3EVVA

Crystal structure of calcium bound dimeric gcamp2 (#2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
411
structure length
385
Chain Sequence
b'SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 100
structure length 385
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evvA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evvA01
1BMOA 4PHNA 3JVTB 2OS8B 2JTTA 5EXCI 5K89A 1PALA 2HCGA 5DTLA 1WDCC 3AKBA 1W7SA 2JC2A 2BBNA 5CSNA 4GOBA 4DUQA 3LLEA 4XOWA 1CKKA 2YFPA 2E30A 2LANA 2AWKA 2QRFA 5J3XA 1JUOA 1F71A 2YE1A 5CSFA 2M29A 3F45A 2JT8A 4JPZB 2MA2A 3SG6A 4I5KA 2I18A 2OGRA 1JWDA 2HFCA 3O78A 1J1EA 1SBJA 4KGFA 1JBZA 5PALA 1S36A 4W75A 4W7FA 4LJDC 2A53B 1IRJA 3RWTA 3OX6A 1NYAA 1DTLA 2MJWB 3TDZA 3CGLA 1EMKA 2MLFC 5LTQA 2KHNA 3BUNB 1CMFA 5CPVA 3SV5A 2FCDA 2H9WA 4KEXA 3KF9A 1MQ1A 4AQIA 1DJZA 1OZSA 2LC5A 4MZJA 2O60A 2KDHA 1SNLA 1YRUB 2QLHA 1KFUL 3I19A 1A75B 2G2BA 1YR5A 1LA3A 2I94A 3BXAA 3CR4X 2LVIA 4JF9A 3IQOA 5KSZA 1NP8A 1E8AA 5KTGA 1GGWA 3C1VA 2LAPA 4MRXA 1G8IA 3PJBA 2OTBA 1DJGA 2L50A 2K7CA 1TCOB 1Y1AA 1RRXA 2KQYA 2H2KA 2LHIA 1OZOA 1F4QA 4RYSA 4Q7TA 3DQAA 1ZFSA 2EMNA 1WLMA 2EGDA 2KFHA 4HRGA 1KP5A 4N5XA 1IQ3A 4KF4A 2BBMA 3CD9A 1RMMA 1KYPA 1QTXA 1KWOB 3CGAA 2QLIA 5AANA 3BX9A 2L4HA 1LKJA 3AI4A 3I5IC 1NCYA 1UHIA 2JADA 3IF7A 1K9KA 1SPYA 3VRQA 3AAJA 2WHUA 4PPLA 4CLNA 3SIAA 1K9PA 4KW4A 1CM1A 3BUOB 4QJ3B 1HQVA 1KQVA 2HJOA 3JVTC 2OS8C 2F3ZA 4OKHA 3D0YB 4J88A 2ARLA 1B4CA 3JTDB 4DXQA 2HQZA 2LM5A 4QJ5B 2KFGA 2ZN8A 2FL1A 3KCTA 5HZSA 5GQQC 4W76A 1KK7Y 4MZLA 3I5FB 1Q73A 3M0WA 4OCIA 1BU3A 3GK1A 5EBJA 3CFFA 3K21A 4YGCB 2WCEA 1SCMB 4W6JA 3PJ5A 3HX4A 1JBAA 5DU0A 4W7XA 1SY9A 4PHKA 3PSRA 4BY4A 3ZWHA 4W6FA 5DQMA 2LP3A 3U8CA 1KSOA 1B7TZ 4DXOA 1CLLA 3O2PA 1Z1QA 1MUXA 2ZFDA 3ZUFA 1JSAA 2DD9A 3GK2A 1JFKA 3DD4A 3E3RA 1EMMA 4CFQA 2JU0A 2M1KB 3I5GB 2Z6YA 4M2QA 1Y1UA 1IWQA 3OX5A 1QVIZ 1CFDA 4BDUA 3I5HB 4W6DA 2HRSA 3DQ4A 3IP2A 1HUYA 4F0ZB 3GEXA 3A8RA 2KOTA 2WCFA 1K9UA 1A75A 5AFPA 4OVNF 2LMVA 3M22A 3O77A 3ST2A 1D1OA 2PASA 1B8CA 2YDZA 1RJVA 2GGMA 2KYCA 4N3DA 1HCJA 1CV7A 4H47A 4OR9B 1Y6WA 1CTRA 2KYFA 1AK8A 1DVIA 3LK0A 2BCAA 4LW5A 1XQMA 2B3PA 3LF3A 4OGSA 4AR7A 4PDZA 3A4UB 1KYRA 3IR8A 2ZRSA 1BFPA 4WRIA 2H5QA 1QJTA 1K94A 2DUEA 1V1FA 1EL4A 2D8NA 1NX1A 2EC6C 4MLWA 1SW8A 2G3DB 2BKIB 3NT9A 3U0LA 2H61C 2Y5IA 2KI6C 2JULA 2MHHA 3DQJA 4TNCA 1NWDA 4GFTA 2K7OA 2L51A 3O6BA 1SK6D 2ZMWA 1RECA 3DQDA 1WDCB 4HQCA 4R6BA 1B8LA 2HQKA 2K7BA 4CIDA 1QYFA 5LTPA 2VVHA 3JTDC 4ZF5A 2MAZA 3CFHA 1U5IA 2KGBC 2G6XA 2BE6A 2IOVA 3CLNA 2LV7A 3D0YA 2Q6PA 4IK8A 2M1UA 3FS7A 3DVMA 2A46A 2JZIA 2B3QA 4W7DA 1DT7B 2VVJA 1SL7A 3ADFA 3U0KA 1OMVA 4AOMA 4DKNA 1K8UA 5KTYA 4W6SA 2G6EA 1EXRA 4GAOA 1RK9A 4R6DA 3BUMB 2E6WA 1G4YR 1XFXO 4IK5A 2DOQA 3VRNA 1XK4C 4Q7RA 1YURA 5DKRA 3BXCA 1H4UA 2NZ0A 1TTXA 4JEOA 1IQ5A 2EMDA 1PVBA 2A52B 3PFVA 4NQGA 4H3LA 1IJ5A 2RGIA 4HQ9A 1XK4A 1J7PA 1EMCA 5BPJA 2WSOA 3PM8A 1QXTA 2NLNA 4IK9A 4KAGA 3DQLA 5HLVA 1YHIA 2M9GA 3W1CA 3EK4A 4HRHA 1AJ4A 1MR8A 2CT9A 5DKNA 5F9GA 3DQNA 1DJXA 2JQ6A 3DQFA 4PPKA 5IBWA 4EDOA 3LL8B 2M97A 1UP5A 1TIZA 1H8BA 2DUIA 3KHEA 1XSSA 4UTSA 2O24A 3NSIA 1MXLC 4W6PA 3DQ8A 3FIAA 3LS3A 1BOCA 5JOLA 3EKHA 1F09A 4KF5C 1DGVA 3SVBA 3FWCA 2GW4B 4P2YB 2AMIA 3SG3A 4OV2A 1GQMA 2JTZA 5HZOA 1ALVA 2F3YA 3I5IB 3GOFA 1XYDA 2LMUA 3M24A 1YVHA 1F0BA 4KF5A 1DJHA 4YI9A 3WHTB 1JC2A 3DPWA 4P5OE 5BQLA 5JJGA 4I5LB 5AERA 4BY5A 1CFPA 3CBEA 2Z6ZA 3U0NA 3BYAA 2H8QA 2C9JA 5DPJA 4JGEA 3K1KA 1Z1PA 3KPXA 2VADA 1OXFA 2H6VA 2F2PA 3PATA 4NDCA 3RM1A 2YE0A 1AP4A 2CTNA 1L2OC 5I2LA 2LP2A 4W6NA 1J1DA 4EMQA 3H1RA 4W7AA 2PSRA 2KGRA 5EB6A 1CB1A 1QATA 2LVVA 1YUTA 1MOUA 4DKMA 1J7OA 3CB9A 1SKTA 4LJDA 4B30B 3GL4A 2DUHA 1TNPA 3CD1A 1KSMA 2WOSA 5DPHA 1LA0A 2M49B 2EMOA 3P28A 1OQPA 4DXMA 4KW8A 2JXCA 1RM9A 2ZNDA 1XFWO 4Q9WA 3PN7B 3KCSA 1OMRA 4GUKA 4TZAA 2KI6D 1M46A 2BKHB 2NCPA 3TUYB 5I8NA 3SG2A 2QLEA 2IB5A 2LLUA 1M39A 3E5TA 1BLQA 1KK7Z 1L7ZA 1W7IB 3SG7A 1RROA 2Q91A 3SIBA 1GGXA 4YBHB 1YZWA 2ZO6A 3MSEB 1PSBA 1JF0A 4UPGA 4PE1A 1LXFC 1TNQA 3TMTA 3WNXB 2A4JA 2KAXA 1EMGA 2AWJA 4W6KA 3DQCA 3ZUJA 2JT0A 3LVCA 1N65A 5DTXA 2EC6B 1QLKA 3EK8A 1H4BA 3SS0A 5EB7A 4JC2A 3TZ1A 4MEWA 3NT3A 4PHMA 1EMEA 1U5IB 3DQ1A 3WLDA 1SCVA 3SVRA 4PHJA 5HYDA 4XJKA 2GX2A 3OSRA 1M31A 1C7VA 2BL0B 1CMGA 4DXPA 1UURA 2MLEC 4DXIA 1J55A 2L2EA 4W74A 5I2OA 1JF2A 3OB2B 1HT9A 4PE7A 2HF5A 3WXAA 3NF0A 2RH7A 4PPJA 1QX7A 4C0LA 3SVEA 3PALA 1AUIB 3NSLA 3ED8A 5LTRA 1ZMZA 1SRAA 4W6TA 2OPOA 5DTYA 3BUXB 2LUXA 2K0JA 1DMOA 1KQMC 5H89A 2LLTA 5EXBA 3RLZA 4KW9A 3TDUA 4W6AA 5G08A 3OB1B 2KBMA 3GK4X 3VRPA 4U2VA 1YX7A 4ORNA 2AWMA 3UG0A 3EVVA 1KFXS 3DQMA 3DF0B 3EVUA 4C0KA 4Q7UA 2JOJA 2KFFA 2KI4B 3SG4A 1XMZA 4W69A 3PN7C 4B30A 1CLBA 1GFLA 2BTJA 1B9CA 2JT3A 4GNKB 4DS7A 3TUYC 1LVCD 4L13A 4XVPA 2K61A 1QS7A 2G9BA 2LUCA 1K95A 1AJ5A 1EG3A 1WRKA 3U8AA 4YGAA 1YTZC 3DVJA 1BR4B 3TDIA 1A4PA 1OE9B 1DJIA 2JRFA 3SSYA 3WLCA 2PVBA 4KPIA 1QLSA 3TS5C 1EG4A 4MN0A 2OTGB 4MZKA 4PFEA 4NWSA 4OHSA 1MF8B 2FJUB 3NSOA 1UWOA 5J2OA 3ZTFA 2Q4UA 5FHVA 1WLZA 4N1FA 3AKOA 2ZNEA 2PXSA 2G2SB 4JRBA 5CSIA 2POXA 1NX3A 1UHJA 2A50B 2AWLA 3NEZA 2LNKA 1PSRA 5BTTA 3S05A 3HCMA 2GX0A 2BCXA 1QYOA 1UISA 2HGDA 1TNXA 2L4IA 4I5NB 4ANJA 3GB3A 5FYXA 2M3WA 1RWYA 1B7TY 2H61A 5LK4A 5D69A 1KYSA 3MGFA 2BL0C 1F8HA 2Y1MA 1N0YA 2TN4A 1YUUA 1ZGQA 4L12A 1ZUZA 1QY3A 4W7EA 2COLB 2H5OA 3OP0A 4XGYA 1QVIY 1JFJA 1TN4A 3CWGA 2ZMUA 1CNPA 1BR1B 2OJKA 1L2OB 2K2AA 4LJBA 3A8SA 3P8UA 3SVDA 1B1GA 4XOVA 4W6CA 1JBYA 2ZRTA 4YGBB 1EJ3A 5EJUA 1W7UA 2KBIA 2FCEA 1S5GZ 2KSPA 4CFRA 1DGUA 1NPQA 2MRDA 2VAEA 4ZB1A 1F54A 4M2PA 1RTP1 1R6PA 1XO5A 1QIVA 4YRUA 4W6OA 3H4SE 1EMLA 2DD7A 3V3DA 4DCKA 1F70A 3U0MA 1QYQA 1Q80A 1IJ6A 1SL9A 2KI4C 5FVIA 3LA1A 2DDDA 4C0JA 3OGOA 4L9MA 1LINA 1NX0A 2A54B 3TMRA 1UHHA 1K90D 2IB6A 4HE4A 4I5JA 3DF0A 2HPWA 4P1QA 4ZF3A 1KCYA 5DPGA 2V4EB 1S26D 4HVFA 4W73A 2WORA 5HKZA 1Y0VH 2AUCA 1QV1A 1K2HA 3DQ9A 2OTGC 2WNDA 4P76A 1OSAA 4W6HA 1RMPA 3UFZA 4ETOA 4CPVA 4W77A 2L98A 1EH2A 1CFCA 2G5ZB 4W72A 3PIBA 3IQQA 4W6MA 5HZUA 4Z4MA 4XJKB 3DQEA 1QV0A 1B47A 1YX8A 2P4MA 3DVKA 3BQ3A 1NSHA 3EVRA 1MYWA 4I2YA 3VK1A 3SVOA 1B8RA 1ZGOA 1YVLA 1WY9A 4W7RA 4D1EA 2FOTA 1IGVA 1NX2A 3FWBA 1EMBA 1XVJA 2ISDA 3O4YA 3ST0A 2OKWA 4A4BA 2NCOA 4ZIOA 4MSPA 2LE9B 3DQ7A 1SR6C 4USLA 3NSKA 2Z6XA 2A47A 5EXUA 1YJFA 4Q04A 2DDCA 2ZN9A 2GV5A 4NDBA 2CCMA 1XFYO 1CM4A 1SMGA 1XFUO 3AAKA 2GW3A 4W6RA 1ALWA 2KAYA 1IG5A 2VZXA 1CFFA 1KK8B 1OXDA 4JWQA 5I2QA 1G7KA 1KQMB 1S6ZA 1TNWA 3CR2A 1F4OA 4W7CA 2F2OA 4OJ0A 2G3OA 4YGDB 4W6IA 4W6GA 1WRZA 3SVNA 4WQ3A 4YI8A 1PRWA 1A29A 1FPWA 3BOWB 3ST4A 2OKYA 2WCBA 4QJ4B 5EHUA 5HKWA 4LQUA 3D10A 2PRUA 5T3IA 1QX2A 3SSHA 1JC0A 2BE4A 3CFAA 5DY6A 3WCKA 1XA9A 1K96A 4Q9XA 3W1DA 2VVIA 2DUGA 4ZCUA 1FBVA 4AQJA 3DQ5A 2QLGB 1FI5A 3QRXA 3TS5B 2V4EC 2C9IA 1XA5A 1G33A 2K8MB 4HQ8A 2AAOA 1OOJA 4W6LA 1OXEA 1B9AA 4H3NA 2JNFA 2IE2A 1Q4DA 2QT2A 1MHOA 3DQ2A 4EULA 1K93D 5BTTB 1J7QA 1QX5B 2A48A 2V4EA 2I7AA 1A2XA 5CSJA 1MWNA 2R2IA 4N1GA 1UHKA 4KA9A 3SRYA 3EVPA 5AXIA 1MOVA 3DQ3A 3BXBA 1NIWA 4XL5A 3LF4B 1VRKA 5HW9A 3WHUB 3SSLA 