3EVVA

Crystal structure of calcium bound dimeric gcamp2 (#2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
411
structure length
385
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 100
structure length 385
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evvA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evvA01
3ST4A 3VHTB 1SR6C 3SG6A 2M49B 1Y1UA 1H4BA 5F9GA 2F3ZA 2AAOA 3UFZA 3HX4A 2BKIB 1QYOA 3VRRA 2LVVA 2H8QA 1MYWA 2LMVA 1A2XA 4H3LA 4TZAA 3O4YA 3EK8A 1TIZA 3SG2A 1YHIA 2G3DB 2V4EA 4YBHB 2M0RA 3KPXA 5HZOA 1TOPA 1AUIB 2ZRTA 4EN1A 1KWOB 4ZCVA 1M31A 2D8NA 1BFPA 1K94A 1L7ZA 2PSRA 4FTGA 1K9KA 1V1GA 1N65A 4C0KA 3S05A 1W7UA 3WHTB 1B8LA 5AERA 2LNKA 1H4UA 4MVFA 3I5IB 2WSNA 5EB7A 3MSEB 4CLNA 2GV5A 1CMGA 1LVCD 1YUSA 5HGEA 4ETOA 3PATA 2V53A 1NIWA 1PRWA 2A50B 1XK4A 3AI5A 2OKWA 1OXEA 1B9AA 1MOUA 5CSFA 3CFAA 2H5QA 2V4EB 5CSIA 3PFVA 4W74A 2OJKA 3PJ7A 2EGDA 4N3DA 3GK4X 2KFHA 1A4PA 1YRTB 2LLSA 2NZ0A 3ADFA 2O60A 1GFLA 3WLCA 1A75A 4CFRA 1H6RA 2HRSA 3H4SE 3BQ3A 2KOTA 4KGFA 2JT8A 2K61A 1OMDA 3DQ1A 1WDCB 1SCVA 2Q4UA 1SW8A 4WQ3A 3EKHA 1Q4EA 3CR4X 2OGRA 3GB3A 1ZOTB 1UHJA 1NX1A 2Z6ZA 1DJWA 2KFGA 1FI6A 4MZKA 4HRGA 2FWQA 5F6TA 3DPXA 1KFUS 3I5FC 4PE7A 5D69A 2MRDA 5DTYA 1IH0A 4LQUA 2WC8A 4OQWA 2Y0GA 2AUCA 4W6KA 2LM5A 4YGCB 1BU3A 4YI9A 1QX7A 1CFDA 1FBVA 2R2IA 3U0NA 3SSTA 1AJ5A 4YGEB 2LUXA 3E5VA 2JXCA 1OOJA 3ZULA 2EC6C 2LMUA 3CR5X 2L4HA 4YGBB 4M2OA 4GESB 2DD7A 3DQ5A 2JRFA 2Y5IA 4L12A 4J88A 4W75A 4DXMA 1RM9A 2ICRA 2LV7A 1RRXA 1SY9A 3EVUA 4D1EA 2JXLA 1QTXA 1CDNA 3I5HB 2RH7A 3SRYA 1WRKA 2KBMA 3ZTFA 1PSBA 1BOCA 2JNFA 1PULA 2FOTA 1XFVO 5BPJA 1SBJA 2AWLA 4W6GA 2I7AA 3AKBA 3U0LA 4GNKB 2BE4A 1K9UA 1AK8A 1R6PA 4W6MA 3GK1A 2L50A 3H1RA 3TUYB 3LVDA 2AWMA 3GJ1A 1NYAA 3ED8A 2DDDA 3SSHA 1SNLA 2BE6A 3NEDA 4EULA 1JFJA 2ZMWA 4NDCA 4PHMA 1G33A 2LP2A 1DJIA 3SVUA 1Y6WA 2O24A 1KWOC 3I5GB 4IK8A 1RTP1 2G6EA 5AANA 1F71A 1OXDA 5BT0A 2MJWB 4EDSA 4ZB1A 1NUBA 1OXFA 1IKUA 3I5IC 5DPJA 1LA3A 2GW4B 2WIQA 3BXCA 4HRHA 3CTNA 2O29A 1MUXA 4W7EA 1GJYA 1LA0A 1A03A 4PE4A 1J7RA 1EMAA 2K7OA 4DIRA 2AWJA 4PHJA 4PE0A 3E3RA 1K95A 3K21A 5AEQA 4UPGA 4H48A 2WORA 4F0ZB 2H5PA 1UHHA 1A29A 2KI6D 1Y1XA 2P4MA 2ZO6A 2JU0A 4AQIA 1RMOA 2LAPA 1NX0A 4W73A 4DCKA 1XK4C 1Y1AA 3LVAA 1DMOA 1WDCC 1L2OB 1J55A 1DF0A 2K7CA 1F09A 2QLGB 4I5NB 4PPKA 2HPWA 2VVJA 1B1GA 4W6TA 1DJXA 3BOWB 1BODA 2VVHA 4L13A 4E68A 2MBXA 2H5RA 4P5OE 5EXUA 3KCTA 1RJVA 1S6JA 2M7NA 1B9CA 3A4UB 1BLQA 2WHSA 5FVIA 4MRYA 3LCPC 4TZGA 4OJ0A 2MHHA 2ARLA 4KAGA 2F2OA 4LJCA 3SG5A 4QJ4B 1DF0B 1SCMB 5PALA 1KYRA 4ZF4A 4ORNA 1CLLA 2CTNA 4UTSA 3FS7A 1QY3A 1UWOA 2HQWA 2HCGA 3WNXB 1RMMA 2RGIA 4IK9A 1Q4AA 2IB6A 5DKRA 4JF9A 1NCZA 2G2SB 5HLVA 5FYXA 3I5HC 2ZFDA 4OV2A 4W6SA 5I2OA 1GL4A 3DPWA 2QLIA 1D1OA 1ZGOA 5DTXA 2H9WA 1NWDA 1PVBA 2MLEC 3NSOA 4HVFA 5DQBA 2ISDA 4AOMA 1Q4DA 1W7IB 1SL8A 4CPVA 3DQNA 1S6CA 3PIBA 3TUYC 2L4IA 1B8CA 1JBAA 2A56B 1DJZA 3QRXA 1MHOA 3LK1A 5HZSA 2Y1MA 1CDMA 3LL8B 4H3NA 3DQOA 1KK7Y 1UHNA 5LK4A 2JNXA 1QV1A 1BJFA 1S36A 1JSAA 3I5GC 5LTPA 2KQYA 1OE9B 3CD9A 1KK7Z 1S6IA 2WHTA 2KQ6A 1ZUXA 1EMKA 3VRPA 1TRFA 3A8SA 2KNEA 5K89A 3VHTA 1XFXO 2CNPA 2VZXA 3DQMA 1CNPA 1CLMA 5B8IB 4P1QA 4TNCA 5FVGA 4ZFSA 1KFUL 4JQ0D 2Z6XA 2Y4QA 3PN7C 1ZFSA 2L5XB 4W6OA 4I5KA 3VRNA 3EVVA 2EMNA 3BYAA 5BQLA 1XFYO 2EHBA 2DUFA 1YVLA 1UURA 1Q73A 5HKYA 2WNDA 1IQ3A 2PRUA 1SKTA 3DVMA 3M0WA 2MA2A 1KFXL 2JULA 5H89A 5DKQA 3OP0A 5H87A 3SSKA 1W7JB 3LF3A 1Z1QA 2LVJA 1L2OC 3SSPA 4J89A 4OVNF 2KYCA 2YDZA 1QYFA 1RECA 5DRGA 1XAEA 4CFQA 1R2UA 4QJ3B 2GX0A 5LTRA 1BMOA 2F33A 3E5TA 4ICBA 2K2AA 5D7FA 3HCMA 1SK6D 1G4YR 3DQ6A 3PLFB 1F4QA 3DQAA 2QPTA 4FQOA 1IQ5A 5FVFA 3M24A 1SCMC 3AKAA 2CXJA 4BDUA 4XJKB 1S6ZA 3SSYA 4PCWA 3TS5C 1SL7A 2H5OA 3U8CA 1DVIA 1NX2A 4KF5A 1SPYA 2A46A 2WCBA 2WSOA 5EB6A 2G6XA 3KCSA 1XA5A 1B4CA 1MXLC 1G7KA 3SV5A 3VICA 3DQCA 3TZ1A 3DQUA 1YHGA 1MOVA 1ZMZA 5J2OA 3ST2A 2HGDA 4USLA 4L1IA 2PMYA 4A4BA 2LLTA 3BXAA 3KO0A 3ST0A 2JT3A 4GGFC 2BCAA 1WLMA 4HQ8A 2PASA 2WURA 3NEZA 3ZUFA 1QYQA 2JTZA 4OCIA 1XO5A 5KU1A 4W7AA 2A48A 2LUCA 1B47A 2M1KB 1F70A 4ZF3A 3SVBA 3GOFA 2FJUB 2A52B 4XVPA 4W6BA 3LA1A 4KW8A 4Q9WA 1OMVA 1QVIY 1B7TY 5I2QA 1BF5A 4JPZB 1B8RA 2JQ6A 2IB5A 4Q7TA 3FIAA 4DKNA 1JFKA 1QVIZ 3SVEA 2H6VA 3NSIA 1S3PA 2I2RE 1TNPA 3LK0A 4B30B 3CLNA 2LCPA 3CBEA 4W6DA 2ZNDA 3LS3A 4W77A 1TNXA 1QIVA 4MRXA 1IJ5A 3JVTB 4H47A 1C7VA 3EKJA 2WISA 1QXTA 1WLZA 3AI4A 1UHIA 1S5GY 2JTTA 3DF0B 3PSRA 3LSAA 3BXBA 2C9IA 4M2PA 5DTLA 1CLBA 4KF4A 5HW9A 2PVBA 2QRFA 1S5GZ 4ZINA 4W6IA 3BUWB 2CCMA 1U5IA 5CSNA 2KI4B 2FCEA 1EG3A 4H3MA 4LJDA 1K9PA 5AQBB 4YI8A 1Y0VH 2DUGA 2LE9B 3SVCA 2VADA 3OB1B 4LJBA 4KGEA 4W7DA 3LLEA 1JUOA 1QS7A 1ZUZA 4I5LB 2IS9A 4XGYA 3U0KA 1N0YA 3NT3A 1BR4B 4KW9A 1M39A 3SVRA 4M2QA 4IK4A 5I8NA 4BY4A 3WXAA 4AR7A 3DVEA 1PSRA 3CZTX 4EDOA 2DUHA 2LVKA 2G5ZB 2SCPA 3VGOA 3OB2B 1U5IB 3WHUB 2QU1A 2DOQA 2KI6C 3JTDB 3AKOA 1QLSA 2PALA 1CV7A 5DPIA 1K96A 2EMDA 1UHKA 4I5JA 1LINA 1EMMA 3D0YB 3G9AA 2KYFA 3KF9A 1RROA 3DQEA 3PN7B 2QLGA 2YE1A 2VRGA 3BOWA 1ALVA 4XOVA 5HZUA 5ER4X 2G6YA 1IG5A 4W7CA 2NLNA 2M1UA 2PXSA 2F2PA 4LW5A 2H61C 1CTRA 4WRIA 4NQGA 1EG4A 2GW3A 2AWKA 2KGBC 4W6UA 2H2KA 3CGAA 5BTTA 2Q91A 2HF5A 1SRAA 4MN0A 1N2DA 4OGSA 4MEWA 3DQ4A 2BCBA 5AXIA 4PE1A 3NF0A 4C0LA 2KSPA 2BBNA 2K7BA 3LVCA 4P76A 1KQMB 4W6PA 4KF5C 1QJTA 1RFJA 1F0BA 1J7OA 2ZRSA 2JC2A 2NCOA 4HREE 3UG0A 1TNWA 5BTTB 2JPTA 1G8IA 2L98A 4U2VA 1CDPA 2QZ0A 1CDLA 1FF1A 1UUSA 2M7LA 1JC0A 2OKYA 2M8UA 4NDDA 1EJ3A 1XFWO 4GGFA 1V1FA 1EMGA 1ODBA 2L0PA 2Z1OA 2DD9A 4DXQA 3TS5B 3JVTC 2G2BA 2OS8B 2JWWA 4ORCB 2M29A 1YVHA 2LC5A 4KPIA 4JGEA 3DQKA 3CS1A 3LF4B 3NXAA 3DVKA 1PVAA 1Q4CA 4U8DA 3PALA 1EMBA 4N1GA 2O5GA 4R6BA 1UISA 4W6AA 3ICBA 2KI4C 4DXPA 3H1OA 4W6HA 4MZJA 4OY4A 4L9MA 4W72A 4DXOA 2OTBA 4I2YA 2WCEA 3OSRA 4NWSA 1DJGA 2BL0C 4KEXA 4PALA 3SVSA 3U8AA 2B1UA 1MR8A 4GPLB 3KEVA 2WCFA 3BUXB 1QV0A 1HCJA 5DPGA 1WRLA 4J8AA 1SL9A 1QXPA 1OSAA 1S26D 1J7PA 4LJDC 3JTDC 2ZN9A 3NT9A 2LLUA 1DTLA 1J7QA 3K1KA 2AH8A 2HQKA 4IK3A 2QLHA 3EVRA 1KCYA 3DQHA 3OGOA 2ZNEA 1KK8B 4B5YA 2KAVA 4ORBB 3VRQA 1DJYA 2AMIA 2GGMA 1EMCA 4C0JA 1NP8A 3TDUA 4PHKA 2AHAA 4DKMA 3ZUJA 1YURA 3A8RA 3SVDA 1JWDA 4W7RA 1J1EA 2BKHB 1RMPA 4ZCUA 2M3WA 1IWQA 5HYDA 3GJ2A 5ER5A 3SG4A 3SG3A 1CB1A 1BR1B 3FWBA 4MSPA 2ZKMX 2I18A 4A4CA 4PFEA 1BT6A 4R1EA 1EH2A 1NX3A 4XJKA 5EJUA 3CR2A 2TN4A 1KQMC 2B3PA 2WOSA 2I94A 1Z1PA 4JFGA 5G08A 4R6DA 4GUKA 4ZIOA 2P6BB 3O78A 1VRKA 5JOLA 1QASA 4HQCA 1DT7B 1TCOB 3SS0A 2H61A 3VK1A 4AS8A 2GX2A 2DUIA 3W1DA 5EXCI 1JF0A 1F54A 5AFPA 1GGXA 1K90D 1LXFC 1CMFA 4CIDA 4Q7RA 3TDZA 1YTZC 4MBEA 2CT9A 2WHUA 3EK7A 2LVIA 2OS8C 1QATA 3PJ5A 1IJ6A 1DJHA 1KSOA 2KFFA 2A53B 3RM1A 3CFFA 2HJOA 3CWGA 3W1CA 1FW4A 1TNQA 3PJBA 4N1FA 4Z4KA 4KA9A 1HUYA 4GGNA 4OKHA 3PM8A 4GBAA 4W7XA 1QX2A 1ALWA 1OZOA 5LTQA 5CPVA 4AQJA 1F4OA 2QT2A 3IR8A 5DY6A 4B30A 1CKKA 2JOJA 1AP4A 1W7SA 4HQ9A 2BECA 1M45A 3BUMB 2ZN8A 4XL5A 3DQ7A 1SYMA 5DPHA 2G16B 3MGFA 2VVIA 1KYSA 1XVJA 1H8BA 4JWQA 2YFPA 5EHUA 2CBLA 2JADA 3OSQA 3SVOA 1FPWA 1YX7A 2E30A 4Z4MA 3DF0A 4GOBA 2QACA 1K2HA 1BG1A 3F45A 1F8HA 1B7TZ 3DQLA 4GF6B 3WLDA 2K7DA 1A75B 2LP3A 4XOWA 3P28A 2COLB 3CB9A 2SASA 4RTCA 4OHSA 2IOVA 2BBMA 1CM4A 4QJ5B 4PPLA 5DU0A 4MZLA 2MLFC 1OMRA 3M22A 4IK5A 1IRJA 1KK8C 4ZBLA 1XFZO 1OQPA 1C7WA 4DXNA 1KFXS 4W6RA 4W76A 1YUTA 3O2PA 4RYSA 5H88A 1YJ2A 1GQMA 1KQVA 1PALA 2A54B 3IQOA 3DQ9A 4PDZA 4JEOA 1C4FA 4JC2A 1CFPA 5IBWA 1YUUA 1JBYA 4OR9B 5KSZA 3EVPA 2OPOA 2A4JA 1CFFA 5I2LA 5DKNA 2BL0B 1XA9A 3D0YA 3NSLA 3KHEA 1K8UA 3BX9A 3EK4A 4GAOA 1F55A 4IL1A 1MWNA 1ZGQA 3DQ8A 2HPSA 2HGYA 3OX6A 4Q04A 2L2EA 2LHLA 3DVJA 1RK9A 3E5WA 2HETA 4ZF5A 2G3OA 5DQMA 3DQJA 1FI5A 1YRUB 1CFCA 5J3XA 1CM1A 5TNCA 1AVSA 1KSMA 2Q57A 3SSLA 3RWTA 3ST3A 2DUEA 2KAXA 4YGDB 1XYDA 2DDCA 1IGVA 2MAZA 2Q6PA 3SIAA 3U0MA 3DQ3A 5KTGA 1XMZA 1W7TA 5HLOA 1DGUA 3I19A 1ZACA 1KP5A 4EMQA 3BXKA 3D10A 4XYNA 3CGLA 2JT0A 3CD1A 2V4EC 1TCFA 2M9GA 2POXA 4DRWA 4Q9XA 2VAEA 2OTGB 2Y1NA 1NSHA 3OX5A 3DD4A 1MF8B 1EXRA 2JZIA 1WY9A 1MXEA 3FWCA 4W69A 4PPJA 1SR6B 5HKZA 2FL1A 1JC2A 5HZTA 3BUOB 1YR5A 2E6WA 3IQQA 5EBJA 3TMTA 3P8UA 4RYWA 1JBZA 3VROA 4W6LA 3AAKA 1PK0D 2KAYA 3WCKA 2KHNA 1HT9A 2ZO7A 1NCXA 2HQ8A 4W6FA 1M46A 1NPQA 1XQMA 5DTZA 1WRZA 1M63B 1E8AA 3C1VA 2LANA 4HE4A 4DS7A 4MLWA 2FZUA 2Z6YA 1QIWA 3NSKA 2KGRA 1X02A 3DQ2A 3OHMB 2NCPA 3GK2A 5DRFA 3GEXA 3IP2A 4W6CA 1EMLA 3DQDA 4W7FA 4DUQA 1EL4A 2PXWA 5JJGA 4IK1A 2GGZA 1TTXA 1OZSA 3RWAA 1YHHA 3SSVA 2K8MB 5HBDA 1QLKA 2NXQA 2BCXA 3SJSA 4N5XA 2OTEA 5HKWA 3U8PA 1EMFA 2EMOA 2IE2A 2HQZA 2YE0A 1DGVA 4ORAB 3GL4A 4HSZA 1GGZA 2F3YA 3TMRA 3DQFA 3SVNA 3TDIA 3BUNB 3ZWHA 1Q4BA 1YX8A 2LHIA 3O6BA 1Q80A 1JC1A 1K93D 1J1DA 2G9BA 1UP5A 4P2YB 4YGAA 1XFUO 1LKJA 5CSJA 1C07A 1ZGPA 2KBIA 2M97A 4ANJA 1TN4A 3AAJA 4LQTA 2ZMUA 1GGWA 4GFTA 3SIBA 1AJ4A 4KW4A 3I5FB 1YFPA 2C9JA 1HQVA 2B3QA 5KTYA 4IZNA 1YZWA 2LMTA 4PHNA 1MQ1A 1RWYA 2O2BA 2L51A 3ZNIA 2K2FA 2BTJA 2F8PA 5T3IA 2A47A 1JF2A 4NDBA 4YRUA 4Q7UA 4W6JA 5GQQC 2EC6B 4WQ2A 4DXIA 5EXBA 1QX5B 3V3DA 1KYPA 2QLEA 1SMGA 5FHVA 3O77A 2FCDA 2K0JA 1AHRA 4BY5A 1XSSA 3CFHA 3DPZA 3IF7A 3RLZA 2HFCA 4JRBA 1NCYA 2OTGC 1EMEA 3DQIA 1S1EA 2KDHA 4W6NA 1YJFA 3SG7A
