA 1FBVA 5I2QA 1RK9A 1YVLA 1MHOA 4ZF4A 5FYXA 3UO9A 1MYWA 1JBYA 1A2XA 5AXIA 3ZTFA 2D8NA 4AR7A 2OTGB 1SL9A 5EHUA 2A4JA 4DS7A 4XJKA 4N1FA 3IP2A 5DPJA 1QX7A 4DXPA 1W7TA 4DCKA 2GGMA 2PRUA 2BL0C 2GX0A 1NP8A 1YX8A 4PE0A 1BG1A 4B30A 2LMVA 2B1UA 2MBXA 3VROA 1W7SA 1K9PA 3DQ5A 2ICRA 2JNFA 4L13A 5HLVA 1QY3A 2ZFDA 1OZOA 4OJ0A 4MBEA 1EMCA 1OXEA 4IL1A 3I5FC 1JUOA 2JXLA 2VAEA 3SJSA 5FVGA 3CZ0A 1MQ1A 5DKNA 5LK4A 4JF9A 2PALA 4PHJA 5EXUA 2M29A 2EGDA 4W7DA 1CKKA 5HKYA 3SSKA 2RGIA 3EK8A 5HZSA 4P1QA 1D1OA 2LUXA 1MOUA 3FE8A 2H5QA 4W6DA 1Z4HA 3S0DA 1YVHA 5FI7A 2JRFA 4OR9B 2EC6C 2NXQA 1CDNA 4W6HA 1K93D 2L0PA 2H9WA 1ZGPA 3V2LA 1G8IA 3VHTA 4ZIOA 3DF0B 2B3QA 1UUSA 3TDIA 5EB7A 1GGXA 1HT9A 3I5GB 4INXA 4CIDA 4ZINA 3CLNA 1SRAA 5EBJA 5AANA 1OOFA 1XA5A 4YRUA 1NCZA 2BL0B 1QIWA 4BY5A 3DQHA 1WRKA 1IQ3A 4H3NA 3DQ7A 4N3DA 1Q4AA 1F8HA 2OS8B 2K0JA 1B7TY 4W75A 1MR8A 3HCMA 2JADA 3RZSA 2QEHA 1XVJA 1UP5A 3WCKA 4XGYA 2EMOA 1M31A 4GESB 2YFPA 2KLDA 1AHRA 3QRXA 2JNXA 3ZUFA 2WORA 4H47A 4JFGA 1CM1A 4W76A 1DJHA 3NT3A 2LLSA 3VRRA 2WCHA 3TUYC 2LCPA 3CTNA 2TN4A 3GB3A 4GFTA 3U8AA 2KYCA 5LTRA 2H8QA 4W6CA 1EXRA 1XFUO 1RMMA 5DTZA 2BBMA 4WQ3A 1PRWA 1XFZO 2WCBA 2O24A 2M8UA 1E8AA 1JC1A 2G16B 1XFWO 1B8CA 1S6JA 3FE9A 5LTPA 3ZNIA 3WLDA 1DGUA 1QWVA 5JOLA 4I5LB 1RRXA 4QJ3B 4DXNA 1LS8A 4JC2A 2CBLA 3PN7C 2R2IA 1TNQA 3SV5A 1YRTB 2LLTA 3CDNA 4NDDA 4PE7A 4KYNA 5AQBB 2Y1NA 1S6ZA 1CNPA 3CGLA 4KF5C 4TZAA 2LHIA 4YGDB 3AKBA 4Q7UA 3GJ2A 4NQGA 2Y0GA 1M39A 1EH2A 2A54B 3PJ7A 1QX2A 2KOTA 5PALA 2Z6ZA 2WCFA 2AWMA 2JT3A 2MAZA 4I2YA 1S6CA 2QLGB 5TNCA 3WLCA 4PHKA 3CFAA 2QLGA 3L4AA 3RLZA 1F4QA 1CLLA 4JKTA 2JOJA 3OSRA 3WHTB 1M63B 3JTDC 1DGVA 3PM8A 3I5HC 1KSOA 1R2UA 3BOWB 2QLIA 1B1GA 1QLSA 2FCDA 1BF5A 1Q80A 2BTJA 2O2BA 2KHNA 3M24A 1DJWA 1AP4A 1H4BA 1NYAA 2RH7A 3D78A 2QZ0A 1G4YR 2HQZA 4RYWA 2KAYA 1AUIB 4W7AA 4DXQA 2MLFC 1K95A 5KSZA 4XOWA 4W69A 3CBEA 4J8AA 3LCPC 4I5JA 3SRYA 2JTTA 5EXCI 3UG0A 4KGEA 1QLKA 2LM5A 2KFHA 5HLOA 2JTZA 4OY4A 3ZUJA 2MRDA 4LJDA 2KBMA 2NZ0A 4W6LA 1NCXA 1J1EA 2MLEC 1IGVA 4YGAA 2HCGA 3GEXA 1DJZA 4INWA 3V3DA 5HZTA 1LVCD 4GBAA 4W7CA 4N1GA 3SVBA 2BKHB 3VRQA 1CDLA 3AKOA 1W9ZA 2PXSA 1Y1XA 2DUFA 1KK7Z 5CPVA 2KQ6A 1CLBA 1EG4A 3ED8A 2KLEA 3LF4B 4FQTA 3BXAA 1RMPA 3DVMA 2WIQA 3KF9A 3TS5C 3NF0A 2GGZA 2K7DA 4W7XA 1GGWA 1TTXA 3OSQA 1Q4CA 3LK0A 3NSIA 2AWJA 4JGEA 4ZFSA 1QV1A 2DUGA 4KGFA 1EMGA 3SSYA 3NSLA 1IH0A 5DTXA 1F4OA 4MEWA 1K96A 5EL2A 4E68A 1B47A 4W6AA 3AAKA 3WHUB 4ORNA 5D69A 1BOCA 3SS0A 2OGRA 2L98A 3SG3A 2AWKA 3SS5A 1B9AA 3I5IB 2PSRA 4FTGA 2GTEA 4KW4A 1QASA 3ADFA 1W7JB 4LJCA 1XQMA 1OQPA 4H3MA 1MF8B 1S5GY 4OVNF 2VRGA 4L9MA 1MOVA 1CFCA 1IJ5A 4ETOA 4AQIA 1SW8A 3R1VA 1RFJA 3VK1A 1YX7A 1BMOA 3DZTA 1DJXA 3DQJA 4W7RA 1B9CA 4D1EA 5DY6A 1UISA 2F33A 1SK6D 4I5NB 2ZNEA 4ZF5A 3L4LA 3E3RA 4PPKA 4N5XA 1VRKA 3EVUA 3ST2A 3D0YB 1DMOA 2YDZA 4PE4A 1GM0A 3AKAA 3LVCA 2WOSA 3I5IC 2QLHA 1IJ6A 1DVIA 1GGZA 3UFZA 1XFYO 5BTTA 2QPTA 4ZBLA 1BJFA 5IBWA 1DC1A 1YJFA 3OHMB 3O78A 3BUNB 3Q8IA 4W6FA 1KP5A 2V53A 3DPXA 1J55A 1BT6A 1QXTA 3CD9A 3ICBA 2VADA 4AOMA 4IK5A 3KO0A 3DQIA 2KFFA 2LAPA 2BAPA 3DF0A 2GV5A 3CB9A 1BR1B 3PATA 3P28A 3OP0A 4MZJA 4FQOA 4GF6B 3C1VA 5H87A 1CV7A 5D3OA 2FOTA 1SR6B 3CR5X 1IQ5A 3SVSA 4C0JA 5HL1A 5CSIA 3K21A 3DXLA 2KGRA 1YZWA 2LMTA 4R6DA 4KW9A 2P71A 4Q04A 3D75A 2JULA 1ZOTB 4PALA 1OMVA 1NUBA 3VGOA 5AERA 1CFDA 3PIBA 2G2BA 2PASA 3BYAA 5EB6A 1GQMA 3DQCA 2YGUA 1S1EA 2BCAA 2NCOA 5CSJA 5BTTB 2A53B 2Y4QA 1TCOB 1Z1QA 2Q91A 3SVCA 5DRFA 3EG5B 1KYPA 1PSBA 4NDBA 4W6TA 1OMRA 1J7PA 1QYQA 3TDZA 2A50B 4GOBA 1FW4A 2HF5A 1TCFA 2IB6A 1J7QA 2K7CA 3RWAA 4DXIA 3VRPA 5JJGA 1PK0D 2Y1MA 4W6JA 1LXFC 3OB2B 4DKNA 2MHHA 1L2OC 2ZNDA 1KFUL 3NSOA 1BLQA 3KCSA 2LANA 1RROA 4W6OA 2QEVA 3P8UA 2GW4B 1OOIX 1CDMA 4DRWA 1CM4A 3CFHA 4W6UA 2L5YA 4XOVA 1YUUA 3LLEA 2LNKA 2H5PA 2JZIA 2FJYA 2KAVA 3A4UB 3TMTA 2VVIA 2JT0A 3EVRA 4KF4A 3AI5A 2OTBA 2M1KB 2LVVA 5ER4X 4YGEB 3I5GC 3DQ3A 1SSEB 3H4SE 1WLZA 3ST3A 2QEBA 2OTEA 4WQ2A 3SSTA 2L2EA 2ZO6A 2KYFA 4PHMA 2L50A 1TUZA 3SSHA 3SVEA 3DQNA 2SCPA 2KAXA 2EC6B 3E5TA 3PALA 2A48A 4GUKA 1NX3A 3ST4A 2FL1A 4Z4KA 1H8BA 2HQWA 3FIAA 2COLB 1OE9B 2JWWA 4YI9A 4W6BA 2LVKA 5EXBA 1C4FA 2WSNA 1H4UA 4PT1A 1YR5A 2IE2A 4KA9A 2P6BB 2PQLA 3BFHA 1KK7Y 5K89A 3I5FB 4Q7TA 3CZ2A 3HX4A 3K1KA 1WY9A 5I2OA 3O4XA 2P70A 2OJKA 2CTNA 1XFRA 2QACA 2E30A 1S6IA 3IQQA 1DF0A 1XAEA 2IS9A 4OQWA 4HQCA 1GFLA 1J7OA 2HRSA 5BT0A 4L1IA 1UHHA 1ORGA 5DQMA 2LHLA 1K90D
chains in the Genus database with same CATH topology
2GX2A 3BUWB 1JF0A 3SIBA 5T3IA 1WDCC 2AAOA 3PSRA 2JPTA 2KI4C 1UHJA 3PN7B 2LVJA 1N65A 1LKJA 3M22A 1RECA 1RWYA 1TRFA 1NCYA 2ZKMX 1UURA 3U0LA 1GJYA 3DPWA 2WISA 4CFRA 3LVDA 3AI4A 2CCMA 4IK4A 2QLEA 1BR4B 1A4PA 2NLNA 2A52B 3GK1A 3PFVA 2VZXA 2HPWA 1KWOB 1TIZA 3DQ1A 4CFQA 3NT9A 1DF0B 3E5WA 2Y5IA 1S36A 1ZUXA 2KGBC 2A47A 2EHBA 4MRYA 1BFPA 1YFPA 4HRHA 2BCXA 2M49B 2ARLA 2C9IA 4CPVA 5I2LA 1KSMA 3W1CA 1HQVA 4PDZA 2DUHA 4LQUA 3TMRA 1NX2A 2F3YA 2DUIA 2V4EB 3WNXB 1R6PA 3KPXA 5HKWA 2GW3A 1XO5A 1NX1A 1UWOA 1MXLC 2JC2A 4GGFA 3TDUA 5HYDA 1AJ5A 2OKWA 4OV2A 4RTCA 5CSNA 4OGSA 3FWCA 2HJOA 5LTQA 2P4MA 3DQLA 3DD4A 2H61C 3SVRA 1KQMC 4EDSA 2L5XB 1DT7B 2LMUA 1SL8A 1UHKA 1MUXA 5DTLA 3NEZA 4OKHA 4MLWA 3GK2A 2MA2A 4KF5A 3KHEA 3PJ5A 1A75A 5D7FA 2CXJA 4MSPA 2HGDA 3TZ1A 4W6RA 1SL7A 1LA3A 1KQVA 5H89A 3W1DA 2WNDA 3E5VA 3CR2A 3SVDA 1A03A 1JC0A 3SG4A 3MSEB 2QT2A 1QXPA 3CFFA 2WHSA 2K7BA 2G6YA 1QVIY 5HZOA 4YGBB 3O6BA 4B5YA 3O4YA 5DKQA 1KFXS 2Q6PA 2ZRSA 1S26D 3LS3A 2WURA 2EMNA 2M9GA 2K61A 3D10A 4B30B 3OGOA 4H48A 3LA1A 1SCVA 2QU1A 4PPLA 1YUSA 2LP3A 2M7NA 1EJ3A 4HRGA 2H6VA 3WXAA 2OTGC 1JWDA 2V4EC 5J3XA 2FJUB 4QJ5B 3EKHA 4PE1A 1JFKA 1QVIZ 1C7VA 4GGFC 1W7UA 3SVOA 4KPIA 3OB1B 3BXBA 3O2PA 4W6SA 2I18A 2F8PA 4PPJA 3FS7A 4HQ8A 1WLMA 3SSVA 1YRUB 1OSAA 3H1OA 4W6GA 2JQ6A 1BODA 1KFXL 4MRXA 3ZWHA 3DQEA 1ZGQA 2LLUA 3NXAA 1YURA 1QYFA 5HKZA 2K7OA 2M3WA 1K8UA 2HGYA 2O5GA 1JF2A 3EKJA 2SASA 5FHVA 1F0BA 2ZMWA 4H3LA 2F2PA 4XJKB 4DXOA 4OHSA 3DQ4A 2LV7A 2BCBA 1JBAA 3RWTA 3ST0A 1OMDA 4Q7RA 1DJGA 5AFPA 1EL4A 5HZUA 5DTYA 2G3OA 2VVJA 3CS1A 1FI5A 5DPHA 3GOFA 4YBHB 1PVBA 1YHHA 3CR4X 3BOWA 1FF1A 2H61A 4MZLA 1QV0A 1YHIA 4BDUA 2DD9A 2A46A 1KYRA 3LK1A 4A4BA 1SKTA 4JQ0D 2BKIB 3DVKA 1ZMZA 1OXFA 2KI6C 5DRGA 1S3PA 4GPLB 2BE6A 1QTXA 4R6BA 2DOQA 4HE4A 2KFGA 1LINA 2I2RE 2HPSA 3DQMA 1S5GZ 1EMKA 1YHGA 1IKUA 4DKMA 4ZCUA 4Q9XA 2BE4A 1L2OB 1XK4A 2BBNA 2I94A 4EMQA 4ORBB 1Y6WA 1XMZA 2FWQA 1V1FA 1CB1A 4MN0A 1KK8B 3PJBA 3DQKA 1WRZA 1QATA 4Q9WA 3BX9A 2OKYA 4U8DA 5KTYA 2VVHA 1PSRA 1AK8A 4W74A 2F2OA 2DDCA 5F6TA 2LUCA 3S05A 4ICBA 3DQUA 1B8RA 3CD1A 1SCMC 1TN4A 1K9UA 3LL8B 1J1DA 4WRIA 4KW8A 1QJTA 3AAJA 4W77A 5DU0A 1F70A 4M2OA 4W6IA 2YE0A 2EMDA 2Z1OA 1SMGA 1NIWA 1XYDA 1RJVA 4GAOA 2ZN8A 2WCEA 1K94A 2IOVA 4HQ9A 2KI4B 1WDCB 1NWDA 2POXA 1L7ZA 5BQLA 1J7RA 