1CDNA 3H1OA 4XYNA 2IS9A 4GF6B 1C7WA 1YUSA 3EK7A 4MRYA 2QZ0A 1C4FA 2BECA 4LQTA 1TCFA 5DTZA 5H88A 1DJWA 4PCWA 2LCPA 3DQHA 5KU1A 2A56B 2KQ6A 1S6IA 4J8AA 1NCXA 1GJYA 3AI5A 2WURA 2K7DA 3NEDA 3ZULA 4WQ2A 1DF0B 3PJ7A 4IK3A 3BXKA 2Q57A 2MBXA 4TZGA 5HKYA 3LVDA 2WC8A 2ZO7A 1KK8C 1YRTB 1BF5A 3CR5X 4J89A 3E5WA 2FWQA 3RWAA 1DJYA 1MXEA 2EHBA 4MVFA 2Y0GA 4IL1A 4ICBA 2WHSA 5HZTA 3GJ1A 3VGOA 1SYMA 2H5RA 2O29A 1Q4CA 4ORCB 1BT6A 4NDDA 5H87A 4EN1A 4U8DA 5BT0A 1PK0D 4IK4A 2M8UA 4W6BA 4RYWA 5DQBA 4JFGA 1GGZA 2O5GA 3VROA 1EMAA 1CDMA 4DRWA 4PALA 4ZCVA 3BOWA 1IKUA 4GESB 2HPSA 4HREE 1NUBA 5F6TA 1XFZO 3VHTB 3SVUA 4IK1A 2WIQA 3G9AA 4Z4KA 4IZNA 1YHGA 3NXAA 1RFJA 3AKAA 5DRGA 4ORBB 2K2FA 2V53A 4GGFC 1S6JA 2WSNA 2L5XB 3SJSA 3DPZA 1Q4BA 1UHNA 2CNPA 2SASA 3VRRA 4AS8A 3CZTX 3DQ6A 2JXLA 4FQOA 5HGEA 2LMTA 2QLGA 3DPXA 4GGFA 2Y4QA 3ZNIA 4ZF4A 3KEVA 3DQOA 1AVSA 3GJ2A 2PALA 3DVEA 1CDPA 1S6CA 2QACA 1JC1A 2FZUA 1YJ2A 4W6UA 1S1EA 1BODA 3ICBA 2LHLA 5HLOA 4GGNA 2LVJA 1R2UA 4LJCA 1N2DA 1FW4A 4ZINA 2CBLA 3SG5A 2AH8A 4A4CA 4DIRA 2O2BA 1X02A 4R1EA 1GL4A 1H6RA 4DXNA 2NXQA 1XFVO 2HQ8A 3EKJA 4EDSA 4M2OA 1KWOC 1ZOTB 2WHTA 3LSAA 2JWWA 3SSPA 2GGZA 4PE4A 4PE0A 3CTNA 1QXPA 1SR6B 1OMDA 1BJFA 1UUSA 1A03A 2OTEA 1FI6A 5HBDA 5AQBB 1PULA 1W7JB 4ZFSA 1IH0A 2Z1OA 3VICA 1KFXL 1Y1XA 2SCPA 2JPTA 4H48A 2G6YA 5ER4X 4JQ0D 1ZGPA 1F55A 3SSTA 3BUWB 1TOPA 1QASA 1NCZA 3SVSA 1CLMA 1ZUXA 3OSQA 2HGYA 2AHAA 2PMYA 1ZACA 4GPLB 3I5FC 1QIWA 1DF0A 4GBAA 1CDLA 1BG1A 2ZKMX 1SL8A 1M45A 2M7NA 4L1IA 4FTGA 1SCMC 1W7TA 1M63B 1YHHA 1YFPA 2G16B 3LVAA 4E68A 2KAVA 2WISA 4ZBLA 4B5YA 1ODBA 1C07A 1Q4AA 2F33A 4ORAB 2LVKA 5FVFA 5D7FA 3ST3A 1J7RA 5AEQA 3I5GC 4H3MA 2H5PA 2LLSA 2M0RA 3KO0A 2BCBA 5TNCA 4KGEA 3I5HC 2CXJA 2HETA 3DQKA 1XAEA 3DQUA 4OQWA 2VRGA 5FVGA 2P6BB 2HQWA 3VHTA 2M7LA 2KNEA 3SSKA 4YGEB 5DKQA 3E5VA 4OY4A 3LCPC 4MBEA 2I2RE 2PXWA 1KFUS 1AHRA 5B8IB 3DQIA 1S3PA 3OHMB 1TRFA 2Y1NA 1WRLA 2QPTA 3SVCA 1V1GA 1Q4EA 5DPIA 5ER5A 3CS1A 2ICRA 1S5GY 1PVAA 2JNXA 3U8PA 3SSVA 2L0PA 2DUFA 4HSZA 5DRFA 3LK1A 1RMOA 3PLFB 2B1UA 1EMFA 2QU1A 2F8PA 1FF1A 4RTCA
chains in the Genus database with same CATH superfamily
1BMOA 3B6XA 4PHNA 3JVTB 2OS8B 2JTTA 5EXCI 5K89A 1PALA 2HCGA 5DTLA 1WDCC 3AKBA 1W7SA 2JC2A 3DYEA 2BBNA 5CSNA 4GOBA 4DUQA 3LLEA 4XOWA 1CKKA 2YFPA 2E30A 2LANA 2AWKA 2QRFA 5J3XA 1JUOA 1F71A 2YE1A 5CSFA 2M29A 3F45A 2JT8A 4JPZB 2MA2A 3SG6A 4I5KA 2I18A 2OGRA 1JWDA 2HFCA 2FJYA 3FE6A 3O78A 1J1EA 1SBJA 1P28A 3NHIA 4KGFA 3B87A 1JBZA 5PALA 1S36A 4W75A 4W7FA 4LJDC 2A53B 1IRJA 3RWTA 3OX6A 1NYAA 1DTLA 3NHTA 2MJWB 3TDZA 3CGLA 1EMKA 2MLFC 5LTQA 2KHNA 3BUNB 1CMFA 5CPVA 3SV5A 2FCDA 2H9WA 4KEXA 1T14A 3KF9A 1MQ1A 2P70A 4AQIA 1DJZA 1OZSA 2LC5A 4MZJA 2O60A 3S0EA 2KDHA 1SNLA 1YRUB 2QLHA 1KFUL 3I19A 1A75B 2G2BA 3SS3A 1YR5A 1LA3A 2I94A 3BXAA 3CR4X 2LVIA 4JF9A 3IQOA 5KSZA 1NP8A 1E8AA 5KTGA 4PT1A 1GGWA 3C1VA 2LAPA 4MRXA 1G8IA 3PJBA 2OTBA 1DJGA 2L50A 2K7CA 1TCOB 1Y1AA 1RRXA 3D76A 2KQYA 4JD9A 2ERBA 2H2KA 2LHIA 1OZOA 1F4QA 4RYSA 4Q7TA 3DQAA 1ZFSA 2EMNA 1WLMA 2EGDA 2KFHA 4HRGA 1KP5A 4N5XA 5I94A 1IQ3A 4KF4A 2BBMA 3CD9A 1RMMA 1KYPA 1QTXA 1KWOB 3CGAA 2QLIA 5AANA 3BX9A 2L4HA 1LKJA 3AI4A 3I5IC 1NCYA 1UHIA 2JADA 3IF7A 1K9KA 1SPYA 3VRQA 3AAJA 2WHUA 4PPLA 4CLNA 3SIAA 1K9PA 4KW4A 1CM1A 3BUOB 4QJ3B 1HQVA 1KQVA 2HJOA 3JVTC 2OS8C 2F3ZA 1ORGA 4OKHA 3D0YB 4J88A 2KLEA 2ARLA 1B4CA 3JTDB 3SS4A 4DXQA 2HQZA 2LM5A 4QJ5B 2KFGA 2WCMA 2ZN8A 2FL1A 3KCTA 5HZSA 5GQQC 4W76A 1KK7Y 4MZLA 3I5FB 1Q73A 3M0WA 4OCIA 1BU3A 3GK1A 5EBJA 3CFFA 3K21A 4YGCB 2WCEA 1OW4A 1SCMB 4W6JA 3PJ5A 3HX4A 3CYZA 1JBAA 5DU0A 4W7XA 1SY9A 4PHKA 3PSRA 4BY4A 3ZWHA 4W6FA 5DQMA 2LP3A 3U8CA 1KSOA 1B7TZ 4DXOA 1CLLA 2QEBA 3O2PA 1Z1QA 1MUXA 2ZFDA 3ZUFA 1JSAA 2DD9A 3GK2A 1JFKA 3DD4A 3E3RA 1EMMA 4CFQA 2JU0A 2M1KB 3I5GB 2Z6YA 4M2QA 1Y1UA 1IWQA 3OX5A 1QVIZ 1CFDA 4BDUA 3R1PA 3I5HB 4W6DA 2HRSA 3DQ4A 3IP2A 1HUYA 4F0ZB 3GEXA 3A8RA 2KOTA 1QWVA 2WCFA 1K9UA 1A75A 5AFPA 4OVNF 2LMVA 3M22A 3O77A 3ST2A 1D1OA 2PASA 1B8CA 1TUZA 2YDZA 1RJVA 2GGMA 2KYCA 4N3DA 1HCJA 1CV7A 4H47A 4OR9B 1Y6WA 1CTRA 2KYFA 3B88A 1AK8A 1DVIA 3LK0A 2BCAA 4LW5A 1XQMA 2B3PA 3LF3A 4OGSA 1OOGA 4AR7A 4PDZA 3A4UB 1KYRA 3IR8A 2ZRSA 1BFPA 4WRIA 2H5QA 1QJTA 1K94A 2DUEA 1V1FA 1EL4A 2D8NA 1NX1A 2EC6C 4MLWA 1C3ZA 2JPOA 1SW8A 2G3DB 2BKIB 3NT9A 3U0LA 2H61C 2Y5IA 3B86A 3FE9A 2KI6C 2JULA 2MHHA 3DQJA 4TNCA 4GFTA 1NWDA 2K7OA 2L51A 3O6BA 1SK6D 2ZMWA 1RECA 3DQDA 1WDCB 4HQCA 4R6BA 1B8LA 2HQKA 2K7BA 4CIDA 1QYFA 5LTPA 2VVHA 3JTDC 4ZF5A 2MAZA 3CFHA 1U5IA 3NGVA 1OOFA 2KGBC 2G6XA 3R1VA 2BE6A 2IOVA 3CLNA 2LV7A 3D0YA 2Q6PA 4IK8A 2M1UA 3FS7A 3DVMA 2A46A 2JZIA 3BJHA 2KLDA 2B3QA 4W7DA 1DT7B 2VVJA 1SL7A 3ADFA 3U0KA 1OMVA 3CZ1A 4AOMA 4DKNA 1K8UA 5KTYA 4W6SA 2P71A 2G6EA 1EXRA 4GAOA 1RK9A 4R6DA 3BUMB 2E6WA 1G4YR 1XFXO 4IK5A 2DOQA 3VRNA 1XK4C 4Q7RA 1YURA 5DKRA 3BXCA 1H4UA 2NZ0A 1TTXA 4JEOA 3SS5A 1IQ5A 2EMDA 1PVBA 2A52B 3PFVA 4NQGA 4H3LA 2WC6A 1IJ5A 2RGIA 4HQ9A 2K60A 1XK4A 1J7PA 2YGUA 1EMCA 5BPJA 2WSOA 3PM8A 3VB1A 3BFBA 1QXTA 3DZTA 2NLNA 4IK9A 4JKTA 4KAGA 3DQLA 5HLVA 1YHIA 2M9GA 3W1CA 3EK4A 4HRHA 1AJ4A 1MR8A 2CT9A 5DKNA 5F9GA 5HL1A 3DQNA 1DJXA 2JQ6A 3DQFA 4PPKA 2H8VA 5IBWA 4EDOA 3LL8B 2M97A 1UP5A 1TIZA 1H8BA 2DUIA 3KHEA 1XSSA 4UTSA 2O24A 3NSIA 1MXLC 4W6PA 3DQ8A 3FIAA 3LS3A 1BOCA 5JOLA 3EKHA 1F09A 4KF5C 1DGVA 3SVBA 3FWCA 2WCHA 2GW4B 3QMEA 4P2YB 2AMIA 3SG3A 4OV2A 1GQMA 2JTZA 5HZOA 3FE8A 1ALVA 2F3YA 3I5IB 3GOFA 1XYDA 2LMUA 3M24A 1YVHA 1F0BA 4KF5A 1DJHA 2PQLA 4YI9A 3WHTB 4FQTA 1JC2A 3DPWA 4P5OE 3OBVA 5BQLA 5JJGA 4I5LB 5AERA 4BY5A 1CFPA 3CBEA 2Z6ZA 3U0NA 4KYNA 3BYAA 2H8QA 2C9JA 5DPJA 4JGEA 3K1KA 1Z1PA 2WCLA 3D75A 3KPXA 2VADA 1OXFA 2H6VA 2F2PA 3PATA 4NDCA 3RM1A 2YE0A 1AP4A 2CTNA 3DXLA 1L2OC 5I2LA 2LP2A 4W6NA 1J1DA 1OOHA 4EMQA 5FI2A 3H1RA 4W7AA 2PSRA 2KGRA 5EB6A 1CB1A 1QATA 2LVVA 1YUTA 1MOUA 4DKMA 1J7OA 3CB9A 1SKTA 4LJDA 4B30B 3GL4A 2DUHA 1TNPA 3CD1A 1KSMA 2WOSA 5DPHA 1LA0A 2M49B 2EMOA 3Q8IA 4F7FA 3P28A 1OQPA 4DXMA 4KW8A 2JXCA 1RM9A 2ZNDA 1XFWO 4Q9WA 3PN7B 3KCSA 1OMRA 4GUKA 4TZAA 2KI6D 1M46A 2BKHB 2NCPA 4OZDA 3TUYB 5I8NA 3SG2A 2QLEA 1TWOA 2IB5A 2LLUA 1M39A 3E5TA 1BLQA 1KK7Z 1IIOA 1L7ZA 1W7IB 2QDIA 3SG7A 1RROA 2Q91A 3SIBA 1GGXA 4YBHB 1YZWA 2ZO6A 2GTEA 2QEVA 3L4AA 3MSEB 1PSBA 1JF0A 4UPGA 4PE1A 1LXFC 1TNQA 3R1OA 3TMTA 3WNXB 2A4JA 2KAXA 1EMGA 2AWJA 4W6KA 3DQCA 3ZUJA 2JT0A 3LVCA 1N65A 5DTXA 2EC6B 1QLKA 3EK8A 1H4BA 3SS0A 5EB7A 4JC2A 3TZ1A 4MEWA 3NT3A 4PHMA 1EMEA 1U5IB 3DQ1A 3WLDA 1SCVA 3SVRA 4PHJA 5HYDA 4XJKA 2GX2A 3OSRA 1M31A 1C7VA 2BL0B 1CMGA 3PM2A 4DXPA 1UURA 2MLEC 4DXIA 1J55A 2L2EA 4W74A 5I2OA 1JF2A 3OB2B 1HT9A 4PE7A 2HF5A 3WXAA 3NF0A 2RH7A 4PPJA 1QX7A 4C0LA 3SVEA 3PALA 1AUIB 3NSLA 3ED8A 5LTRA 1ZMZA 1SRAA 4W6TA 2OPOA 5DTYA 3BUXB 2LUXA 2K0JA 1DMOA 1KQMC 5H89A 2LLTA 5EXBA 3RLZA 4KW9A 3TDUA 4W6AA 5G08A 3OB1B 2KBMA 3GK4X 3VRPA 4U2VA 1YX7A 4ORNA 2AWMA 3UG0A 3EVVA 1KFXS 3S0BA 3DQMA 3DF0B 3EVUA 4C0KA 4Q7UA 2JOJA 2KFFA 2KI4B 3SG4A 1XMZA 4W69A 1LS8A 3PN7C 3L4LA 4B30A 1CLBA 1GFLA 2BTJA 1B9CA 2JT3A 4GNKB 4DS7A 3TUYC 1LVCD 4L13A 4XVPA 2K61A 1QS7A 2G9BA 2LUCA 