chains in the Genus database with same CATH superfamily
3ST4A 3VHTB 1SR6C 3SG6A 2M49B 1Y1UA 1DEKA 1H4BA 5F9GA 2F3ZA 2AAOA 3UFZA 3HX4A 2BKIB 3R72A 1QYOA 3VRRA 2LVVA 2H8QA 1MYWA 2LMVA 1TUJA 1A2XA 4JKTA 4H3LA 4TZAA 3O4YA 3EK8A 1TIZA 3SG2A 1YHIA 2G3DB 2V4EA 4YBHB 2M0RA 3KPXA 5HZOA 1TOPA 1AUIB 2ZRTA 4EN1A 1KWOB 4ZCVA 1M31A 2D8NA 1BFPA 1K94A 1L7ZA 2PSRA 4FTGA 1K9KA 1V1GA 1N65A 4C0KA 3S05A 1W7UA 3WHTB 3IVTA 1B8LA 5AERA 3R1VA 2LNKA 1H4UA 4MVFA 3I5IB 2WSNA 5EB7A 3MSEB 4CLNA 2GV5A 4INXA 1CMGA 1LVCD 3NHTA 1YUSA 5HGEA 4ETOA 3PATA 2V53A 1NIWA 1PRWA 2A50B 1XK4A 3AI5A 2OKWA 1OXEA 1B9AA 1MOUA 5CSFA 3CFAA 1TUZA 2H5QA 2V4EB 5CSIA 3BFBA 3PFVA 4W74A 1W9ZA 2OJKA 3PJ7A 2EGDA 4N3DA 3GK4X 2KFHA 1A4PA 1YRTB 2LLSA 2NZ0A 3ADFA 2O60A 1GFLA 3WLCA 1A75A 4CFRA 1H6RA 2HRSA 3H4SE 3BQ3A 3PJIA 2KOTA 5HL1A 4KGFA 2JT8A 3B86A 2K61A 1OMDA 3DQ1A 1WDCB 1SCVA 2Q4UA 1SW8A 4WQ3A 3EKHA 1Q4EA 3CR4X 2OGRA 3GB3A 4JD9A 1ZOTB 1UHJA 1NX1A 5EL2A 2Z6ZA 1DJWA 2KFGA 1FI6A 4MZKA 4HRGA 2FWQA 5F6TA 3DPXA 1KFUS 3I5FC 3CABA 4PE7A 5D69A 3UNWA 2MRDA 5DTYA 1IH0A 4LQUA 2WC8A 4OQWA 3S0BA 2Y0GA 2AUCA 4W6KA 2LM5A 4YGCB 1BU3A 4YI9A 1QX7A 1CFDA 3UO9A 1FBVA 2R2IA 3U0NA 3SSTA 1AJ5A 4YGEB 2LUXA 1GM0A 3E5VA 2JXCA 1OOJA 3ZULA 2EC6C 5DICA 2LMUA 3CR5X 2L4HA 4YGBB 4M2OA 4GESB 2DD7A 3DQ5A 2JRFA 2Y5IA 4L12A 4J88A 4W75A 4DXMA 1RM9A 2ICRA 2LV7A 1RRXA 1SY9A 3EVUA 4D1EA 2JXLA 1QTXA 1CDNA 3I5HB 2RH7A 2WCHA 3SRYA 1WRKA 2KBMA 3ZTFA 3DY9A 1PSBA 1BOCA 2JNFA 1PULA 2FOTA 1XFVO 5BPJA 1SBJA 2AWLA 4W6GA 2I7AA 2GTEA 3AKBA 3U0LA 4GNKB 2BE4A 3S0AA 1K9UA 1AK8A 1R6PA 4W6MA 3GK1A 2L50A 3H1RA 3TUYB 3LVDA 2AWMA 3GJ1A 2ERBA 3DYEA 1NYAA 3ED8A 2DDDA 3SSHA 1SNLA 2BE6A 3NEDA 4EULA 1JFJA 2ZMWA 4NDCA 3SS3A 4PHMA 1G33A 2LP2A 1DJIA 3SVUA 1Y6WA 2O24A 1KWOC 3I5GB 4IK8A 1RTP1 2G6EA 5AANA 1F71A 1OXDA 5BT0A 2MJWB 4EDSA 2QDIA 4ZB1A 1NUBA 1OXFA 1IKUA 3I5IC 5DPJA 1LA3A 3CYZA 2GW4B 2WIQA 3BXCA 4HRHA 3CTNA 2O29A 1MUXA 4W7EA 1GJYA 1LA0A 1A03A 4PE4A 1J7RA 1EMAA 2K7OA 4DIRA 2AWJA 4PHJA 4PE0A 3E3RA 1K95A 3K21A 5AEQA 4UPGA 4H48A 2WORA 4F0ZB 2H5PA 3S0GA 1UHHA 1A29A 2KI6D 1Y1XA 2P4MA 2ZO6A 2JU0A 4AQIA 1RMOA 3L4AA 2LAPA 3R1OA 1NX0A 4W73A 4DCKA 1XK4C 1Y1AA 3LVAA 1DMOA 1WDCC 2QEOA 1L2OB 1J55A 1DF0A 2K7CA 1F09A 2QLGB 4I5NB 4PPKA 2HPWA 2VVJA 1B1GA 4W6TA 1DJXA 3BOWB 1BODA 2VVHA 4L13A 4E68A 2MBXA 3D76A 4KYNA 2H5RA 4P5OE 2K60A 5EXUA 3KCTA 1RJVA 1S6JA 2M7NA 1B9CA 3A4UB 1BLQA 2WHSA 5FVIA 4MRYA 3LCPC 4TZGA 4OJ0A 2MHHA 2ARLA 4KAGA 2F2OA 4LJCA 3SG5A 4QJ4B 1DF0B 1SCMB 5PALA 1KYRA 4ZF4A 4ORNA 1CLLA 2CTNA 4UTSA 2PQLA 3FS7A 1QY3A 1UWOA 2HQWA 2HCGA 3WNXB 1RMMA 2RGIA 4IK9A 1Q4AA 2IB6A 5DKRA 4JF9A 1NCZA 2G2SB 5HLVA 5FYXA 3I5HC 2ZFDA 4OV2A 4W6SA 5I2OA 1GL4A 3DPWA 1LS8A 2QLIA 1D1OA 3B87A 2WCKA 1ZGOA 5DTXA 2H9WA 1NWDA 1PVBA 2MLEC 3NSOA 4HVFA 5DQBA 2ISDA 2L5YA 4AOMA 1Q4DA 1W7IB 1SL8A 4CPVA 3DQNA 1S6CA 3PIBA 3TUYC 2L4IA 1B8CA 1JBAA 2QEBA 2A56B 1DJZA 3QRXA 1MHOA 3LK1A 3V2LA 5HZSA 2Y1MA 1TWOA 1CDMA 3LL8B 4H3NA 3DQOA 1KK7Y 3FE6A 1UHNA 5LK4A 2JNXA 1QV1A 1BJFA 1S36A 1JSAA 3I5GC 5LTPA 2KQYA 1OE9B 3CD9A 3D78A 1KK7Z 1S6IA 2WHTA 2KQ6A 1ZUXA 1EMKA 3VRPA 1TRFA 3A8SA 2KNEA 5K89A 3VHTA 1XFXO 2CNPA 3B6XA 2VZXA 3DQMA 1CNPA 1CLMA 5B8IB 4P1QA 4TNCA 4OZDA 5FVGA 4ZFSA 1KFUL 3OGNA 4JQ0D 3K1EA 2Z6XA 2Y4QA 3PN7C 1ZFSA 2L5XB 4W6OA 4I5KA 3VRNA 3EVVA 2EMNA 3BYAA 5BQLA 1XFYO 2EHBA 2DUFA 1YVLA 1UURA 1Q73A 5HKYA 2WNDA 1IQ3A 2PRUA 1SKTA 1DQEA 3DVMA 3M0WA 2MA2A 1KFXL 2JULA 5H89A 5DKQA 3OP0A 5H87A 3SSKA 1W7JB 3LF3A 1Z1QA 3S0EA 2LVJA 1L2OC 3SSPA 4J89A 4OVNF 2KYCA 2YDZA 3RZSA 1QYFA 1RECA 5DRGA 2P70A 1XAEA 4CFQA 1R2UA 4QJ3B 2GX0A 5LTRA 1BMOA 2F33A 3E5TA 4ICBA 2K2AA 5D7FA 3HCMA 1SK6D 1G4YR 3DQ6A 3PLFB 1F4QA 3DQAA 2QPTA 4FQOA 1IQ5A 3L47A 5FVFA 3M24A 1SCMC 3AKAA 2CXJA 4BDUA 4XJKB 1S6ZA 3SSYA 4PCWA 3TS5C 1SL7A 2H5OA 3U8CA 1DVIA 1NX2A 4KF5A 1SPYA 2A46A 2WCBA 2WSOA 5EB6A 2G6XA 3KCSA 1XA5A 1B4CA 1MXLC 1G7KA 3SV5A 3VICA 3DQCA 3TZ1A 3DQUA 1YHGA 1MOVA 1ZMZA 5J2OA 3ST2A 2HGDA 4USLA 4L1IA 2PMYA 4A4BA 2LLTA 3BXAA 3KO0A 3ST0A 2JT3A 3QMEA 4GGFC 2BCAA 1WLMA 4HQ8A 2PASA 2WURA 3NEZA 3ZUFA 1QYQA 1ORGA 2JTZA 4OCIA 1XO5A 5KU1A 4W7AA 2A48A 2LUCA 1B47A 2M1KB 1F70A 4ZF3A 3SVBA 2WCLA 3GOFA 2FJUB 2A52B 4XVPA 4W6BA 3LA1A 4KW8A 4Q9WA 1OMVA 1QVIY 1B7TY 5I2QA 1BF5A 4JPZB 1B8RA 2JQ6A 2IB5A 4Q7TA 3FIAA 4DKNA 1JFKA 1QVIZ 3SVEA 2H6VA 3NSIA 1S3PA 2I2RE 1TNPA 3LK0A 4B30B 3S0DA 3CLNA 2LCPA 3CBEA 3BFAA 4W6DA 2ZNDA 3LS3A 4W77A 1TNXA 1QIVA 4MRXA 1IJ5A 3JVTB 4H47A 1C7VA 3EKJA 2WISA 1QXTA 1WLZA 3AI4A 1UHIA 1S5GY 2JTTA 3DF0B 3PSRA 3LSAA 3BXBA 2C9IA 4M2PA 5DTLA 1CLBA 4KF4A 5HW9A 2PVBA 2QRFA 3B7AA 1S5GZ 4ZINA 4W6IA 3BUWB 2CCMA 3BJHA 1U5IA 5CSNA 2KI4B 2FCEA 1EG3A 4H3MA 4LJDA 1K9PA 5AQBB 4YI8A 1Y0VH 2DUGA 2LE9B 3SVCA 2VADA 3OB1B 4LJBA 4KGEA 4W7DA 3LLEA 1JUOA 1QS7A 1ZUZA 4I5LB 2IS9A 4XGYA 3U0KA 1N0YA 3NT3A 1BR4B 4KW9A 1M39A 3SVRA 4M2QA 4IK4A 5I8NA 4BY4A 1C3YA 3WXAA 4AR7A 3DVEA 1PSRA 3CZTX 4EDOA 2DUHA 2LVKA 2G5ZB 2SCPA 3VGOA 3OB2B 1U5IB 3WHUB 2QU1A 2DOQA 2KI6C 3JTDB 3AKOA 1QLSA 2PALA 1CV7A 5DPIA 1K96A 2EMDA 1UHKA 4I5JA 1LINA 3DXLA 1EMMA 3D0YB 3G9AA 2KYFA 3D75A 3KF9A 1RROA 3DQEA 3PN7B 2QLGA 2QEVA 2YE1A 2VRGA 3BOWA 1ALVA 4XOVA 5HZUA 5ER4X 2G6YA 1IG5A 4W7CA 2NLNA 2M1UA 2PXSA 2F2PA 4LW5A 2H61C 1CTRA 4WRIA 4NQGA 1EG4A 2GW3A 2AWKA 2KGBC 4W6UA 2H2KA 3CGAA 5BTTA 2Q91A 2HF5A 1SRAA 4MN0A 1N2DA 4OGSA 4MEWA 3DQ4A 2BCBA 5AXIA 4PE1A 3NF0A 4C0LA 1Z4HA 2KSPA 2BBNA 2K7BA 3LVCA 4P76A 1KQMB 4W6PA 4KF5C 1QJTA 1Z2CB 1RFJA 1F0BA 1J7OA 2ZRSA 2JC2A 2NCOA 4HREE 3UG0A 1TNWA 5BTTB 2JPTA 1G8IA 2L98A 4U2VA 1CDPA 2QZ0A 3FE8A 1CDLA 1FF1A 1UUSA 2M7LA 1JC0A 2OKYA 2M8UA 4NDDA 1EJ3A 1XFWO 4GGFA 1V1FA 1EMGA 1ODBA 2L0PA 2Z1OA 4FQTA 2DD9A 4DXQA 3TS5B 3JVTC 2G2BA 2OS8B 2JWWA 4ORCB 2M29A 1YVHA 3FE9A 2LC5A 4KPIA 4JGEA 3DQKA 3CS1A 1DELA 3LF4B 3NXAA 3DVKA 1PVAA 1Q4CA 4U8DA 3PALA 1EMBA 4N1GA 2O5GA 4R6BA 1UISA 4W6AA 3ICBA 2KI4C 4DXPA 3H1OA 3CDNA 4W6HA 4MZJA 4OY4A 4L9MA 4W72A 4DXOA 2OTBA 4I2YA 2WCEA 3OSRA 5FI2A 3D73A 4NWSA 1DJGA 2BL0C 3VB1A 4KEXA 4PALA 3SVSA 3U8AA 2B1UA 1MR8A 4GPLB 3KEVA 2WCFA 1OOFA 3BUXB 1QV0A 1HCJA 5DPGA 1WRLA 4J8AA 1SL9A 1QXPA 1OSAA 1S26D 1J7PA 4LJDC 3JTDC 2ZN9A 3NT9A 2LLUA 1DTLA 1J7QA 3S0FA 3K1KA 2AH8A 2HQKA 4IK3A 2QLHA 1QWVA 3EVRA 1KCYA 2WCJA 3DQHA 3OGOA 2ZNEA 1KK8B 4B5YA 2KAVA 4ORBB 3VRQA 1DJYA 2AMIA 1T14A 2GGMA 1EMCA 4C0JA 1NP8A 3TDUA 4PHKA 2AHAA 4DKMA 3ZUJA 1YURA 3A8RA 3SVDA 1JWDA 4W7RA 1J1EA 2BKHB 1RMPA 4ZCUA 2M3WA 1IWQA 5HYDA 3GJ2A 5ER5A 3SG4A 3SG3A 1CB1A 1BR1B 3FWBA 4MSPA 1OOIX 2ZKMX 2I18A 2BAPA 2WCMA 4A4CA 4PFEA 1BT6A 2H8VA 4R1EA 1EH2A 1NX3A 4XJKA 5EJUA 3CR2A 2TN4A 1KQMC 2KPHA 3SS4A 2B3PA 2WOSA 2I94A 3D77A 1Z1PA 4JFGA 5G08A 4R6DA 4GUKA 4ZIOA 2P6BB 3O78A 1VRKA 5JOLA 1QASA 4HQCA 3BFHA 1DT7B 1TCOB 3SS0A 2H61A 3VK1A 4AS8A 2GX2A 3SS5A 2DUIA 3W1DA 5EXCI 1JF0A 2JPOA 1F54A 5AFPA 1GGXA 3R1PA 1K90D 1LXFC 1CMFA 4CIDA 4Q7RA 3TDZA 1XFRA 1YTZC 4MBEA 2CT9A 2WHUA 3EK7A 2LVIA 2OS8C 1QATA 3PJ5A 1IJ6A 1DJHA 3CZ0A 1KSOA 2KFFA 2A53B 3RM1A 3CFFA 2HJOA 4INWA 3CWGA 3W1CA 1FW4A 1TNQA 3PJBA 4N1FA 4Z4KA 4KA9A 1HUYA 4GGNA 4OKHA 3PM8A 4GBAA 4W7XA 1QX2A 1ALWA 1OZOA 5LTQA 5CPVA 1DC1A 4AQJA 1F4OA 2QT2A 3IR8A 5DY6A 3B88A 4B30A 1OW4A 1CKKA 2JOJA 1AP4A 1W7SA 4HQ9A 2BECA 1M45A 3BUMB 2ZN8A 4XL5A 3DQ7A 1SYMA 5DPHA 2G16B 2WC6A 3MGFA 2VVIA 1KYSA 1XVJA 1H8BA 4JWQA 2YFPA 5EHUA 2CBLA 2JADA 3OSQA 3SVOA 1FPWA 1YX7A 2E30A 4Z4MA 3DF0A 4GOBA 2QACA 1K2HA 1BG1A 3F45A 1F8HA 1B7TZ 3D74A 3DQLA 4GF6B 3WLDA 2K7DA 1A75B 2LP3A 4XOWA 3P28A 2COLB 3CB9A 5FI6A 2SASA 4RTCA 4OHSA 2IOVA 2BBMA 1CM4A 4QJ5B 4PPLA 5DU0A 4MZLA 2MLFC 1OMRA 3M22A 4IK5A 1IRJA 1KK8C 2L2CA 4ZBLA 3N7HA 1XFZO 1OQPA 1C7WA 4DXNA 1KFXS 3NGVA 4W6RA 4W76A 3PM2A 1YUTA 3O2PA 4RYSA 5H88A 1YJ2A 1GQMA 1KQVA 1PALA 2A54B 3IQOA 3DQ9A 4PDZA 4JEOA 1C4FA 4JC2A 1CFPA 3O4XA 5IBWA 2QEHA 1YUUA 1JBYA 4OR9B 5KSZA 3EVPA 2OPOA 2A4JA 1CFFA 5I2LA 5DKNA 2BL0B 1XA9A 3D0YA 1C3ZA 3NSLA 3KHEA 1K8UA 3BX9A 3EK4A 4GAOA 1F55A 4IL1A 1MWNA 1ZGQA 3DQ8A 2HPSA 2HGYA 3OX6A 4Q04A 3Q8IA 2L2EA 2LHLA 3DVJA 2BNXA 1RK9A 3E5WA 2HETA 1SSEB 3EG5B 4F7FA 4ZF5A 