1UHNA 4J88A 3DQAA 3GK4X 1EMEA 1QS7A 3PLFB 3EK7A 4MZKA 4TNCA 5DPGA 4C0KA 1IRJA 3BXKA 4PFEA 3JVTB 2E6WA 1XSSA 2H5OA 4KEXA 2AHAA 5FVFA 5FVIA 4IK8A 2PMYA 5B8IB 1C7WA 3GJ1A 3U0MA 1SYMA 2L51A 2ZO7A 1F55A 3DQFA 4GNKB 1PVAA 2G6XA 4F0ZB 2K8MB 1N0YA 1LA0A 1EMAA 2MJWB 1CMGA 3LF3A 1PALA 4IK9A 1GL4A 4DUQA 4ZB1A 1DJIA 3EVPA 2KI6D 4KAGA 3IQOA 4IZNA 4DXMA 2M1UA 1V1GA 4XL5A 2HFCA 2Q4UA 4W7FA 3DQ9A 2K2FA 3NSKA 1QX5B 4GGNA 4CLNA 5EJUA 4AS8A 3EK4A 3A8SA 2KQYA 4LQTA 1BU3A 2M7LA 4EULA 2DDDA 2KBIA 5HW9A 2NCPA 2HQKA 2ZRTA 5DPIA 2KDHA 2V4EA 3SG7A 5G08A 2JT8A 1KCYA 2G3DB 1B8LA 4LJBA 1Z1PA 4HREE 2OPOA 1NPQA 4P5OE 1YJ2A 1XK4C 3MGFA 5J2OA 1CFFA 1AJ4A 3EVVA 4R1EA 4BY4A 1RTP1 1H6RA 2AMIA 2LVIA 1K9KA 3CGAA 2DD7A 3LVAA 4JEOA 1JSAA 3OX6A 2K2AA 1EMLA 1YUTA 3DQ8A 4RYSA 1EMFA 4L12A 2AUCA 4M2PA 1SY9A 4M2QA 1TNXA 1B4CA 1M45A 1ODBA 3OX5A 2F3ZA 3BUMB 1F54A 2WHUA 4I5KA 2A56B 2QRFA 3U8PA 4W73A 5KTGA 3G9AA 2O29A 1Y1UA 1EG3A 5I8NA 2G5ZB 2C9JA 1DTLA 2JXCA 3VRNA 1U5IA 2LE9B 4W72A 1TNWA 1Q4EA 2Q57A 3TS5B 3DVJA 3KEVA 3H1RA 4ANJA 4NDCA 1Q73A 1SR6C 2Z6XA 4ZF3A 3RM1A 3O77A 3D0YA 2KNEA 1A29A 4IK3A 3BQ3A 1K2HA 1NSHA 1MXEA 3IF7A 1SPYA 5H88A 2BECA 1IG5A 3IR8A 1ZUZA 3A8RA 1EMBA 3F45A 3DQ2A 2KSPA 3DQDA 4XVPA 5ER5A 5KU1A 3DQ6A 1HCJA 2FCEA 1Y0VH 2OS8C 3VICA 4IK1A 1G7KA 4W6NA 1XFXO 1KFUS 3DVEA 3M0WA 1ALWA 4OCIA 3JTDB 2AH8A 4W6KA 3LSAA 2B3PA 2PVBA 4W6MA 4W7EA 1CDPA 4MVFA 1WRLA 2ZMUA 2I7AA 5HGEA 1TNPA 4PCWA 1EMMA 5DQBA 1XA9A 3SG6A 4YI8A 1ALVA 3VHTB 1OZSA 2WSOA 1F09A 2CT9A 2ZN9A 1U5IB 1JBZA 2CNPA 1CTRA 3CWGA 4XYNA 2H2KA 4JWQA 1UHIA 3SSLA 5BPJA 5CSFA 1KYSA 4A4CA 3SSPA 4U2VA 1G33A 1B7TZ 1TOPA 3I5HB 2FZUA 1MWNA 4ORCB 3BUOB 1RMOA 4ORAB 2PXWA 2L4HA 4USLA 1OOJA 1SBJA 1KQMB 1X02A 4PHNA 4TZGA 4UTSA 3U0NA 5AEQA 3FWBA 3KCTA 3JVTC 1Y1AA 2DUEA 1HUYA 1IWQA 1FI6A 1NX0A 3SG2A 2HQ8A 1YTZC 2WC8A 3U8CA 2LC5A 1A75B 4EDOA 3SVUA 4YGCB 1CMFA 4HSZA 3SVNA 4W6PA 4EN1A 1JFJA 1AVSA 1JC2A 1F71A 1RM9A 2WHTA 2JU0A 1OXDA 4QJ4B 3TUYB 1N2DA 3DQOA 1ZFSA 1Q4DA 5DKRA 4AQJA 2AWLA 2Z6YA 1QIVA 1DJYA 2HETA 4Z4MA 3CZTX 3BUXB 1W7IB 4NWSA 1QYOA 1XFVO 4P2YB 5GQQC 1ZGOA 1CLMA 1SCMB 2LP2A 2M97A 4C0LA 1Q4BA 3SG5A 3SIAA 1C07A 1KWOC 1M46A 2YE1A 3DPZA 4P76A 4UPGA 4LW5A 4JPZB 1ZACA 2O60A 4DIRA 2ISDA 3U0KA 1SNLA 4LJDC 4HVFA 4JRBA 2M0RA 2IB5A 2G2SB 2H5RA 4J89A 3ZULA 2L4IA 3NEDA 1KK8C 3BXCA 5HBDA 3I19A 2G6EA 2G9BA 1CFPA 1FPWA 3GL4A 1PULA 5F9GA 4ZCVA 1FBVA 5I2QA 1RK9A 1YVLA 1MHOA 4ZF4A 5FYXA 1MYWA 1JBYA 1A2XA 5AXIA 3ZTFA 2D8NA 4AR7A 2OTGB 1SL9A 5EHUA 2A4JA 4DS7A 4XJKA 4N1FA 3IP2A 5DPJA 1QX7A 4DXPA 1W7TA 4DCKA 2GGMA 2PRUA 2BL0C 2GX0A 1NP8A 1YX8A 4PE0A 1BG1A 4B30A 2LMVA 2B1UA 2MBXA 3VROA 1W7SA 1K9PA 3DQ5A 2ICRA 2JNFA 4L13A 5HLVA 1QY3A 2ZFDA 1OZOA 4OJ0A 4MBEA 1EMCA 1OXEA 4IL1A 3I5FC 1JUOA 2JXLA 2VAEA 3SJSA 5FVGA 1MQ1A 5DKNA 5LK4A 4JF9A 2PALA 4PHJA 5EXUA 2M29A 2EGDA 4W7DA 1CKKA 5HKYA 3SSKA 2RGIA 3EK8A 5HZSA 4P1QA 1D1OA 2LUXA 1MOUA 2H5QA 4W6DA 1YVHA 2JRFA 4OR9B 2EC6C 2NXQA 1CDNA 4W6HA 1K93D 2L0PA 2H9WA 1ZGPA 1G8IA 3VHTA 4ZIOA 3DF0B 2B3QA 1UUSA 3TDIA 5EB7A 1GGXA 1HT9A 3I5GB 4CIDA 4ZINA 3CLNA 1SRAA 5EBJA 5AANA 1XA5A 4YRUA 1NCZA 2BL0B 1QIWA 4BY5A 3DQHA 1WRKA 1IQ3A 4H3NA 3DQ7A 4N3DA 1Q4AA 1F8HA 2OS8B 2K0JA 1B7TY 4W75A 1MR8A 3HCMA 2JADA 1XVJA 1UP5A 3WCKA 4XGYA 2EMOA 1M31A 4GESB 2YFPA 1AHRA 3QRXA 2JNXA 3ZUFA 2WORA 4H47A 4JFGA 4W76A 1CM1A 1DJHA 3NT3A 2LLSA 3VRRA 3TUYC 2LCPA 3CTNA 2TN4A 3GB3A 4GFTA 3U8AA 2KYCA 5LTRA 2H8QA 4W6CA 1EXRA 1XFUO 1RMMA 5DTZA 2BBMA 4WQ3A 1PRWA 1XFZO 2WCBA 2O24A 2M8UA 1E8AA 1JC1A 2G16B 1XFWO 1B8CA 1S6JA 5LTPA 3ZNIA 3WLDA 1DGUA 5JOLA 4I5LB 1RRXA 4QJ3B 4DXNA 4JC2A 2CBLA 3PN7C 2R2IA 1TNQA 3SV5A 1YRTB 2LLTA 4NDDA 4PE7A 5AQBB 2Y1NA 1S6ZA 1CNPA 3CGLA 4KF5C 4TZAA 2LHIA 4YGDB 3AKBA 4Q7UA 4NQGA 3GJ2A 2Y0GA 1M39A 1EH2A 2A54B 3PJ7A 1QX2A 2KOTA 5PALA 2Z6ZA 2WCFA 2AWMA 2JT3A 2MAZA 4I2YA 1S6CA 2QLGB 5TNCA 3WLCA 4PHKA 3CFAA 2QLGA 3RLZA 1F4QA 1CLLA 2JOJA 3OSRA 3WHTB 1M63B 3JTDC 1DGVA 3PM8A 3I5HC 1KSOA 1R2UA 3BOWB 2QLIA 1B1GA 1QLSA 2FCDA 1BF5A 1Q80A 2BTJA 2O2BA 2KHNA 3M24A 1DJWA 1AP4A 1H4BA 1NYAA 2RH7A 2QZ0A 1G4YR 2HQZA 4RYWA 2KAYA 1AUIB 4W7AA 4DXQA 2MLFC 1K95A 5KSZA 4XOWA 4W69A 3CBEA 4J8AA 3LCPC 4I5JA 3SRYA 2JTTA 5EXCI 3UG0A 4KGEA 1QLKA 2LM5A 2KFHA 5HLOA 2JTZA 4OY4A 3ZUJA 2MRDA 4LJDA 2KBMA 2NZ0A 4W6LA 1NCXA 1J1EA 2MLEC 1IGVA 4YGAA 2HCGA 3GEXA 1DJZA 3V3DA 5HZTA 1LVCD 4GBAA 4W7CA 4N1GA 3SVBA 2BKHB 3VRQA 1CDLA 3AKOA 2PXSA 1Y1XA 2DUFA 1KK7Z 5CPVA 2KQ6A 1CLBA 1EG4A 3ED8A 3LF4B 3BXAA 1RMPA 3DVMA 2WIQA 3KF9A 3TS5C 3NF0A 2GGZA 2K7DA 4W7XA 1GGWA 1TTXA 3OSQA 1Q4CA 3LK0A 3NSIA 2AWJA 4JGEA 4ZFSA 1QV1A 2DUGA 4KGFA 1EMGA 3SSYA 3NSLA 1IH0A 5DTXA 1F4OA 4MEWA 1K96A 4E68A 1B47A 4W6AA 3AAKA 3WHUB 4ORNA 3SS0A 5D69A 1BOCA 2OGRA 2L98A 3SG3A 2AWKA 1B9AA 3I5IB 2PSRA 4FTGA 4KW4A 1QASA 3ADFA 1W7JB 4LJCA 1XQMA 1OQPA 4H3MA 1MF8B 1S5GY 4OVNF 2VRGA 4L9MA 1MOVA 1CFCA 1IJ5A 4ETOA 4AQIA 1SW8A 1RFJA 3VK1A 1YX7A 1BMOA 1DJXA 3DQJA 4W7RA 1B9CA 4D1EA 5DY6A 1UISA 2F33A 1SK6D 4I5NB 2ZNEA 4ZF5A 3E3RA 4PPKA 4N5XA 1VRKA 3EVUA 3ST2A 3D0YB 1DMOA 2YDZA 4PE4A 3AKAA 3LVCA 2WOSA 3I5IC 2QLHA 1IJ6A 1DVIA 1GGZA 3UFZA 1XFYO 5BTTA 2QPTA 4ZBLA 1BJFA 5IBWA 1YJFA 3OHMB 3O78A 3BUNB 4W6FA 1KP5A 2V53A 3DPXA 1J55A 1BT6A 1QXTA 3CD9A 3ICBA 2VADA 4AOMA 4IK5A 3KO0A 3DQIA 2KFFA 2LAPA 3DF0A 2GV5A 3CB9A 1BR1B 3PATA 3P28A 3OP0A 4MZJA 4FQOA 4GF6B 3C1VA 5H87A 1CV7A 2FOTA 1SR6B 3CR5X 1IQ5A 3SVSA 4C0JA 5CSIA 3K21A 2KGRA 1YZWA 2LMTA 4R6DA 4KW9A 4Q04A 2JULA 1ZOTB 4PALA 1OMVA 1NUBA 3VGOA 5AERA 1CFDA 3PIBA 2G2BA 5EB6A 2PASA 3BYAA 1GQMA 3DQCA 1S1EA 2BCAA 2NCOA 5CSJA 5BTTB 2A53B 2Y4QA 1TCOB 1Z1QA 2Q91A 3SVCA 5DRFA 1KYPA 1PSBA 4NDBA 4W6TA 1OMRA 1J7PA 1QYQA 3TDZA 2A50B 4GOBA 1FW4A 2HF5A 1TCFA 2IB6A 1J7QA 2K7CA 3RWAA 4DXIA 3VRPA 5JJGA 1PK0D 2Y1MA 4W6JA 1LXFC 3OB2B 4DKNA 2MHHA 1L2OC 2ZNDA 1KFUL 3NSOA 1BLQA 3KCSA 2LANA 1RROA 4W6OA 3P8UA 2GW4B 1CDMA 4DRWA 1CM4A 3CFHA 4W6UA 4XOVA 1YUUA 3LLEA 2LNKA 2H5PA 2JZIA 3TMTA 2KAVA 3A4UB 2VVIA 2JT0A 3EVRA 4KF4A 3AI5A 2OTBA 2M1KB 2LVVA 5ER4X 4YGEB 3I5GC 3DQ3A 3H4SE 1WLZA 3ST3A 2OTEA 4WQ2A 3SSTA 2L2EA 2ZO6A 2KYFA 4PHMA 2L50A 3SSHA 3SVEA 3DQNA 2SCPA 2KAXA 2EC6B 3E5TA 3PALA 2A48A 4GUKA 1NX3A 3ST4A 2FL1A 4Z4KA 1H8BA 2HQWA 3FIAA 2COLB 1OE9B 2JWWA 4YI9A 4W6BA 2LVKA 5EXBA 1C4FA 2WSNA 1H4UA 1YR5A 2IE2A 4KA9A 2P6BB 1KK7Y 5K89A 3I5FB 4Q7TA 3K1KA 3HX4A 1WY9A 5I2OA 2OJKA 2CTNA 2QACA 2E30A 1S6IA 3IQQA 1DF0A 1XAEA 2IS9A 4OQWA 4HQCA 1GFLA 1J7OA 2HRSA 5BT0A 4L1IA 1UHHA 5DQMA 2LHLA 1K90D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2GX2 A;  3BUW B;  1JF0 A;  3SIB A;  5T3I A;  1WDC C;  2AAO A;  3PSR A;  2JPT A;  2KI4 C;  1UHJ A;  3PN7 B;  2LVJ A;  1N65 A;  1LKJ A;  3M22 A;  1REC A;  1RWY A;  1TRF A;  1NCY A;  2ZKM X;  1UUR A;  3U0L A;  1GJY A;  3DPW A;  2WIS A;  4CFR A;  3LVD A;  3AI4 A;  