1K95A 1AJ5A 1EG3A 1WRKA 3U8AA 1DELA 4YGAA 1YTZC 3DVJA 1BR4B 3TDIA 1A4PA 1OE9B 1DJIA 2JRFA 3SSYA 3WLCA 2PVBA 4KPIA 1QLSA 3TS5C 1EG4A 4MN0A 2OTGB 4MZKA 4PFEA 4NWSA 4OHSA 1MF8B 2FJUB 3NSOA 1UWOA 5J2OA 3ZTFA 2Q4UA 5FHVA 1WLZA 4N1FA 3AKOA 2ZNEA 2PXSA 2G2SB 4JRBA 1DC1A 5CSIA 2POXA 3S0FA 1NX3A 1UHJA 2A50B 3L47A 2AWLA 3NEZA 2LNKA 1PSRA 5BTTA 3S05A 1Z4HA 3HCMA 2GX0A 2BCXA 1QYOA 1UISA 2HGDA 1TNXA 2L4IA 4I5NB 4ANJA 3GB3A 5FYXA 2M3WA 1RWYA 1B7TY 2H61A 2L2CA 5LK4A 5D69A 1KYSA 3S0AA 3MGFA 2BL0C 1F8HA 2Y1MA 1N0YA 2TN4A 1YUUA 1ZGQA 4L12A 1ZUZA 1QY3A 4W7EA 3RZSA 2COLB 2H5OA 3OP0A 4XGYA 1QVIY 1JFJA 1TN4A 3CWGA 2ZMUA 1CNPA 1BR1B 4INXA 2OJKA 1L2OB 2K2AA 4LJBA 3A8SA 3P8UA 2L5YA 3SVDA 1B1GA 4XOVA 4W6CA 1JBYA 1GM0A 2ZRTA 4YGBB 1EJ3A 5EJUA 1W7UA 2KBIA 2FCEA 1S5GZ 2KSPA 4CFRA 1DGUA 1NPQA 2MRDA 2VAEA 4ZB1A 1F54A 4M2PA 1RTP1 1R6PA 1XO5A 1QIVA 4YRUA 3DY9A 4W6OA 3H4SE 1EMLA 2DD7A 3V3DA 4DCKA 1F70A 3U0MA 2QEHA 1QYQA 1Q80A 1IJ6A 1SL9A 2KI4C 5FVIA 3BFAA 3LA1A 2DDDA 4C0JA 3OGOA 4L9MA 1LINA 1NX0A 2A54B 3CABA 3TMRA 1UHHA 1K90D 2IB6A 4HE4A 1W9ZA 3B7AA 4I5JA 3DF0A 2HPWA 4P1QA 4ZF3A 1KCYA 5DPGA 2V4EB 1S26D 4HVFA 4W73A 2WORA 5HKZA 1Y0VH 2AUCA 1QV1A 1K2HA 3DQ9A 2OTGC 2WNDA 4P76A 1OSAA 4W6HA 1RMPA 3UFZA 4IJ7A 4INWA 4ETOA 4CPVA 1OOIX 4W77A 2L98A 1EH2A 1CFCA 2G5ZB 4W72A 3PIBA 1DEKA 3D78A 3IQQA 4W6MA 5HZUA 4Z4MA 4XJKB 3DQEA 1QV0A 1B47A 1YX8A 3EG5B 2P4MA 3DVKA 3BQ3A 1NSHA 3EVRA 1TUJA 1MYWA 4I2YA 3VK1A 3SVOA 1B8RA 1ZGOA 1YVLA 1WY9A 4W7RA 4D1EA 2FOTA 1IGVA 1DQEA 1NX2A 3FWBA 1EMBA 1XVJA 2ISDA 3O4YA 3ST0A 2OKWA 4A4BA 2NCOA 4ZIOA 4MSPA 2LE9B 3DQ7A 3UNWA 1SR6C 4USLA 3NSKA 2Z6XA 2A47A 5EXUA 2KPHA 4Q04A 1YJFA 2DDCA 2ZN9A 2GV5A 4NDBA 2CCMA 1XFYO 1CM4A 1SMGA 1XFUO 3AAKA 2GW3A 3BFHA 2WC5A 4W6RA 1ALWA 2KAYA 1IG5A 2VZXA 3N7HA 1CFFA 1KK8B 1OXDA 4JWQA 5I2QA 1G7KA 1KQMB 1S6ZA 1TNWA 3CR2A 1F4OA 4W7CA 2F2OA 4OJ0A 3R72A 2G3OA 4YGDB 4W6IA 4W6GA 1WRZA 3SVNA 4WQ3A 4YI8A 1PRWA 1A29A 5FI7A 1FPWA 3BOWB 3ST4A 2OKYA 2WCBA 4QJ4B 3IVTA 5EHUA 5HKWA 4LQUA 3D10A 2PRUA 5T3IA 1QX2A 2PYQA 3SSHA 1JC0A 2BE4A 3CFAA 5DY6A 3WCKA 1XA9A 1K96A 4Q9XA 3W1DA 2VVIA 2DUGA 4ZCUA 1FBVA 4AQJA 3DQ5A 2QLGB 1FI5A 3QRXA 3TS5B 2V4EC 2C9IA 1XA5A 1G33A 2K8MB 4HQ8A 2AAOA 1OOJA 4W6LA 1OXEA 1B9AA 3K1EA 4H3NA 2JNFA 2IE2A 1Q4DA 2QT2A 1MHOA 3DQ2A 4EULA 1K93D 5BTTB 1J7QA 1QX5B 2A48A 2V4EA 2I7AA 1A2XA 5CSJA 1Z2CB 1MWNA 2R2IA 4N1GA 1UHKA 4KA9A 3SRYA 3EVPA 5AXIA 1MOVA 3DQ3A 3BXBA 1NIWA 4XL5A 3LF4B 1VRKA 5HW9A 3WHUB 3SSLA 1CDNA 3H1OA 4XYNA 2IS9A 4GF6B 1C7WA 1YUSA 3EK7A 4MRYA 2QZ0A 1C4FA 3D73A 2BECA 4LQTA 1TCFA 5DTZA 5H88A 2WCJA 1DJWA 4PCWA 2LCPA 3DQHA 1C3YA 5KU1A 2A56B 2KQ6A 1S6IA 4J8AA 1NCXA 1GJYA 3AI5A 2WURA 2K7DA 3NEDA 3ZULA 4WQ2A 1DF0B 3CZ2A 3PJ7A 4IK3A 3BXKA 2Q57A 2MBXA 4TZGA 3PJIA 5HKYA 3LVDA 2WC8A 2ZO7A 1KK8C 1YRTB 1BF5A 3CR5X 4J89A 3E5WA 2FWQA 3RWAA 5DICA 1DJYA 2WCKA 1MXEA 2EHBA 4MVFA 2Y0GA 4IL1A 3V2LA 4ICBA 2WHSA 5HZTA 3GJ1A 3VGOA 1SYMA 2H5RA 2O29A 1Q4CA 4ORCB 1BT6A 4NDDA 5H87A 4EN1A 4U8DA 5BT0A 1PK0D 4IK4A 2M8UA 4W6BA 4RYWA 5DQBA 4JFGA 1GGZA 2O5GA 3VROA 1EMAA 1CDMA 4DRWA 4PALA 4ZCVA 3BOWA 1IKUA 4GESB 2HPSA 4HREE 1NUBA 5F6TA 1XFZO 3VHTB 3SVUA 4IK1A 2WIQA 3G9AA 4Z4KA 4IZNA 1YHGA 3NXAA 1RFJA 3AKAA 3CZ0A 5DRGA 3D77A 4ORBB 2K2FA 2V53A 4GGFC 1S6JA 2WSNA 2L5XB 3SJSA 3DPZA 1Q4BA 1UHNA 2CNPA 5D3OA 2SASA 3VRRA 4AS8A 3CZTX 3DQ6A 2JXLA 4FQOA 5HGEA 2LMTA 2QLGA 2QEOA 3DPXA 3D74A 3O4XA 4GGFA 2BAPA 2Y4QA 3ZNIA 4ZF4A 3KEVA 3DQOA 1AVSA 3GJ2A 2PALA 3DVEA 1CDPA 1S6CA 2QACA 1JC1A 2FZUA 1YJ2A 4W6UA 1S1EA 1BODA 3ICBA 2LHLA 5HLOA 4GGNA 2LVJA 1R2UA 4LJCA 1N2DA 1FW4A 4ZINA 2CBLA 3SG5A 2AH8A 4A4CA 4DIRA 2O2BA 1X02A 4R1EA 1GL4A 1H6RA 4DXNA 2NXQA 1XFVO 2HQ8A 3EKJA 1XFRA 3S0DA 4EDSA 4M2OA 1KWOC 1ZOTB 2WHTA 3LSAA 2JWWA 3SSPA 2GGZA 3OGNA 4PE4A 4PE0A 3CTNA 1QXPA 1SR6B 1OMDA 1BJFA 1UUSA 1A03A 2OTEA 1FI6A 5HBDA 5AQBB 1PULA 1W7JB 4ZFSA 1IH0A 2Z1OA 3VICA 1KFXL 1Y1XA 2SCPA 2JPTA 4H48A 3S0GA 2G6YA 5ER4X 4JQ0D 1ZGPA 1F55A 3SSTA 3BUWB 1TOPA 1QASA 1NCZA 3SVSA 1CLMA 1ZUXA 3OSQA 2HGYA 2AHAA 2PMYA 1ZACA 4GPLB 3I5FC 1QIWA 1DF0A 4GBAA 1CDLA 1BG1A 2ZKMX 1SL8A 1M45A 2M7NA 4L1IA 4FTGA 1SCMC 1W7TA 1M63B 1YHHA 1YFPA 2G16B 3LVAA 4E68A 2KAVA 2WISA 4ZBLA 4B5YA 1ODBA 1C07A 1Q4AA 1SSEB 2F33A 3CDNA 4ORAB 2LVKA 5FVFA 5D7FA 5FI6A 3ST3A 1J7RA 5AEQA 3I5GC 4H3MA 2H5PA 2LLSA 3UO9A 2M0RA 3KO0A 2BCBA 5TNCA 4KGEA 3I5HC 2CXJA 2HETA 3DQKA 1XAEA 3DQUA 4OQWA 2VRGA 5FVGA 2P6BB 2HQWA 3VHTA 2M7LA 2KNEA 3SSKA 4YGEB 5DKQA 3E5VA 4OY4A 3LCPC 2BNXA 4MBEA 2I2RE 2PXWA 1KFUS 1AHRA 5B8IB 3DQIA 1S3PA 3OHMB 5EL2A 1TRFA 2Y1NA 1WRLA 2QPTA 3SVCA 1V1GA 1Q4EA 5DPIA 5ER5A 3CS1A 2ICRA 1S5GY 1PVAA 2JNXA 3U8PA 3SSVA 2L0PA 2DUFA 4HSZA 5DRFA 3LK1A 1RMOA 3PLFB 2B1UA 1EMFA 2QU1A 2F8PA 1FF1A 4RTCA
chains in the Genus database with same CATH topology
1BMOA 4PHNA 3JVTB 2OS8B 2JTTA 5EXCI 5K89A 1PALA 2HCGA 5DTLA 1WDCC 3AKBA 1W7SA 2JC2A 2BBNA 5CSNA 4GOBA 4DUQA 3LLEA 4XOWA 1CKKA 2YFPA 2E30A 2LANA 2AWKA 2QRFA 5J3XA 1JUOA 1F71A 2YE1A 5CSFA 2M29A 3F45A 2JT8A 4JPZB 2MA2A 3SG6A 4I5KA 2I18A 2OGRA 1JWDA 2HFCA 3O78A 1J1EA 1SBJA 4KGFA 1JBZA 5PALA 1S36A 4W75A 4W7FA 4LJDC 2A53B 1IRJA 3RWTA 3OX6A 1NYAA 1DTLA 2MJWB 3TDZA 3CGLA 1EMKA 2MLFC 5LTQA 2KHNA 3BUNB 1CMFA 5CPVA 3SV5A 2FCDA 2H9WA 4KEXA 3KF9A 1MQ1A 4AQIA 1DJZA 1OZSA 2LC5A 4MZJA 2O60A 2KDHA 1SNLA 1YRUB 2QLHA 1KFUL 3I19A 1A75B 2G2BA 1YR5A 1LA3A 2I94A 3BXAA 3CR4X 2LVIA 4JF9A 3IQOA 5KSZA 1NP8A 1E8AA 5KTGA 1GGWA 3C1VA 2LAPA 4MRXA 1G8IA 3PJBA 2OTBA 1DJGA 2L50A 2K7CA 1TCOB 1Y1AA 1RRXA 2KQYA 2H2KA 2LHIA 1OZOA 1F4QA 4RYSA 4Q7TA 3DQAA 1ZFSA 2EMNA 1WLMA 2EGDA 2KFHA 4HRGA 1KP5A 4N5XA 1IQ3A 4KF4A 2BBMA 3CD9A 1RMMA 1KYPA 1QTXA 1KWOB 3CGAA 2QLIA 5AANA 3BX9A 2L4HA 1LKJA 3AI4A 3I5IC 1NCYA 1UHIA 2JADA 3IF7A 1K9KA 1SPYA 3VRQA 3AAJA 2WHUA 4PPLA 4CLNA 3SIAA 1K9PA 4KW4A 1CM1A 3BUOB 4QJ3B 1HQVA 1KQVA 2HJOA 3JVTC 2OS8C 2F3ZA 4OKHA 3D0YB 4J88A 2ARLA 1B4CA 3JTDB 4DXQA 2HQZA 2LM5A 4QJ5B 2KFGA 2ZN8A 2FL1A 3KCTA 5HZSA 5GQQC 4W76A 1KK7Y 4MZLA 3I5FB 1Q73A 3M0WA 4OCIA 1BU3A 3GK1A 5EBJA 3CFFA 3K21A 4YGCB 2WCEA 1SCMB 4W6JA 3PJ5A 3HX4A 1JBAA 5DU0A 4W7XA 1SY9A 4PHKA 3PSRA 4BY4A 3ZWHA 4W6FA 5DQMA 2LP3A 3U8CA 1KSOA 1B7TZ 4DXOA 1CLLA 3O2PA 1Z1QA 1MUXA 2ZFDA 3ZUFA 1JSAA 2DD9A 3GK2A 1JFKA 3DD4A 3E3RA 1EMMA 4CFQA 2JU0A 2M1KB 3I5GB 2Z6YA 4M2QA 1Y1UA 1IWQA 3OX5A 1QVIZ 1CFDA 4BDUA 3I5HB 4W6DA 2HRSA 3DQ4A 3IP2A 1HUYA 4F0ZB 3GEXA 3A8RA 2KOTA 2WCFA 1K9UA 1A75A 5AFPA 4OVNF 2LMVA 3M22A 3O77A 3ST2A 1D1OA 2PASA 1B8CA 2YDZA 1RJVA 2GGMA 2KYCA 4N3DA 1HCJA 1CV7A 4H47A 4OR9B 1Y6WA 1CTRA 2KYFA 1AK8A 1DVIA 3LK0A 2BCAA 4LW5A 1XQMA 2B3PA 3LF3A 4OGSA 4AR7A 4PDZA 3A4UB 1KYRA 3IR8A 2ZRSA 1BFPA 4WRIA 2H5QA 1QJTA 1K94A 2DUEA 1V1FA 1EL4A 2D8NA 1NX1A 2EC6C 4MLWA 1SW8A 2G3DB 2BKIB 3NT9A 3U0LA 2H61C 2Y5IA 2KI6C 2JULA 2MHHA 3DQJA 4TNCA 1NWDA 4GFTA 2K7OA 2L51A 3O6BA 1SK6D 2ZMWA 1RECA 3DQDA 1WDCB 4HQCA 4R6BA 1B8LA 2HQKA 2K7BA 4CIDA 1QYFA 5LTPA 2VVHA 3JTDC 4ZF5A 2MAZA 3CFHA 1U5IA 2KGBC 2G6XA 2BE6A 2IOVA 3CLNA 2LV7A 3D0YA 2Q6PA 4IK8A 2M1UA 3FS7A 3DVMA 2A46A 2JZIA 2B3QA 4W7DA 1DT7B 2VVJA 1SL7A 