2G3OA 5DQMA 3DQJA 1FI5A 1YRUB 3DZTA 1CFCA 5J3XA 1CM1A 5TNCA 1AVSA 1KSMA 2Q57A 3SSLA 3RWTA 3ST3A 2DUEA 2KAXA 4YGDB 1XYDA 2WC5A 2DDCA 1IGVA 2MAZA 2Q6PA 3SIAA 3U0MA 3DQ3A 5KTGA 1XMZA 1W7TA 5HLOA 1DGUA 3I19A 3CZ2A 1ZACA 1KP5A 4EMQA 1P28A 3BXKA 3D10A 4XYNA 3CGLA 2JT0A 3CD1A 2V4EC 1TCFA 2M9GA 2POXA 4DRWA 4Q9XA 2VAEA 2OTGB 2Y1NA 1NSHA 3OX5A 3DD4A 1MF8B 1EXRA 2JZIA 1WY9A 1MXEA 3FWCA 4W69A 4PPJA 3L4LA 1SR6B 5HKZA 2FL1A 1JC2A 5HZTA 3BUOB 1YR5A 2E6WA 3IQQA 5EBJA 1OOHA 3P8UA 3TMTA 4RYWA 1JBZA 3VROA 4W6LA 3AAKA 1PK0D 2KAYA 3WCKA 2KHNA 1HT9A 2ZO7A 1NCXA 5FI7A 2HQ8A 4W6FA 1M46A 1NPQA 1XQMA 5DTZA 1WRZA 1M63B 1E8AA 3C1VA 2LANA 4HE4A 5D3OA 4DS7A 4MLWA 2FZUA 2Z6YA 1QIWA 3NSKA 1IIOA 2KGRA 1X02A 3DQ2A 3OHMB 2NCPA 3GK2A 5DRFA 3GEXA 3IP2A 4W6CA 1EMLA 3DQDA 4W7FA 4DUQA 1EL4A 2PXWA 5JJGA 4IK1A 2GGZA 1TTXA 1OZSA 3RWAA 1YHHA 3SSVA 2K8MB 5HBDA 1QLKA 2NXQA 4PT1A 2BCXA 3SJSA 4N5XA 2PYQA 2OTEA 5HKWA 2KLDA 3U8PA 1EMFA 2EMOA 2IE2A 2HQZA 2YE0A 1DGVA 4ORAB 2KLEA 3GL4A 2YGUA 4HSZA 1GGZA 2F3YA 3TMRA 3DQFA 3SVNA 3TDIA 3BUNB 3ZWHA 1Q4BA 1YX8A 2LHIA 3O6BA 1Q80A 1JC1A 4IJ7A 1K93D 1J1DA 2G9BA 1UP5A 4P2YB 4YGAA 1XFUO 1LKJA 5CSJA 1C07A 1ZGPA 2KBIA 2M97A 4ANJA 1TN4A 3AAJA 4LQTA 2ZMUA 1GGWA 4GFTA 3SIBA 1AJ4A 5I94A 4KW4A 3I5FB 2P71A 1YFPA 2C9JA 1HQVA 2B3QA 5KTYA 4IZNA 2FJYA 1YZWA 2LMTA 4PHNA 1MQ1A 1RWYA 2O2BA 2L51A 3ZNIA 2K2FA 3NHIA 2BTJA 2F8PA 5T3IA 2A47A 1JF2A 4NDBA 4YRUA 4Q7UA 4W6JA 3CZ1A 5GQQC 2EC6B 4WQ2A 4DXIA 5EXBA 1QX5B 3V3DA 1KYPA 2QLEA 1OOGA 1SMGA 5FHVA 3O77A 2FCDA 2K0JA 1AHRA 4BY5A 1XSSA 3CFHA 3DPZA 3IF7A 3RLZA 2HFCA 4JRBA 1NCYA 2OTGC 1EMEA 3DQIA 1S1EA 2KDHA 4W6NA 3OBVA 1YJFA 3SG7A
chains in the Genus database with same CATH topology
3ST4A 3VHTB 1SR6C 3SG6A 2M49B 1Y1UA 1H4BA 5F9GA 2F3ZA 2AAOA 3UFZA 3HX4A 2BKIB 1QYOA 3VRRA 2LVVA 2H8QA 1MYWA 2LMVA 1A2XA 4H3LA 4TZAA 3O4YA 3EK8A 1TIZA 3SG2A 1YHIA 2G3DB 2V4EA 4YBHB 2M0RA 3KPXA 5HZOA 1TOPA 1AUIB 2ZRTA 4EN1A 1KWOB 4ZCVA 1M31A 2D8NA 1BFPA 1K94A 1L7ZA 2PSRA 4FTGA 1K9KA 1V1GA 1N65A 4C0KA 3S05A 1W7UA 3WHTB 1B8LA 5AERA 2LNKA 1H4UA 4MVFA 3I5IB 2WSNA 5EB7A 3MSEB 4CLNA 2GV5A 1CMGA 1LVCD 1YUSA 5HGEA 4ETOA 3PATA 2V53A 1NIWA 1PRWA 2A50B 1XK4A 3AI5A 2OKWA 1OXEA 1B9AA 1MOUA 5CSFA 3CFAA 2H5QA 2V4EB 5CSIA 3PFVA 4W74A 2OJKA 3PJ7A 2EGDA 4N3DA 3GK4X 2KFHA 1A4PA 1YRTB 2LLSA 2NZ0A 3ADFA 2O60A 1GFLA 3WLCA 1A75A 4CFRA 1H6RA 2HRSA 3H4SE 3BQ3A 2KOTA 4KGFA 2JT8A 2K61A 1OMDA 3DQ1A 1WDCB 1SCVA 2Q4UA 1SW8A 4WQ3A 3EKHA 1Q4EA 3CR4X 2OGRA 3GB3A 1ZOTB 1UHJA 1NX1A 2Z6ZA 1DJWA 2KFGA 1FI6A 4MZKA 4HRGA 2FWQA 5F6TA 3DPXA 1KFUS 3I5FC 4PE7A 5D69A 2MRDA 5DTYA 1IH0A 4LQUA 2WC8A 4OQWA 2Y0GA 2AUCA 4W6KA 2LM5A 4YGCB 1BU3A 4YI9A 1QX7A 1CFDA 1FBVA 2R2IA 3U0NA 3SSTA 1AJ5A 4YGEB 2LUXA 3E5VA 2JXCA 1OOJA 3ZULA 2EC6C 2LMUA 3CR5X 2L4HA 4YGBB 4M2OA 4GESB 2DD7A 3DQ5A 2JRFA 2Y5IA 4L12A 4J88A 4W75A 4DXMA 1RM9A 2ICRA 2LV7A 1RRXA 1SY9A 3EVUA 4D1EA 2JXLA 1QTXA 1CDNA 3I5HB 2RH7A 3SRYA 1WRKA 2KBMA 3ZTFA 1PSBA 1BOCA 2JNFA 1PULA 2FOTA 1XFVO 5BPJA 1SBJA 2AWLA 4W6GA 2I7AA 3AKBA 3U0LA 4GNKB 2BE4A 1K9UA 1AK8A 1R6PA 4W6MA 3GK1A 2L50A 3H1RA 3TUYB 3LVDA 2AWMA 3GJ1A 1NYAA 3ED8A 2DDDA 3SSHA 1SNLA 2BE6A 3NEDA 4EULA 1JFJA 2ZMWA 4NDCA 4PHMA 1G33A 2LP2A 1DJIA 3SVUA 1Y6WA 2O24A 1KWOC 3I5GB 4IK8A 1RTP1 2G6EA 5AANA 1F71A 1OXDA 5BT0A 2MJWB 4EDSA 4ZB1A 1NUBA 1OXFA 1IKUA 3I5IC 5DPJA 1LA3A 2GW4B 2WIQA 3BXCA 4HRHA 3CTNA 2O29A 1MUXA 4W7EA 1GJYA 1LA0A 1A03A 4PE4A 1J7RA 1EMAA 2K7OA 4DIRA 2AWJA 4PHJA 4PE0A 3E3RA 1K95A 3K21A 5AEQA 4UPGA 4H48A 2WORA 4F0ZB 2H5PA 1UHHA 1A29A 2KI6D 1Y1XA 2P4MA 2ZO6A 2JU0A 4AQIA 1RMOA 2LAPA 1NX0A 4W73A 4DCKA 1XK4C 1Y1AA 3LVAA 1DMOA 1WDCC 1L2OB 1J55A 1DF0A 2K7CA 1F09A 2QLGB 4I5NB 4PPKA 2HPWA 2VVJA 1B1GA 4W6TA 1DJXA 3BOWB 1BODA 2VVHA 4L13A 4E68A 2MBXA 2H5RA 4P5OE 5EXUA 3KCTA 1RJVA 1S6JA 2M7NA 1B9CA 3A4UB 1BLQA 2WHSA 5FVIA 4MRYA 3LCPC 4TZGA 4OJ0A 2MHHA 2ARLA 4KAGA 2F2OA 4LJCA 3SG5A 4QJ4B 1DF0B 1SCMB 5PALA 1KYRA 4ZF4A 4ORNA 1CLLA 2CTNA 4UTSA 3FS7A 1QY3A 1UWOA 2HQWA 2HCGA 3WNXB 1RMMA 2RGIA 4IK9A 1Q4AA 2IB6A 5DKRA 4JF9A 1NCZA 2G2SB 5HLVA 5FYXA 3I5HC 2ZFDA 4OV2A 4W6SA 5I2OA 1GL4A 3DPWA 2QLIA 1D1OA 1ZGOA 5DTXA 2H9WA 1NWDA 1PVBA 2MLEC 3NSOA 4HVFA 5DQBA 2ISDA 4AOMA 1Q4DA 1W7IB 1SL8A 4CPVA 3DQNA 1S6CA 3PIBA 3TUYC 2L4IA 1B8CA 1JBAA 2A56B 1DJZA 3QRXA 1MHOA 3LK1A 5HZSA 2Y1MA 1CDMA 3LL8B 4H3NA 3DQOA 1KK7Y 1UHNA 5LK4A 2JNXA 1QV1A 1BJFA 1S36A 1JSAA 3I5GC 5LTPA 2KQYA 1OE9B 3CD9A 1KK7Z 1S6IA 2WHTA 2KQ6A 1ZUXA 1EMKA 3VRPA 1TRFA 3A8SA 2KNEA 5K89A 3VHTA 1XFXO 2CNPA 2VZXA 3DQMA 1CNPA 1CLMA 5B8IB 4P1QA 4TNCA 5FVGA 4ZFSA 1KFUL 4JQ0D 2Z6XA 2Y4QA 3PN7C 1ZFSA 2L5XB 4W6OA 4I5KA 3VRNA 3EVVA 2EMNA 3BYAA 5BQLA 1XFYO 2EHBA 2DUFA 1YVLA 1UURA 1Q73A 5HKYA 2WNDA 1IQ3A 2PRUA 1SKTA 3DVMA 3M0WA 2MA2A 1KFXL 2JULA 5H89A 5DKQA 3OP0A 5H87A 3SSKA 1W7JB 3LF3A 1Z1QA 2LVJA 1L2OC 3SSPA 4J89A 4OVNF 2KYCA 2YDZA 1QYFA 1RECA 5DRGA 1XAEA 4CFQA 1R2UA 4QJ3B 2GX0A 5LTRA 1BMOA 2F33A 3E5TA 4ICBA 2K2AA 5D7FA 3HCMA 1SK6D 1G4YR 3DQ6A 3PLFB 1F4QA 3DQAA 2QPTA 4FQOA 1IQ5A 5FVFA 3M24A 1SCMC 3AKAA 2CXJA 4BDUA 4XJKB 1S6ZA 3SSYA 4PCWA 3TS5C 1SL7A 2H5OA 3U8CA 1DVIA 1NX2A 4KF5A 1SPYA 2A46A 2WCBA 2WSOA 5EB6A 2G6XA 3KCSA 1XA5A 1B4CA 1MXLC 1G7KA 3SV5A 3VICA 3DQCA 3TZ1A 3DQUA 1YHGA 1MOVA 1ZMZA 5J2OA 3ST2A 2HGDA 4USLA 4L1IA 2PMYA 4A4BA 2LLTA 3BXAA 3KO0A 3ST0A 2JT3A 4GGFC 2BCAA 1WLMA 4HQ8A 2PASA 2WURA 3NEZA 3ZUFA 1QYQA 2JTZA 4OCIA 1XO5A 5KU1A 4W7AA 2A48A 2LUCA 1B47A 2M1KB 1F70A 4ZF3A 3SVBA 3GOFA 2FJUB 2A52B 4XVPA 4W6BA 3LA1A 4KW8A 4Q9WA 1OMVA 1QVIY 1B7TY 5I2QA 1BF5A 4JPZB 1B8RA 2JQ6A 2IB5A 4Q7TA 3FIAA 4DKNA 1JFKA 1QVIZ 3SVEA 2H6VA 3NSIA 1S3PA 2I2RE 1TNPA 3LK0A 4B30B 3CLNA 2LCPA 3CBEA 4W6DA 2ZNDA 3LS3A 4W77A 1TNXA 1QIVA 4MRXA 1IJ5A 3JVTB 4H47A 1C7VA 3EKJA 2WISA 1QXTA 1WLZA 3AI4A 1UHIA 1S5GY 2JTTA 3DF0B 3PSRA 3LSAA 3BXBA 2C9IA 4M2PA 5DTLA 1CLBA 4KF4A 5HW9A 2PVBA 2QRFA 1S5GZ 4ZINA 4W6IA 3BUWB 2CCMA 1U5IA 5CSNA 2KI4B 2FCEA 1EG3A 4H3MA 4LJDA 1K9PA 5AQBB 4YI8A 1Y0VH 2DUGA 2LE9B 3SVCA 2VADA 3OB1B 4LJBA 4KGEA 4W7DA 3LLEA 1JUOA 1QS7A 1ZUZA 4I5LB 2IS9A 4XGYA 3U0KA 1N0YA 3NT3A 1BR4B 4KW9A 1M39A 3SVRA 4M2QA 4IK4A 5I8NA 4BY4A 3WXAA 4AR7A 3DVEA 1PSRA 3CZTX 4EDOA 2DUHA 2LVKA 2G5ZB 2SCPA 3VGOA 3OB2B 1U5IB 3WHUB 2QU1A 2DOQA 2KI6C 3JTDB 3AKOA 1QLSA 2PALA 1CV7A 5DPIA 1K96A 2EMDA 1UHKA 4I5JA 1LINA 1EMMA 3D0YB 3G9AA 2KYFA 3KF9A 1RROA 3DQEA 3PN7B 2QLGA 2YE1A 2VRGA 3BOWA 1ALVA 4XOVA 5HZUA 5ER4X 2G6YA 1IG5A 4W7CA 2NLNA 2M1UA 2PXSA 2F2PA 4LW5A 2H61C 1CTRA 4WRIA 4NQGA 1EG4A 2GW3A 2AWKA 2KGBC 4W6UA 2H2KA 3CGAA 5BTTA 2Q91A 2HF5A 1SRAA 4MN0A 1N2DA 4OGSA 4MEWA 3DQ4A 2BCBA 5AXIA 4PE1A 3NF0A 4C0LA 2KSPA 2BBNA 2K7BA 3LVCA 4P76A 1KQMB 4W6PA 4KF5C 1QJTA 1RFJA 1F0BA 1J7OA 2ZRSA 2JC2A 2NCOA 4HREE 3UG0A 1TNWA 5BTTB 2JPTA 1G8IA 2L98A 4U2VA 1CDPA 2QZ0A 1CDLA 1FF1A 1UUSA 2M7LA 1JC0A 2OKYA 2M8UA 4NDDA 1EJ3A 1XFWO 4GGFA 1V1FA 1EMGA 1ODBA 2L0PA 2Z1OA 2DD9A 4DXQA 3TS5B 3JVTC 2G2BA 2OS8B 2JWWA 4ORCB 2M29A 1YVHA 2LC5A 4KPIA 4JGEA 3DQKA 3CS1A 3LF4B 3NXAA 3DVKA 1PVAA 1Q4CA 4U8DA 3PALA 1EMBA 4N1GA 2O5GA 4R6BA 1UISA 4W6AA 3ICBA 2KI4C 4DXPA 3H1OA 4W6HA 4MZJA 4OY4A 4L9MA 4W72A 4DXOA 2OTBA 4I2YA 2WCEA 3OSRA 4NWSA 1DJGA 2BL0C 4KEXA 4PALA 3SVSA 3U8AA 2B1UA 1MR8A 4GPLB 3KEVA 2WCFA 3BUXB 1QV0A 1HCJA 5DPGA 1WRLA 4J8AA 1SL9A 1QXPA 1OSAA 1S26D 1J7PA 4LJDC 3JTDC 2ZN9A 3NT9A 2LLUA 1DTLA 1J7QA 3K1KA 2AH8A 2HQKA 4IK3A 2QLHA 3EVRA 1KCYA 3DQHA 3OGOA 2ZNEA 1KK8B 4B5YA 2KAVA 4ORBB 3VRQA 1DJYA 2AMIA 2GGMA 1EMCA 4C0JA 1NP8A 3TDUA 4PHKA 2AHAA 4DKMA 3ZUJA 1YURA 3A8RA 3SVDA 1JWDA 4W7RA 1J1EA 2BKHB 1RMPA 4ZCUA 2M3WA 1IWQA 5HYDA 3GJ2A 5ER5A 3SG4A 3SG3A 1CB1A 1BR1B 3FWBA 4MSPA 2ZKMX 2I18A 4A4CA 4PFEA 1BT6A 4R1EA 1EH2A 1NX3A 4XJKA 5EJUA 3CR2A 2TN4A 1KQMC 2B3PA 2WOSA 2I94A 1Z1PA 4JFGA 5G08A 4R6DA 4GUKA 4ZIOA 2P6BB 3O78A 1VRKA 5JOLA 1QASA 4HQCA 1DT7B 1TCOB 3SS0A 2H61A 3VK1A 4AS8A 2GX2A 2DUIA 3W1DA 5EXCI 1JF0A 1F54A 5AFPA 1GGXA 1K90D 1LXFC 1CMFA 4CIDA 4Q7RA 3TDZA 1YTZC 4MBEA 2CT9A 2WHUA 3EK7A 2LVIA 2OS8C 1QATA 3PJ5A 1IJ6A 1DJHA 1KSOA 2KFFA 2A53B 3RM1A 3CFFA 2HJOA 3CWGA 3W1CA 1FW4A 1TNQA 3PJBA 4N1FA 4Z4KA 4KA9A 1HUYA 4GGNA 4OKHA 3PM8A 4GBAA 4W7XA 1QX2A 1ALWA 1OZOA 5LTQA 5CPVA 4AQJA 1F4OA 2QT2A 3IR8A 5DY6A 4B30A 1CKKA 2JOJA 1AP4A 1W7SA 4HQ9A 2BECA 1M45A 3BUMB 2ZN8A 4XL5A 3DQ7A 1SYMA 5DPHA 2G16B 3MGFA 2VVIA 1KYSA 1XVJA 1H8BA 4JWQA 2YFPA 5EHUA 2CBLA 2JADA 3OSQA 3SVOA 1FPWA 1YX7A 2E30A 4Z4MA 3DF0A 4GOBA 2QACA 1K2HA 1BG1A 3F45A 1F8HA 1B7TZ 3DQLA 4GF6B 3WLDA 2K7DA 1A75B 2LP3A 4XOWA 3P28A 2COLB 3CB9A 2SASA 4RTCA 4OHSA 2IOVA 2BBMA 1CM4A 4QJ5B 4PPLA 5DU0A 4MZLA 2MLFC 1OMRA 3M22A 4IK5A 1IRJA 