2CCM A;  4IK4 A;  2QLE A;  1BR4 B;  1A4P A;  2NLN A;  2A52 B;  3GK1 A;  3PFV A;  2VZX A;  2HPW A;  1KWO B;  1TIZ A;  3DQ1 A;  4CFQ A;  3NT9 A;  1DF0 B;  3E5W A;  2Y5I A;  1S36 A;  1ZUX A;  2KGB C;  2A47 A;  2EHB A;  4MRY A;  1BFP A;  1YFP A;  4HRH A;  2BCX A;  2M49 B;  2ARL A;  2C9I A;  4CPV A;  5I2L A;  1KSM A;  3W1C A;  1HQV A;  4PDZ A;  2DUH A;  4LQU A;  3TMR A;  1NX2 A;  2F3Y A;  2DUI A;  2V4E B;  3WNX B;  1R6P A;  3KPX A;  5HKW A;  2GW3 A;  1XO5 A;  1NX1 A;  1UWO A;  1MXL C;  2JC2 A;  4GGF A;  3TDU A;  5HYD A;  1AJ5 A;  2OKW A;  4OV2 A;  4RTC A;  5CSN A;  4OGS A;  3FWC A;  2HJO A;  5LTQ A;  2P4M A;  3DQL A;  3DD4 A;  2H61 C;  3SVR A;  1KQM C;  4EDS A;  2L5X B;  1DT7 B;  2LMU A;  1SL8 A;  1UHK A;  1MUX A;  5DTL A;  3NEZ A;  4OKH A;  4MLW A;  3GK2 A;  2MA2 A;  4KF5 A;  3KHE A;  3PJ5 A;  1A75 A;  5D7F A;  2CXJ A;  4MSP A;  2HGD A;  3TZ1 A;  4W6R A;  1SL7 A;  1LA3 A;  1KQV A;  5H89 A;  3W1D A;  2WND A;  3E5V A;  3CR2 A;  3SVD A;  1A03 A;  1JC0 A;  3SG4 A;  3MSE B;  2QT2 A;  1QXP A;  3CFF A;  2WHS A;  2K7B A;  2G6Y A;  1QVI Y;  5HZO A;  4YGB B;  3O6B A;  4B5Y A;  3O4Y A;  5DKQ A;  1KFX S;  2Q6P A;  2ZRS A;  1S26 D;  3LS3 A;  2WUR A;  2EMN A;  2M9G A;  2K61 A;  3D10 A;  4B30 B;  3OGO A;  4H48 A;  3LA1 A;  1SCV A;  2QU1 A;  4PPL A;  1YUS A;  2LP3 A;  2M7N A;  1EJ3 A;  4HRG A;  2H6V A;  3WXA A;  2OTG C;  1JWD A;  2V4E C;  5J3X A;  2FJU B;  4QJ5 B;  3EKH A;  4PE1 A;  1JFK A;  1QVI Z;  1C7V A;  4GGF C;  1W7U A;  3SVO A;  4KPI A;  3OB1 B;  3BXB A;  3O2P A;  4W6S A;  2I18 A;  2F8P A;  4PPJ A;  3FS7 A;  4HQ8 A;  1WLM A;  3SSV A;  1YRU B;  1OSA A;  3H1O A;  4W6G A;  2JQ6 A;  1BOD A;  1KFX L;  4MRX A;  3ZWH A;  3DQE A;  1ZGQ A;  2LLU A;  3NXA A;  1YUR A;  1QYF A;  5HKZ A;  2K7O A;  2M3W A;  1K8U A;  2HGY A;  2O5G A;  1JF2 A;  3EKJ A;  2SAS A;  5FHV A;  1F0B A;  2ZMW A;  4H3L A;  2F2P A;  4XJK B;  4DXO A;  4OHS A;  3DQ4 A;  2LV7 A;  2BCB A;  1JBA A;  3RWT A;  3ST0 A;  1OMD A;  4Q7R A;  1DJG A;  5AFP A;  1EL4 A;  5HZU A;  5DTY A;  2G3O A;  2VVJ A;  3CS1 A;  1FI5 A;  5DPH A;  3GOF A;  4YBH B;  1PVB A;  1YHH A;  3CR4 X;  3BOW A;  1FF1 A;  2H61 A;  4MZL A;  1QV0 A;  1YHI A;  4BDU A;  2DD9 A;  2A46 A;  1KYR A;  3LK1 A;  4A4B A;  1SKT A;  4JQ0 D;  2BKI B;  3DVK A;  1ZMZ A;  1OXF A;  2KI6 C;  5DRG A;  1S3P A;  4GPL B;  2BE6 A;  1QTX A;  4R6B A;  2DOQ A;  4HE4 A;  2KFG A;  1LIN A;  2I2R E;  2HPS A;  3DQM A;  1S5G Z;  1EMK A;  1YHG A;  1IKU A;  4DKM A;  4ZCU A;  4Q9X A;  2BE4 A;  1L2O B;  1XK4 A;  2BBN A;  2I94 A;  4EMQ A;  4ORB B;  1Y6W A;  1XMZ A;  2FWQ A;  1V1F A;  1CB1 A;  4MN0 A;  1KK8 B;  3PJB A;  3DQK A;  1WRZ A;  1QAT A;  4Q9W A;  3BX9 A;  2OKY A;  4U8D A;  5KTY A;  2VVH A;  1PSR A;  1AK8 A;  4W74 A;  2F2O A;  2DDC A;  5F6T A;  2LUC A;  3S05 A;  4ICB A;  3DQU A;  1B8R A;  3CD1 A;  1SCM C;  1TN4 A;  1K9U A;  3LL8 B;  1J1D A;  4WRI A;  4KW8 A;  1QJT A;  3AAJ A;  4W77 A;  5DU0 A;  1F70 A;  4M2O A;  4W6I A;  2YE0 A;  2EMD A;  2Z1O A;  1SMG A;  1NIW A;  1XYD A;  1RJV A;  4GAO A;  2ZN8 A;  2WCE A;  1K94 A;  2IOV A;  4HQ9 A;  2KI4 B;  1WDC B;  1NWD A;  2POX A;  1L7Z A;  5BQL A;  1J7R A;  1UHN A;  4J88 A;  3DQA A;  3GK4 X;  1EME A;  1QS7 A;  3PLF B;  3EK7 A;  4MZK A;  4TNC A;  5DPG A;  4C0K A;  1IRJ A;  3BXK A;  4PFE A;  3JVT B;  2E6W A;  1XSS A;  2H5O A;  4KEX A;  2AHA A;  5FVF A;  5FVI A;  4IK8 A;  2PMY A;  5B8I B;  1C7W A;  3GJ1 A;  3U0M A;  1SYM A;  2L51 A;  2ZO7 A;  1F55 A;  3DQF A;  4GNK B;  1PVA A;  2G6X A;  4F0Z B;  2K8M B;  1N0Y A;  1LA0 A;  1EMA A;  2MJW B;  1CMG A;  3LF3 A;  1PAL A;  4IK9 A;  1GL4 A;  4DUQ A;  4ZB1 A;  1DJI A;  3EVP A;  2KI6 D;  4KAG A;  3IQO A;  4IZN A;  4DXM A;  2M1U A;  1V1G A;  4XL5 A;  2HFC A;  2Q4U A;  4W7F A;  3DQ9 A;  2K2F A;  3NSK A;  1QX5 B;  4GGN A;  4CLN A;  5EJU A;  4AS8 A;  3EK4 A;  3A8S A;  2KQY A;  4LQT A;  1BU3 A;  2M7L A;  4EUL A;  2DDD A;  2KBI A;  5HW9 A;  2NCP A;  2HQK A;  2ZRT A;  5DPI A;  2KDH A;  2V4E A;  3SG7 A;  5G08 A;  2JT8 A;  1KCY A;  2G3D B;  1B8L A;  4LJB A;  1Z1P A;  4HRE E;  2OPO A;  1NPQ A;  4P5O E;  1YJ2 A;  1XK4 C;  3MGF A;  5J2O A;  1CFF A;  1AJ4 A;  3EVV A;  4R1E A;  4BY4 A;  1RTP 1;  1H6R A;  2AMI A;  2LVI A;  1K9K A;  3CGA A;  2DD7 A;  3LVA A;  4JEO A;  1JSA A;  3OX6 A;  2K2A A;  1EML A;  1YUT A;  3DQ8 A;  4RYS A;  1EMF A;  4L12 A;  2AUC A;  4M2P A;  1SY9 A;  4M2Q A;  1TNX A;  1B4C A;  1M45 A;  1ODB A;  3OX5 A;  2F3Z A;  3BUM B;  1F54 A;  2WHU A;  4I5K A;  2A56 B;  2QRF A;  3U8P A;  4W73 A;  5KTG A;  3G9A A;  2O29 A;  1Y1U A;  1EG3 A;  5I8N A;  2G5Z B;  2C9J A;  1DTL A;  2JXC A;  3VRN A;  1U5I A;  2LE9 B;  4W72 A;  1TNW A;  1Q4E A;  2Q57 A;  3TS5 B;  3DVJ A;  3KEV A;  3H1R A;  4ANJ A;  4NDC A;  1Q73 A;  1SR6 C;  2Z6X A;  4ZF3 A;  3RM1 A;  3O77 A;  3D0Y A;  2KNE A;  1A29 A;  4IK3 A;  3BQ3 A;  1K2H A;  1NSH A;  1MXE A;  3IF7 A;  1SPY A;  5H88 A;  2BEC A;  1IG5 A;  3IR8 A;  1ZUZ A;  3A8R A;  1EMB A;  3F45 A;  3DQ2 A;  2KSP A;  3DQD A;  4XVP A;  5ER5 A;  5KU1 A;  3DQ6 A;  1HCJ A;  2FCE A;  1Y0V H;  2OS8 C;  3VIC A;  4IK1 A;  1G7K A;  4W6N A;  1XFX O;  1KFU S;  3DVE A;  3M0W A;  1ALW A;  4OCI A;  3JTD B;  2AH8 A;  4W6K A;  3LSA A;  2B3P A;  2PVB A;  4W6M A;  4W7E A;  1CDP A;  4MVF A;  1WRL A;  2ZMU A;  2I7A A;  5HGE A;  1TNP A;  4PCW A;  1EMM A;  5DQB A;  1XA9 A;  3SG6 A;  4YI8 A;  1ALV A;  3VHT B;  1OZS A;  2WSO A;  1F09 A;  2CT9 A;  2ZN9 A;  1U5I B;  1JBZ A;  2CNP A;  1CTR A;  3CWG A;  4XYN A;  2H2K A;  4JWQ A;  1UHI A;  3SSL A;  5BPJ A;  5CSF A;  1KYS A;  4A4C A;  3SSP A;  4U2V A;  1G33 A;  1B7T Z;  1TOP A;  3I5H B;  2FZU A;  1MWN A;  4ORC B;  3BUO B;  1RMO A;  4ORA B;  2PXW A;  2L4H A;  4USL A;  1OOJ A;  1SBJ A;  1KQM B;  1X02 A;  4PHN A;  4TZG A;  4UTS A;  3U0N A;  5AEQ A;  3FWB A;  3KCT A;  3JVT C;  1Y1A A;  2DUE A;  1HUY A;  1IWQ A;  1FI6 A;  1NX0 A;  3SG2 A;  2HQ8 A;  1YTZ C;  2WC8 A;  3U8C A;  2LC5 A;  1A75 B;  4EDO A;  3SVU A;  4YGC B;  1CMF A;  4HSZ A;  3SVN A;  4W6P A;  4EN1 A;  1JFJ A;  1AVS A;  1JC2 A;  1F71 A;  1RM9 A;  2WHT A;  2JU0 A;  1OXD A;  4QJ4 B;  3TUY B;  1N2D A;  3DQO A;  1ZFS A;  1Q4D A;  5DKR A;  4AQJ A;  2AWL A;  2Z6Y A;  1QIV A;  1DJY A;  2HET A;  4Z4M A;  3CZT X;  3BUX B;  1W7I B;  4NWS A;  1QYO A;  1XFV O;  4P2Y B;  5GQQ C;  1ZGO A;  1CLM A;  1SCM B;  2LP2 A;  2M97 A;  4C0L A;  1Q4B A;  3SG5 A;  3SIA A;  1C07 A;  1KWO C;  1M46 A;  2YE1 A;  3DPZ A;  4P76 A;  4UPG A;  4LW5 A;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  2ISD A;  3U0K A;  1SNL A;  4LJD C;  4HVF A;  4JRB A;  2M0R A;  2IB5 A;  2G2S B;  2H5R A;  4J89 A;  3ZUL A;  2L4I A;  3NED A;  1KK8 C;  3BXC A;  5HBD A;  3I19 A;  2G6E A;  2G9B A;  1CFP A;  1FPW A;  3GL4 A;  1PUL