3ADFA 3U0KA 1OMVA 4AOMA 4DKNA 1K8UA 5KTYA 4W6SA 2G6EA 1EXRA 4GAOA 1RK9A 4R6DA 3BUMB 2E6WA 1G4YR 1XFXO 4IK5A 2DOQA 3VRNA 1XK4C 4Q7RA 1YURA 5DKRA 3BXCA 1H4UA 2NZ0A 1TTXA 4JEOA 1IQ5A 2EMDA 1PVBA 2A52B 3PFVA 4NQGA 4H3LA 1IJ5A 2RGIA 4HQ9A 1XK4A 1J7PA 1EMCA 5BPJA 2WSOA 3PM8A 1QXTA 2NLNA 4IK9A 4KAGA 3DQLA 5HLVA 1YHIA 2M9GA 3W1CA 3EK4A 4HRHA 1AJ4A 1MR8A 2CT9A 5DKNA 5F9GA 3DQNA 1DJXA 2JQ6A 3DQFA 4PPKA 5IBWA 4EDOA 3LL8B 2M97A 1UP5A 1TIZA 1H8BA 2DUIA 3KHEA 1XSSA 4UTSA 2O24A 3NSIA 1MXLC 4W6PA 3DQ8A 3FIAA 3LS3A 1BOCA 5JOLA 3EKHA 1F09A 4KF5C 1DGVA 3SVBA 3FWCA 2GW4B 4P2YB 2AMIA 3SG3A 4OV2A 1GQMA 2JTZA 5HZOA 1ALVA 2F3YA 3I5IB 3GOFA 1XYDA 2LMUA 3M24A 1YVHA 1F0BA 4KF5A 1DJHA 4YI9A 3WHTB 1JC2A 3DPWA 4P5OE 5BQLA 5JJGA 4I5LB 5AERA 4BY5A 1CFPA 3CBEA 2Z6ZA 3U0NA 3BYAA 2H8QA 2C9JA 5DPJA 4JGEA 3K1KA 1Z1PA 3KPXA 2VADA 1OXFA 2H6VA 2F2PA 3PATA 4NDCA 3RM1A 2YE0A 1AP4A 2CTNA 1L2OC 5I2LA 2LP2A 4W6NA 1J1DA 4EMQA 3H1RA 4W7AA 2PSRA 2KGRA 5EB6A 1CB1A 1QATA 2LVVA 1YUTA 1MOUA 4DKMA 1J7OA 3CB9A 1SKTA 4LJDA 4B30B 3GL4A 2DUHA 1TNPA 3CD1A 1KSMA 2WOSA 5DPHA 1LA0A 2M49B 2EMOA 3P28A 1OQPA 4DXMA 4KW8A 2JXCA 1RM9A 2ZNDA 1XFWO 4Q9WA 3PN7B 3KCSA 1OMRA 4GUKA 4TZAA 2KI6D 1M46A 2BKHB 2NCPA 3TUYB 5I8NA 3SG2A 2QLEA 2IB5A 2LLUA 1M39A 3E5TA 1BLQA 1KK7Z 1L7ZA 1W7IB 3SG7A 1RROA 2Q91A 3SIBA 1GGXA 4YBHB 1YZWA 2ZO6A 3MSEB 1PSBA 1JF0A 4UPGA 4PE1A 1LXFC 1TNQA 3TMTA 3WNXB 2A4JA 2KAXA 1EMGA 2AWJA 4W6KA 3DQCA 3ZUJA 2JT0A 3LVCA 1N65A 5DTXA 2EC6B 1QLKA 3EK8A 1H4BA 3SS0A 5EB7A 4JC2A 3TZ1A 4MEWA 3NT3A 4PHMA 1EMEA 1U5IB 3DQ1A 3WLDA 1SCVA 3SVRA 4PHJA 5HYDA 4XJKA 2GX2A 3OSRA 1M31A 1C7VA 2BL0B 1CMGA 4DXPA 1UURA 2MLEC 4DXIA 1J55A 2L2EA 4W74A 5I2OA 1JF2A 3OB2B 1HT9A 4PE7A 2HF5A 3WXAA 3NF0A 2RH7A 4PPJA 1QX7A 4C0LA 3SVEA 3PALA 1AUIB 3NSLA 3ED8A 5LTRA 1ZMZA 1SRAA 4W6TA 2OPOA 5DTYA 3BUXB 2LUXA 2K0JA 1DMOA 1KQMC 5H89A 2LLTA 5EXBA 3RLZA 4KW9A 3TDUA 4W6AA 5G08A 3OB1B 2KBMA 3GK4X 3VRPA 4U2VA 1YX7A 4ORNA 2AWMA 3UG0A 3EVVA 1KFXS 3DQMA 3DF0B 3EVUA 4C0KA 4Q7UA 2JOJA 2KFFA 2KI4B 3SG4A 1XMZA 4W69A 3PN7C 4B30A 1CLBA 1GFLA 2BTJA 1B9CA 2JT3A 4GNKB 4DS7A 3TUYC 1LVCD 4L13A 4XVPA 2K61A 1QS7A 2G9BA 2LUCA 1K95A 1AJ5A 1EG3A 1WRKA 3U8AA 4YGAA 1YTZC 3DVJA 1BR4B 3TDIA 1A4PA 1OE9B 1DJIA 2JRFA 3SSYA 3WLCA 2PVBA 4KPIA 1QLSA 3TS5C 1EG4A 4MN0A 2OTGB 4MZKA 4PFEA 4NWSA 4OHSA 1MF8B 2FJUB 3NSOA 1UWOA 5J2OA 3ZTFA 2Q4UA 5FHVA 1WLZA 4N1FA 3AKOA 2ZNEA 2PXSA 2G2SB 4JRBA 5CSIA 2POXA 1NX3A 1UHJA 2A50B 2AWLA 3NEZA 2LNKA 1PSRA 5BTTA 3S05A 3HCMA 2GX0A 2BCXA 1QYOA 1UISA 2HGDA 1TNXA 2L4IA 4I5NB 4ANJA 3GB3A 5FYXA 2M3WA 1RWYA 1B7TY 2H61A 5LK4A 5D69A 1KYSA 3MGFA 2BL0C 1F8HA 2Y1MA 1N0YA 2TN4A 1YUUA 1ZGQA 4L12A 1ZUZA 1QY3A 4W7EA 2COLB 2H5OA 3OP0A 4XGYA 1QVIY 1JFJA 1TN4A 3CWGA 2ZMUA 1CNPA 1BR1B 2OJKA 1L2OB 2K2AA 4LJBA 3A8SA 3P8UA 3SVDA 1B1GA 4XOVA 4W6CA 1JBYA 2ZRTA 4YGBB 1EJ3A 5EJUA 1W7UA 2KBIA 2FCEA 1S5GZ 2KSPA 4CFRA 1DGUA 1NPQA 2MRDA 2VAEA 4ZB1A 1F54A 4M2PA 1RTP1 1R6PA 1XO5A 1QIVA 4YRUA 4W6OA 3H4SE 1EMLA 2DD7A 3V3DA 4DCKA 1F70A 3U0MA 1QYQA 1Q80A 1IJ6A 1SL9A 2KI4C 5FVIA 3LA1A 2DDDA 4C0JA 3OGOA 4L9MA 1LINA 1NX0A 2A54B 3TMRA 1UHHA 1K90D 2IB6A 4HE4A 4I5JA 3DF0A 2HPWA 4P1QA 4ZF3A 1KCYA 5DPGA 2V4EB 1S26D 4HVFA 4W73A 2WORA 5HKZA 1Y0VH 2AUCA 1QV1A 1K2HA 3DQ9A 2OTGC 2WNDA 4P76A 1OSAA 4W6HA 1RMPA 3UFZA 4ETOA 4CPVA 4W77A 2L98A 1EH2A 1CFCA 2G5ZB 4W72A 3PIBA 3IQQA 4W6MA 5HZUA 4Z4MA 4XJKB 3DQEA 1QV0A 1B47A 1YX8A 2P4MA 3DVKA 3BQ3A 1NSHA 3EVRA 1MYWA 4I2YA 3VK1A 3SVOA 1B8RA 1ZGOA 1YVLA 1WY9A 4W7RA 4D1EA 2FOTA 1IGVA 1NX2A 3FWBA 1EMBA 1XVJA 2ISDA 3O4YA 3ST0A 2OKWA 4A4BA 2NCOA 4ZIOA 4MSPA 2LE9B 3DQ7A 1SR6C 4USLA 3NSKA 2Z6XA 2A47A 5EXUA 1YJFA 4Q04A 2DDCA 2ZN9A 2GV5A 4NDBA 2CCMA 1XFYO 1CM4A 1SMGA 1XFUO 3AAKA 2GW3A 4W6RA 1ALWA 2KAYA 1IG5A 2VZXA 1CFFA 1KK8B 1OXDA 4JWQA 5I2QA 1G7KA 1KQMB 1S6ZA 1TNWA 3CR2A 1F4OA 4W7CA 2F2OA 4OJ0A 2G3OA 4YGDB 4W6IA 4W6GA 1WRZA 3SVNA 4WQ3A 4YI8A 1PRWA 1A29A 1FPWA 3BOWB 3ST4A 2OKYA 2WCBA 4QJ4B 5EHUA 5HKWA 4LQUA 3D10A 2PRUA 5T3IA 1QX2A 3SSHA 1JC0A 2BE4A 3CFAA 5DY6A 3WCKA 1XA9A 1K96A 4Q9XA 3W1DA 2VVIA 2DUGA 4ZCUA 1FBVA 4AQJA 3DQ5A 2QLGB 1FI5A 3QRXA 3TS5B 2V4EC 2C9IA 1XA5A 1G33A 2K8MB 4HQ8A 2AAOA 1OOJA 4W6LA 1OXEA 1B9AA 4H3NA 2JNFA 2IE2A 1Q4DA 2QT2A 1MHOA 3DQ2A 4EULA 1K93D 5BTTB 1J7QA 1QX5B 2A48A 2V4EA 2I7AA 1A2XA 5CSJA 1MWNA 2R2IA 4N1GA 1UHKA 4KA9A 3SRYA 3EVPA 5AXIA 1MOVA 3DQ3A 3BXBA 1NIWA 4XL5A 3LF4B 1VRKA 5HW9A 3WHUB 3SSLA 1CDNA 3H1OA 4XYNA 2IS9A 4GF6B 1C7WA 1YUSA 3EK7A 4MRYA 2QZ0A 1C4FA 2BECA 4LQTA 1TCFA 5DTZA 5H88A 1DJWA 4PCWA 2LCPA 3DQHA 5KU1A 2A56B 2KQ6A 1S6IA 4J8AA 1NCXA 1GJYA 3AI5A 2WURA 2K7DA 3NEDA 3ZULA 4WQ2A 1DF0B 3PJ7A 4IK3A 3BXKA 2Q57A 2MBXA 4TZGA 5HKYA 3LVDA 2WC8A 2ZO7A 1KK8C 1YRTB 1BF5A 3CR5X 4J89A 3E5WA 2FWQA 3RWAA 1DJYA 1MXEA 2EHBA 4MVFA 2Y0GA 4IL1A 4ICBA 2WHSA 5HZTA 3GJ1A 3VGOA 1SYMA 2H5RA 2O29A 1Q4CA 4ORCB 1BT6A 4NDDA 5H87A 4EN1A 4U8DA 5BT0A 1PK0D 4IK4A 2M8UA 4W6BA 4RYWA 5DQBA 4JFGA 1GGZA 2O5GA 3VROA 1EMAA 1CDMA 4DRWA 4PALA 4ZCVA 3BOWA 1IKUA 4GESB 2HPSA 4HREE 1NUBA 5F6TA 1XFZO 3VHTB 3SVUA 4IK1A 2WIQA 3G9AA 4Z4KA 4IZNA 1YHGA 3NXAA 1RFJA 3AKAA 5DRGA 4ORBB 2K2FA 2V53A 4GGFC 1S6JA 2WSNA 2L5XB 3SJSA 3DPZA 1Q4BA 1UHNA 2CNPA 2SASA 3VRRA 4AS8A 3CZTX 3DQ6A 2JXLA 4FQOA 5HGEA 2LMTA 2QLGA 3DPXA 4GGFA 2Y4QA 3ZNIA 4ZF4A 3KEVA 3DQOA 1AVSA 3GJ2A 2PALA 3DVEA 1CDPA 1S6CA 2QACA 1JC1A 2FZUA 1YJ2A 4W6UA 1S1EA 1BODA 3ICBA 2LHLA 5HLOA 4GGNA 2LVJA 1R2UA 4LJCA 1N2DA 1FW4A 4ZINA 2CBLA 3SG5A 2AH8A 4A4CA 4DIRA 2O2BA 1X02A 4R1EA 1GL4A 1H6RA 4DXNA 2NXQA 1XFVO 2HQ8A 3EKJA 4EDSA 4M2OA 1KWOC 1ZOTB 2WHTA 3LSAA 2JWWA 3SSPA 2GGZA 4PE4A 4PE0A 3CTNA 1QXPA 1SR6B 1OMDA 1BJFA 1UUSA 1A03A 2OTEA 1FI6A 5HBDA 5AQBB 1PULA 1W7JB 4ZFSA 1IH0A 2Z1OA 3VICA 1KFXL 1Y1XA 2SCPA 2JPTA 4H48A 2G6YA 5ER4X 4JQ0D 1ZGPA 1F55A 3SSTA 3BUWB 1TOPA 1QASA 1NCZA 3SVSA 1CLMA 1ZUXA 3OSQA 2HGYA 2AHAA 2PMYA 1ZACA 4GPLB 3I5FC 1QIWA 1DF0A 4GBAA 1CDLA 1BG1A 2ZKMX 1SL8A 1M45A 2M7NA 4L1IA 4FTGA 1SCMC 1W7TA 1M63B 1YHHA 1YFPA 2G16B 3LVAA 4E68A 2KAVA 2WISA 4ZBLA 4B5YA 1ODBA 1C07A 1Q4AA 2F33A 4ORAB 2LVKA 5FVFA 5D7FA 3ST3A 1J7RA 5AEQA 3I5GC 4H3MA 2H5PA 2LLSA 2M0RA 3KO0A 2BCBA 5TNCA 4KGEA 3I5HC 2CXJA 2HETA 3DQKA 1XAEA 3DQUA 4OQWA 2VRGA 5FVGA 2P6BB 2HQWA 3VHTA 2M7LA 2KNEA 3SSKA 4YGEB 5DKQA 3E5VA 4OY4A 3LCPC 4MBEA 2I2RE 2PXWA 1KFUS 1AHRA 5B8IB 3DQIA 1S3PA 3OHMB 1TRFA 2Y1NA 1WRLA 2QPTA 3SVCA 1V1GA 1Q4EA 5DPIA 5ER5A 3CS1A 2ICRA 1S5GY 1PVAA 2JNXA 3U8PA 3SSVA 2L0PA 2DUFA 4HSZA 5DRFA 3LK1A 1RMOA 3PLFB 2B1UA 1EMFA 2QU1A 2F8PA 1FF1A 4RTCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BMO A;  4PHN A;  3JVT B;  2OS8 B;  2JTT A;  5EXC I;  5K89 A;  1PAL A;  2HCG A;  5DTL A;  1WDC C;  3AKB A;  1W7S A;  2JC2 A;  2BBN A;  5CSN A;  4GOB A;  4DUQ A;  3LLE A;  4XOW A;  1CKK A;  2YFP A;  2E30 A;  2LAN A;  2AWK A;  2QRF A;  5J3X A;  1JUO A;  1F71 A;  2YE1 A;  5CSF A;  2M29 A;  3F45 A;  2JT8 A;  4JPZ B;  2MA2 A;  3SG6 A;  4I5K A;  2I18 A;  2OGR A;  1JWD A;  2HFC A;  3O78 A;  1J1E A;  1SBJ A;  4KGF A;  1JBZ A;  5PAL A;  1S36 A;  4W75 A;  4W7F A;  4LJD C;  