1KK8C 4ZBLA 1XFZO 1OQPA 1C7WA 4DXNA 1KFXS 4W6RA 4W76A 1YUTA 3O2PA 4RYSA 5H88A 1YJ2A 1GQMA 1KQVA 1PALA 2A54B 3IQOA 3DQ9A 4PDZA 4JEOA 1C4FA 4JC2A 1CFPA 5IBWA 1YUUA 1JBYA 4OR9B 5KSZA 3EVPA 2OPOA 2A4JA 1CFFA 5I2LA 5DKNA 2BL0B 1XA9A 3D0YA 3NSLA 3KHEA 1K8UA 3BX9A 3EK4A 4GAOA 1F55A 4IL1A 1MWNA 1ZGQA 3DQ8A 2HPSA 2HGYA 3OX6A 4Q04A 2L2EA 2LHLA 3DVJA 1RK9A 3E5WA 2HETA 4ZF5A 2G3OA 5DQMA 3DQJA 1FI5A 1YRUB 1CFCA 5J3XA 1CM1A 5TNCA 1AVSA 1KSMA 2Q57A 3SSLA 3RWTA 3ST3A 2DUEA 2KAXA 4YGDB 1XYDA 2DDCA 1IGVA 2MAZA 2Q6PA 3SIAA 3U0MA 3DQ3A 5KTGA 1XMZA 1W7TA 5HLOA 1DGUA 3I19A 1ZACA 1KP5A 4EMQA 3BXKA 3D10A 4XYNA 3CGLA 2JT0A 3CD1A 2V4EC 1TCFA 2M9GA 2POXA 4DRWA 4Q9XA 2VAEA 2OTGB 2Y1NA 1NSHA 3OX5A 3DD4A 1MF8B 1EXRA 2JZIA 1WY9A 1MXEA 3FWCA 4W69A 4PPJA 1SR6B 5HKZA 2FL1A 1JC2A 5HZTA 3BUOB 1YR5A 2E6WA 3IQQA 5EBJA 3TMTA 3P8UA 4RYWA 1JBZA 3VROA 4W6LA 3AAKA 1PK0D 2KAYA 3WCKA 2KHNA 1HT9A 2ZO7A 1NCXA 2HQ8A 4W6FA 1M46A 1NPQA 1XQMA 5DTZA 1WRZA 1M63B 1E8AA 3C1VA 2LANA 4HE4A 4DS7A 4MLWA 2FZUA 2Z6YA 1QIWA 3NSKA 2KGRA 1X02A 3DQ2A 3OHMB 2NCPA 3GK2A 5DRFA 3GEXA 3IP2A 4W6CA 1EMLA 3DQDA 4W7FA 4DUQA 1EL4A 2PXWA 5JJGA 4IK1A 2GGZA 1TTXA 1OZSA 3RWAA 1YHHA 3SSVA 2K8MB 5HBDA 1QLKA 2NXQA 2BCXA 3SJSA 4N5XA 2OTEA 5HKWA 3U8PA 1EMFA 2EMOA 2IE2A 2HQZA 2YE0A 1DGVA 4ORAB 3GL4A 4HSZA 1GGZA 2F3YA 3TMRA 3DQFA 3SVNA 3TDIA 3BUNB 3ZWHA 1Q4BA 1YX8A 2LHIA 3O6BA 1Q80A 1JC1A 1K93D 1J1DA 2G9BA 1UP5A 4P2YB 4YGAA 1XFUO 1LKJA 5CSJA 1C07A 1ZGPA 2KBIA 2M97A 4ANJA 1TN4A 3AAJA 4LQTA 2ZMUA 1GGWA 4GFTA 3SIBA 1AJ4A 4KW4A 3I5FB 1YFPA 2C9JA 1HQVA 2B3QA 5KTYA 4IZNA 1YZWA 2LMTA 4PHNA 1MQ1A 1RWYA 2O2BA 2L51A 3ZNIA 2K2FA 2BTJA 2F8PA 5T3IA 2A47A 1JF2A 4NDBA 4YRUA 4Q7UA 4W6JA 5GQQC 2EC6B 4WQ2A 4DXIA 5EXBA 1QX5B 3V3DA 1KYPA 2QLEA 1SMGA 5FHVA 3O77A 2FCDA 2K0JA 1AHRA 4BY5A 1XSSA 3CFHA 3DPZA 3IF7A 3RLZA 2HFCA 4JRBA 1NCYA 2OTGC 1EMEA 3DQIA 1S1EA 2KDHA 4W6NA 1YJFA 3SG7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ST4 A;  3VHT B;  1SR6 C;  3SG6 A;  2M49 B;  1Y1U A;  1H4B A;  5F9G A;  2F3Z A;  2AAO A;  3UFZ A;  3HX4 A;  2BKI B;  1QYO A;  3VRR A;  2LVV A;  2H8Q A;  1MYW A;  2LMV A;  1A2X A;  4H3L A;  4TZA A;  3O4Y A;  3EK8 A;  1TIZ A;  3SG2 A;  1YHI A;  2G3D B;  2V4E A;  4YBH B;  2M0R A;  3KPX A;  5HZO A;  1TOP A;  1AUI B;  2ZRT A;  4EN1 A;  1KWO B;  4ZCV A;  1M31 A;  2D8N A;  1BFP A;  1K94 A;  1L7Z A;  2PSR A;  4FTG A;  1K9K A;  1V1G A;  1N65 A;  4C0K A;  3S05 A;  1W7U A;  3WHT B;  1B8L A;  5AER A;  2LNK A;  1H4U A;  4MVF A;  3I5I B;  2WSN A;  5EB7 A;  3MSE B;  4CLN A;  2GV5 A;  1CMG A;  1LVC D;  1YUS A;  5HGE A;  4ETO A;  3PAT A;  2V53 A;  1NIW A;  1PRW A;  2A50 B;  1XK4 A;  3AI5 A;  2OKW A;  1OXE A;  1B9A A;  1MOU A;  5CSF A;  3CFA A;  2H5Q A;  2V4E B;  5CSI A;  3PFV A;  4W74 A;  2OJK A;  3PJ7 A;  2EGD A;  4N3D A;  3GK4 X;  2KFH A;  1A4P A;  1YRT B;  2LLS A;  2NZ0 A;  3ADF A;  2O60 A;  1GFL A;  3WLC A;  1A75 A;  4CFR A;  1H6R A;  2HRS A;  3H4S E;  3BQ3 A;  2KOT A;  4KGF A;  2JT8 A;  2K61 A;  1OMD A;  3DQ1 A;  1WDC B;  1SCV A;  2Q4U A;  1SW8 A;  4WQ3 A;  3EKH A;  1Q4E A;  3CR4 X;  2OGR A;  3GB3 A;  1ZOT B;  1UHJ A;  1NX1 A;  2Z6Z A;  1DJW A;  2KFG A;  1FI6 A;  4MZK A;  4HRG A;  2FWQ A;  5F6T A;  3DPX A;  1KFU S;  3I5F C;  4PE7 A;  5D69 A;  2MRD A;  5DTY A;  1IH0 A;  4LQU A;  2WC8 A;  4OQW A;  2Y0G A;  2AUC A;  4W6K A;  2LM5 A;  4YGC B;  1BU3 A;  4YI9 A;  1QX7 A;  1CFD A;  1FBV A;  2R2I A;  3U0N A;  3SST A;  1AJ5 A;  4YGE B;  2LUX A;  3E5V A;  2JXC A;  1OOJ A;  3ZUL A;  2EC6 C;  2LMU A;  3CR5 X;  2L4H A;  4YGB B;  4M2O A;  4GES B;  2DD7 A;  3DQ5 A;  2JRF A;  2Y5I A;  4L12 A;  4J88 A;  4W75 A;  4DXM A;  1RM9 A;  2ICR A;  2LV7 A;  1RRX A;  1SY9 A;  3EVU A;  4D1E A;  2JXL A;  1QTX A;  1CDN A;  3I5H B;  2RH7 A;  3SRY A;  1WRK A;  2KBM A;  3ZTF A;  1PSB A;  1BOC A;  2JNF A;  1PUL A;  2FOT A;  1XFV O;  5BPJ A;  1SBJ A;  2AWL A;  4W6G A;  2I7A A;  3AKB A;  3U0L A;  4GNK B;  2BE4 A;  1K9U A;  1AK8 A;  1R6P A;  4W6M A;  3GK1 A;  2L50 A;  3H1R A;  3TUY B;  3LVD A;  2AWM A;  3GJ1 A;  1NYA A;  3ED8 A;  2DDD A;  3SSH A;  1SNL A;  2BE6 A;  3NED A;  4EUL A;  1JFJ A;  2ZMW A;  4NDC A;  4PHM A;  1G33 A;  2LP2 A;  1DJI A;  3SVU A;  1Y6W A;  2O24 A;  1KWO C;  3I5G B;  4IK8 A;  1RTP 1;  2G6E A;  5AAN A;  1F71 A;  1OXD A;  5BT0 A;  2MJW B;  4EDS A;  4ZB1 A;  1NUB A;  1OXF A;  1IKU A;  3I5I C;  5DPJ A;  1LA3 A;  2GW4 B;  2WIQ A;  3BXC A;  4HRH A;  3CTN A;  2O29 A;  1MUX A;  4W7E A;  1GJY A;  1LA0 A;  1A03 A;  4PE4 A;  1J7R A;  1EMA A;  2K7O A;  4DIR A;  2AWJ A;  4PHJ A;  4PE0 A;  3E3R A;  1K95 A;  3K21 A;  5AEQ A;  4UPG A;  4H48 A;  2WOR A;  4F0Z B;  2H5P A;  1UHH A;  1A29 A;  2KI6 D;  1Y1X A;  2P4M A;  2ZO6 A;  2JU0 A;  4AQI A;  1RMO A;  2LAP A;  1NX0 A;  4W73 A;  4DCK A;  1XK4 C;  1Y1A A;  3LVA A;  1DMO A;  1WDC C;  1L2O B;  1J55 A;  1DF0 A;  2K7C A;  1F09 A;  2QLG B;  4I5N B;  4PPK A;  2HPW A;  2VVJ A;  1B1G A;  4W6T A;  1DJX A;  3BOW B;  1BOD A;  2VVH A;  4L13 A;  4E68 A;  2MBX A;  2H5R A;  4P5O E;  5EXU A;  3KCT A;  1RJV A;  1S6J A;  2M7N A;  1B9C A;  3A4U B;  1BLQ A;  2WHS A;  5FVI A;  4MRY A;  3LCP C;  4TZG A;  4OJ0 A;  2MHH A;  2ARL A;  4KAG A;  2F2O A;  4LJC A;  3SG5 A;  4QJ4 B;  1DF0 B;  1SCM B;  5PAL A;  1KYR A;  4ZF4 A;  4ORN A;  1CLL A;  2CTN A;  4UTS A;  3FS7 A;  1QY3 A;  1UWO A;  2HQW A;  2HCG A;  3WNX B;  1RMM A;  2RGI A;  4IK9 A;  1Q4A A;  2IB6 A;  5DKR A;  4JF9 A;  1NCZ A;  2G2S B;  5HLV A;  5FYX A;  3I5H C;  2ZFD A;  4OV2 A;  4W6S A;  5I2O A;  1GL4 A;  3DPW A;  2QLI A;  1D1O A;  1ZGO A;  5DTX A;  2H9W A;  1NWD A;  1PVB A;  2MLE C;  3NSO A;  4HVF A;  5DQB A;  2ISD A;  4AOM A;  1Q4D A;  1W7I B;  1SL8 A;  4CPV A;  3DQN A;  1S6C A;  3PIB A;  3TUY C;  2L4I A;  1B8C A;  1JBA A;  2A56 B;  1DJZ A;  3QRX A;  1MHO A;  3LK1 A;  5HZS A;  2Y1M A;  1CDM A;  3LL8 B;  4H3N A;  3DQO A;  1KK7 Y;  1UHN A;  5LK4 A;  2JNX A;  1QV1 A;  1BJF A;  1S36 A;  1JSA A;  3I5G C;  5LTP A;  2KQY A;  1OE9 B;  3CD9 A;  1KK7 Z;  1S6I A;  2WHT A;  2KQ6 A;  1ZUX A;  1EMK A;  3VRP A;  1TRF A;  3A8S A;  2KNE A;  5K89 A;  3VHT A;  1XFX O;  2CNP A;  2VZX A;  3DQM A;  1CNP A;  1CLM A;  5B8I B;  4P1Q A;  4TNC A;  5FVG A;  4ZFS A;  1KFU L;  4JQ0 D;  2Z6X A;  2Y4Q A;  3PN7 C;  1ZFS A;  2L5X B;  4W6O A;  4I5K A;  3VRN A;  3EVV A;  2EMN A;  3BYA A;  5BQL A;  1XFY O;  2EHB A;  2DUF A;  1YVL A;  1UUR A;  1Q73 A;  5HKY A;  2WND A;  1IQ3 A;  2PRU A;  1SKT A;  3DVM A;  3M0W A;  2MA2 A;  1KFX L;  2JUL A;  5H89 A;  5DKQ A;  3OP0 A;  5H87 A;  3SSK A;  1W7J B;  3LF3 A;  1Z1Q A;  2LVJ A;  1L2O C;  3SSP A;  4J89 A;  4OVN F;  2KYC A;  2YDZ A;  1QYF A;  1REC A;  5DRG A;  1XAE A;  4CFQ A;  1R2U A;  4QJ3 B;  2GX0 A;  5LTR A;  1BMO A;  2F33 A;  3E5T A;  4ICB A;  2K2A A;  5D7F A;  3HCM A;  1SK6 D;  1G4Y R;  3DQ6 A;  3PLF B;  1F4Q A;  3DQA A;  2QPT A;  4FQO A;  1IQ5 A;  5FVF A;  3M24 A;  1SCM C;  3AKA A;  2CXJ A;  4BDU A;  4XJK B;  1S6Z A;  3SSY A;  4PCW A;  3TS5 C;  1SL7 A;  2H5O A;  3U8C A;  1DVI A;  1NX2 A;  4KF5 A;  1SPY A;  2A46 A;  2WCB A;  2WSO A;  5EB6 A;  2G6X A;  3KCS A;  1XA5 A;  1B4C A;  1MXL C;  1G7K A;  3SV5 A;  3VIC A;  3DQC A;  3TZ1 A;  3DQU A;  1YHG A;  1MOV A;  1ZMZ A;  5J2O A;  3ST2 A;  2HGD A;  4USL A;  4L1I A;  2PMY A;  4A4B A;  2LLT A;  3BXA A;  3KO0 A;  3ST0 A;  2JT3 A;  4GGF C;  2BCA A;  1WLM A;  4HQ8 A;  2PAS A;  2WUR A;  3NEZ A;  3ZUF A;  1QYQ A;  2JTZ A;  4OCI A;  1XO5 A;  5KU1 A;  4W7A A;  2A48 A;  2LUC A;  1B47 A;  2M1K B;  1F70 A;  4ZF3 A;  3SVB A;  3GOF A;  2FJU B;  2A52 B;  4XVP A;  4W6B A;  3LA1 A;  4KW8 A;  4Q9W A;  1OMV A;  1QVI Y;  1B7T Y;  5I2Q A;  1BF5 A;  4JPZ B;  1B8R A;  2JQ6 A;  2IB5 A;  4Q7T A;  3FIA A;  4DKN A;  1JFK A;  1QVI Z;  3SVE A;  2H6V A;  3NSI A;  1S3P A;  2I2R E;  1TNP A;  3LK0 A;  4B30 B;  3CLN A;  2LCP A;  3CBE A;  4W6D A;  2ZND A;  3LS3 A;  4W77 A;  1TNX A;  1QIV A;  4MRX A;  1IJ5 A;  3JVT B;  4H47 A;  1C7V A;  3EKJ A;  2WIS A;  1QXT A;  1WLZ A;  3AI4 A;  1UHI A;  1S5G Y;  2JTT A;  3DF0 B;  3PSR A;  3LSA A;  3BXB A;  2C9I A;  4M2P A;  5DTL A;  1CLB A;  4KF4 A;  5HW9 A;  2PVB A;  2QRF A;  1S5G Z;  4ZIN A;  4W6I A;  3BUW B;  2CCM A;  1U5I A;  5CSN A;  2KI4 B;  2FCE A;  1EG3 A;  4H3M A;  4LJD A;  1K9P A;  5AQB B;  4YI8 A;  1Y0V H;  2DUG A;  2LE9 B;  3SVC A;  2VAD A;  3OB1 B;  4LJB A;  4KGE A;  4W7D A;  3LLE A;  1JUO A;  1QS7 A;  1ZUZ A;  4I5L B;  2IS9 A;  4XGY A;  3U0K A;  1N0Y A;  3NT3 A;  1BR4 B;  4KW9 A;  1M39 A;  3SVR A;  4M2Q A;  4IK4 A;  5I8N A;  4BY4 A;  3WXA A;  4AR7 A;  