A;  5F9G A;  4ZCV A;  1FBV A;  5I2Q A;  1RK9 A;  1YVL A;  1MHO A;  4ZF4 A;  5FYX A;  1MYW A;  1JBY A;  1A2X A;  5AXI A;  3ZTF A;  2D8N A;  4AR7 A;  2OTG B;  1SL9 A;  5EHU A;  2A4J A;  4DS7 A;  4XJK A;  4N1F A;  3IP2 A;  5DPJ A;  1QX7 A;  4DXP A;  1W7T A;  4DCK A;  2GGM A;  2PRU A;  2BL0 C;  2GX0 A;  1NP8 A;  1YX8 A;  4PE0 A;  1BG1 A;  4B30 A;  2LMV A;  2B1U A;  2MBX A;  3VRO A;  1W7S A;  1K9P A;  3DQ5 A;  2ICR A;  2JNF A;  4L13 A;  5HLV A;  1QY3 A;  2ZFD A;  1OZO A;  4OJ0 A;  4MBE A;  1EMC A;  1OXE A;  4IL1 A;  3I5F C;  1JUO A;  2JXL A;  2VAE A;  3SJS A;  5FVG A;  1MQ1 A;  5DKN A;  5LK4 A;  4JF9 A;  2PAL A;  4PHJ A;  5EXU A;  2M29 A;  2EGD A;  4W7D A;  1CKK A;  5HKY A;  3SSK A;  2RGI A;  3EK8 A;  5HZS A;  4P1Q A;  1D1O A;  2LUX A;  1MOU A;  2H5Q A;  4W6D A;  1YVH A;  2JRF A;  4OR9 B;  2EC6 C;  2NXQ A;  1CDN A;  4W6H A;  1K93 D;  2L0P A;  2H9W A;  1ZGP A;  1G8I A;  3VHT A;  4ZIO A;  3DF0 B;  2B3Q A;  1UUS A;  3TDI A;  5EB7 A;  1GGX A;  1HT9 A;  3I5G B;  4CID A;  4ZIN A;  3CLN A;  1SRA A;  5EBJ A;  5AAN A;  1XA5 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  4BY5 A;  3DQH A;  1WRK A;  1IQ3 A;  4H3N A;  3DQ7 A;  4N3D A;  1Q4A A;  1F8H A;  2OS8 B;  2K0J A;  1B7T Y;  4W75 A;  1MR8 A;  3HCM A;  2JAD A;  1XVJ A;  1UP5 A;  3WCK A;  4XGY A;  2EMO A;  1M31 A;  4GES B;  2YFP A;  1AHR A;  3QRX A;  2JNX A;  3ZUF A;  2WOR A;  4H47 A;  4JFG A;  4W76 A;  1CM1 A;  1DJH A;  3NT3 A;  2LLS A;  3VRR A;  3TUY C;  2LCP A;  3CTN A;  2TN4 A;  3GB3 A;  4GFT A;  3U8A A;  2KYC A;  5LTR A;  2H8Q A;  4W6C A;  1EXR A;  1XFU O;  1RMM A;  5DTZ A;  2BBM A;  4WQ3 A;  1PRW A;  1XFZ O;  2WCB A;  2O24 A;  2M8U A;  1E8A A;  1JC1 A;  2G16 B;  1XFW O;  1B8C A;  1S6J A;  5LTP A;  3ZNI A;  3WLD A;  1DGU A;  5JOL A;  4I5L B;  1RRX A;  4QJ3 B;  4DXN A;  4JC2 A;  2CBL A;  3PN7 C;  2R2I A;  1TNQ A;  3SV5 A;  1YRT B;  2LLT A;  4NDD A;  4PE7 A;  5AQB B;  2Y1N A;  1S6Z A;  1CNP A;  3CGL A;  4KF5 C;  4TZA A;  2LHI A;  4YGD B;  3AKB A;  4Q7U A;  4NQG A;  3GJ2 A;  2Y0G A;  1M39 A;  1EH2 A;  2A54 B;  3PJ7 A;  1QX2 A;  2KOT A;  5PAL A;  2Z6Z A;  2WCF A;  2AWM A;  2JT3 A;  2MAZ A;  4I2Y A;  1S6C A;  2QLG B;  5TNC A;  3WLC A;  4PHK A;  3CFA A;  2QLG A;  3RLZ A;  1F4Q A;  1CLL A;  2JOJ A;  3OSR A;  3WHT B;  1M63 B;  3JTD C;  1DGV A;  3PM8 A;  3I5H C;  1KSO A;  1R2U A;  3BOW B;  2QLI A;  1B1G A;  1QLS A;  2FCD A;  1BF5 A;  1Q80 A;  2BTJ A;  2O2B A;  2KHN A;  3M24 A;  1DJW A;  1AP4 A;  1H4B A;  1NYA A;  2RH7 A;  2QZ0 A;  1G4Y R;  2HQZ A;  4RYW A;  2KAY A;  1AUI B;  4W7A A;  4DXQ A;  2MLF C;  1K95 A;  5KSZ A;  4XOW A;  4W69 A;  3CBE A;  4J8A A;  3LCP C;  4I5J A;  3SRY A;  2JTT A;  5EXC I;  3UG0 A;  4KGE A;  1QLK A;  2LM5 A;  2KFH A;  5HLO A;  2JTZ A;  4OY4 A;  3ZUJ A;  2MRD A;  4LJD A;  2KBM A;  2NZ0 A;  4W6L A;  1NCX A;  1J1E A;  2MLE C;  1IGV A;  4YGA A;  2HCG A;  3GEX A;  1DJZ A;  3V3D A;  5HZT A;  1LVC D;  4GBA A;  4W7C A;  4N1G A;  3SVB A;  2BKH B;  3VRQ A;  1CDL A;  3AKO A;  2PXS A;  1Y1X A;  2DUF A;  1KK7 Z;  5CPV A;  2KQ6 A;  1CLB A;  1EG4 A;  3ED8 A;  3LF4 B;  3BXA A;  1RMP A;  3DVM A;  2WIQ A;  3KF9 A;  3TS5 C;  3NF0 A;  2GGZ A;  2K7D A;  4W7X A;  1GGW A;  1TTX A;  3OSQ A;  1Q4C A;  3LK0 A;  3NSI A;  2AWJ A;  4JGE A;  4ZFS A;  1QV1 A;  2DUG A;  4KGF A;  1EMG A;  3SSY A;  3NSL A;  1IH0 A;  5DTX A;  1F4O A;  4MEW A;  1K96 A;  4E68 A;  1B47 A;  4W6A A;  3AAK A;  3WHU B;  4ORN A;  3SS0 A;  5D69 A;  1BOC A;  2OGR A;  2L98 A;  3SG3 A;  2AWK A;  1B9A A;  3I5I B;  2PSR A;  4FTG A;  4KW4 A;  1QAS A;  3ADF A;  1W7J B;  4LJC A;  1XQM A;  1OQP A;  4H3M A;  1MF8 B;  1S5G Y;  4OVN F;  2VRG A;  4L9M A;  1MOV A;  1CFC A;  1IJ5 A;  4ETO A;  4AQI A;  1SW8 A;  1RFJ A;  3VK1 A;  1YX7 A;  1BMO A;  1DJX A;  3DQJ A;  4W7R A;  1B9C A;  4D1E A;  5DY6 A;  1UIS A;  2F33 A;  1SK6 D;  4I5N B;  2ZNE A;  4ZF5 A;  3E3R A;  4PPK A;  4N5X A;  1VRK A;  3EVU A;  3ST2 A;  3D0Y B;  1DMO A;  2YDZ A;  4PE4 A;  3AKA A;  3LVC A;  2WOS A;  3I5I C;  2QLH A;  1IJ6 A;  1DVI A;  1GGZ A;  3UFZ A;  1XFY O;  5BTT A;  2QPT A;  4ZBL A;  1BJF A;  5IBW A;  1YJF A;  3OHM B;  3O78 A;  3BUN B;  4W6F A;  1KP5 A;  2V53 A;  3DPX A;  1J55 A;  1BT6 A;  1QXT A;  3CD9 A;  3ICB A;  2VAD A;  4AOM A;  4IK5 A;  3KO0 A;  3DQI A;  2KFF A;  2LAP A;  3DF0 A;  2GV5 A;  3CB9 A;  1BR1 B;  3PAT A;  3P28 A;  3OP0 A;  4MZJ A;  4FQO A;  4GF6 B;  3C1V A;  5H87 A;  1CV7 A;  2FOT A;  1SR6 B;  3CR5 X;  1IQ5 A;  3SVS A;  4C0J A;  5CSI A;  3K21 A;  2KGR A;  1YZW A;  2LMT A;  4R6D A;  4KW9 A;  4Q04 A;  2JUL A;  1ZOT B;  4PAL A;  1OMV A;  1NUB A;  3VGO A;  5AER A;  1CFD A;  3PIB A;  2G2B A;  5EB6 A;  2PAS A;  3BYA A;  1GQM A;  3DQC A;  1S1E A;  2BCA A;  2NCO A;  5CSJ A;  5BTT B;  2A53 B;  2Y4Q A;  1TCO B;  1Z1Q A;  2Q91 A;  3SVC A;  5DRF A;  1KYP A;  1PSB A;  4NDB A;  4W6T A;  1OMR A;  1J7P A;  1QYQ A;  3TDZ A;  2A50 B;  4GOB A;  1FW4 A;  2HF5 A;  1TCF A;  2IB6 A;  1J7Q A;  2K7C A;  3RWA A;  4DXI A;  3VRP A;  5JJG A;  1PK0 D;  2Y1M A;  4W6J A;  1LXF C;  3OB2 B;  4DKN A;  2MHH A;  1L2O C;  2ZND A;  1KFU L;  3NSO A;  1BLQ A;  3KCS A;  2LAN A;  1RRO A;  4W6O A;  3P8U A;  2GW4 B;  1CDM A;  4DRW A;  1CM4 A;  3CFH A;  4W6U A;  4XOV A;  1YUU A;  3LLE A;  2LNK A;  2H5P A;  2JZI A;  3TMT A;  2KAV A;  3A4U B;  2VVI A;  2JT0 A;  3EVR A;  4KF4 A;  3AI5 A;  2OTB A;  2M1K B;  2LVV A;  5ER4 X;  4YGE B;  3I5G C;  3DQ3 A;  3H4S E;  1WLZ A;  3ST3 A;  2OTE A;  4WQ2 A;  3SST A;  2L2E A;  2ZO6 A;  2KYF A;  4PHM A;  2L50 A;  3SSH A;  3SVE A;  3DQN A;  2SCP A;  2KAX A;  2EC6 B;  3E5T A;  3PAL A;  2A48 A;  4GUK A;  1NX3 A;  3ST4 A;  2FL1 A;  4Z4K A;  1H8B A;  2HQW A;  3FIA A;  2COL B;  1OE9 B;  2JWW A;  4YI9 A;  4W6B A;  2LVK A;  5EXB A;  1C4F A;  2WSN A;  1H4U A;  1YR5 A;  2IE2 A;  4KA9 A;  2P6B B;  1KK7 Y;  5K89 A;  3I5F B;  4Q7T A;  3K1K A;  3HX4 A;  1WY9 A;  5I2O A;  2OJK A;  2CTN A;  2QAC A;  2E30 A;  1S6I A;  3IQQ A;  1DF0 A;  1XAE A;  2IS9 A;  4OQW A;  4HQC A;  1GFL A;  1J7O A;  2HRS A;  5BT0 A;  4L1I A;  1UHH A;  5DQM A;  2LHL A;  1K90 D; 
#chains in the Genus database with same CATH topology