2A53 B;  1IRJ A;  3RWT A;  3OX6 A;  1NYA A;  1DTL A;  2MJW B;  3TDZ A;  3CGL A;  1EMK A;  2MLF C;  5LTQ A;  2KHN A;  3BUN B;  1CMF A;  5CPV A;  3SV5 A;  2FCD A;  2H9W A;  4KEX A;  3KF9 A;  1MQ1 A;  4AQI A;  1DJZ A;  1OZS A;  2LC5 A;  4MZJ A;  2O60 A;  2KDH A;  1SNL A;  1YRU B;  2QLH A;  1KFU L;  3I19 A;  1A75 B;  2G2B A;  1YR5 A;  1LA3 A;  2I94 A;  3BXA A;  3CR4 X;  2LVI A;  4JF9 A;  3IQO A;  5KSZ A;  1NP8 A;  1E8A A;  5KTG A;  1GGW A;  3C1V A;  2LAP A;  4MRX A;  1G8I A;  3PJB A;  2OTB A;  1DJG A;  2L50 A;  2K7C A;  1TCO B;  1Y1A A;  1RRX A;  2KQY A;  2H2K A;  2LHI A;  1OZO A;  1F4Q A;  4RYS A;  4Q7T A;  3DQA A;  1ZFS A;  2EMN A;  1WLM A;  2EGD A;  2KFH A;  4HRG A;  1KP5 A;  4N5X A;  1IQ3 A;  4KF4 A;  2BBM A;  3CD9 A;  1RMM A;  1KYP A;  1QTX A;  1KWO B;  3CGA A;  2QLI A;  5AAN A;  3BX9 A;  2L4H A;  1LKJ A;  3AI4 A;  3I5I C;  1NCY A;  1UHI A;  2JAD A;  3IF7 A;  1K9K A;  1SPY A;  3VRQ A;  3AAJ A;  2WHU A;  4PPL A;  4CLN A;  3SIA A;  1K9P A;  4KW4 A;  1CM1 A;  3BUO B;  4QJ3 B;  1HQV A;  1KQV A;  2HJO A;  3JVT C;  2OS8 C;  2F3Z A;  4OKH A;  3D0Y B;  4J88 A;  2ARL A;  1B4C A;  3JTD B;  4DXQ A;  2HQZ A;  2LM5 A;  4QJ5 B;  2KFG A;  2ZN8 A;  2FL1 A;  3KCT A;  5HZS A;  5GQQ C;  4W76 A;  1KK7 Y;  4MZL A;  3I5F B;  1Q73 A;  3M0W A;  4OCI A;  1BU3 A;  3GK1 A;  5EBJ A;  3CFF A;  3K21 A;  4YGC B;  2WCE A;  1SCM B;  4W6J A;  3PJ5 A;  3HX4 A;  1JBA A;  5DU0 A;  4W7X A;  1SY9 A;  4PHK A;  3PSR A;  4BY4 A;  3ZWH A;  4W6F A;  5DQM A;  2LP3 A;  3U8C A;  1KSO A;  1B7T Z;  4DXO A;  1CLL A;  3O2P A;  1Z1Q A;  1MUX A;  2ZFD A;  3ZUF A;  1JSA A;  2DD9 A;  3GK2 A;  1JFK A;  3DD4 A;  3E3R A;  1EMM A;  4CFQ A;  2JU0 A;  2M1K B;  3I5G B;  2Z6Y A;  4M2Q A;  1Y1U A;  1IWQ A;  3OX5 A;  1QVI Z;  1CFD A;  4BDU A;  3I5H B;  4W6D A;  2HRS A;  3DQ4 A;  3IP2 A;  1HUY A;  4F0Z B;  3GEX A;  3A8R A;  2KOT A;  2WCF A;  1K9U A;  1A75 A;  5AFP A;  4OVN F;  2LMV A;  3M22 A;  3O77 A;  3ST2 A;  1D1O A;  2PAS A;  1B8C A;  2YDZ A;  1RJV A;  2GGM A;  2KYC A;  4N3D A;  1HCJ A;  1CV7 A;  4H47 A;  4OR9 B;  1Y6W A;  1CTR A;  2KYF A;  1AK8 A;  1DVI A;  3LK0 A;  2BCA A;  4LW5 A;  1XQM A;  2B3P A;  3LF3 A;  4OGS A;  4AR7 A;  4PDZ A;  3A4U B;  1KYR A;  3IR8 A;  2ZRS A;  1BFP A;  4WRI A;  2H5Q A;  1QJT A;  1K94 A;  2DUE A;  1V1F A;  1EL4 A;  2D8N A;  1NX1 A;  2EC6 C;  4MLW A;  1SW8 A;  2G3D B;  2BKI B;  3NT9 A;  3U0L A;  2H61 C;  2Y5I A;  2KI6 C;  2JUL A;  2MHH A;  3DQJ A;  4TNC A;  1NWD A;  4GFT A;  2K7O A;  2L51 A;  3O6B A;  1SK6 D;  2ZMW A;  1REC A;  3DQD A;  1WDC B;  4HQC A;  4R6B A;  1B8L A;  2HQK A;  2K7B A;  4CID A;  1QYF A;  5LTP A;  2VVH A;  3JTD C;  4ZF5 A;  2MAZ A;  3CFH A;  1U5I A;  2KGB C;  2G6X A;  2BE6 A;  2IOV A;  3CLN A;  2LV7 A;  3D0Y A;  2Q6P A;  4IK8 A;  2M1U A;  3FS7 A;  3DVM A;  2A46 A;  2JZI A;  2B3Q A;  4W7D A;  1DT7 B;  2VVJ A;  1SL7 A;  3ADF A;  3U0K A;  1OMV A;  4AOM A;  4DKN A;  1K8U A;  5KTY A;  4W6S A;  2G6E A;  1EXR A;  4GAO A;  1RK9 A;  4R6D A;  3BUM B;  2E6W A;  1G4Y R;  1XFX O;  4IK5 A;  2DOQ A;  3VRN A;  1XK4 C;  4Q7R A;  1YUR A;  5DKR A;  3BXC A;  1H4U A;  2NZ0 A;  1TTX A;  4JEO A;  1IQ5 A;  2EMD A;  1PVB A;  2A52 B;  3PFV A;  4NQG A;  4H3L A;  1IJ5 A;  2RGI A;  4HQ9 A;  1XK4 A;  1J7P A;  1EMC A;  5BPJ A;  2WSO A;  3PM8 A;  1QXT A;  2NLN A;  4IK9 A;  4KAG A;  3DQL A;  5HLV A;  1YHI A;  2M9G A;  3W1C A;  3EK4 A;  4HRH A;  1AJ4 A;  1MR8 A;  2CT9 A;  5DKN A;  5F9G A;  3DQN A;  1DJX A;  2JQ6 A;  3DQF A;  4PPK A;  5IBW A;  4EDO A;  3LL8 B;  2M97 A;  1UP5 A;  1TIZ A;  1H8B A;  2DUI A;  3KHE A;  1XSS A;  4UTS A;  2O24 A;  3NSI A;  1MXL C;  4W6P A;  3DQ8 A;  3FIA A;  3LS3 A;  1BOC A;  5JOL A;  3EKH A;  1F09 A;  4KF5 C;  1DGV A;  3SVB A;  3FWC A;  2GW4 B;  4P2Y B;  2AMI A;  3SG3 A;  4OV2 A;  1GQM A;  2JTZ A;  5HZO A;  1ALV A;  2F3Y A;  3I5I B;  3GOF A;  1XYD A;  2LMU A;  3M24 A;  1YVH A;  1F0B A;  4KF5 A;  1DJH A;  4YI9 A;  3WHT B;  1JC2 A;  3DPW A;  4P5O E;  5BQL A;  5JJG A;  4I5L B;  5AER A;  4BY5 A;  1CFP A;  3CBE A;  2Z6Z A;  3U0N A;  3BYA A;  2H8Q A;  2C9J A;  5DPJ A;  4JGE A;  3K1K A;  1Z1P A;  3KPX A;  2VAD A;  1OXF A;  2H6V A;  2F2P A;  3PAT A;  4NDC A;  3RM1 A;  2YE0 A;  1AP4 A;  2CTN A;  1L2O C;  5I2L A;  2LP2 A;  4W6N A;  1J1D A;  4EMQ A;  3H1R A;  4W7A A;  2PSR A;  2KGR A;  5EB6 A;  1CB1 A;  1QAT A;  2LVV A;  1YUT A;  1MOU A;  4DKM A;  1J7O A;  3CB9 A;  1SKT A;  4LJD A;  4B30 B;  3GL4 A;  2DUH A;  1TNP A;  3CD1 A;  1KSM A;  2WOS A;  5DPH A;  1LA0 A;  2M49 B;  2EMO A;  3P28 A;  1OQP A;  4DXM A;  4KW8 A;  2JXC A;  1RM9 A;  2ZND A;  1XFW O;  4Q9W A;  3PN7 B;  3KCS A;  1OMR A;  4GUK A;  4TZA A;  2KI6 D;  1M46 A;  2BKH B;  2NCP A;  3TUY B;  5I8N A;  3SG2 A;  2QLE A;  2IB5 A;  2LLU A;  1M39 A;  3E5T A;  1BLQ A;  1KK7 Z;  1L7Z A;  1W7I B;  3SG7 A;  1RRO A;  2Q91 A;  3SIB A;  1GGX A;  4YBH B;  1YZW A;  2ZO6 A;  3MSE B;  1PSB A;  1JF0 A;  4UPG A;  4PE1 A;  1LXF C;  1TNQ A;  3TMT A;  3WNX B;  2A4J A;  2KAX A;  1EMG A;  2AWJ A;  4W6K A;  3DQC A;  3ZUJ A;  2JT0 A;  3LVC A;  1N65 A;  5DTX A;  2EC6 B;  1QLK A;  3EK8 A;  1H4B A;  3SS0 A;  5EB7 A;  4JC2 A;  3TZ1 A;  4MEW A;  3NT3 A;  4PHM A;  1EME A;  1U5I B;  3DQ1 A;  3WLD A;  1SCV A;  3SVR A;  4PHJ A;  5HYD A;  4XJK A;  2GX2 A;  3OSR A;  1M31 A;  1C7V A;  2BL0 B;  1CMG A;  4DXP A;  1UUR A;  2MLE C;  4DXI A;  1J55 A;  2L2E A;  4W74 A;  5I2O A;  1JF2 A;  3OB2 B;  1HT9 A;  4PE7 A;  2HF5 A;  3WXA A;  3NF0 A;  2RH7 A;  4PPJ A;  1QX7 A;  4C0L A;  3SVE A;  3PAL A;  1AUI B;  3NSL A;  3ED8 A;  5LTR A;  1ZMZ A;  1SRA A;  4W6T A;  2OPO A;  5DTY A;  3BUX B;  2LUX A;  2K0J A;  1DMO A;  1KQM C;  5H89 A;  2LLT A;  5EXB A;  3RLZ A;  4KW9 A;  3TDU A;  4W6A A;  5G08 A;  3OB1 B;  2KBM A;  3GK4 X;  3VRP A;  4U2V A;  1YX7 A;  4ORN A;  2AWM A;  3UG0 A;  3EVV A;  1KFX S;  3DQM A;  3DF0 B;  3EVU A;  4C0K A;  4Q7U A;  2JOJ A;  2KFF A;  2KI4 B;  3SG4 A;  1XMZ A;  4W69 A;  3PN7 C;  4B30 A;  1CLB A;  1GFL A;  2BTJ A;  1B9C A;  2JT3 A;  4GNK B;  4DS7 A;  3TUY C;  1LVC D;  4L13 A;  4XVP A;  2K61 A;  1QS7 A;  2G9B A;  2LUC A;  1K95 A;  1AJ5 A;  1EG3 A;  1WRK A;  3U8A A;  4YGA A;  1YTZ C;  3DVJ A;  1BR4 B;  3TDI A;  1A4P A;  1OE9 B;  1DJI A;  2JRF A;  3SSY A;  3WLC A;  2PVB A;  4KPI A;  1QLS A;  3TS5 C;  1EG4 A;  4MN0 A;  2OTG B;  4MZK A;  4PFE A;  4NWS A;  4OHS A;  1MF8 B;  2FJU B;  3NSO A;  1UWO A;  5J2O A;  3ZTF A;  2Q4U A;  5FHV A;  1WLZ A;  4N1F A;  3AKO A;  2ZNE A;  2PXS A;  2G2S B;  4JRB A;  5CSI A;  2POX A;  1NX3 A;  1UHJ A;  2A50 B;  2AWL A;  3NEZ A;  2LNK A;  1PSR A;  5BTT A;  3S05 A;  3HCM A;  2GX0 A;  2BCX A;  1QYO A;  1UIS A;  2HGD A;  1TNX A;  2L4I A;  4I5N B;  4ANJ A;  3GB3 A;  5FYX A;  2M3W A;  1RWY A;  1B7T Y;  2H61 A;  5LK4 A;  5D69 A;  1KYS A;  3MGF A;  2BL0 C;  1F8H A;  2Y1M A;  1N0Y A;  2TN4 A;  1YUU A;  1ZGQ A;  4L12 A;  1ZUZ A;  1QY3 A;  4W7E A;  2COL B;  2H5O A;  3OP0 A;  4XGY A;  1QVI Y;  1JFJ A;  1TN4 A;  3CWG A;  2ZMU A;  1CNP A;  1BR1 B;  2OJK A;  