3DVE A;  1PSR A;  3CZT X;  4EDO A;  2DUH A;  2LVK A;  2G5Z B;  2SCP A;  3VGO A;  3OB2 B;  1U5I B;  3WHU B;  2QU1 A;  2DOQ A;  2KI6 C;  3JTD B;  3AKO A;  1QLS A;  2PAL A;  1CV7 A;  5DPI A;  1K96 A;  2EMD A;  1UHK A;  4I5J A;  1LIN A;  1EMM A;  3D0Y B;  3G9A A;  2KYF A;  3KF9 A;  1RRO A;  3DQE A;  3PN7 B;  2QLG A;  2YE1 A;  2VRG A;  3BOW A;  1ALV A;  4XOV A;  5HZU A;  5ER4 X;  2G6Y A;  1IG5 A;  4W7C A;  2NLN A;  2M1U A;  2PXS A;  2F2P A;  4LW5 A;  2H61 C;  1CTR A;  4WRI A;  4NQG A;  1EG4 A;  2GW3 A;  2AWK A;  2KGB C;  4W6U A;  2H2K A;  3CGA A;  5BTT A;  2Q91 A;  2HF5 A;  1SRA A;  4MN0 A;  1N2D A;  4OGS A;  4MEW A;  3DQ4 A;  2BCB A;  5AXI A;  4PE1 A;  3NF0 A;  4C0L A;  2KSP A;  2BBN A;  2K7B A;  3LVC A;  4P76 A;  1KQM B;  4W6P A;  4KF5 C;  1QJT A;  1RFJ A;  1F0B A;  1J7O A;  2ZRS A;  2JC2 A;  2NCO A;  4HRE E;  3UG0 A;  1TNW A;  5BTT B;  2JPT A;  1G8I A;  2L98 A;  4U2V A;  1CDP A;  2QZ0 A;  1CDL A;  1FF1 A;  1UUS A;  2M7L A;  1JC0 A;  2OKY A;  2M8U A;  4NDD A;  1EJ3 A;  1XFW O;  4GGF A;  1V1F A;  1EMG A;  1ODB A;  2L0P A;  2Z1O A;  2DD9 A;  4DXQ A;  3TS5 B;  3JVT C;  2G2B A;  2OS8 B;  2JWW A;  4ORC B;  2M29 A;  1YVH A;  2LC5 A;  4KPI A;  4JGE A;  3DQK A;  3CS1 A;  3LF4 B;  3NXA A;  3DVK A;  1PVA A;  1Q4C A;  4U8D A;  3PAL A;  1EMB A;  4N1G A;  2O5G A;  4R6B A;  1UIS A;  4W6A A;  3ICB A;  2KI4 C;  4DXP A;  3H1O A;  4W6H A;  4MZJ A;  4OY4 A;  4L9M A;  4W72 A;  4DXO A;  2OTB A;  4I2Y A;  2WCE A;  3OSR A;  4NWS A;  1DJG A;  2BL0 C;  4KEX A;  4PAL A;  3SVS A;  3U8A A;  2B1U A;  1MR8 A;  4GPL B;  3KEV A;  2WCF A;  3BUX B;  1QV0 A;  1HCJ A;  5DPG A;  1WRL A;  4J8A A;  1SL9 A;  1QXP A;  1OSA A;  1S26 D;  1J7P A;  4LJD C;  3JTD C;  2ZN9 A;  3NT9 A;  2LLU A;  1DTL A;  1J7Q A;  3K1K A;  2AH8 A;  2HQK A;  4IK3 A;  2QLH A;  3EVR A;  1KCY A;  3DQH A;  3OGO A;  2ZNE A;  1KK8 B;  4B5Y A;  2KAV A;  4ORB B;  3VRQ A;  1DJY A;  2AMI A;  2GGM A;  1EMC A;  4C0J A;  1NP8 A;  3TDU A;  4PHK A;  2AHA A;  4DKM A;  3ZUJ A;  1YUR A;  3A8R A;  3SVD A;  1JWD A;  4W7R A;  1J1E A;  2BKH B;  1RMP A;  4ZCU A;  2M3W A;  1IWQ A;  5HYD A;  3GJ2 A;  5ER5 A;  3SG4 A;  3SG3 A;  1CB1 A;  1BR1 B;  3FWB A;  4MSP A;  2ZKM X;  2I18 A;  4A4C A;  4PFE A;  1BT6 A;  4R1E A;  1EH2 A;  1NX3 A;  4XJK A;  5EJU A;  3CR2 A;  2TN4 A;  1KQM C;  2B3P A;  2WOS A;  2I94 A;  1Z1P A;  4JFG A;  5G08 A;  4R6D A;  4GUK A;  4ZIO A;  2P6B B;  3O78 A;  1VRK A;  5JOL A;  1QAS A;  4HQC A;  1DT7 B;  1TCO B;  3SS0 A;  2H61 A;  3VK1 A;  4AS8 A;  2GX2 A;  2DUI A;  3W1D A;  5EXC I;  1JF0 A;  1F54 A;  5AFP A;  1GGX A;  1K90 D;  1LXF C;  1CMF A;  4CID A;  4Q7R A;  3TDZ A;  1YTZ C;  4MBE A;  2CT9 A;  2WHU A;  3EK7 A;  2LVI A;  2OS8 C;  1QAT A;  3PJ5 A;  1IJ6 A;  1DJH A;  1KSO A;  2KFF A;  2A53 B;  3RM1 A;  3CFF A;  2HJO A;  3CWG A;  3W1C A;  1FW4 A;  1TNQ A;  3PJB A;  4N1F A;  4Z4K A;  4KA9 A;  1HUY A;  4GGN A;  4OKH A;  3PM8 A;  4GBA A;  4W7X A;  1QX2 A;  1ALW A;  1OZO A;  5LTQ A;  5CPV A;  4AQJ A;  1F4O A;  2QT2 A;  3IR8 A;  5DY6 A;  4B30 A;  1CKK A;  2JOJ A;  1AP4 A;  1W7S A;  4HQ9 A;  2BEC A;  1M45 A;  3BUM B;  2ZN8 A;  4XL5 A;  3DQ7 A;  1SYM A;  5DPH A;  2G16 B;  3MGF A;  2VVI A;  1KYS A;  1XVJ A;  1H8B A;  4JWQ A;  2YFP A;  5EHU A;  2CBL A;  2JAD A;  3OSQ A;  3SVO A;  1FPW A;  1YX7 A;  2E30 A;  4Z4M A;  3DF0 A;  4GOB A;  2QAC A;  1K2H A;  1BG1 A;  3F45 A;  1F8H A;  1B7T Z;  3DQL A;  4GF6 B;  3WLD A;  2K7D A;  1A75 B;  2LP3 A;  4XOW A;  3P28 A;  2COL B;  3CB9 A;  2SAS A;  4RTC A;  4OHS A;  2IOV A;  2BBM A;  1CM4 A;  4QJ5 B;  4PPL A;  5DU0 A;  4MZL A;  2MLF C;  1OMR A;  3M22 A;  4IK5 A;  1IRJ A;  1KK8 C;  4ZBL A;  1XFZ O;  1OQP A;  1C7W A;  4DXN A;  1KFX S;  4W6R A;  4W76 A;  1YUT A;  3O2P A;  4RYS A;  5H88 A;  1YJ2 A;  1GQM A;  1KQV A;  1PAL A;  2A54 B;  3IQO A;  3DQ9 A;  4PDZ A;  4JEO A;  1C4F A;  4JC2 A;  1CFP A;  5IBW A;  1YUU A;  1JBY A;  4OR9 B;  5KSZ A;  3EVP A;  2OPO A;  2A4J A;  1CFF A;  5I2L A;  5DKN A;  2BL0 B;  1XA9 A;  3D0Y A;  3NSL A;  3KHE A;  1K8U A;  3BX9 A;  3EK4 A;  4GAO A;  1F55 A;  4IL1 A;  1MWN A;  1ZGQ A;  3DQ8 A;  2HPS A;  2HGY A;  3OX6 A;  4Q04 A;  2L2E A;  2LHL A;  3DVJ A;  1RK9 A;  3E5W A;  2HET A;  4ZF5 A;  2G3O A;  5DQM A;  3DQJ A;  1FI5 A;  1YRU B;  1CFC A;  5J3X A;  1CM1 A;  5TNC A;  1AVS A;  1KSM A;  2Q57 A;  3SSL A;  3RWT A;  3ST3 A;  2DUE A;  2KAX A;  4YGD B;  1XYD A;  2DDC A;  1IGV A;  2MAZ A;  2Q6P A;  3SIA A;  3U0M A;  3DQ3 A;  5KTG A;  1XMZ A;  1W7T A;  5HLO A;  1DGU A;  3I19 A;  1ZAC A;  1KP5 A;  4EMQ A;  3BXK A;  3D10 A;  4XYN A;  3CGL A;  2JT0 A;  3CD1 A;  2V4E C;  1TCF A;  2M9G A;  2POX A;  4DRW A;  4Q9X A;  2VAE A;  2OTG B;  2Y1N A;  1NSH A;  3OX5 A;  3DD4 A;  1MF8 B;  1EXR A;  2JZI A;  1WY9 A;  1MXE A;  3FWC A;  4W69 A;  4PPJ A;  1SR6 B;  5HKZ A;  2FL1 A;  1JC2 A;  5HZT A;  3BUO B;  1YR5 A;  2E6W A;  3IQQ A;  5EBJ A;  3TMT A;  3P8U A;  4RYW A;  1JBZ A;  3VRO A;  4W6L A;  3AAK A;  1PK0 D;  2KAY A;  3WCK A;  2KHN A;  1HT9 A;  2ZO7 A;  1NCX A;  2HQ8 A;  4W6F A;  1M46 A;  1NPQ A;  1XQM A;  5DTZ A;  1WRZ A;  1M63 B;  1E8A A;  3C1V A;  2LAN A;  4HE4 A;  4DS7 A;  4MLW A;  2FZU A;  2Z6Y A;  1QIW A;  3NSK A;  2KGR A;  1X02 A;  3DQ2 A;  3OHM B;  2NCP A;  3GK2 A;  5DRF A;  3GEX A;  3IP2 A;  4W6C A;  1EML A;  3DQD A;  4W7F A;  4DUQ A;  1EL4 A;  2PXW A;  5JJG A;  4IK1 A;  2GGZ A;  1TTX A;  1OZS A;  3RWA A;  1YHH A;  3SSV A;  2K8M B;  5HBD A;  1QLK A;  2NXQ A;  2BCX A;  3SJS A;  4N5X A;  2OTE A;  5HKW A;  3U8P A;  1EMF A;  2EMO A;  2IE2 A;  2HQZ A;  2YE0 A;  1DGV A;  4ORA B;  3GL4 A;  4HSZ A;  1GGZ A;  2F3Y A;  3TMR A;  3DQF A;  3SVN A;  3TDI A;  3BUN B;  3ZWH A;  1Q4B A;  1YX8 A;  2LHI A;  3O6B A;  1Q80 A;  1JC1 A;  1K93 D;  1J1D A;  2G9B A;  1UP5 A;  4P2Y B;  4YGA A;  1XFU O;  1LKJ A;  5CSJ A;  1C07 A;  1ZGP A;  2KBI A;  2M97 A;  4ANJ A;  1TN4 A;  3AAJ A;  4LQT A;  2ZMU A;  1GGW A;  4GFT A;  3SIB A;  1AJ4 A;  4KW4 A;  3I5F B;  1YFP A;  2C9J A;  1HQV A;  2B3Q A;  5KTY A;  4IZN A;  1YZW A;  2LMT A;  4PHN A;  1MQ1 A;  1RWY A;  2O2B A;  2L51 A;  3ZNI A;  2K2F A;  2BTJ A;  2F8P A;  5T3I A;  2A47 A;  1JF2 A;  4NDB A;  4YRU A;  4Q7U A;  4W6J A;  5GQQ C;  2EC6 B;  4WQ2 A;  4DXI A;  5EXB A;  1QX5 B;  3V3D A;  1KYP A;  2QLE A;  1SMG A;  5FHV A;  3O77 A;  2FCD A;  2K0J A;  1AHR A;  4BY5 A;  1XSS A;  3CFH A;  3DPZ A;  3IF7 A;  3RLZ A;  2HFC A;  4JRB A;  1NCY A;  2OTG C;  1EME A;  3DQI A;  1S1E A;  2KDH A;  4W6N A;  1YJF A;  3SG7 A; 
#chains in the Genus database with same CATH topology
 3ST4 A;  3VHT B;  1SR6 C;  3SG6 A;  2M49 B;  1Y1U A;  1DEK A;  1H4B A;  5F9G A;  2F3Z A;  2AAO A;  3UFZ A;  3HX4 A;  2BKI B;  3R72 A;  1QYO A;  3VRR A;  2LVV A;  2H8Q A;  1MYW A;  2LMV A;  1TUJ A;  1A2X A;  4JKT A;  4H3L A;  4TZA A;  3O4Y A;  3EK8 A;  1TIZ A;  3SG2 A;  1YHI A;  2G3D B;  2V4E A;  4YBH B;  2M0R A;  3KPX A;  5HZO A;  1TOP A;  1AUI B;  2ZRT A;  4EN1 A;  1KWO B;  4ZCV A;  1M31 A;  2D8N A;  1BFP A;  1K94 A;  1L7Z A;  2PSR A;  4FTG A;  1K9K A;  1V1G A;  1N65 A;  4C0K A;  3S05 A;  1W7U A;  3WHT B;  3IVT A;  1B8L A;  5AER A;  3R1V A;  2LNK A;  1H4U A;  4MVF A;  3I5I B;  2WSN A;  5EB7 A;  3MSE B;  4CLN A;  2GV5 A;  4INX A;  1CMG A;  1LVC D;  3NHT A;  1YUS A;  5HGE A;  4ETO A;  3PAT A;  2V53 A;  1NIW A;  1PRW A;  2A50 B;  1XK4 A;  3AI5 A;  2OKW A;  1OXE A;  1B9A A;  1MOU A;  5CSF A;  3CFA A;  1TUZ A;  2H5Q A;  2V4E B;  5CSI A;  3BFB A;  3PFV A;  4W74 A;  1W9Z A;  2OJK A;  3PJ7 A;  2EGD A;  4N3D A;  3GK4 X;  2KFH A;  1A4P A;  1YRT B;  2LLS A;  2NZ0 A;  3ADF A;  2O60 A;  1GFL A;  3WLC A;  1A75 A;  4CFR A;  1H6R A;  2HRS A;  3H4S E;  3BQ3 A;  3PJI A;  2KOT A;  5HL1 A;  4KGF A;  2JT8 A;  3B86 A;  2K61 A;  1OMD A;  3DQ1 A;  1WDC B;  1SCV A;  2Q4U A;  1SW8 A;  4WQ3 A;  3EKH A;  1Q4E A;  3CR4 X;  2OGR A;  3GB3 A;  4JD9 A;  1ZOT B;  1UHJ A;  1NX1 A;  5EL2 A;  2Z6Z A;  1DJW A;  2KFG A;  1FI6 A;  4MZK A;  4HRG A;  2FWQ A;  5F6T A;  3DPX A;  1KFU S;  3I5F C;  3CAB A;  4PE7 A;  5D69 A;  3UNW A;  2MRD A;  5DTY A;  1IH0 A;  4LQU A;  2WC8 A;  4OQW A;  3S0B A;  2Y0G A;  2AUC A;  4W6K A;  2LM5 A;  4YGC B;  1BU3 A;  4YI9 A;  1QX7 A;  1CFD A;  3UO9 A;  1FBV A;  2R2I A;  3U0N A;  3SST A;  1AJ5 A;  4YGE B;  2LUX A;  1GM0 A;  3E5V A;  2JXC A;  1OOJ A;  3ZUL A;  2EC6 C;  5DIC A;  2LMU A;  3CR5 X;  2L4H A;  4YGB B;  4M2O A;  4GES B;  2DD7 A;  3DQ5 A;  2JRF A;  2Y5I A;  4L12 A;  4J88 A;  4W75 A;  4DXM A;  1RM9 A;  2ICR A;  2LV7 A;  1RRX A;  1SY9 A;  3EVU A;  4D1E A;  