 2GX2 A;  3BUW B;  1JF0 A;  3SIB A;  5T3I A;  1WDC C;  2AAO A;  3PSR A;  2JPT A;  2KI4 C;  1UHJ A;  3PN7 B;  2LVJ A;  1N65 A;  3R1O A;  1LKJ A;  3M22 A;  1REC A;  1RWY A;  1TRF A;  1NCY A;  2ZKM X;  3IVT A;  2KPH A;  1UUR A;  3U0L A;  3FE6 A;  1GJY A;  3DPW A;  2WIS A;  4CFR A;  3NHI A;  3LVD A;  3AI4 A;  3BFA A;  2CCM A;  4IK4 A;  2QLE A;  1BR4 B;  1A4P A;  2NLN A;  2A52 B;  3GK1 A;  3PFV A;  2VZX A;  2HPW A;  1KWO B;  1TIZ A;  3DQ1 A;  4CFQ A;  3NT9 A;  1DF0 B;  3E5W A;  2Y5I A;  1S36 A;  1ZUX A;  2KGB C;  2A47 A;  2EHB A;  3SS4 A;  4MRY A;  1BFP A;  1YFP A;  4HRH A;  2BCX A;  2M49 B;  2ARL A;  2C9I A;  4CPV A;  2QDI A;  5I2L A;  1KSM A;  3W1C A;  1HQV A;  4PDZ A;  2DUH A;  4LQU A;  3TMR A;  1NX2 A;  2F3Y A;  2DUI A;  2V4E B;  3WNX B;  1R6P A;  3KPX A;  5HKW A;  2GW3 A;  3NHT A;  1XO5 A;  1NX1 A;  1UWO A;  1MXL C;  3PJI A;  2JC2 A;  4GGF A;  3TDU A;  5HYD A;  1AJ5 A;  2OKW A;  4OV2 A;  4RTC A;  5CSN A;  4OGS A;  3FWC A;  2HJO A;  5LTQ A;  1OW4 A;  2WC5 A;  2P4M A;  3DQL A;  3DD4 A;  1DQE A;  2H61 C;  3SVR A;  1KQM C;  4EDS A;  2L5X B;  1DT7 B;  2LMU A;  1DEK A;  1SL8 A;  1UHK A;  3L47 A;  1MUX A;  5DTL A;  3NEZ A;  4OKH A;  4MLW A;  3GK2 A;  2MA2 A;  3R72 A;  4KF5 A;  3KHE A;  3PJ5 A;  3B87 A;  1A75 A;  5D7F A;  2CXJ A;  4MSP A;  2HGD A;  3TZ1 A;  4W6R A;  1SL7 A;  1LA3 A;  1KQV A;  5H89 A;  3W1D A;  2WND A;  3E5V A;  3CR2 A;  3SVD A;  1A03 A;  1JC0 A;  3SG4 A;  3MSE B;  2QT2 A;  1QXP A;  3CFF A;  2WHS A;  2K7B A;  2G6Y A;  3BFB A;  1QVI Y;  5HZO A;  4YGB B;  3O6B A;  4B5Y A;  3O4Y A;  5DKQ A;  1KFX S;  2Q6P A;  2ZRS A;  1S26 D;  2K60 A;  3LS3 A;  2WUR A;  2EMN A;  2M9G A;  2K61 A;  3D10 A;  4B30 B;  3OGO A;  4H48 A;  3LA1 A;  1SCV A;  2QU1 A;  4PPL A;  1YUS A;  1DEL A;  3B7A A;  2LP3 A;  2M7N A;  1EJ3 A;  4HRG A;  2H6V A;  3WXA A;  2OTG C;  4IJ7 A;  1JWD A;  2V4E C;  5J3X A;  2FJU B;  4QJ5 B;  3EKH A;  4PE1 A;  1JFK A;  1QVI Z;  1C7V A;  1OOG A;  4GGF C;  1W7U A;  3SVO A;  4KPI A;  3OB1 B;  3BXB A;  3O2P A;  4W6S A;  2I18 A;  3SS3 A;  2F8P A;  4PPJ A;  3FS7 A;  4HQ8 A;  1WLM A;  3SSV A;  1YRU B;  1OSA A;  3S0G A;  3H1O A;  1Z2C B;  4W6G A;  2JQ6 A;  1BOD A;  1KFX L;  4MRX A;  3ZWH A;  3DQE A;  1ZGQ A;  2LLU A;  3NXA A;  1YUR A;  1QYF A;  5HKZ A;  2K7O A;  2M3W A;  2L2C A;  1K8U A;  2HGY A;  2O5G A;  1JF2 A;  5FI6 A;  1IIO A;  3EKJ A;  2SAS A;  5FHV A;  1F0B A;  3D77 A;  2ZMW A;  4H3L A;  2F2P A;  4XJK B;  4DXO A;  3VB1 A;  4OHS A;  3DQ4 A;  4JD9 A;  2LV7 A;  2BCB A;  1JBA A;  3RWT A;  3ST0 A;  1OMD A;  4Q7R A;  1DJG A;  5AFP A;  1EL4 A;  5HZU A;  5DTY A;  2G3O A;  2VVJ A;  2PYQ A;  3CS1 A;  1FI5 A;  5DPH A;  3B86 A;  3GOF A;  4YBH B;  1PVB A;  1YHH A;  3CR4 X;  1OOH A;  3BOW A;  1FF1 A;  2H61 A;  4MZL A;  1QV0 A;  1YHI A;  4BDU A;  2DD9 A;  2A46 A;  1KYR A;  3LK1 A;  4A4B A;  1SKT A;  4JQ0 D;  2BKI B;  3DVK A;  1ZMZ A;  1OXF A;  2KI6 C;  2BNX A;  5DRG A;  1S3P A;  4GPL B;  2BE6 A;  1QTX A;  4R6B A;  2DOQ A;  4HE4 A;  2KFG A;  1LIN A;  2I2R E;  2HPS A;  3DQM A;  1S5G Z;  1EMK A;  1YHG A;  1IKU A;  4DKM A;  4ZCU A;  4Q9X A;  2BE4 A;  1L2O B;  1XK4 A;  2BBN A;  2I94 A;  3D76 A;  4EMQ A;  4ORB B;  3CAB A;  3DYE A;  1Y6W A;  1XMZ A;  2FWQ A;  1V1F A;  1CB1 A;  4MN0 A;  1KK8 B;  4F7F A;  3PJB A;  3DQK A;  1WRZ A;  1QAT A;  3B88 A;  4Q9W A;  3BX9 A;  2OKY A;  4U8D A;  3D73 A;  5KTY A;  3S0A A;  2VVH A;  1PSR A;  1AK8 A;  4W74 A;  2F2O A;  2DDC A;  5F6T A;  2LUC A;  2ERB A;  3S05 A;  4ICB A;  3DQU A;  1B8R A;  3CD1 A;  1SCM C;  1TN4 A;  1K9U A;  3LL8 B;  1J1D A;  4WRI A;  4KW8 A;  1QJT A;  3AAJ A;  4W77 A;  5DU0 A;  1F70 A;  4M2O A;  4W6I A;  2YE0 A;  2EMD A;  2Z1O A;  1SMG A;  1NIW A;  1XYD A;  1RJV A;  4GAO A;  2ZN8 A;  2WCE A;  1K94 A;  2IOV A;  4HQ9 A;  2KI4 B;  3DY9 A;  1WDC B;  1NWD A;  2POX A;  1L7Z A;  5BQL A;  1J7R A;  1UHN A;  4J88 A;  3DQA A;  3GK4 X;  1EME A;  1QS7 A;  3PLF B;  3EK7 A;  4MZK A;  4TNC A;  5DPG A;  4C0K A;  1IRJ A;  3BXK A;  4PFE A;  3JVT B;  2E6W A;  1XSS A;  2H5O A;  1TUJ A;  4KEX A;  2AHA A;  5FVF A;  5FVI A;  4IK8 A;  2PMY A;  5B8I B;  1C7W A;  3GJ1 A;  3U0M A;  1SYM A;  2L51 A;  3CYZ A;  2ZO7 A;  1F55 A;  3DQF A;  4GNK B;  1PVA A;  2G6X A;  4F0Z B;  2K8M B;  1N0Y A;  1LA0 A;  1EMA A;  2MJW B;  1CMG A;  3LF3 A;  1PAL A;  4IK9 A;  1GL4 A;  4DUQ A;  4ZB1 A;  1DJI A;  3EVP A;  2KI6 D;  1C3Z A;  4KAG A;  3IQO A;  4IZN A;  4DXM A;  2M1U A;  1V1G A;  4XL5 A;  2HFC A;  2Q4U A;  4W7F A;  3DQ9 A;  2K2F A;  3NSK A;  1QX5 B;  4GGN A;  4CLN A;  5EJU A;  4AS8 A;  3EK4 A;  3A8S A;  3NGV A;  2KQY A;  4LQT A;  1BU3 A;  2M7L A;  4EUL A;  2DDD A;  2KBI A;  5HW9 A;  2NCP A;  3BJH A;  2HQK A;  2ZRT A;  5DPI A;  2KDH A;  2V4E A;  3SG7 A;  5G08 A;  2JT8 A;  2WC6 A;  1KCY A;  2G3D B;  1B8L A;  4LJB A;  1Z1P A;  4HRE E;  2OPO A;  1NPQ A;  4P5O E;  1YJ2 A;  1XK4 C;  3MGF A;  5J2O A;  2QEO A;  1CFF A;  1AJ4 A;  3EVV A;  4R1E A;  4BY4 A;  1RTP 1;  1H6R A;  5FI2 A;  2AMI A;  2LVI A;  1K9K A;  3CGA A;  2DD7 A;  3LVA A;  4JEO A;  1JSA A;  3OX6 A;  2K2A A;  1EML A;  1YUT A;  3DQ8 A;  4RYS A;  1EMF A;  3S0F A;  4L12 A;  2AUC A;  4M2P A;  3D74 A;  1SY9 A;  4M2Q A;  1TNX A;  1B4C A;  1M45 A;  1ODB A;  3OX5 A;  2F3Z A;  3BUM B;  5I94 A;  1F54 A;  2WHU A;  4I5K A;  2A56 B;  2QRF A;  1T14 A;  3U8P A;  4W73 A;  3N7H A;  5KTG A;  3G9A A;  2O29 A;  1Y1U A;  1EG3 A;  5I8N A;  2WCJ A;  2G5Z B;  2C9J A;  1DTL A;  2JXC A;  3VRN A;  1U5I A;  2LE9 B;  4W72 A;  1TNW A;  1Q4E A;  2Q57 A;  3TS5 B;  3DVJ A;  3KEV A;  3H1R A;  4ANJ A;  4NDC A;  1Q73 A;  1SR6 C;  2Z6X A;  4ZF3 A;  3RM1 A;  3QME A;  3O77 A;  3D0Y A;  2KNE A;  1A29 A;  4IK3 A;  3BQ3 A;  2JPO A;  5DIC A;  1K2H A;  1NSH A;  1MXE A;  3IF7 A;  1SPY A;  5H88 A;  2BEC A;  1IG5 A;  3IR8 A;  1ZUZ A;  3A8R A;  1EMB A;  3F45 A;  4OZD A;  3DQ2 A;  2KSP A;  3DQD A;  4XVP A;  5ER5 A;  5KU1 A;  3DQ6 A;  1HCJ A;  2FCE A;  1Y0V H;  2OS8 C;  3VIC A;  4IK1 A;  1G7K A;  4W6N A;  1XFX O;  1KFU S;  3DVE A;  3M0W A;  1ALW A;  4OCI A;  3JTD B;  2AH8 A;  4W6K A;  3LSA A;  2B3P A;  2PVB A;  4W6M A;  4W7E A;  1CDP A;  4MVF A;  1WRL A;  2ZMU A;  2I7A A;  5HGE A;  1TNP A;  2WCL A;  4PCW A;  1EMM A;  5DQB A;  1XA9 A;  3UNW A;  3SG6 A;  4YI8 A;  1ALV A;  3VHT B;  1OZS A;  2WSO A;  1F09 A;  2CT9 A;  2ZN9 A;  1U5I B;  1JBZ A;  2CNP A;  1CTR A;  3CWG A;  4XYN A;  2H2K A;  4JWQ A;  1UHI A;  3SSL A;  5BPJ A;  5CSF A;  1KYS A;  1TWO A;  4A4C A;  3SSP A;  4U2V A;  1G33 A;  1B7T Z;  1TOP A;  3I5H B;  2FZU A;  3S0E A;  1MWN A;  3R1P A;  4ORC B;  3BUO B;  1RMO A;  4ORA B;  2PXW A;  2L4H A;  3OGN A;  4USL A;  1OOJ A;  1SBJ A;  1KQM B;  1X02 A;  1C3Y A;  3K1E A;  4PHN A;  4TZG A;  3OBV A;  4UTS A;  3U0N A;  1P28 A;  5AEQ A;  3FWB A;  3KCT A;  3JVT C;  3B6X A;  1Y1A A;  2DUE A;  1HUY A;  1IWQ A;  1FI6 A;  1NX0 A;  3SG2 A;  2HQ8 A;  1YTZ C;  2WC8 A;  3U8C A;  2LC5 A;  1A75 B;  2H8V A;  4EDO A;  3SVU A;  4YGC B;  1CMF A;  4HSZ A;  3SVN A;  4W6P A;  4EN1 A;  1JFJ A;  1AVS A;  1JC2 A;  1F71 A;  1RM9 A;  2WHT A;  2JU0 A;  1OXD A;  4QJ4 B;  3TUY B;  1N2D A;  3DQO A;  1ZFS A;  1Q4D A;  5DKR A;  4AQJ A;  2AWL A;  3PM2 A;  2Z6Y A;  1QIV A;  1DJY A;  2HET A;  4Z4M A;  3CZT X;  3BUX B;  1W7I B;  4NWS A;  1QYO A;  1XFV O;  4P2Y B;  5GQQ C;  1ZGO A;  1CLM A;  1SCM B;  2LP2 A;  2M97 A;  4C0L