1L2O B;  2K2A A;  4LJB A;  3A8S A;  3P8U A;  3SVD A;  1B1G A;  4XOV A;  4W6C A;  1JBY A;  2ZRT A;  4YGB B;  1EJ3 A;  5EJU A;  1W7U A;  2KBI A;  2FCE A;  1S5G Z;  2KSP A;  4CFR A;  1DGU A;  1NPQ A;  2MRD A;  2VAE A;  4ZB1 A;  1F54 A;  4M2P A;  1RTP 1;  1R6P A;  1XO5 A;  1QIV A;  4YRU A;  4W6O A;  3H4S E;  1EML A;  2DD7 A;  3V3D A;  4DCK A;  1F70 A;  3U0M A;  1QYQ A;  1Q80 A;  1IJ6 A;  1SL9 A;  2KI4 C;  5FVI A;  3LA1 A;  2DDD A;  4C0J A;  3OGO A;  4L9M A;  1LIN A;  1NX0 A;  2A54 B;  3TMR A;  1UHH A;  1K90 D;  2IB6 A;  4HE4 A;  4I5J A;  3DF0 A;  2HPW A;  4P1Q A;  4ZF3 A;  1KCY A;  5DPG A;  2V4E B;  1S26 D;  4HVF A;  4W73 A;  2WOR A;  5HKZ A;  1Y0V H;  2AUC A;  1QV1 A;  1K2H A;  3DQ9 A;  2OTG C;  2WND A;  4P76 A;  1OSA A;  4W6H A;  1RMP A;  3UFZ A;  4ETO A;  4CPV A;  4W77 A;  2L98 A;  1EH2 A;  1CFC A;  2G5Z B;  4W72 A;  3PIB A;  3IQQ A;  4W6M A;  5HZU A;  4Z4M A;  4XJK B;  3DQE A;  1QV0 A;  1B47 A;  1YX8 A;  2P4M A;  3DVK A;  3BQ3 A;  1NSH A;  3EVR A;  1MYW A;  4I2Y A;  3VK1 A;  3SVO A;  1B8R A;  1ZGO A;  1YVL A;  1WY9 A;  4W7R A;  4D1E A;  2FOT A;  1IGV A;  1NX2 A;  3FWB A;  1EMB A;  1XVJ A;  2ISD A;  3O4Y A;  3ST0 A;  2OKW A;  4A4B A;  2NCO A;  4ZIO A;  4MSP A;  2LE9 B;  3DQ7 A;  1SR6 C;  4USL A;  3NSK A;  2Z6X A;  2A47 A;  5EXU A;  1YJF A;  4Q04 A;  2DDC A;  2ZN9 A;  2GV5 A;  4NDB A;  2CCM A;  1XFY O;  1CM4 A;  1SMG A;  1XFU O;  3AAK A;  2GW3 A;  4W6R A;  1ALW A;  2KAY A;  1IG5 A;  2VZX A;  1CFF A;  1KK8 B;  1OXD A;  4JWQ A;  5I2Q A;  1G7K A;  1KQM B;  1S6Z A;  1TNW A;  3CR2 A;  1F4O A;  4W7C A;  2F2O A;  4OJ0 A;  2G3O A;  4YGD B;  4W6I A;  4W6G A;  1WRZ A;  3SVN A;  4WQ3 A;  4YI8 A;  1PRW A;  1A29 A;  1FPW A;  3BOW B;  3ST4 A;  2OKY A;  2WCB A;  4QJ4 B;  5EHU A;  5HKW A;  4LQU A;  3D10 A;  2PRU A;  5T3I A;  1QX2 A;  3SSH A;  1JC0 A;  2BE4 A;  3CFA A;  5DY6 A;  3WCK A;  1XA9 A;  1K96 A;  4Q9X A;  3W1D A;  2VVI A;  2DUG A;  4ZCU A;  1FBV A;  4AQJ A;  3DQ5 A;  2QLG B;  1FI5 A;  3QRX A;  3TS5 B;  2V4E C;  2C9I A;  1XA5 A;  1G33 A;  2K8M B;  4HQ8 A;  2AAO A;  1OOJ A;  4W6L A;  1OXE A;  1B9A A;  4H3N A;  2JNF A;  2IE2 A;  1Q4D A;  2QT2 A;  1MHO A;  3DQ2 A;  4EUL A;  1K93 D;  5BTT B;  1J7Q A;  1QX5 B;  2A48 A;  2V4E A;  2I7A A;  1A2X A;  5CSJ A;  1MWN A;  2R2I A;  4N1G A;  1UHK A;  4KA9 A;  3SRY A;  3EVP A;  5AXI A;  1MOV A;  3DQ3 A;  3BXB A;  1NIW A;  4XL5 A;  3LF4 B;  1VRK A;  5HW9 A;  3WHU B;  3SSL A;  1CDN A;  3H1O A;  4XYN A;  2IS9 A;  4GF6 B;  1C7W A;  1YUS A;  3EK7 A;  4MRY A;  2QZ0 A;  1C4F A;  2BEC A;  4LQT A;  1TCF A;  5DTZ A;  5H88 A;  1DJW A;  4PCW A;  2LCP A;  3DQH A;  5KU1 A;  2A56 B;  2KQ6 A;  1S6I A;  4J8A A;  1NCX A;  1GJY A;  3AI5 A;  2WUR A;  2K7D A;  3NED A;  3ZUL A;  4WQ2 A;  1DF0 B;  3PJ7 A;  4IK3 A;  3BXK A;  2Q57 A;  2MBX A;  4TZG A;  5HKY A;  3LVD A;  2WC8 A;  2ZO7 A;  1KK8 C;  1YRT B;  1BF5 A;  3CR5 X;  4J89 A;  3E5W A;  2FWQ A;  3RWA A;  1DJY A;  1MXE A;  2EHB A;  4MVF A;  2Y0G A;  4IL1 A;  4ICB A;  2WHS A;  5HZT A;  3GJ1 A;  3VGO A;  1SYM A;  2H5R A;  2O29 A;  1Q4C A;  4ORC B;  1BT6 A;  4NDD A;  5H87 A;  4EN1 A;  4U8D A;  5BT0 A;  1PK0 D;  4IK4 A;  2M8U A;  4W6B A;  4RYW A;  5DQB A;  4JFG A;  1GGZ A;  2O5G A;  3VRO A;  1EMA A;  1CDM A;  4DRW A;  4PAL A;  4ZCV A;  3BOW A;  1IKU A;  4GES B;  2HPS A;  4HRE E;  1NUB A;  5F6T A;  1XFZ O;  3VHT B;  3SVU A;  4IK1 A;  2WIQ A;  3G9A A;  4Z4K A;  4IZN A;  1YHG A;  3NXA A;  1RFJ A;  3AKA A;  5DRG A;  4ORB B;  2K2F A;  2V53 A;  4GGF C;  1S6J A;  2WSN A;  2L5X B;  3SJS A;  3DPZ A;  1Q4B A;  1UHN A;  2CNP A;  2SAS A;  3VRR A;  4AS8 A;  3CZT X;  3DQ6 A;  2JXL A;  4FQO A;  5HGE A;  2LMT A;  2QLG A;  3DPX A;  4GGF A;  2Y4Q A;  3ZNI A;  4ZF4 A;  3KEV A;  3DQO A;  1AVS A;  3GJ2 A;  2PAL A;  3DVE A;  1CDP A;  1S6C A;  2QAC A;  1JC1 A;  2FZU A;  1YJ2 A;  4W6U A;  1S1E A;  1BOD A;  3ICB A;  2LHL A;  5HLO A;  4GGN A;  2LVJ A;  1R2U A;  4LJC A;  1N2D A;  1FW4 A;  4ZIN A;  2CBL A;  3SG5 A;  2AH8 A;  4A4C A;  4DIR A;  2O2B A;  1X02 A;  4R1E A;  1GL4 A;  1H6R A;  4DXN A;  2NXQ A;  1XFV O;  2HQ8 A;  3EKJ A;  4EDS A;  4M2O A;  1KWO C;  1ZOT B;  2WHT A;  3LSA A;  2JWW A;  3SSP A;  2GGZ A;  4PE4 A;  4PE0 A;  3CTN A;  1QXP A;  1SR6 B;  1OMD A;  1BJF A;  1UUS A;  1A03 A;  2OTE A;  1FI6 A;  5HBD A;  5AQB B;  1PUL A;  1W7J B;  4ZFS A;  1IH0 A;  2Z1O A;  3VIC A;  1KFX L;  1Y1X A;  2SCP A;  2JPT A;  4H48 A;  2G6Y A;  5ER4 X;  4JQ0 D;  1ZGP A;  1F55 A;  3SST A;  3BUW B;  1TOP A;  1QAS A;  1NCZ A;  3SVS A;  1CLM A;  1ZUX A;  3OSQ A;  2HGY A;  2AHA A;  2PMY A;  1ZAC A;  4GPL B;  3I5F C;  1QIW A;  1DF0 A;  4GBA A;  1CDL A;  1BG1 A;  2ZKM X;  1SL8 A;  1M45 A;  2M7N A;  4L1I A;  4FTG A;  1SCM C;  1W7T A;  1M63 B;  1YHH A;  1YFP A;  2G16 B;  3LVA A;  4E68 A;  2KAV A;  2WIS A;  4ZBL A;  4B5Y A;  1ODB A;  1C07 A;  1Q4A A;  2F33 A;  4ORA B;  2LVK A;  5FVF A;  5D7F A;  3ST3 A;  1J7R A;  5AEQ A;  3I5G C;  4H3M A;  2H5P A;  2LLS A;  2M0R A;  3KO0 A;  2BCB A;  5TNC A;  4KGE A;  3I5H C;  2CXJ A;  2HET A;  3DQK A;  1XAE A;  3DQU A;  4OQW A;  2VRG A;  5FVG A;  2P6B B;  2HQW A;  3VHT A;  2M7L A;  2KNE A;  3SSK A;  4YGE B;  5DKQ A;  3E5V A;  4OY4 A;  3LCP C;  4MBE A;  2I2R E;  2PXW A;  1KFU S;  1AHR A;  5B8I B;  3DQI A;  1S3P A;  3OHM B;  1TRF A;  2Y1N A;  1WRL A;  2QPT A;  3SVC A;  1V1G A;  1Q4E A;  5DPI A;  5ER5 A;  3CS1 A;  2ICR A;  1S5G Y;  1PVA A;  2JNX A;  3U8P A;  3SSV A;  2L0P A;  2DUF A;  4HSZ A;  5DRF A;  3LK1 A;  1RMO A;  3PLF B;  2B1U A;  1EMF A;  2QU1 A;  2F8P A;  1FF1 A;  4RTC A; 
#chains in the Genus database with same CATH topology
 1BMO A;  3B6X A;  4PHN A;  3JVT B;  2OS8 B;  2JTT A;  5EXC I;  5K89 A;  1PAL A;  2HCG A;  5DTL A;  1WDC C;  3AKB A;  1W7S A;  2JC2 A;  3DYE A;  2BBN A;  5CSN A;  4GOB A;  4DUQ A;  3LLE A;  4XOW A;  1CKK A;  2YFP A;  2E30 A;  2LAN A;  2AWK A;  2QRF A;  5J3X A;  1JUO A;  1F71 A;  2YE1 A;  5CSF A;  2M29 A;  3F45 A;  2JT8 A;  4JPZ B;  2MA2 A;  3SG6 A;  4I5K A;  2I18 A;  2OGR A;  1JWD A;  2HFC A;  2FJY A;  3FE6 A;  3O78 A;  1J1E A;  1SBJ A;  1P28 A;  3NHI A;  4KGF A;  3B87 A;  1JBZ A;  5PAL A;  1S36 A;  4W75 A;  4W7F A;  4LJD C;  2A53 B;  1IRJ A;  3RWT A;  3OX6 A;  1NYA A;  1DTL A;  3NHT A;  2MJW B;  3TDZ A;  3CGL A;  1EMK A;  2MLF C;  5LTQ A;  2KHN A;  3BUN B;  1CMF A;  5CPV A;  3SV5 A;  2FCD A;  2H9W A;  4KEX A;  1T14 A;  3KF9 A;  1MQ1 A;  2P70 A;  4AQI A;  1DJZ A;  1OZS A;  2LC5 A;  4MZJ A;  2O60 A;  3S0E A;  2KDH A;  1SNL A;  1YRU B;  2QLH A;  1KFU L;  3I19 A;  1A75 B;  2G2B A;  3SS3 A;  1YR5 A;  1LA3 A;  2I94 A;  3BXA A;  3CR4 X;  2LVI A;  4JF9 A;  3IQO A;  5KSZ A;  1NP8 A;  1E8A A;  5KTG A;  4PT1 A;  1GGW A;  3C1V A;  2LAP A;  4MRX A;  1G8I A;  3PJB A;  2OTB A;  1DJG A;  2L50 A;  2K7C A;  1TCO B;  1Y1A A;  1RRX A;  3D76 A;  2KQY A;  4JD9 A;  2ERB A;  2H2K A;  2LHI A;  1OZO A;  1F4Q A;  4RYS A;  4Q7T A;  3DQA A;  1ZFS A;  2EMN A;  1WLM A;  2EGD A;  2KFH A;  4HRG A;  1KP5 A;  4N5X A;  5I94 A;  1IQ3 