2JXL A;  1QTX A;  1CDN A;  3I5H B;  2RH7 A;  2WCH A;  3SRY A;  1WRK A;  2KBM A;  3ZTF A;  3DY9 A;  1PSB A;  1BOC A;  2JNF A;  1PUL A;  2FOT A;  1XFV O;  5BPJ A;  1SBJ A;  2AWL A;  4W6G A;  2I7A A;  2GTE A;  3AKB A;  3U0L A;  4GNK B;  2BE4 A;  3S0A A;  1K9U A;  1AK8 A;  1R6P A;  4W6M A;  3GK1 A;  2L50 A;  3H1R A;  3TUY B;  3LVD A;  2AWM A;  3GJ1 A;  2ERB A;  3DYE A;  1NYA A;  3ED8 A;  2DDD A;  3SSH A;  1SNL A;  2BE6 A;  3NED A;  4EUL A;  1JFJ A;  2ZMW A;  4NDC A;  3SS3 A;  4PHM A;  1G33 A;  2LP2 A;  1DJI A;  3SVU A;  1Y6W A;  2O24 A;  1KWO C;  3I5G B;  4IK8 A;  1RTP 1;  2G6E A;  5AAN A;  1F71 A;  1OXD A;  5BT0 A;  2MJW B;  4EDS A;  2QDI A;  4ZB1 A;  1NUB A;  1OXF A;  1IKU A;  3I5I C;  5DPJ A;  1LA3 A;  3CYZ A;  2GW4 B;  2WIQ A;  3BXC A;  4HRH A;  3CTN A;  2O29 A;  1MUX A;  4W7E A;  1GJY A;  1LA0 A;  1A03 A;  4PE4 A;  1J7R A;  1EMA A;  2K7O A;  4DIR A;  2AWJ A;  4PHJ A;  4PE0 A;  3E3R A;  1K95 A;  3K21 A;  5AEQ A;  4UPG A;  4H48 A;  2WOR A;  4F0Z B;  2H5P A;  3S0G A;  1UHH A;  1A29 A;  2KI6 D;  1Y1X A;  2P4M A;  2ZO6 A;  2JU0 A;  4AQI A;  1RMO A;  3L4A A;  2LAP A;  3R1O A;  1NX0 A;  4W73 A;  4DCK A;  1XK4 C;  1Y1A A;  3LVA A;  1DMO A;  1WDC C;  2QEO A;  1L2O B;  1J55 A;  1DF0 A;  2K7C A;  1F09 A;  2QLG B;  4I5N B;  4PPK A;  2HPW A;  2VVJ A;  1B1G A;  4W6T A;  1DJX A;  3BOW B;  1BOD A;  2VVH A;  4L13 A;  4E68 A;  2MBX A;  3D76 A;  4KYN A;  2H5R A;  4P5O E;  2K60 A;  5EXU A;  3KCT A;  1RJV A;  1S6J A;  2M7N A;  1B9C A;  3A4U B;  1BLQ A;  2WHS A;  5FVI A;  4MRY A;  3LCP C;  4TZG A;  4OJ0 A;  2MHH A;  2ARL A;  4KAG A;  2F2O A;  4LJC A;  3SG5 A;  4QJ4 B;  1DF0 B;  1SCM B;  5PAL A;  1KYR A;  4ZF4 A;  4ORN A;  1CLL A;  2CTN A;  4UTS A;  2PQL A;  3FS7 A;  1QY3 A;  1UWO A;  2HQW A;  2HCG A;  3WNX B;  1RMM A;  2RGI A;  4IK9 A;  1Q4A A;  2IB6 A;  5DKR A;  4JF9 A;  1NCZ A;  2G2S B;  5HLV A;  5FYX A;  3I5H C;  2ZFD A;  4OV2 A;  4W6S A;  5I2O A;  1GL4 A;  3DPW A;  1LS8 A;  2QLI A;  1D1O A;  3B87 A;  2WCK A;  1ZGO A;  5DTX A;  2H9W A;  1NWD A;  1PVB A;  2MLE C;  3NSO A;  4HVF A;  5DQB A;  2ISD A;  2L5Y A;  4AOM A;  1Q4D A;  1W7I B;  1SL8 A;  4CPV A;  3DQN A;  1S6C A;  3PIB A;  3TUY C;  2L4I A;  1B8C A;  1JBA A;  2QEB A;  2A56 B;  1DJZ A;  3QRX A;  1MHO A;  3LK1 A;  3V2L A;  5HZS A;  2Y1M A;  1TWO A;  1CDM A;  3LL8 B;  4H3N A;  3DQO A;  1KK7 Y;  3FE6 A;  1UHN A;  5LK4 A;  2JNX A;  1QV1 A;  1BJF A;  1S36 A;  1JSA A;  3I5G C;  5LTP A;  2KQY A;  1OE9 B;  3CD9 A;  3D78 A;  1KK7 Z;  1S6I A;  2WHT A;  2KQ6 A;  1ZUX A;  1EMK A;  3VRP A;  1TRF A;  3A8S A;  2KNE A;  5K89 A;  3VHT A;  1XFX O;  2CNP A;  3B6X A;  2VZX A;  3DQM A;  1CNP A;  1CLM A;  5B8I B;  4P1Q A;  4TNC A;  4OZD A;  5FVG A;  4ZFS A;  1KFU L;  3OGN A;  4JQ0 D;  3K1E A;  2Z6X A;  2Y4Q A;  3PN7 C;  1ZFS A;  2L5X B;  4W6O A;  4I5K A;  3VRN A;  3EVV A;  2EMN A;  3BYA A;  5BQL A;  1XFY O;  2EHB A;  2DUF A;  1YVL A;  1UUR A;  1Q73 A;  5HKY A;  2WND A;  1IQ3 A;  2PRU A;  1SKT A;  1DQE A;  3DVM A;  3M0W A;  2MA2 A;  1KFX L;  2JUL A;  5H89 A;  5DKQ A;  3OP0 A;  5H87 A;  3SSK A;  1W7J B;  3LF3 A;  1Z1Q A;  3S0E A;  2LVJ A;  1L2O C;  3SSP A;  4J89 A;  4OVN F;  2KYC A;  2YDZ A;  3RZS A;  1QYF A;  1REC A;  5DRG A;  2P70 A;  1XAE A;  4CFQ A;  1R2U A;  4QJ3 B;  2GX0 A;  5LTR A;  1BMO A;  2F33 A;  3E5T A;  4ICB A;  2K2A A;  5D7F A;  3HCM A;  1SK6 D;  1G4Y R;  3DQ6 A;  3PLF B;  1F4Q A;  3DQA A;  2QPT A;  4FQO A;  1IQ5 A;  3L47 A;  5FVF A;  3M24 A;  1SCM C;  3AKA A;  2CXJ A;  4BDU A;  4XJK B;  1S6Z A;  3SSY A;  4PCW A;  3TS5 C;  1SL7 A;  2H5O A;  3U8C A;  1DVI A;  1NX2 A;  4KF5 A;  1SPY A;  2A46 A;  2WCB A;  2WSO A;  5EB6 A;  2G6X A;  3KCS A;  1XA5 A;  1B4C A;  1MXL C;  1G7K A;  3SV5 A;  3VIC A;  3DQC A;  3TZ1 A;  3DQU A;  1YHG A;  1MOV A;  1ZMZ A;  5J2O A;  3ST2 A;  2HGD A;  4USL A;  4L1I A;  2PMY A;  4A4B A;  2LLT A;  3BXA A;  3KO0 A;  3ST0 A;  2JT3 A;  3QME A;  4GGF C;  2BCA A;  1WLM A;  4HQ8 A;  2PAS A;  2WUR A;  3NEZ A;  3ZUF A;  1QYQ A;  1ORG A;  2JTZ A;  4OCI A;  1XO5 A;  5KU1 A;  4W7A A;  2A48 A;  2LUC A;  1B47 A;  2M1K B;  1F70 A;  4ZF3 A;  3SVB A;  2WCL A;  3GOF A;  2FJU B;  2A52 B;  4XVP A;  4W6B A;  3LA1 A;  4KW8 A;  4Q9W A;  1OMV A;  1QVI Y;  1B7T Y;  5I2Q A;  1BF5 A;  4JPZ B;  1B8R A;  2JQ6 A;  2IB5 A;  4Q7T A;  3FIA A;  4DKN A;  1JFK A;  1QVI Z;  3SVE A;  2H6V A;  3NSI A;  1S3P A;  2I2R E;  1TNP A;  3LK0 A;  4B30 B;  3S0D A;  3CLN A;  2LCP A;  3CBE A;  3BFA A;  4W6D A;  2ZND A;  3LS3 A;  4W77 A;  1TNX A;  1QIV A;  4MRX A;  1IJ5 A;  3JVT B;  4H47 A;  1C7V A;  3EKJ A;  2WIS A;  1QXT A;  1WLZ A;  3AI4 A;  1UHI A;  1S5G Y;  2JTT A;  3DF0 B;  3PSR A;  3LSA A;  3BXB A;  2C9I A;  4M2P A;  5DTL A;  1CLB A;  4KF4 A;  5HW9 A;  2PVB A;  2QRF A;  3B7A A;  1S5G Z;  4ZIN A;  4W6I A;  3BUW B;  2CCM A;  3BJH A;  1U5I A;  5CSN A;  2KI4 B;  2FCE A;  1EG3 A;  4H3M A;  4LJD A;  1K9P A;  5AQB B;  4YI8 A;  1Y0V H;  2DUG A;  2LE9 B;  3SVC A;  2VAD A;  3OB1 B;  4LJB A;  4KGE A;  4W7D A;  3LLE A;  1JUO A;  1QS7 A;  1ZUZ A;  4I5L B;  2IS9 A;  4XGY A;  3U0K A;  1N0Y A;  3NT3 A;  1BR4 B;  4KW9 A;  1M39 A;  3SVR A;  4M2Q A;  4IK4 A;  5I8N A;  4BY4 A;  1C3Y A;  3WXA A;  4AR7 A;  3DVE A;  1PSR A;  3CZT X;  4EDO A;  2DUH A;  2LVK A;  2G5Z B;  2SCP A;  3VGO A;  3OB2 B;  1U5I B;  3WHU B;  2QU1 A;  2DOQ A;  2KI6 C;  3JTD B;  3AKO A;  1QLS A;  2PAL A;  1CV7 A;  5DPI A;  1K96 A;  2EMD A;  1UHK A;  4I5J A;  1LIN A;  3DXL A;  1EMM A;  3D0Y B;  3G9A A;  2KYF A;  3D75 A;  3KF9 A;  1RRO A;  3DQE A;  3PN7 B;  2QLG A;  2QEV A;  2YE1 A;  2VRG A;  3BOW A;  1ALV A;  4XOV A;  5HZU A;  5ER4 X;  2G6Y A;  1IG5 A;  4W7C A;  2NLN A;  2M1U A;  2PXS A;  2F2P A;  4LW5 A;  2H61 C;  1CTR A;  4WRI A;  4NQG A;  1EG4 A;  2GW3 A;  2AWK A;  2KGB C;  4W6U A;  2H2K A;  3CGA A;  5BTT A;  2Q91 A;  2HF5 A;  1SRA A;  4MN0 A;  1N2D A;  4OGS A;  4MEW A;  3DQ4 A;  2BCB A;  5AXI A;  4PE1 A;  3NF0 A;  4C0L A;  1Z4H A;  2KSP A;  2BBN A;  2K7B A;  3LVC A;  4P76 A;  1KQM B;  4W6P A;  4KF5 C;  1QJT A;  1Z2C B;  1RFJ A;  1F0B A;  1J7O A;  2ZRS A;  2JC2 A;  2NCO A;  4HRE E;  3UG0 A;  1TNW A;  5BTT B;  2JPT A;  1G8I A;  2L98 A;  4U2V A;  1CDP A;  2QZ0 A;  3FE8 A;  1CDL A;  1FF1 A;  1UUS A;  2M7L A;  1JC0 A;  2OKY A;  2M8U A;  4NDD A;  1EJ3 A;  1XFW O;  4GGF A;  1V1F A;  1EMG A;  1ODB A;  2L0P A;  2Z1O A;  4FQT A;  2DD9 A;  4DXQ A;  3TS5 B;  3JVT C;  2G2B A;  2OS8 B;  2JWW A;  4ORC B;  2M29 A;  1YVH A;  3FE9 A;  2LC5 A;  4KPI A;  4JGE A;  3DQK A;  3CS1 A;  1DEL A;  3LF4 B;  3NXA A;  3DVK A;  1PVA A;  1Q4C A;  4U8D A;  3PAL A;  1EMB A;  4N1G A;  2O5G A;  4R6B A;  1UIS A;  4W6A A;  3ICB A;  2KI4 C;  4DXP A;  3H1O A;  3CDN A;  4W6H A;  4MZJ A;  4OY4 A;  4L9M A;  4W72 A;  4DXO A;  2OTB A;  4I2Y A;  2WCE A;  3OSR A;  5FI2 A;  3D73 A;  4NWS A;  1DJG A;  2BL0 C;  3VB1 A;  4KEX A;  4PAL A;  3SVS A;  3U8A A;  2B1U A;  1MR8 A;  4GPL B;  3KEV A;  2WCF A;  1OOF A;  3BUX B;  1QV0 A;  1HCJ A;  5DPG A;  1WRL A;  4J8A A;  1SL9 A;  1QXP A;  1OSA A;  1S26 D;  1J7P A;  4LJD C;  3JTD C;  2ZN9 A;  3NT9 A;  2LLU A;  1DTL A;  1J7Q A;  3S0F A;  3K1K A;  2AH8 A;  2HQK A;  4IK3 A;  2QLH A;  1QWV A;  3EVR A;  1KCY A;  2WCJ A;  3DQH A;  3OGO A;  2ZNE A;  1KK8 B;  4B5Y A;  2KAV A;  4ORB B;  3VRQ A;  1DJY A;  2AMI A;  1T14 A;  2GGM A;  1EMC A;  4C0J A;  1NP8 A;  3TDU A;  4PHK A;  2AHA A;  4DKM A;  3ZUJ A;  1YUR A;  3A8R A;  3SVD A;  1JWD A;  4W7R A;  1J1E A;  2BKH B;  1RMP A;  4ZCU A;  2M3W A;  1IWQ A;  5HYD A;  3GJ2 A;  5ER5 A;  3SG4 A;  3SG3 A;  1CB1 A;  1BR1 B;  3FWB A;  4MSP A;  1OOI X;  2ZKM X;  2I18 A;  2BAP A;  2WCM A;  4A4C A;  4PFE A;  1BT6 A;  2H8V A;  4R1E A;  1EH2 A;  1NX3 A;  4XJK A;  5EJU A;  3CR2 A;  2TN4 A;  1KQM C;  2KPH A;  3SS4 A;  2B3P A;  2WOS A;  2I94 A;  3D77 A;  1Z1P A;  4JFG A;  5G08 A;  4R6D A;  4GUK A;  4ZIO A;  2P6B B;  3O78 A;  1VRK A;  5JOL A;  1QAS A;  4HQC A;  3BFH A;  1DT7 B;  1TCO B;  3SS0 A;  2H61 A;  3VK1 A;  4AS8 A;  2GX2 A;  3SS5 A;  2DUI A;  3W1D A;  5EXC I;  1JF0 A;  2JPO A;  1F54 A;  5AFP A;  1GGX A;  3R1P A;  1K90 D;  1LXF C;  1CMF A;  4CID A;  4Q7R A;  3TDZ A;  1XFR A;  1YTZ C;  4MBE A;  2CT9 A;  2WHU A;  3EK7 A;  2LVI A;  2OS8 C;  1QAT A;  3PJ5 A;  1IJ6 A;  1DJH A;  3CZ0 A;  1KSO A;  2KFF A;  2A53 B;  3RM1 A;  3CFF A;  2HJO A;  4INW A;  3CWG A;  3W1C A;  1FW4 A;  1TNQ A;  3PJB A;  4N1F A;  4Z4K A;  4KA9 A;  1HUY A;  4GGN A;  4OKH A;  3PM8 A;  4GBA A;  4W7X A;  1QX2 A;  1ALW A;  1OZO A;  5LTQ A;  5CPV A;  