A;  1Q4B A;  3S0B A;  3SG5 A;  3SIA A;  1C07 A;  1KWO C;  1M46 A;  2WCM A;  2YE1 A;  3DPZ A;  4P76 A;  4UPG A;  4LW5 A;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  2ISD A;  3U0K A;  1SNL A;  4LJD C;  4HVF A;  4JRB A;  2M0R A;  2IB5 A;  2G2S B;  2H5R A;  4J89 A;  3ZUL A;  2L4I A;  3NED A;  1KK8 C;  2WCK A;  3BXC A;  3CZ1 A;  5HBD A;  3I19 A;  2G6E A;  2G9B A;  1CFP A;  1FPW A;  3GL4 A;  1PUL A;  5F9G A;  4ZCV A;  1FBV A;  5I2Q A;  1RK9 A;  1YVL A;  1MHO A;  4ZF4 A;  5FYX A;  3UO9 A;  1MYW A;  1JBY A;  1A2X A;  5AXI A;  3ZTF A;  2D8N A;  4AR7 A;  2OTG B;  1SL9 A;  5EHU A;  2A4J A;  4DS7 A;  4XJK A;  4N1F A;  3IP2 A;  5DPJ A;  1QX7 A;  4DXP A;  1W7T A;  4DCK A;  2GGM A;  2PRU A;  2BL0 C;  2GX0 A;  1NP8 A;  1YX8 A;  4PE0 A;  1BG1 A;  4B30 A;  2LMV A;  2B1U A;  2MBX A;  3VRO A;  1W7S A;  1K9P A;  3DQ5 A;  2ICR A;  2JNF A;  4L13 A;  5HLV A;  1QY3 A;  2ZFD A;  1OZO A;  4OJ0 A;  4MBE A;  1EMC A;  1OXE A;  4IL1 A;  3I5F C;  1JUO A;  2JXL A;  2VAE A;  3SJS A;  5FVG A;  3CZ0 A;  1MQ1 A;  5DKN A;  5LK4 A;  4JF9 A;  2PAL A;  4PHJ A;  5EXU A;  2M29 A;  2EGD A;  4W7D A;  1CKK A;  5HKY A;  3SSK A;  2RGI A;  3EK8 A;  5HZS A;  4P1Q A;  1D1O A;  2LUX A;  1MOU A;  3FE8 A;  2H5Q A;  4W6D A;  1Z4H A;  3S0D A;  1YVH A;  5FI7 A;  2JRF A;  4OR9 B;  2EC6 C;  2NXQ A;  1CDN A;  4W6H A;  1K93 D;  2L0P A;  2H9W A;  1ZGP A;  3V2L A;  1G8I A;  3VHT A;  4ZIO A;  3DF0 B;  2B3Q A;  1UUS A;  3TDI A;  5EB7 A;  1GGX A;  1HT9 A;  3I5G B;  4INX A;  4CID A;  4ZIN A;  3CLN A;  1SRA A;  5EBJ A;  5AAN A;  1OOF A;  1XA5 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  4BY5 A;  3DQH A;  1WRK A;  1IQ3 A;  4H3N A;  3DQ7 A;  4N3D A;  1Q4A A;  1F8H A;  2OS8 B;  2K0J A;  1B7T Y;  4W75 A;  1MR8 A;  3HCM A;  2JAD A;  3RZS A;  2QEH A;  1XVJ A;  1UP5 A;  3WCK A;  4XGY A;  2EMO A;  1M31 A;  4GES B;  2YFP A;  2KLD A;  1AHR A;  3QRX A;  2JNX A;  3ZUF A;  2WOR A;  4H47 A;  4JFG A;  1CM1 A;  4W76 A;  1DJH A;  3NT3 A;  2LLS A;  3VRR A;  2WCH A;  3TUY C;  2LCP A;  3CTN A;  2TN4 A;  3GB3 A;  4GFT A;  3U8A A;  2KYC A;  5LTR A;  2H8Q A;  4W6C A;  1EXR A;  1XFU O;  1RMM A;  5DTZ A;  2BBM A;  4WQ3 A;  1PRW A;  1XFZ O;  2WCB A;  2O24 A;  2M8U A;  1E8A A;  1JC1 A;  2G16 B;  1XFW O;  1B8C A;  1S6J A;  3FE9 A;  5LTP A;  3ZNI A;  3WLD A;  1DGU A;  1QWV A;  5JOL A;  4I5L B;  1RRX A;  4QJ3 B;  4DXN A;  1LS8 A;  4JC2 A;  2CBL A;  3PN7 C;  2R2I A;  1TNQ A;  3SV5 A;  1YRT B;  2LLT A;  3CDN A;  4NDD A;  4PE7 A;  4KYN A;  5AQB B;  2Y1N A;  1S6Z A;  1CNP A;  3CGL A;  4KF5 C;  4TZA A;  2LHI A;  4YGD B;  3AKB A;  4Q7U A;  3GJ2 A;  4NQG A;  2Y0G A;  1M39 A;  1EH2 A;  2A54 B;  3PJ7 A;  1QX2 A;  2KOT A;  5PAL A;  2Z6Z A;  2WCF A;  2AWM A;  2JT3 A;  2MAZ A;  4I2Y A;  1S6C A;  2QLG B;  5TNC A;  3WLC A;  4PHK A;  3CFA A;  2QLG A;  3L4A A;  3RLZ A;  1F4Q A;  1CLL A;  4JKT A;  2JOJ A;  3OSR A;  3WHT B;  1M63 B;  3JTD C;  1DGV A;  3PM8 A;  3I5H C;  1KSO A;  1R2U A;  3BOW B;  2QLI A;  1B1G A;  1QLS A;  2FCD A;  1BF5 A;  1Q80 A;  2BTJ A;  2O2B A;  2KHN A;  3M24 A;  1DJW A;  1AP4 A;  1H4B A;  1NYA A;  2RH7 A;  3D78 A;  2QZ0 A;  1G4Y R;  2HQZ A;  4RYW A;  2KAY A;  1AUI B;  4W7A A;  4DXQ A;  2MLF C;  1K95 A;  5KSZ A;  4XOW A;  4W69 A;  3CBE A;  4J8A A;  3LCP C;  4I5J A;  3SRY A;  2JTT A;  5EXC I;  3UG0 A;  4KGE A;  1QLK A;  2LM5 A;  2KFH A;  5HLO A;  2JTZ A;  4OY4 A;  3ZUJ A;  2MRD A;  4LJD A;  2KBM A;  2NZ0 A;  4W6L A;  1NCX A;  1J1E A;  2MLE C;  1IGV A;  4YGA A;  2HCG A;  3GEX A;  1DJZ A;  4INW A;  3V3D A;  5HZT A;  1LVC D;  4GBA A;  4W7C A;  4N1G A;  3SVB A;  2BKH B;  3VRQ A;  1CDL A;  3AKO A;  1W9Z A;  2PXS A;  1Y1X A;  2DUF A;  1KK7 Z;  5CPV A;  2KQ6 A;  1CLB A;  1EG4 A;  3ED8 A;  2KLE A;  3LF4 B;  4FQT A;  3BXA A;  1RMP A;  3DVM A;  2WIQ A;  3KF9 A;  3TS5 C;  3NF0 A;  2GGZ A;  2K7D A;  4W7X A;  1GGW A;  1TTX A;  3OSQ A;  1Q4C A;  3LK0 A;  3NSI A;  2AWJ A;  4JGE A;  4ZFS A;  1QV1 A;  2DUG A;  4KGF A;  1EMG A;  3SSY A;  3NSL A;  1IH0 A;  5DTX A;  1F4O A;  4MEW A;  1K96 A;  5EL2 A;  4E68 A;  1B47 A;  4W6A A;  3AAK A;  3WHU B;  4ORN A;  5D69 A;  1BOC A;  3SS0 A;  2OGR A;  2L98 A;  3SG3 A;  2AWK A;  3SS5 A;  1B9A A;  3I5I B;  2PSR A;  4FTG A;  2GTE A;  4KW4 A;  1QAS A;  3ADF A;  1W7J B;  4LJC A;  1XQM A;  1OQP A;  4H3M A;  1MF8 B;  1S5G Y;  4OVN F;  2VRG A;  4L9M A;  1MOV A;  1CFC A;  1IJ5 A;  4ETO A;  4AQI A;  1SW8 A;  3R1V A;  1RFJ A;  3VK1 A;  1YX7 A;  1BMO A;  3DZT A;  1DJX A;  3DQJ A;  4W7R A;  1B9C A;  4D1E A;  5DY6 A;  1UIS A;  2F33 A;  1SK6 D;  4I5N B;  2ZNE A;  4ZF5 A;  3L4L A;  3E3R A;  4PPK A;  4N5X A;  1VRK A;  3EVU A;  3ST2 A;  3D0Y B;  1DMO A;  2YDZ A;  4PE4 A;  1GM0 A;  3AKA A;  3LVC A;  2WOS A;  3I5I C;  2QLH A;  1IJ6 A;  1DVI A;  1GGZ A;  3UFZ A;  1XFY O;  5BTT A;  2QPT A;  4ZBL A;  1BJF A;  5IBW A;  1DC1 A;  1YJF A;  3OHM B;  3O78 A;  3BUN B;  3Q8I A;  4W6F A;  1KP5 A;  2V53 A;  3DPX A;  1J55 A;  1BT6 A;  1QXT A;  3CD9 A;  3ICB A;  2VAD A;  4AOM A;  4IK5 A;  3KO0 A;  3DQI A;  2KFF A;  2LAP A;  2BAP A;  3DF0 A;  2GV5 A;  3CB9 A;  1BR1 B;  3PAT A;  3P28 A;  3OP0 A;  4MZJ A;  4FQO A;  4GF6 B;  3C1V A;  5H87 A;  1CV7 A;  5D3O A;  2FOT A;  1SR6 B;  3CR5 X;  1IQ5 A;  3SVS A;  4C0J A;  5HL1 A;  5CSI A;  3K21 A;  3DXL A;  2KGR A;  1YZW A;  2LMT A;  4R6D A;  4KW9 A;  2P71 A;  4Q04 A;  3D75 A;  2JUL A;  1ZOT B;  4PAL A;  1OMV A;  1NUB A;  3VGO A;  5AER A;  1CFD A;  3PIB A;  2G2B A;  2PAS A;  3BYA A;  5EB6 A;  1GQM A;  3DQC A;  2YGU A;  1S1E A;  2BCA A;  2NCO A;  5CSJ A;  5BTT B;  2A53 B;  2Y4Q A;  1TCO B;  1Z1Q A;  2Q91 A;  3SVC A;  5DRF A;  3EG5 B;  1KYP A;  1PSB A;  4NDB A;  4W6T A;  1OMR A;  1J7P A;  1QYQ A;  3TDZ A;  2A50 B;  4GOB A;  1FW4 A;  2HF5 A;  1TCF A;  2IB6 A;  1J7Q A;  2K7C A;  3RWA A;  4DXI A;  3VRP A;  5JJG A;  1PK0 D;  2Y1M A;  4W6J A;  1LXF C;  3OB2 B;  4DKN A;  2MHH A;  1L2O C;  2ZND A;  1KFU L;  3NSO A;  1BLQ A;  3KCS A;  2LAN A;  1RRO A;  4W6O A;  2QEV A;  3P8U A;  2GW4 B;  1OOI X;  1CDM A;  4DRW A;  1CM4 A;  3CFH A;  4W6U A;  2L5Y A;  4XOV A;  1YUU A;  3LLE A;  2LNK A;  2H5P A;  2JZI A;  2FJY A;  2KAV A;  3A4U B;  3TMT A;  2VVI A;  2JT0 A;  3EVR A;  4KF4 A;  3AI5 A;  2OTB A;  2M1K B;  2LVV A;  5ER4 X;  4YGE B;  3I5G C;  3DQ3 A;  1SSE B;  3H4S E;  1WLZ A;  3ST3 A;  2QEB A;  2OTE A;  4WQ2 A;  3SST A;  2L2E A;  2ZO6 A;  2KYF A;  4PHM A;  2L50 A;  1TUZ A;  3SSH A;  3SVE A;  3DQN A;  2SCP A;  2KAX A;  2EC6 B;  3E5T A;  3PAL A;  2A48 A;  4GUK A;  1NX3 A;  3ST4 A;  2FL1 A;  4Z4K A;  1H8B A;  2HQW A;  3FIA A;  2COL B;  1OE9 B;  2JWW A;  4YI9 A;  4W6B A;  2LVK A;  5EXB A;  1C4F A;  2WSN A;  1H4U A;  4PT1 A;  1YR5 A;  2IE2 A;  4KA9 A;  2P6B B;  2PQL A;  3BFH A;  1KK7 Y;  5K89 A;  3I5F B;  4Q7T A;  3CZ2 A;  3HX4 A;  3K1K A;  1WY9 A;  5I2O A;  3O4X A;  2P70 A;  2OJK A;  2CTN A;  1XFR A;  2QAC A;  2E30 A;  1S6I A;  3IQQ A;  1DF0 A;  1XAE A;  2IS9 A;  4OQW A;  4HQC A;  1GFL A;  1J7O A;  2HRS A;  5BT0 A;  4L1I A;  1UHH A;  1ORG A;  5DQM A;  2LHL A;  1K90 D; 