A;  4KF4 A;  2BBM A;  3CD9 A;  1RMM A;  1KYP A;  1QTX A;  1KWO B;  3CGA A;  2QLI A;  5AAN A;  3BX9 A;  2L4H A;  1LKJ A;  3AI4 A;  3I5I C;  1NCY A;  1UHI A;  2JAD A;  3IF7 A;  1K9K A;  1SPY A;  3VRQ A;  3AAJ A;  2WHU A;  4PPL A;  4CLN A;  3SIA A;  1K9P A;  4KW4 A;  1CM1 A;  3BUO B;  4QJ3 B;  1HQV A;  1KQV A;  2HJO A;  3JVT C;  2OS8 C;  2F3Z A;  1ORG A;  4OKH A;  3D0Y B;  4J88 A;  2KLE A;  2ARL A;  1B4C A;  3JTD B;  3SS4 A;  4DXQ A;  2HQZ A;  2LM5 A;  4QJ5 B;  2KFG A;  2WCM A;  2ZN8 A;  2FL1 A;  3KCT A;  5HZS A;  5GQQ C;  4W76 A;  1KK7 Y;  4MZL A;  3I5F B;  1Q73 A;  3M0W A;  4OCI A;  1BU3 A;  3GK1 A;  5EBJ A;  3CFF A;  3K21 A;  4YGC B;  2WCE A;  1OW4 A;  1SCM B;  4W6J A;  3PJ5 A;  3HX4 A;  3CYZ A;  1JBA A;  5DU0 A;  4W7X A;  1SY9 A;  4PHK A;  3PSR A;  4BY4 A;  3ZWH A;  4W6F A;  5DQM A;  2LP3 A;  3U8C A;  1KSO A;  1B7T Z;  4DXO A;  1CLL A;  2QEB A;  3O2P A;  1Z1Q A;  1MUX A;  2ZFD A;  3ZUF A;  1JSA A;  2DD9 A;  3GK2 A;  1JFK A;  3DD4 A;  3E3R A;  1EMM A;  4CFQ A;  2JU0 A;  2M1K B;  3I5G B;  2Z6Y A;  4M2Q A;  1Y1U A;  1IWQ A;  3OX5 A;  1QVI Z;  1CFD A;  4BDU A;  3R1P A;  3I5H B;  4W6D A;  2HRS A;  3DQ4 A;  3IP2 A;  1HUY A;  4F0Z B;  3GEX A;  3A8R A;  2KOT A;  1QWV A;  2WCF A;  1K9U A;  1A75 A;  5AFP A;  4OVN F;  2LMV A;  3M22 A;  3O77 A;  3ST2 A;  1D1O A;  2PAS A;  1B8C A;  1TUZ A;  2YDZ A;  1RJV A;  2GGM A;  2KYC A;  4N3D A;  1HCJ A;  1CV7 A;  4H47 A;  4OR9 B;  1Y6W A;  1CTR A;  2KYF A;  3B88 A;  1AK8 A;  1DVI A;  3LK0 A;  2BCA A;  4LW5 A;  1XQM A;  2B3P A;  3LF3 A;  4OGS A;  1OOG A;  4AR7 A;  4PDZ A;  3A4U B;  1KYR A;  3IR8 A;  2ZRS A;  1BFP A;  4WRI A;  2H5Q A;  1QJT A;  1K94 A;  2DUE A;  1V1F A;  1EL4 A;  2D8N A;  1NX1 A;  2EC6 C;  4MLW A;  1C3Z A;  2JPO A;  1SW8 A;  2G3D B;  2BKI B;  3NT9 A;  3U0L A;  2H61 C;  2Y5I A;  3B86 A;  3FE9 A;  2KI6 C;  2JUL A;  2MHH A;  3DQJ A;  4TNC A;  4GFT A;  1NWD A;  2K7O A;  2L51 A;  3O6B A;  1SK6 D;  2ZMW A;  1REC A;  3DQD A;  1WDC B;  4HQC A;  4R6B A;  1B8L A;  2HQK A;  2K7B A;  4CID A;  1QYF A;  5LTP A;  2VVH A;  3JTD C;  4ZF5 A;  2MAZ A;  3CFH A;  1U5I A;  3NGV A;  1OOF A;  2KGB C;  2G6X A;  3R1V A;  2BE6 A;  2IOV A;  3CLN A;  2LV7 A;  3D0Y A;  2Q6P A;  4IK8 A;  2M1U A;  3FS7 A;  3DVM A;  2A46 A;  2JZI A;  3BJH A;  2KLD A;  2B3Q A;  4W7D A;  1DT7 B;  2VVJ A;  1SL7 A;  3ADF A;  3U0K A;  1OMV A;  3CZ1 A;  4AOM A;  4DKN A;  1K8U A;  5KTY A;  4W6S A;  2P71 A;  2G6E A;  1EXR A;  4GAO A;  1RK9 A;  4R6D A;  3BUM B;  2E6W A;  1G4Y R;  1XFX O;  4IK5 A;  2DOQ A;  3VRN A;  1XK4 C;  4Q7R A;  1YUR A;  5DKR A;  3BXC A;  1H4U A;  2NZ0 A;  1TTX A;  4JEO A;  3SS5 A;  1IQ5 A;  2EMD A;  1PVB A;  2A52 B;  3PFV A;  4NQG A;  4H3L A;  2WC6 A;  1IJ5 A;  2RGI A;  4HQ9 A;  2K60 A;  1XK4 A;  1J7P A;  2YGU A;  1EMC A;  5BPJ A;  2WSO A;  3PM8 A;  3VB1 A;  3BFB A;  1QXT A;  3DZT A;  2NLN A;  4IK9 A;  4JKT A;  4KAG A;  3DQL A;  5HLV A;  1YHI A;  2M9G A;  3W1C A;  3EK4 A;  4HRH A;  1AJ4 A;  1MR8 A;  2CT9 A;  5DKN A;  5F9G A;  5HL1 A;  3DQN A;  1DJX A;  2JQ6 A;  3DQF A;  4PPK A;  2H8V A;  5IBW A;  4EDO A;  3LL8 B;  2M97 A;  1UP5 A;  1TIZ A;  1H8B A;  2DUI A;  3KHE A;  1XSS A;  4UTS A;  2O24 A;  3NSI A;  1MXL C;  4W6P A;  3DQ8 A;  3FIA A;  3LS3 A;  1BOC A;  5JOL A;  3EKH A;  1F09 A;  4KF5 C;  1DGV A;  3SVB A;  3FWC A;  2WCH A;  2GW4 B;  3QME A;  4P2Y B;  2AMI A;  3SG3 A;  4OV2 A;  1GQM A;  2JTZ A;  5HZO A;  3FE8 A;  1ALV A;  2F3Y A;  3I5I B;  3GOF A;  1XYD A;  2LMU A;  3M24 A;  1YVH A;  1F0B A;  4KF5 A;  1DJH A;  2PQL A;  4YI9 A;  3WHT B;  4FQT A;  1JC2 A;  3DPW A;  4P5O E;  3OBV A;  5BQL A;  5JJG A;  4I5L B;  5AER A;  4BY5 A;  1CFP A;  3CBE A;  2Z6Z A;  3U0N A;  4KYN A;  3BYA A;  2H8Q A;  2C9J A;  5DPJ A;  4JGE A;  3K1K A;  1Z1P A;  2WCL A;  3D75 A;  3KPX A;  2VAD A;  1OXF A;  2H6V A;  2F2P A;  3PAT A;  4NDC A;  3RM1 A;  2YE0 A;  1AP4 A;  2CTN A;  3DXL A;  1L2O C;  5I2L A;  2LP2 A;  4W6N A;  1J1D A;  1OOH A;  4EMQ A;  5FI2 A;  3H1R A;  4W7A A;  2PSR A;  2KGR A;  5EB6 A;  1CB1 A;  1QAT A;  2LVV A;  1YUT A;  1MOU A;  4DKM A;  1J7O A;  3CB9 A;  1SKT A;  4LJD A;  4B30 B;  3GL4 A;  2DUH A;  1TNP A;  3CD1 A;  1KSM A;  2WOS A;  5DPH A;  1LA0 A;  2M49 B;  2EMO A;  3Q8I A;  4F7F A;  3P28 A;  1OQP A;  4DXM A;  4KW8 A;  2JXC A;  1RM9 A;  2ZND A;  1XFW O;  4Q9W A;  3PN7 B;  3KCS A;  1OMR A;  4GUK A;  4TZA A;  2KI6 D;  1M46 A;  2BKH B;  2NCP A;  4OZD A;  3TUY B;  5I8N A;  3SG2 A;  2QLE A;  1TWO A;  2IB5 A;  2LLU A;  1M39 A;  3E5T A;  1BLQ A;  1KK7 Z;  1IIO A;  1L7Z A;  1W7I B;  2QDI A;  3SG7 A;  1RRO A;  2Q91 A;  3SIB A;  1GGX A;  4YBH B;  1YZW A;  2ZO6 A;  2GTE A;  2QEV A;  3L4A A;  3MSE B;  1PSB A;  1JF0 A;  4UPG A;  4PE1 A;  1LXF C;  1TNQ A;  3R1O A;  3TMT A;  3WNX B;  2A4J A;  2KAX A;  1EMG A;  2AWJ A;  4W6K A;  3DQC A;  3ZUJ A;  2JT0 A;  3LVC A;  1N65 A;  5DTX A;  2EC6 B;  1QLK A;  3EK8 A;  1H4B A;  3SS0 A;  5EB7 A;  4JC2 A;  3TZ1 A;  4MEW A;  3NT3 A;  4PHM A;  1EME A;  1U5I B;  3DQ1 A;  3WLD A;  1SCV A;  3SVR A;  4PHJ A;  5HYD A;  4XJK A;  2GX2 A;  3OSR A;  1M31 A;  1C7V A;  2BL0 B;  1CMG A;  3PM2 A;  4DXP A;  1UUR A;  2MLE C;  4DXI A;  1J55 A;  2L2E A;  4W74 A;  5I2O A;  1JF2 A;  3OB2 B;  1HT9 A;  4PE7 A;  2HF5 A;  3WXA A;  3NF0 A;  2RH7 A;  4PPJ A;  1QX7 A;  4C0L A;  3SVE A;  3PAL A;  1AUI B;  3NSL A;  3ED8 A;  5LTR A;  1ZMZ A;  1SRA A;  4W6T A;  2OPO A;  5DTY A;  3BUX B;  2LUX A;  2K0J A;  1DMO A;  1KQM C;  5H89 A;  2LLT A;  5EXB A;  3RLZ A;  4KW9 A;  3TDU A;  4W6A A;  5G08 A;  3OB1 B;  2KBM A;  3GK4 X;  3VRP A;  4U2V A;  1YX7 A;  4ORN A;  2AWM A;  3UG0 A;  3EVV A;  1KFX S;  3S0B A;  3DQM A;  3DF0 B;  3EVU A;  4C0K A;  4Q7U A;  2JOJ A;  2KFF A;  2KI4 B;  3SG4 A;  1XMZ A;  4W69 A;  1LS8 A;  3PN7 C;  3L4L A;  4B30 A;  1CLB A;  1GFL A;  2BTJ A;  1B9C A;  2JT3 A;  4GNK B;  4DS7 A;  3TUY C;  1LVC D;  4L13 A;  4XVP A;  2K61 A;  1QS7 A;  2G9B A;  2LUC A;  1K95 A;  1AJ5 A;  1EG3 A;  1WRK A;  3U8A A;  1DEL A;  4YGA A;  1YTZ C;  3DVJ A;  1BR4 B;  3TDI A;  1A4P A;  1OE9 B;  1DJI A;  2JRF A;  3SSY A;  3WLC A;  2PVB A;  4KPI A;  1QLS A;  3TS5 C;  1EG4 A;  4MN0 A;  2OTG B;  4MZK A;  4PFE A;  4NWS A;  4OHS A;  1MF8 B;  2FJU B;  3NSO A;  1UWO A;  5J2O A;  3ZTF A;  2Q4U A;  5FHV A;  1WLZ A;  4N1F A;  3AKO A;  2ZNE A;  2PXS A;  2G2S B;  4JRB A;  1DC1 A;  5CSI A;  2POX A;  3S0F A;  1NX3 A;  1UHJ A;  2A50 B;  3L47 A;  2AWL A;  3NEZ A;  2LNK A;  1PSR A;  5BTT A;  3S05 A;  1Z4H A;  3HCM A;  2GX0 A;  2BCX A;  1QYO A;  1UIS A;  2HGD A;  1TNX A;  2L4I A;  4I5N B;  4ANJ A;  3GB3 A;  5FYX A;  2M3W A;  1RWY A;  1B7T Y;  2H61 A;  2L2C A;  5LK4 A;  5D69 A;  1KYS A;  3S0A A;  3MGF A;  2BL0 C;  1F8H A;  2Y1M A;  1N0Y A;  2TN4 A;  1YUU A;  1ZGQ A;  4L12 A;  1ZUZ A;  1QY3 A;  4W7E A;  3RZS A;  2COL B;  2H5O A;  3OP0 A;  4XGY A;  1QVI Y;  1JFJ A;  1TN4 A;  3CWG A;  2ZMU A;  1CNP A;  1BR1 B;  4INX A;  2OJK A;  1L2O B;  2K2A A;  4LJB A;  3A8S A;  3P8U A;  2L5Y A;  3SVD A;  1B1G A;  4XOV A;  