1DC1 A;  4AQJ A;  1F4O A;  2QT2 A;  3IR8 A;  5DY6 A;  3B88 A;  4B30 A;  1OW4 A;  1CKK A;  2JOJ A;  1AP4 A;  1W7S A;  4HQ9 A;  2BEC A;  1M45 A;  3BUM B;  2ZN8 A;  4XL5 A;  3DQ7 A;  1SYM A;  5DPH A;  2G16 B;  2WC6 A;  3MGF A;  2VVI A;  1KYS A;  1XVJ A;  1H8B A;  4JWQ A;  2YFP A;  5EHU A;  2CBL A;  2JAD A;  3OSQ A;  3SVO A;  1FPW A;  1YX7 A;  2E30 A;  4Z4M A;  3DF0 A;  4GOB A;  2QAC A;  1K2H A;  1BG1 A;  3F45 A;  1F8H A;  1B7T Z;  3D74 A;  3DQL A;  4GF6 B;  3WLD A;  2K7D A;  1A75 B;  2LP3 A;  4XOW A;  3P28 A;  2COL B;  3CB9 A;  5FI6 A;  2SAS A;  4RTC A;  4OHS A;  2IOV A;  2BBM A;  1CM4 A;  4QJ5 B;  4PPL A;  5DU0 A;  4MZL A;  2MLF C;  1OMR A;  3M22 A;  4IK5 A;  1IRJ A;  1KK8 C;  2L2C A;  4ZBL A;  3N7H A;  1XFZ O;  1OQP A;  1C7W A;  4DXN A;  1KFX S;  3NGV A;  4W6R A;  4W76 A;  3PM2 A;  1YUT A;  3O2P A;  4RYS A;  5H88 A;  1YJ2 A;  1GQM A;  1KQV A;  1PAL A;  2A54 B;  3IQO A;  3DQ9 A;  4PDZ A;  4JEO A;  1C4F A;  4JC2 A;  1CFP A;  3O4X A;  5IBW A;  2QEH A;  1YUU A;  1JBY A;  4OR9 B;  5KSZ A;  3EVP A;  2OPO A;  2A4J A;  1CFF A;  5I2L A;  5DKN A;  2BL0 B;  1XA9 A;  3D0Y A;  1C3Z A;  3NSL A;  3KHE A;  1K8U A;  3BX9 A;  3EK4 A;  4GAO A;  1F55 A;  4IL1 A;  1MWN A;  1ZGQ A;  3DQ8 A;  2HPS A;  2HGY A;  3OX6 A;  4Q04 A;  3Q8I A;  2L2E A;  2LHL A;  3DVJ A;  2BNX A;  1RK9 A;  3E5W A;  2HET A;  1SSE B;  3EG5 B;  4F7F A;  4ZF5 A;  2G3O A;  5DQM A;  3DQJ A;  1FI5 A;  1YRU B;  3DZT A;  1CFC A;  5J3X A;  1CM1 A;  5TNC A;  1AVS A;  1KSM A;  2Q57 A;  3SSL A;  3RWT A;  3ST3 A;  2DUE A;  2KAX A;  4YGD B;  1XYD A;  2WC5 A;  2DDC A;  1IGV A;  2MAZ A;  2Q6P A;  3SIA A;  3U0M A;  3DQ3 A;  5KTG A;  1XMZ A;  1W7T A;  5HLO A;  1DGU A;  3I19 A;  3CZ2 A;  1ZAC A;  1KP5 A;  4EMQ A;  1P28 A;  3BXK A;  3D10 A;  4XYN A;  3CGL A;  2JT0 A;  3CD1 A;  2V4E C;  1TCF A;  2M9G A;  2POX A;  4DRW A;  4Q9X A;  2VAE A;  2OTG B;  2Y1N A;  1NSH A;  3OX5 A;  3DD4 A;  1MF8 B;  1EXR A;  2JZI A;  1WY9 A;  1MXE A;  3FWC A;  4W69 A;  4PPJ A;  3L4L A;  1SR6 B;  5HKZ A;  2FL1 A;  1JC2 A;  5HZT A;  3BUO B;  1YR5 A;  2E6W A;  3IQQ A;  5EBJ A;  1OOH A;  3P8U A;  3TMT A;  4RYW A;  1JBZ A;  3VRO A;  4W6L A;  3AAK A;  1PK0 D;  2KAY A;  3WCK A;  2KHN A;  1HT9 A;  2ZO7 A;  1NCX A;  5FI7 A;  2HQ8 A;  4W6F A;  1M46 A;  1NPQ A;  1XQM A;  5DTZ A;  1WRZ A;  1M63 B;  1E8A A;  3C1V A;  2LAN A;  4HE4 A;  5D3O A;  4DS7 A;  4MLW A;  2FZU A;  2Z6Y A;  1QIW A;  3NSK A;  1IIO A;  2KGR A;  1X02 A;  3DQ2 A;  3OHM B;  2NCP A;  3GK2 A;  5DRF A;  3GEX A;  3IP2 A;  4W6C A;  1EML A;  3DQD A;  4W7F A;  4DUQ A;  1EL4 A;  2PXW A;  5JJG A;  4IK1 A;  2GGZ A;  1TTX A;  1OZS A;  3RWA A;  1YHH A;  3SSV A;  2K8M B;  5HBD A;  1QLK A;  2NXQ A;  4PT1 A;  2BCX A;  3SJS A;  4N5X A;  2PYQ A;  2OTE A;  5HKW A;  2KLD A;  3U8P A;  1EMF A;  2EMO A;  2IE2 A;  2HQZ A;  2YE0 A;  1DGV A;  4ORA B;  2KLE A;  3GL4 A;  2YGU A;  4HSZ A;  1GGZ A;  2F3Y A;  3TMR A;  3DQF A;  3SVN A;  3TDI A;  3BUN B;  3ZWH A;  1Q4B A;  1YX8 A;  2LHI A;  3O6B A;  1Q80 A;  1JC1 A;  4IJ7 A;  1K93 D;  1J1D A;  2G9B A;  1UP5 A;  4P2Y B;  4YGA A;  1XFU O;  1LKJ A;  5CSJ A;  1C07 A;  1ZGP A;  2KBI A;  2M97 A;  4ANJ A;  1TN4 A;  3AAJ A;  4LQT A;  2ZMU A;  1GGW A;  4GFT A;  3SIB A;  1AJ4 A;  5I94 A;  4KW4 A;  3I5F B;  2P71 A;  1YFP A;  2C9J A;  1HQV A;  2B3Q A;  5KTY A;  4IZN A;  2FJY A;  1YZW A;  2LMT A;  4PHN A;  1MQ1 A;  1RWY A;  2O2B A;  2L51 A;  3ZNI A;  2K2F A;  3NHI A;  2BTJ A;  2F8P A;  5T3I A;  2A47 A;  1JF2 A;  4NDB A;  4YRU A;  4Q7U A;  4W6J A;  3CZ1 A;  5GQQ C;  2EC6 B;  4WQ2 A;  4DXI A;  5EXB A;  1QX5 B;  3V3D A;  1KYP A;  2QLE A;  1OOG A;  1SMG A;  5FHV A;  3O77 A;  2FCD A;  2K0J A;  1AHR A;  4BY5 A;  1XSS A;  3CFH A;  3DPZ A;  3IF7 A;  3RLZ A;  2HFC A;  4JRB A;  1NCY A;  2OTG C;  1EME A;  3DQI A;  1S1E A;  2KDH A;  4W6N A;  3OBV A;  1YJF A;  3SG7 A; 
#chains in the Genus database with same CATH homology
 3ST4 A;  3VHT B;  1SR6 C;  3SG6 A;  2M49 B;  1Y1U A;  1H4B A;  5F9G A;  2F3Z A;  2AAO A;  3UFZ A;  3HX4 A;  2BKI B;  1QYO A;  3VRR A;  2LVV A;  2H8Q A;  1MYW A;  2LMV A;  1A2X A;  4H3L A;  4TZA A;  3O4Y A;  3EK8 A;  1TIZ A;  3SG2 A;  1YHI A;  2G3D B;  2V4E A;  4YBH B;  2M0R A;  3KPX A;  5HZO A;  1TOP A;  1AUI B;  2ZRT A;  4EN1 A;  1KWO B;  4ZCV A;  1M31 A;  2D8N A;  1BFP A;  1K94 A;  1L7Z A;  2PSR A;  4FTG A;  1K9K A;  1V1G A;  1N65 A;  4C0K A;  3S05 A;  1W7U A;  3WHT B;  1B8L A;  5AER A;  2LNK A;  1H4U A;  4MVF A;  3I5I B;  2WSN A;  5EB7 A;  3MSE B;  4CLN A;  2GV5 A;  1CMG A;  1LVC D;  1YUS A;  5HGE A;  4ETO A;  3PAT A;  2V53 A;  1NIW A;  1PRW A;  2A50 B;  1XK4 A;  3AI5 A;  2OKW A;  1OXE A;  1B9A A;  1MOU A;  5CSF A;  3CFA A;  2H5Q A;  2V4E B;  5CSI A;  3PFV A;  4W74 A;  2OJK A;  3PJ7 A;  2EGD A;  4N3D A;  3GK4 X;  2KFH A;  1A4P A;  1YRT B;  2LLS A;  2NZ0 A;  3ADF A;  2O60 A;  1GFL A;  3WLC A;  1A75 A;  4CFR A;  1H6R A;  2HRS A;  3H4S E;  3BQ3 A;  2KOT A;  4KGF A;  2JT8 A;  2K61 A;  1OMD A;  3DQ1 A;  1WDC B;  1SCV A;  2Q4U A;  1SW8 A;  4WQ3 A;  3EKH A;  1Q4E A;  3CR4 X;  2OGR A;  3GB3 A;  1ZOT B;  1UHJ A;  1NX1 A;  2Z6Z A;  1DJW A;  2KFG A;  1FI6 A;  4MZK A;  4HRG A;  2FWQ A;  5F6T A;  3DPX A;  1KFU S;  3I5F C;  4PE7 A;  5D69 A;  2MRD A;  5DTY A;  1IH0 A;  4LQU A;  2WC8 A;  4OQW A;  2Y0G A;  2AUC A;  4W6K A;  2LM5 A;  4YGC B;  1BU3 A;  4YI9 A;  1QX7 A;  1CFD A;  1FBV A;  2R2I A;  3U0N A;  3SST A;  1AJ5 A;  4YGE B;  2LUX A;  3E5V A;  2JXC A;  1OOJ A;  3ZUL A;  2EC6 C;  2LMU A;  3CR5 X;  2L4H A;  4YGB B;  4M2O A;  4GES B;  2DD7 A;  3DQ5 A;  2JRF A;  2Y5I A;  4L12 A;  4J88 A;  4W75 A;  4DXM A;  1RM9 A;  2ICR A;  2LV7 A;  1RRX A;  1SY9 A;  3EVU A;  4D1E A;  2JXL A;  1QTX A;  1CDN A;  3I5H B;  2RH7 A;  3SRY A;  1WRK A;  2KBM A;  3ZTF A;  1PSB A;  1BOC A;  2JNF A;  1PUL A;  2FOT A;  1XFV O;  5BPJ A;  1SBJ A;  2AWL A;  4W6G A;  2I7A A;  3AKB A;  3U0L A;  4GNK B;  2BE4 A;  1K9U A;  1AK8 A;  1R6P A;  4W6M A;  3GK1 A;  2L50 A;  3H1R A;  3TUY B;  3LVD A;  2AWM A;  3GJ1 A;  1NYA A;  3ED8 A;  2DDD A;  3SSH A;  1SNL A;  2BE6 A;  3NED A;  4EUL A;  1JFJ A;  2ZMW A;  4NDC A;  4PHM A;  1G33 A;  2LP2 A;  1DJI A;  3SVU A;  1Y6W A;  2O24 A;  1KWO C;  3I5G B;  4IK8 A;  1RTP 1;  2G6E A;  5AAN A;  1F71 A;  1OXD A;  5BT0 A;  2MJW B;  4EDS A;  4ZB1 A;  1NUB A;  1OXF A;  1IKU A;  3I5I C;  5DPJ A;  1LA3 A;  2GW4 B;  2WIQ A;  3BXC A;  4HRH A;  3CTN A;  2O29 A;  1MUX A;  4W7E A;  1GJY A;  1LA0 A;  1A03 A;  4PE4 A;  1J7R A;  1EMA A;  2K7O A;  4DIR A;  2AWJ A;  4PHJ A;  4PE0 A;  3E3R A;  1K95 A;  3K21 A;  5AEQ A;  4UPG A;  4H48 A;  2WOR A;  4F0Z B;  2H5P A;  1UHH A;  1A29 A;  2KI6 D;  1Y1X A;  2P4M A;  2ZO6 A;  2JU0 A;  4AQI A;  1RMO A;  2LAP A;  1NX0 A;  4W73 A;  4DCK A;  1XK4 C;  1Y1A A;  3LVA A;  1DMO A;  1WDC C;  1L2O B;  1J55 A;  1DF0 A;  2K7C A;  1F09 A;  2QLG B;  4I5N B;  4PPK A;  2HPW A;  2VVJ A;  1B1G A;  4W6T A;  1DJX A;  3BOW B;  1BOD A;  2VVH A;  4L13 A;  4E68 A;  2MBX A;  2H5R A;  4P5O E;  5EXU A;  3KCT A;  1RJV A;  1S6J A;  2M7N A;  1B9C A;  3A4U B;  1BLQ A;  2WHS A;  5FVI A;  4MRY A;  3LCP C;  4TZG A;  4OJ0 A;  2MHH A;  2ARL A;  4KAG A;  2F2O A;  4LJC A;  3SG5 A;  4QJ4 B;  1DF0 B;  1SCM B;  5PAL A;  1KYR A;  4ZF4 A;  4ORN A;  1CLL A;  2CTN A;  4UTS A;  3FS7 A;  1QY3 A;  1UWO A;  2HQW A;  2HCG A;  3WNX B;  1RMM A;  2RGI A;  4IK9 A;  1Q4A A;  2IB6 A;  5DKR A;  4JF9 A;  1NCZ A;  2G2S B;  5HLV A;  5FYX A;  3I5H C;  2ZFD A;  4OV2 A;  4W6S A;  5I2O A;  1GL4 A;  3DPW A;  2QLI A;  1D1O A;  1ZGO A;  5DTX A;  2H9W A;  1NWD A;  1PVB A;  2MLE C;  3NSO A;  4HVF A;  5DQB A;  2ISD A;  4AOM A;  1Q4D A;  1W7I B;  1SL8 A;  4CPV A;  3DQN A;  1S6C A;  3PIB A;  3TUY C;  2L4I A;  1B8C A;  1JBA A;  2A56 B;  1DJZ A;  3QRX A;  1MHO A;  3LK1 A;  5HZS A;  2Y1M A;  1CDM A;  3LL8 B;  4H3N A;  3DQO A;  1KK7 Y;  1UHN A;  5LK4 A;  2JNX A;  1QV1 A;  1BJF A;  1S36 A;  1JSA A;  3I5G C;  5LTP A;  2KQY A;  1OE9 B;  3CD9 A;  1KK7 Z;  1S6I A;  2WHT A;  2KQ6 A;  1ZUX A;  1EMK A;  3VRP A;  1TRF A;  3A8S A;  2KNE A;  5K89 A;  3VHT A;  1XFX O;  2CNP A;  2VZX A;  3DQM A;  1CNP A;  1CLM A;  5B8I B;  4P1Q A;  4TNC A;  5FVG A;  4ZFS A;  1KFU L;  4JQ0 D;  2Z6X A;  2Y4Q A;  3PN7 C;  1ZFS A;  2L5X B;  4W6O A;  4I5K A;  3VRN A;  3EVV A;  2EMN A;  3BYA A;  5BQL A;  1XFY O;  2EHB A;  2DUF A;  1YVL A;  1UUR A;  1Q73 A;  5HKY A;  2WND A;  1IQ3 A;  2PRU A;  1SKT A;  3DVM A;  3M0W A;  2MA2 A;  1KFX L;  2JUL A;  5H89 A;  5DKQ A;  3OP0 A;  5H87 A;  3SSK A;  1W7J B;  3LF3 A;  1Z1Q