#chains in the Genus database with same CATH homology
 2GX2 A;  3BUW B;  1JF0 A;  3SIB A;  5T3I A;  1WDC C;  2AAO A;  3PSR A;  2JPT A;  2KI4 C;  1UHJ A;  3PN7 B;  2LVJ A;  1N65 A;  1LKJ A;  3M22 A;  1REC A;  1RWY A;  1TRF A;  1NCY A;  2ZKM X;  1UUR A;  3U0L A;  1GJY A;  3DPW A;  2WIS A;  4CFR A;  3LVD A;  3AI4 A;  2CCM A;  4IK4 A;  2QLE A;  1BR4 B;  1A4P A;  2NLN A;  2A52 B;  3GK1 A;  3PFV A;  2VZX A;  2HPW A;  1KWO B;  1TIZ A;  3DQ1 A;  4CFQ A;  3NT9 A;  1DF0 B;  3E5W A;  2Y5I A;  1S36 A;  1ZUX A;  2KGB C;  2A47 A;  2EHB A;  4MRY A;  1BFP A;  1YFP A;  4HRH A;  2BCX A;  2M49 B;  2ARL A;  2C9I A;  4CPV A;  5I2L A;  1KSM A;  3W1C A;  1HQV A;  4PDZ A;  2DUH A;  4LQU A;  3TMR A;  1NX2 A;  2F3Y A;  2DUI A;  2V4E B;  3WNX B;  1R6P A;  3KPX A;  5HKW A;  2GW3 A;  1XO5 A;  1NX1 A;  1UWO A;  1MXL C;  2JC2 A;  4GGF A;  3TDU A;  5HYD A;  1AJ5 A;  2OKW A;  4OV2 A;  4RTC A;  5CSN A;  4OGS A;  3FWC A;  2HJO A;  5LTQ A;  2P4M A;  3DQL A;  3DD4 A;  2H61 C;  3SVR A;  1KQM C;  4EDS A;  2L5X B;  1DT7 B;  2LMU A;  1SL8 A;  1UHK A;  1MUX A;  5DTL A;  3NEZ A;  4OKH A;  4MLW A;  3GK2 A;  2MA2 A;  4KF5 A;  3KHE A;  3PJ5 A;  1A75 A;  5D7F A;  2CXJ A;  4MSP A;  2HGD A;  3TZ1 A;  4W6R A;  1SL7 A;  1LA3 A;  1KQV A;  5H89 A;  3W1D A;  2WND A;  3E5V A;  3CR2 A;  3SVD A;  1A03 A;  1JC0 A;  3SG4 A;  3MSE B;  2QT2 A;  1QXP A;  3CFF A;  2WHS A;  2K7B A;  2G6Y A;  1QVI Y;  5HZO A;  4YGB B;  3O6B A;  4B5Y A;  3O4Y A;  5DKQ A;  1KFX S;  2Q6P A;  2ZRS A;  1S26 D;  3LS3 A;  2WUR A;  2EMN A;  2M9G A;  2K61 A;  3D10 A;  4B30 B;  3OGO A;  4H48 A;  3LA1 A;  1SCV A;  2QU1 A;  4PPL A;  1YUS A;  2LP3 A;  2M7N A;  1EJ3 A;  4HRG A;  2H6V A;  3WXA A;  2OTG C;  1JWD A;  2V4E C;  5J3X A;  2FJU B;  4QJ5 B;  3EKH A;  4PE1 A;  1JFK A;  1QVI Z;  1C7V A;  4GGF C;  1W7U A;  3SVO A;  4KPI A;  3OB1 B;  3BXB A;  3O2P A;  4W6S A;  2I18 A;  2F8P A;  4PPJ A;  3FS7 A;  4HQ8 A;  1WLM A;  3SSV A;  1YRU B;  1OSA A;  3H1O A;  4W6G A;  2JQ6 A;  1BOD A;  1KFX L;  4MRX A;  3ZWH A;  3DQE A;  1ZGQ A;  2LLU A;  3NXA A;  1YUR A;  1QYF A;  5HKZ A;  2K7O A;  2M3W A;  1K8U A;  2HGY A;  2O5G A;  1JF2 A;  3EKJ A;  2SAS A;  5FHV A;  1F0B A;  2ZMW A;  4H3L A;  2F2P A;  4XJK B;  4DXO A;  4OHS A;  3DQ4 A;  2LV7 A;  2BCB A;  1JBA A;  3RWT A;  3ST0 A;  1OMD A;  4Q7R A;  1DJG A;  5AFP A;  1EL4 A;  5HZU A;  5DTY A;  2G3O A;  2VVJ A;  3CS1 A;  1FI5 A;  5DPH A;  3GOF A;  4YBH B;  1PVB A;  1YHH A;  3CR4 X;  3BOW A;  1FF1 A;  2H61 A;  4MZL A;  1QV0 A;  1YHI A;  4BDU A;  2DD9 A;  2A46 A;  1KYR A;  3LK1 A;  4A4B A;  1SKT A;  4JQ0 D;  2BKI B;  3DVK A;  1ZMZ A;  1OXF A;  2KI6 C;  5DRG A;  1S3P A;  4GPL B;  2BE6 A;  1QTX A;  4R6B A;  2DOQ A;  4HE4 A;  2KFG A;  1LIN A;  2I2R E;  2HPS A;  3DQM A;  1S5G Z;  1EMK A;  1YHG A;  1IKU A;  4DKM A;  4ZCU A;  4Q9X A;  2BE4 A;  1L2O B;  1XK4 A;  2BBN A;  2I94 A;  4EMQ A;  4ORB B;  1Y6W A;  1XMZ A;  2FWQ A;  1V1F A;  1CB1 A;  4MN0 A;  1KK8 B;  3PJB A;  3DQK A;  1WRZ A;  1QAT A;  4Q9W A;  3BX9 A;  2OKY A;  4U8D A;  5KTY A;  2VVH A;  1PSR A;  1AK8 A;  4W74 A;  2F2O A;  2DDC A;  5F6T A;  2LUC A;  3S05 A;  4ICB A;  3DQU A;  1B8R A;  3CD1 A;  1SCM C;  1TN4 A;  1K9U A;  3LL8 B;  1J1D A;  4WRI A;  4KW8 A;  1QJT A;  3AAJ A;  4W77 A;  5DU0 A;  1F70 A;  4M2O A;  4W6I A;  2YE0 A;  2EMD A;  2Z1O A;  1SMG A;  1NIW A;  1XYD A;  1RJV A;  4GAO A;  2ZN8 A;  2WCE A;  1K94 A;  2IOV A;  4HQ9 A;  2KI4 B;  1WDC B;  1NWD A;  2POX A;  1L7Z A;  5BQL A;  1J7R A;  1UHN A;  4J88 A;  3DQA A;  3GK4 X;  1EME A;  1QS7 A;  3PLF B;  3EK7 A;  4MZK A;  4TNC A;  5DPG A;  4C0K A;  1IRJ A;  3BXK A;  4PFE A;  3JVT B;  2E6W A;  1XSS A;  2H5O A;  4KEX A;  2AHA A;  5FVF A;  5FVI A;  4IK8 A;  2PMY A;  5B8I B;  1C7W A;  3GJ1 A;  3U0M A;  1SYM A;  2L51 A;  2ZO7 A;  1F55 A;  3DQF A;  4GNK B;  1PVA A;  2G6X A;  4F0Z B;  2K8M B;  1N0Y A;  1LA0 A;  1EMA A;  2MJW B;  1CMG A;  3LF3 A;  1PAL A;  4IK9 A;  1GL4 A;  4DUQ A;  4ZB1 A;  1DJI A;  3EVP A;  2KI6 D;  4KAG A;  3IQO A;  4IZN A;  4DXM A;  2M1U A;  1V1G A;  4XL5 A;  2HFC A;  2Q4U A;  4W7F A;  3DQ9 A;  2K2F A;  3NSK A;  1QX5 B;  4GGN A;  4CLN A;  5EJU A;  4AS8 A;  3EK4 A;  3A8S A;  2KQY A;  4LQT A;  1BU3 A;  2M7L A;  4EUL A;  2DDD A;  2KBI A;  5HW9 A;  2NCP A;  2HQK A;  2ZRT A;  5DPI A;  2KDH A;  2V4E A;  3SG7 A;  5G08 A;  2JT8 A;  1KCY A;  2G3D B;  1B8L A;  4LJB A;  1Z1P A;  4HRE E;  2OPO A;  1NPQ A;  4P5O E;  1YJ2 A;  1XK4 C;  3MGF A;  5J2O A;  1CFF A;  1AJ4 A;  3EVV A;  4R1E A;  4BY4 A;  1RTP 1;  1H6R A;  2AMI A;  2LVI A;  1K9K A;  3CGA A;  2DD7 A;  3LVA A;  4JEO A;  1JSA A;  3OX6 A;  2K2A A;  1EML A;  1YUT A;  3DQ8 A;  4RYS A;  1EMF A;  4L12 A;  2AUC A;  4M2P A;  1SY9 A;  4M2Q A;  1TNX A;  1B4C A;  1M45 A;  1ODB A;  3OX5 A;  2F3Z A;  3BUM B;  1F54 A;  2WHU A;  4I5K A;  2A56 B;  2QRF A;  3U8P A;  4W73 A;  5KTG A;  3G9A A;  2O29 A;  1Y1U A;  1EG3 A;  5I8N A;  2G5Z B;  2C9J A;  1DTL A;  2JXC A;  3VRN A;  1U5I A;  2LE9 B;  4W72 A;  1TNW A;  1Q4E A;  2Q57 A;  3TS5 B;  3DVJ A;  3KEV A;  3H1R A;  4ANJ A;  4NDC A;  1Q73 A;  1SR6 C;  2Z6X A;  4ZF3 A;  3RM1 A;  3O77 A;  3D0Y A;  2KNE A;  1A29 A;  4IK3 A;  3BQ3 A;  1K2H A;  1NSH A;  1MXE A;  3IF7 A;  1SPY A;  5H88 A;  2BEC A;  1IG5 A;  3IR8 A;  1ZUZ A;  3A8R A;  1EMB A;  3F45 A;  3DQ2 A;  2KSP A;  3DQD A;  4XVP A;  5ER5 A;  5KU1 A;  3DQ6 A;  1HCJ A;  2FCE A;  1Y0V H;  2OS8 C;  3VIC A;  4IK1 A;  1G7K A;  4W6N A;  1XFX O;  1KFU S;  3DVE A;  3M0W A;  1ALW A;  4OCI A;  3JTD B;  2AH8 A;  4W6K A;  3LSA A;  2B3P A;  2PVB A;  4W6M A;  4W7E A;  1CDP A;  4MVF A;  1WRL A;  2ZMU A;  2I7A A;  5HGE A;  1TNP A;  4PCW A;  1EMM A;  5DQB A;  1XA9 A;  3SG6 A;  4YI8 A;  1ALV A;  3VHT B;  1OZS A;  2WSO A;  1F09 A;  2CT9 A;  2ZN9 A;  1U5I B;  1JBZ A;  2CNP A;  1CTR A;  3CWG A;  4XYN A;  2H2K A;  4JWQ A;  1UHI A;  3SSL A;  5BPJ A;  5CSF A;  1KYS A;  4A4C A;  3SSP A;  4U2V A;  1G33 A;  1B7T Z;  1TOP A;  3I5H B;  2FZU A;  1MWN A;  4ORC B;  3BUO B;  1RMO A;  4ORA B;  2PXW A;  2L4H A;  4USL A;  1OOJ A;  1SBJ A;  1KQM B;  1X02 A;  4PHN A;  4TZG A;  4UTS A;  3U0N A;  5AEQ A;  3FWB A;  3KCT A;  3JVT C;  1Y1A A;  2DUE A;  1HUY A;  1IWQ A;  1FI6 A;  1NX0 A;  3SG2 A;  2HQ8 A;  1YTZ C;  2WC8 A;  3U8C A;  2LC5 A;  1A75 B;  4EDO A;  3SVU A;  4YGC B;  1CMF A;  4HSZ A;  3SVN A;  4W6P A;  4EN1 A;  1JFJ A;  1AVS A;  1JC2 A;  1F71 A;  1RM9 A;  2WHT A;  2JU0 A;  1OXD A;  4QJ4 B;  