A;  2LVJ A;  1L2O C;  3SSP A;  4J89 A;  4OVN F;  2KYC A;  2YDZ A;  1QYF A;  1REC A;  5DRG A;  1XAE A;  4CFQ A;  1R2U A;  4QJ3 B;  2GX0 A;  5LTR A;  1BMO A;  2F33 A;  3E5T A;  4ICB A;  2K2A A;  5D7F A;  3HCM A;  1SK6 D;  1G4Y R;  3DQ6 A;  3PLF B;  1F4Q A;  3DQA A;  2QPT A;  4FQO A;  1IQ5 A;  5FVF A;  3M24 A;  1SCM C;  3AKA A;  2CXJ A;  4BDU A;  4XJK B;  1S6Z A;  3SSY A;  4PCW A;  3TS5 C;  1SL7 A;  2H5O A;  3U8C A;  1DVI A;  1NX2 A;  4KF5 A;  1SPY A;  2A46 A;  2WCB A;  2WSO A;  5EB6 A;  2G6X A;  3KCS A;  1XA5 A;  1B4C A;  1MXL C;  1G7K A;  3SV5 A;  3VIC A;  3DQC A;  3TZ1 A;  3DQU A;  1YHG A;  1MOV A;  1ZMZ A;  5J2O A;  3ST2 A;  2HGD A;  4USL A;  4L1I A;  2PMY A;  4A4B A;  2LLT A;  3BXA A;  3KO0 A;  3ST0 A;  2JT3 A;  4GGF C;  2BCA A;  1WLM A;  4HQ8 A;  2PAS A;  2WUR A;  3NEZ A;  3ZUF A;  1QYQ A;  2JTZ A;  4OCI A;  1XO5 A;  5KU1 A;  4W7A A;  2A48 A;  2LUC A;  1B47 A;  2M1K B;  1F70 A;  4ZF3 A;  3SVB A;  3GOF A;  2FJU B;  2A52 B;  4XVP A;  4W6B A;  3LA1 A;  4KW8 A;  4Q9W A;  1OMV A;  1QVI Y;  1B7T Y;  5I2Q A;  1BF5 A;  4JPZ B;  1B8R A;  2JQ6 A;  2IB5 A;  4Q7T A;  3FIA A;  4DKN A;  1JFK A;  1QVI Z;  3SVE A;  2H6V A;  3NSI A;  1S3P A;  2I2R E;  1TNP A;  3LK0 A;  4B30 B;  3CLN A;  2LCP A;  3CBE A;  4W6D A;  2ZND A;  3LS3 A;  4W77 A;  1TNX A;  1QIV A;  4MRX A;  1IJ5 A;  3JVT B;  4H47 A;  1C7V A;  3EKJ A;  2WIS A;  1QXT A;  1WLZ A;  3AI4 A;  1UHI A;  1S5G Y;  2JTT A;  3DF0 B;  3PSR A;  3LSA A;  3BXB A;  2C9I A;  4M2P A;  5DTL A;  1CLB A;  4KF4 A;  5HW9 A;  2PVB A;  2QRF A;  1S5G Z;  4ZIN A;  4W6I A;  3BUW B;  2CCM A;  1U5I A;  5CSN A;  2KI4 B;  2FCE A;  1EG3 A;  4H3M A;  4LJD A;  1K9P A;  5AQB B;  4YI8 A;  1Y0V H;  2DUG A;  2LE9 B;  3SVC A;  2VAD A;  3OB1 B;  4LJB A;  4KGE A;  4W7D A;  3LLE A;  1JUO A;  1QS7 A;  1ZUZ A;  4I5L B;  2IS9 A;  4XGY A;  3U0K A;  1N0Y A;  3NT3 A;  1BR4 B;  4KW9 A;  1M39 A;  3SVR A;  4M2Q A;  4IK4 A;  5I8N A;  4BY4 A;  3WXA A;  4AR7 A;  3DVE A;  1PSR A;  3CZT X;  4EDO A;  2DUH A;  2LVK A;  2G5Z B;  2SCP A;  3VGO A;  3OB2 B;  1U5I B;  3WHU B;  2QU1 A;  2DOQ A;  2KI6 C;  3JTD B;  3AKO A;  1QLS A;  2PAL A;  1CV7 A;  5DPI A;  1K96 A;  2EMD A;  1UHK A;  4I5J A;  1LIN A;  1EMM A;  3D0Y B;  3G9A A;  2KYF A;  3KF9 A;  1RRO A;  3DQE A;  3PN7 B;  2QLG A;  2YE1 A;  2VRG A;  3BOW A;  1ALV A;  4XOV A;  5HZU A;  5ER4 X;  2G6Y A;  1IG5 A;  4W7C A;  2NLN A;  2M1U A;  2PXS A;  2F2P A;  4LW5 A;  2H61 C;  1CTR A;  4WRI A;  4NQG A;  1EG4 A;  2GW3 A;  2AWK A;  2KGB C;  4W6U A;  2H2K A;  3CGA A;  5BTT A;  2Q91 A;  2HF5 A;  1SRA A;  4MN0 A;  1N2D A;  4OGS A;  4MEW A;  3DQ4 A;  2BCB A;  5AXI A;  4PE1 A;  3NF0 A;  4C0L A;  2KSP A;  2BBN A;  2K7B A;  3LVC A;  4P76 A;  1KQM B;  4W6P A;  4KF5 C;  1QJT A;  1RFJ A;  1F0B A;  1J7O A;  2ZRS A;  2JC2 A;  2NCO A;  4HRE E;  3UG0 A;  1TNW A;  5BTT B;  2JPT A;  1G8I A;  2L98 A;  4U2V A;  1CDP A;  2QZ0 A;  1CDL A;  1FF1 A;  1UUS A;  2M7L A;  1JC0 A;  2OKY A;  2M8U A;  4NDD A;  1EJ3 A;  1XFW O;  4GGF A;  1V1F A;  1EMG A;  1ODB A;  2L0P A;  2Z1O A;  2DD9 A;  4DXQ A;  3TS5 B;  3JVT C;  2G2B A;  2OS8 B;  2JWW A;  4ORC B;  2M29 A;  1YVH A;  2LC5 A;  4KPI A;  4JGE A;  3DQK A;  3CS1 A;  3LF4 B;  3NXA A;  3DVK A;  1PVA A;  1Q4C A;  4U8D A;  3PAL A;  1EMB A;  4N1G A;  2O5G A;  4R6B A;  1UIS A;  4W6A A;  3ICB A;  2KI4 C;  4DXP A;  3H1O A;  4W6H A;  4MZJ A;  4OY4 A;  4L9M A;  4W72 A;  4DXO A;  2OTB A;  4I2Y A;  2WCE A;  3OSR A;  4NWS A;  1DJG A;  2BL0 C;  4KEX A;  4PAL A;  3SVS A;  3U8A A;  2B1U A;  1MR8 A;  4GPL B;  3KEV A;  2WCF A;  3BUX B;  1QV0 A;  1HCJ A;  5DPG A;  1WRL A;  4J8A A;  1SL9 A;  1QXP A;  1OSA A;  1S26 D;  1J7P A;  4LJD C;  3JTD C;  2ZN9 A;  3NT9 A;  2LLU A;  1DTL A;  1J7Q A;  3K1K A;  2AH8 A;  2HQK A;  4IK3 A;  2QLH A;  3EVR A;  1KCY A;  3DQH A;  3OGO A;  2ZNE A;  1KK8 B;  4B5Y A;  2KAV A;  4ORB B;  3VRQ A;  1DJY A;  2AMI A;  2GGM A;  1EMC A;  4C0J A;  1NP8 A;  3TDU A;  4PHK A;  2AHA A;  4DKM A;  3ZUJ A;  1YUR A;  3A8R A;  3SVD A;  1JWD A;  4W7R A;  1J1E A;  2BKH B;  1RMP A;  4ZCU A;  2M3W A;  1IWQ A;  5HYD A;  3GJ2 A;  5ER5 A;  3SG4 A;  3SG3 A;  1CB1 A;  1BR1 B;  3FWB A;  4MSP A;  2ZKM X;  2I18 A;  4A4C A;  4PFE A;  1BT6 A;  4R1E A;  1EH2 A;  1NX3 A;  4XJK A;  5EJU A;  3CR2 A;  2TN4 A;  1KQM C;  2B3P A;  2WOS A;  2I94 A;  1Z1P A;  4JFG A;  5G08 A;  4R6D A;  4GUK A;  4ZIO A;  2P6B B;  3O78 A;  1VRK A;  5JOL A;  1QAS A;  4HQC A;  1DT7 B;  1TCO B;  3SS0 A;  2H61 A;  3VK1 A;  4AS8 A;  2GX2 A;  2DUI A;  3W1D A;  5EXC I;  1JF0 A;  1F54 A;  5AFP A;  1GGX A;  1K90 D;  1LXF C;  1CMF A;  4CID A;  4Q7R A;  3TDZ A;  1YTZ C;  4MBE A;  2CT9 A;  2WHU A;  3EK7 A;  2LVI A;  2OS8 C;  1QAT A;  3PJ5 A;  1IJ6 A;  1DJH A;  1KSO A;  2KFF A;  2A53 B;  3RM1 A;  3CFF A;  2HJO A;  3CWG A;  3W1C A;  1FW4 A;  1TNQ A;  3PJB A;  4N1F A;  4Z4K A;  4KA9 A;  1HUY A;  4GGN A;  4OKH A;  3PM8 A;  4GBA A;  4W7X A;  1QX2 A;  1ALW A;  1OZO A;  5LTQ A;  5CPV A;  4AQJ A;  1F4O A;  2QT2 A;  3IR8 A;  5DY6 A;  4B30 A;  1CKK A;  2JOJ A;  1AP4 A;  1W7S A;  4HQ9 A;  2BEC A;  1M45 A;  3BUM B;  2ZN8 A;  4XL5 A;  3DQ7 A;  1SYM A;  5DPH A;  2G16 B;  3MGF A;  2VVI A;  1KYS A;  1XVJ A;  1H8B A;  4JWQ A;  2YFP A;  5EHU A;  2CBL A;  2JAD A;  3OSQ A;  3SVO A;  1FPW A;  1YX7 A;  2E30 A;  4Z4M A;  3DF0 A;  4GOB A;  2QAC A;  1K2H A;  1BG1 A;  3F45 A;  1F8H A;  1B7T Z;  3DQL A;  4GF6 B;  3WLD A;  2K7D A;  1A75 B;  2LP3 A;  4XOW A;  3P28 A;  2COL B;  3CB9 A;  2SAS A;  4RTC A;  4OHS A;  2IOV A;  2BBM A;  1CM4 A;  4QJ5 B;  4PPL A;  5DU0 A;  4MZL A;  2MLF C;  1OMR A;  3M22 A;  4IK5 A;  1IRJ A;  1KK8 C;  4ZBL A;  1XFZ O;  1OQP A;  1C7W A;  4DXN A;  1KFX S;  4W6R A;  4W76 A;  1YUT A;  3O2P A;  4RYS A;  5H88 A;  1YJ2 A;  1GQM A;  1KQV A;  1PAL A;  2A54 B;  3IQO A;  3DQ9 A;  4PDZ A;  4JEO A;  1C4F A;  4JC2 A;  1CFP A;  5IBW A;  1YUU A;  1JBY A;  4OR9 B;  5KSZ A;  3EVP A;  2OPO A;  2A4J A;  1CFF A;  5I2L A;  5DKN A;  2BL0 B;  1XA9 A;  3D0Y A;  3NSL A;  3KHE A;  1K8U A;  3BX9 A;  3EK4 A;  4GAO A;  1F55 A;  4IL1 A;  1MWN A;  1ZGQ A;  3DQ8 A;  2HPS A;  2HGY A;  3OX6 A;  4Q04 A;  2L2E A;  2LHL A;  3DVJ A;  1RK9 A;  3E5W A;  2HET A;  4ZF5 A;  2G3O A;  5DQM A;  3DQJ A;  1FI5 A;  1YRU B;  1CFC A;  5J3X A;  1CM1 A;  5TNC A;  1AVS A;  1KSM A;  2Q57 A;  3SSL A;  3RWT A;  3ST3 A;  2DUE A;  2KAX A;  4YGD B;  1XYD A;  2DDC A;  1IGV A;  2MAZ A;  2Q6P A;  3SIA A;  3U0M A;  3DQ3 A;  5KTG A;  1XMZ A;  1W7T A;  5HLO A;  1DGU A;  3I19 A;  1ZAC A;  1KP5 A;  4EMQ A;  3BXK A;  3D10 A;  4XYN A;  3CGL A;  2JT0 A;  3CD1 A;  2V4E C;  1TCF A;  2M9G A;  2POX A;  4DRW A;  4Q9X A;  2VAE A;  2OTG B;  2Y1N A;  1NSH A;  3OX5 A;  3DD4 A;  1MF8 B;  1EXR A;  2JZI A;  1WY9 A;  1MXE A;  3FWC A;  4W69 A;  4PPJ A;  1SR6 B;  5HKZ A;  2FL1 A;  1JC2 A;  5HZT A;  3BUO B;  1YR5 A;  2E6W A;  3IQQ A;  5EBJ A;  3TMT A;  3P8U A;  4RYW A;  1JBZ A;  3VRO A;  4W6L A;  3AAK A;  1PK0 D;  2KAY A;  3WCK A;  2KHN A;  1HT9 A;  2ZO7 A;  1NCX A;  2HQ8 A;  4W6F A;  1M46 A;  1NPQ A;  1XQM A;  5DTZ A;  1WRZ A;  1M63 B;  1E8A A;  3C1V A;  2LAN A;  4HE4 A;  4DS7 A;  4MLW A;  2FZU A;  2Z6Y A;  1QIW A;  3NSK A;  2KGR A;  1X02 A;  3DQ2 A;  3OHM B;  2NCP A;  3GK2 A;  5DRF A;  3GEX A;  3IP2 A;  4W6C A;  1EML A;  3DQD A;  4W7F A;  4DUQ A;  1EL4 A;  2PXW A;  5JJG A;  4IK1 A;  2GGZ A;  1TTX A;  1OZS A;  3RWA A;  1YHH A;  3SSV A;  2K8M B;  5HBD A;  1QLK A;  2NXQ A;  2BCX A;  3SJS A;  4N5X A;  2OTE A;  5HKW A;  3U8P A;  1EMF A;  2EMO A;  2IE2 A;  2HQZ A;  2YE0 A;  1DGV A;  4ORA B;  3GL4 A;  4HSZ A;  1GGZ A;  2F3Y A;  3TMR A;  3DQF A;  3SVN A;  3TDI A;  3BUN B;  3ZWH A;  1Q4B A;  1YX8 A;  2LHI A;  3O6B A;  1Q80 A;  1JC1 A;  1K93 D;  1J1D A;  2G9B A;  1UP5 A;  4P2Y B;  4YGA A;  1XFU O;  1LKJ A;  5CSJ A;  1C07 A;  1ZGP A;  2KBI A;  2M97 A;  4ANJ A;  1TN4 A;  3AAJ A;  4LQT A;  2ZMU A;  1GGW A;  4GFT A;  3SIB A;  1AJ4 A;  4KW4 A;  3I5F B;  1YFP A;  2C9J A;  1HQV A;  2B3Q A;  5KTY A;  4IZN A;  1YZW A;  2LMT A;  4PHN A;  1MQ1 A;  1RWY A;  2O2B A;  2L51 A;  3ZNI A;  2K2F A;  2BTJ A;  2F8P A;  5T3I A;  2A47 A;  1JF2 A;  4NDB A;  4YRU A;  4Q7U A;  4W6J A;  5GQQ C;  2EC6 B;  4WQ2 A;  4DXI A;  5EXB A;  1QX5 B;  3V3D A;  1KYP A;  2QLE A;  1SMG A;  5FHV A;  3O77 A;  2FCD A;  2K0J A;  1AHR A;  4BY5 A;  1XSS A;  3CFH A;  3DPZ A;  3IF7 A;  3RLZ A;  2HFC A;  4JRB A;  1NCY A;  2OTG C;  1EME A;  3DQI A;  1S1E A;  2KDH A;  4W6N A;  1YJF A;  3SG7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...