3TUY B;  1N2D A;  3DQO A;  1ZFS A;  1Q4D A;  5DKR A;  4AQJ A;  2AWL A;  2Z6Y A;  1QIV A;  1DJY A;  2HET A;  4Z4M A;  3CZT X;  3BUX B;  1W7I B;  4NWS A;  1QYO A;  1XFV O;  4P2Y B;  5GQQ C;  1ZGO A;  1CLM A;  1SCM B;  2LP2 A;  2M97 A;  4C0L A;  1Q4B A;  3SG5 A;  3SIA A;  1C07 A;  1KWO C;  1M46 A;  2YE1 A;  3DPZ A;  4P76 A;  4UPG A;  4LW5 A;  4JPZ B;  1ZAC A;  2O60 A;  4DIR A;  2ISD A;  3U0K A;  1SNL A;  4LJD C;  4HVF A;  4JRB A;  2M0R A;  2IB5 A;  2G2S B;  2H5R A;  4J89 A;  3ZUL A;  2L4I A;  3NED A;  1KK8 C;  3BXC A;  5HBD A;  3I19 A;  2G6E A;  2G9B A;  1CFP A;  1FPW A;  3GL4 A;  1PUL A;  5F9G A;  4ZCV A;  1FBV A;  5I2Q A;  1RK9 A;  1YVL A;  1MHO A;  4ZF4 A;  5FYX A;  1MYW A;  1JBY A;  1A2X A;  5AXI A;  3ZTF A;  2D8N A;  4AR7 A;  2OTG B;  1SL9 A;  5EHU A;  2A4J A;  4DS7 A;  4XJK A;  4N1F A;  3IP2 A;  5DPJ A;  1QX7 A;  4DXP A;  1W7T A;  4DCK A;  2GGM A;  2PRU A;  2BL0 C;  2GX0 A;  1NP8 A;  1YX8 A;  4PE0 A;  1BG1 A;  4B30 A;  2LMV A;  2B1U A;  2MBX A;  3VRO A;  1W7S A;  1K9P A;  3DQ5 A;  2ICR A;  2JNF A;  4L13 A;  5HLV A;  1QY3 A;  2ZFD A;  1OZO A;  4OJ0 A;  4MBE A;  1EMC A;  1OXE A;  4IL1 A;  3I5F C;  1JUO A;  2JXL A;  2VAE A;  3SJS A;  5FVG A;  1MQ1 A;  5DKN A;  5LK4 A;  4JF9 A;  2PAL A;  4PHJ A;  5EXU A;  2M29 A;  2EGD A;  4W7D A;  1CKK A;  5HKY A;  3SSK A;  2RGI A;  3EK8 A;  5HZS A;  4P1Q A;  1D1O A;  2LUX A;  1MOU A;  2H5Q A;  4W6D A;  1YVH A;  2JRF A;  4OR9 B;  2EC6 C;  2NXQ A;  1CDN A;  4W6H A;  1K93 D;  2L0P A;  2H9W A;  1ZGP A;  1G8I A;  3VHT A;  4ZIO A;  3DF0 B;  2B3Q A;  1UUS A;  3TDI A;  5EB7 A;  1GGX A;  1HT9 A;  3I5G B;  4CID A;  4ZIN A;  3CLN A;  1SRA A;  5EBJ A;  5AAN A;  1XA5 A;  4YRU A;  1NCZ A;  2BL0 B;  1QIW A;  4BY5 A;  3DQH A;  1WRK A;  1IQ3 A;  4H3N A;  3DQ7 A;  4N3D A;  1Q4A A;  1F8H A;  2OS8 B;  2K0J A;  1B7T Y;  4W75 A;  1MR8 A;  3HCM A;  2JAD A;  1XVJ A;  1UP5 A;  3WCK A;  4XGY A;  2EMO A;  1M31 A;  4GES B;  2YFP A;  1AHR A;  3QRX A;  2JNX A;  3ZUF A;  2WOR A;  4H47 A;  4JFG A;  4W76 A;  1CM1 A;  1DJH A;  3NT3 A;  2LLS A;  3VRR A;  3TUY C;  2LCP A;  3CTN A;  2TN4 A;  3GB3 A;  4GFT A;  3U8A A;  2KYC A;  5LTR A;  2H8Q A;  4W6C A;  1EXR A;  1XFU O;  1RMM A;  5DTZ A;  2BBM A;  4WQ3 A;  1PRW A;  1XFZ O;  2WCB A;  2O24 A;  2M8U A;  1E8A A;  1JC1 A;  2G16 B;  1XFW O;  1B8C A;  1S6J A;  5LTP A;  3ZNI A;  3WLD A;  1DGU A;  5JOL A;  4I5L B;  1RRX A;  4QJ3 B;  4DXN A;  4JC2 A;  2CBL A;  3PN7 C;  2R2I A;  1TNQ A;  3SV5 A;  1YRT B;  2LLT A;  4NDD A;  4PE7 A;  5AQB B;  2Y1N A;  1S6Z A;  1CNP A;  3CGL A;  4KF5 C;  4TZA A;  2LHI A;  4YGD B;  3AKB A;  4Q7U A;  4NQG A;  3GJ2 A;  2Y0G A;  1M39 A;  1EH2 A;  2A54 B;  3PJ7 A;  1QX2 A;  2KOT A;  5PAL A;  2Z6Z A;  2WCF A;  2AWM A;  2JT3 A;  2MAZ A;  4I2Y A;  1S6C A;  2QLG B;  5TNC A;  3WLC A;  4PHK A;  3CFA A;  2QLG A;  3RLZ A;  1F4Q A;  1CLL A;  2JOJ A;  3OSR A;  3WHT B;  1M63 B;  3JTD C;  1DGV A;  3PM8 A;  3I5H C;  1KSO A;  1R2U A;  3BOW B;  2QLI A;  1B1G A;  1QLS A;  2FCD A;  1BF5 A;  1Q80 A;  2BTJ A;  2O2B A;  2KHN A;  3M24 A;  1DJW A;  1AP4 A;  1H4B A;  1NYA A;  2RH7 A;  2QZ0 A;  1G4Y R;  2HQZ A;  4RYW A;  2KAY A;  1AUI B;  4W7A A;  4DXQ A;  2MLF C;  1K95 A;  5KSZ A;  4XOW A;  4W69 A;  3CBE A;  4J8A A;  3LCP C;  4I5J A;  3SRY A;  2JTT A;  5EXC I;  3UG0 A;  4KGE A;  1QLK A;  2LM5 A;  2KFH A;  5HLO A;  2JTZ A;  4OY4 A;  3ZUJ A;  2MRD A;  4LJD A;  2KBM A;  2NZ0 A;  4W6L A;  1NCX A;  1J1E A;  2MLE C;  1IGV A;  4YGA A;  2HCG A;  3GEX A;  1DJZ A;  3V3D A;  5HZT A;  1LVC D;  4GBA A;  4W7C A;  4N1G A;  3SVB A;  2BKH B;  3VRQ A;  1CDL A;  3AKO A;  2PXS A;  1Y1X A;  2DUF A;  1KK7 Z;  5CPV A;  2KQ6 A;  1CLB A;  1EG4 A;  3ED8 A;  3LF4 B;  3BXA A;  1RMP A;  3DVM A;  2WIQ A;  3KF9 A;  3TS5 C;  3NF0 A;  2GGZ A;  2K7D A;  4W7X A;  1GGW A;  1TTX A;  3OSQ A;  1Q4C A;  3LK0 A;  3NSI A;  2AWJ A;  4JGE A;  4ZFS A;  1QV1 A;  2DUG A;  4KGF A;  1EMG A;  3SSY A;  3NSL A;  1IH0 A;  5DTX A;  1F4O A;  4MEW A;  1K96 A;  4E68 A;  1B47 A;  4W6A A;  3AAK A;  3WHU B;  4ORN A;  3SS0 A;  5D69 A;  1BOC A;  2OGR A;  2L98 A;  3SG3 A;  2AWK A;  1B9A A;  3I5I B;  2PSR A;  4FTG A;  4KW4 A;  1QAS A;  3ADF A;  1W7J B;  4LJC A;  1XQM A;  1OQP A;  4H3M A;  1MF8 B;  1S5G Y;  4OVN F;  2VRG A;  4L9M A;  1MOV A;  1CFC A;  1IJ5 A;  4ETO A;  4AQI A;  1SW8 A;  1RFJ A;  3VK1 A;  1YX7 A;  1BMO A;  1DJX A;  3DQJ A;  4W7R A;  1B9C A;  4D1E A;  5DY6 A;  1UIS A;  2F33 A;  1SK6 D;  4I5N B;  2ZNE A;  4ZF5 A;  3E3R A;  4PPK A;  4N5X A;  1VRK A;  3EVU A;  3ST2 A;  3D0Y B;  1DMO A;  2YDZ A;  4PE4 A;  3AKA A;  3LVC A;  2WOS A;  3I5I C;  2QLH A;  1IJ6 A;  1DVI A;  1GGZ A;  3UFZ A;  1XFY O;  5BTT A;  2QPT A;  4ZBL A;  1BJF A;  5IBW A;  1YJF A;  3OHM B;  3O78 A;  3BUN B;  4W6F A;  1KP5 A;  2V53 A;  3DPX A;  1J55 A;  1BT6 A;  1QXT A;  3CD9 A;  3ICB A;  2VAD A;  4AOM A;  4IK5 A;  3KO0 A;  3DQI A;  2KFF A;  2LAP A;  3DF0 A;  2GV5 A;  3CB9 A;  1BR1 B;  3PAT A;  3P28 A;  3OP0 A;  4MZJ A;  4FQO A;  4GF6 B;  3C1V A;  5H87 A;  1CV7 A;  2FOT A;  1SR6 B;  3CR5 X;  1IQ5 A;  3SVS A;  4C0J A;  5CSI A;  3K21 A;  2KGR A;  1YZW A;  2LMT A;  4R6D A;  4KW9 A;  4Q04 A;  2JUL A;  1ZOT B;  4PAL A;  1OMV A;  1NUB A;  3VGO A;  5AER A;  1CFD A;  3PIB A;  2G2B A;  5EB6 A;  2PAS A;  3BYA A;  1GQM A;  3DQC A;  1S1E A;  2BCA A;  2NCO A;  5CSJ A;  5BTT B;  2A53 B;  2Y4Q A;  1TCO B;  1Z1Q A;  2Q91 A;  3SVC A;  5DRF A;  1KYP A;  1PSB A;  4NDB A;  4W6T A;  1OMR A;  1J7P A;  1QYQ A;  3TDZ A;  2A50 B;  4GOB A;  1FW4 A;  2HF5 A;  1TCF A;  2IB6 A;  1J7Q A;  2K7C A;  3RWA A;  4DXI A;  3VRP A;  5JJG A;  1PK0 D;  2Y1M A;  4W6J A;  1LXF C;  3OB2 B;  4DKN A;  2MHH A;  1L2O C;  2ZND A;  1KFU L;  3NSO A;  1BLQ A;  3KCS A;  2LAN A;  1RRO A;  4W6O A;  3P8U A;  2GW4 B;  1CDM A;  4DRW A;  1CM4 A;  3CFH A;  4W6U A;  4XOV A;  1YUU A;  3LLE A;  2LNK A;  2H5P A;  2JZI A;  3TMT A;  2KAV A;  3A4U B;  2VVI A;  2JT0 A;  3EVR A;  4KF4 A;  3AI5 A;  2OTB A;  2M1K B;  2LVV A;  5ER4 X;  4YGE B;  3I5G C;  3DQ3 A;  3H4S E;  1WLZ A;  3ST3 A;  2OTE A;  4WQ2 A;  3SST A;  2L2E A;  2ZO6 A;  2KYF A;  4PHM A;  2L50 A;  3SSH A;  3SVE A;  3DQN A;  2SCP A;  2KAX A;  2EC6 B;  3E5T A;  3PAL A;  2A48 A;  4GUK A;  1NX3 A;  3ST4 A;  2FL1 A;  4Z4K A;  1H8B A;  2HQW A;  3FIA A;  2COL B;  1OE9 B;  2JWW A;  4YI9 A;  4W6B A;  2LVK A;  5EXB A;  1C4F A;  2WSN A;  1H4U A;  1YR5 A;  2IE2 A;  4KA9 A;  2P6B B;  1KK7 Y;  5K89 A;  3I5F B;  4Q7T A;  3K1K A;  3HX4 A;  1WY9 A;  5I2O A;  2OJK A;  2CTN A;  2QAC A;  2E30 A;  1S6I A;  3IQQ A;  1DF0 A;  1XAE A;  2IS9 A;  4OQW A;  4HQC A;  1GFL A;  1J7O A;  2HRS A;  5BT0 A;  4L1I A;  1UHH A;  5DQM A;  2LHL A;  1K90 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...