4W6C A;  1JBY A;  1GM0 A;  2ZRT A;  4YGB B;  1EJ3 A;  5EJU A;  1W7U A;  2KBI A;  2FCE A;  1S5G Z;  2KSP A;  4CFR A;  1DGU A;  1NPQ A;  2MRD A;  2VAE A;  4ZB1 A;  1F54 A;  4M2P A;  1RTP 1;  1R6P A;  1XO5 A;  1QIV A;  4YRU A;  3DY9 A;  4W6O A;  3H4S E;  1EML A;  2DD7 A;  3V3D A;  4DCK A;  1F70 A;  3U0M A;  2QEH A;  1QYQ A;  1Q80 A;  1IJ6 A;  1SL9 A;  2KI4 C;  5FVI A;  3BFA A;  3LA1 A;  2DDD A;  4C0J A;  3OGO A;  4L9M A;  1LIN A;  1NX0 A;  2A54 B;  3CAB A;  3TMR A;  1UHH A;  1K90 D;  2IB6 A;  4HE4 A;  1W9Z A;  3B7A A;  4I5J A;  3DF0 A;  2HPW A;  4P1Q A;  4ZF3 A;  1KCY A;  5DPG A;  2V4E B;  1S26 D;  4HVF A;  4W73 A;  2WOR A;  5HKZ A;  1Y0V H;  2AUC A;  1QV1 A;  1K2H A;  3DQ9 A;  2OTG C;  2WND A;  4P76 A;  1OSA A;  4W6H A;  1RMP A;  3UFZ A;  4IJ7 A;  4INW A;  4ETO A;  4CPV A;  1OOI X;  4W77 A;  2L98 A;  1EH2 A;  1CFC A;  2G5Z B;  4W72 A;  3PIB A;  1DEK A;  3D78 A;  3IQQ A;  4W6M A;  5HZU A;  4Z4M A;  4XJK B;  3DQE A;  1QV0 A;  1B47 A;  1YX8 A;  3EG5 B;  2P4M A;  3DVK A;  3BQ3 A;  1NSH A;  3EVR A;  1TUJ A;  1MYW A;  4I2Y A;  3VK1 A;  3SVO A;  1B8R A;  1ZGO A;  1YVL A;  1WY9 A;  4W7R A;  4D1E A;  2FOT A;  1IGV A;  1DQE A;  1NX2 A;  3FWB A;  1EMB A;  1XVJ A;  2ISD A;  3O4Y A;  3ST0 A;  2OKW A;  4A4B A;  2NCO A;  4ZIO A;  4MSP A;  2LE9 B;  3DQ7 A;  3UNW A;  1SR6 C;  4USL A;  3NSK A;  2Z6X A;  2A47 A;  5EXU A;  2KPH A;  4Q04 A;  1YJF A;  2DDC A;  2ZN9 A;  2GV5 A;  4NDB A;  2CCM A;  1XFY O;  1CM4 A;  1SMG A;  1XFU O;  3AAK A;  2GW3 A;  3BFH A;  2WC5 A;  4W6R A;  1ALW A;  2KAY A;  1IG5 A;  2VZX A;  3N7H A;  1CFF A;  1KK8 B;  1OXD A;  4JWQ A;  5I2Q A;  1G7K A;  1KQM B;  1S6Z A;  1TNW A;  3CR2 A;  1F4O A;  4W7C A;  2F2O A;  4OJ0 A;  3R72 A;  2G3O A;  4YGD B;  4W6I A;  4W6G A;  1WRZ A;  3SVN A;  4WQ3 A;  4YI8 A;  1PRW A;  1A29 A;  5FI7 A;  1FPW A;  3BOW B;  3ST4 A;  2OKY A;  2WCB A;  4QJ4 B;  3IVT A;  5EHU A;  5HKW A;  4LQU A;  3D10 A;  2PRU A;  5T3I A;  1QX2 A;  2PYQ A;  3SSH A;  1JC0 A;  2BE4 A;  3CFA A;  5DY6 A;  3WCK A;  1XA9 A;  1K96 A;  4Q9X A;  3W1D A;  2VVI A;  2DUG A;  4ZCU A;  1FBV A;  4AQJ A;  3DQ5 A;  2QLG B;  1FI5 A;  3QRX A;  3TS5 B;  2V4E C;  2C9I A;  1XA5 A;  1G33 A;  2K8M B;  4HQ8 A;  2AAO A;  1OOJ A;  4W6L A;  1OXE A;  1B9A A;  3K1E A;  4H3N A;  2JNF A;  2IE2 A;  1Q4D A;  2QT2 A;  1MHO A;  3DQ2 A;  4EUL A;  1K93 D;  5BTT B;  1J7Q A;  1QX5 B;  2A48 A;  2V4E A;  2I7A A;  1A2X A;  5CSJ A;  1Z2C B;  1MWN A;  2R2I A;  4N1G A;  1UHK A;  4KA9 A;  3SRY A;  3EVP A;  5AXI A;  1MOV A;  3DQ3 A;  3BXB A;  1NIW A;  4XL5 A;  3LF4 B;  1VRK A;  5HW9 A;  3WHU B;  3SSL A;  1CDN A;  3H1O A;  4XYN A;  2IS9 A;  4GF6 B;  1C7W A;  1YUS A;  3EK7 A;  4MRY A;  2QZ0 A;  1C4F A;  3D73 A;  2BEC A;  4LQT A;  1TCF A;  5DTZ A;  5H88 A;  2WCJ A;  1DJW A;  4PCW A;  2LCP A;  3DQH A;  1C3Y A;  5KU1 A;  2A56 B;  2KQ6 A;  1S6I A;  4J8A A;  1NCX A;  1GJY A;  3AI5 A;  2WUR A;  2K7D A;  3NED A;  3ZUL A;  4WQ2 A;  1DF0 B;  3CZ2 A;  3PJ7 A;  4IK3 A;  3BXK A;  2Q57 A;  2MBX A;  4TZG A;  3PJI A;  5HKY A;  3LVD A;  2WC8 A;  2ZO7 A;  1KK8 C;  1YRT B;  1BF5 A;  3CR5 X;  4J89 A;  3E5W A;  2FWQ A;  3RWA A;  5DIC A;  1DJY A;  2WCK A;  1MXE A;  2EHB A;  4MVF A;  2Y0G A;  4IL1 A;  3V2L A;  4ICB A;  2WHS A;  5HZT A;  3GJ1 A;  3VGO A;  1SYM A;  2H5R A;  2O29 A;  1Q4C A;  4ORC B;  1BT6 A;  4NDD A;  5H87 A;  4EN1 A;  4U8D A;  5BT0 A;  1PK0 D;  4IK4 A;  2M8U A;  4W6B A;  4RYW A;  5DQB A;  4JFG A;  1GGZ A;  2O5G A;  3VRO A;  1EMA A;  1CDM A;  4DRW A;  4PAL A;  4ZCV A;  3BOW A;  1IKU A;  4GES B;  2HPS A;  4HRE E;  1NUB A;  5F6T A;  1XFZ O;  3VHT B;  3SVU A;  4IK1 A;  2WIQ A;  3G9A A;  4Z4K A;  4IZN A;  1YHG A;  3NXA A;  1RFJ A;  3AKA A;  3CZ0 A;  5DRG A;  3D77 A;  4ORB B;  2K2F A;  2V53 A;  4GGF C;  1S6J A;  2WSN A;  2L5X B;  3SJS A;  3DPZ A;  1Q4B A;  1UHN A;  2CNP A;  5D3O A;  2SAS A;  3VRR A;  4AS8 A;  3CZT X;  3DQ6 A;  2JXL A;  4FQO A;  5HGE A;  2LMT A;  2QLG A;  2QEO A;  3DPX A;  3D74 A;  3O4X A;  4GGF A;  2BAP A;  2Y4Q A;  3ZNI A;  4ZF4 A;  3KEV A;  3DQO A;  1AVS A;  3GJ2 A;  2PAL A;  3DVE A;  1CDP A;  1S6C A;  2QAC A;  1JC1 A;  2FZU A;  1YJ2 A;  4W6U A;  1S1E A;  1BOD A;  3ICB A;  2LHL A;  5HLO A;  4GGN A;  2LVJ A;  1R2U A;  4LJC A;  1N2D A;  1FW4 A;  4ZIN A;  2CBL A;  3SG5 A;  2AH8 A;  4A4C A;  4DIR A;  2O2B A;  1X02 A;  4R1E A;  1GL4 A;  1H6R A;  4DXN A;  2NXQ A;  1XFV O;  2HQ8 A;  3EKJ A;  1XFR A;  3S0D A;  4EDS A;  4M2O A;  1KWO C;  1ZOT B;  2WHT A;  3LSA A;  2JWW A;  3SSP A;  2GGZ A;  3OGN A;  4PE4 A;  4PE0 A;  3CTN A;  1QXP A;  1SR6 B;  1OMD A;  1BJF A;  1UUS A;  1A03 A;  2OTE A;  1FI6 A;  5HBD A;  5AQB B;  1PUL A;  1W7J B;  4ZFS A;  1IH0 A;  2Z1O A;  3VIC A;  1KFX L;  1Y1X A;  2SCP A;  2JPT A;  4H48 A;  3S0G A;  2G6Y A;  5ER4 X;  4JQ0 D;  1ZGP A;  1F55 A;  3SST A;  3BUW B;  1TOP A;  1QAS A;  1NCZ A;  3SVS A;  1CLM A;  1ZUX A;  3OSQ A;  2HGY A;  2AHA A;  2PMY A;  1ZAC A;  4GPL B;  3I5F C;  1QIW A;  1DF0 A;  4GBA A;  1CDL A;  1BG1 A;  2ZKM X;  1SL8 A;  1M45 A;  2M7N A;  4L1I A;  4FTG A;  1SCM C;  1W7T A;  1M63 B;  1YHH A;  1YFP A;  2G16 B;  3LVA A;  4E68 A;  2KAV A;  2WIS A;  4ZBL A;  4B5Y A;  1ODB A;  1C07 A;  1Q4A A;  1SSE B;  2F33 A;  3CDN A;  4ORA B;  2LVK A;  5FVF A;  5D7F A;  5FI6 A;  3ST3 A;  1J7R A;  5AEQ A;  3I5G C;  4H3M A;  2H5P A;  2LLS A;  3UO9 A;  2M0R A;  3KO0 A;  2BCB A;  5TNC A;  4KGE A;  3I5H C;  2CXJ A;  2HET A;  3DQK A;  1XAE A;  3DQU A;  4OQW A;  2VRG A;  5FVG A;  2P6B B;  2HQW A;  3VHT A;  2M7L A;  2KNE A;  3SSK A;  4YGE B;  5DKQ A;  3E5V A;  4OY4 A;  3LCP C;  2BNX A;  4MBE A;  2I2R E;  2PXW A;  1KFU S;  1AHR A;  5B8I B;  3DQI A;  1S3P A;  3OHM B;  5EL2 A;  1TRF A;  2Y1N A;  1WRL A;  2QPT A;  3SVC A;  1V1G A;  1Q4E A;  5DPI A;  5ER5 A;  3CS1 A;  2ICR A;  1S5G Y;  1PVA A;  2JNX A;  3U8P A;  3SSV A;  2L0P A;  2DUF A;  4HSZ A;  5DRF A;  3LK1 A;  1RMO A;  3PLF B;  2B1U A;  1EMF A;  2QU1 A;  2F8P A;  1FF1 A;  4RTC A; 
#chains in the Genus database with same CATH homology
 1BMO A;  4PHN A;  3JVT B;  2OS8 B;  2JTT A;  5EXC I;  5K89 A;  1PAL A;  2HCG A;  5DTL A;  1WDC C;  3AKB A;  1W7S A;  2JC2 A;  2BBN A;  5CSN A;  4GOB A;  4DUQ A;  3LLE A;  4XOW A;  1CKK A;  2YFP A;  2E30 A;  2LAN A;  2AWK A;  2QRF A;  5J3X A;  1JUO A;  1F71 A;  2YE1 A;  5CSF A;  2M29 A;  3F45 A;  2JT8 A;  4JPZ B;  2MA2 A;  3SG6 A;  4I5K A;  2I18 A;  2OGR A;  1JWD A;  2HFC A;  3O78 A;  1J1E A;  1SBJ A;  4KGF A;  1JBZ A;  5PAL A;  1S36 A;  4W75 A;  4W7F A;  4LJD C;  2A53 B;  1IRJ A;  3RWT A;  3OX6 A;  1NYA A;  1DTL A;  2MJW B;  3TDZ A;  3CGL A;  1EMK A;  2MLF C;  5LTQ A;  2KHN A;  3BUN B;  1CMF A;  5CPV A;  3SV5 A;  2FCD A;  2H9W A;  4KEX A;  3KF9 A;  1MQ1 A;  4AQI A;  1DJZ A;  1OZS A;  2LC5 A;  4MZJ A;  2O60 A;  2KDH A;  1SNL A;  1YRU B;  2QLH A;  1KFU L;  3I19 A;  1A75 B;  2G2B A;  1YR5 A;  1LA3 A;  2I94 A;  3BXA A;  3CR4 X;  2LVI A;  4JF9 A;  3IQO A;  5KSZ A;  1NP8 A;  1E8A A;  5KTG A;  1GGW A;  3C1V A;  2LAP A;  4MRX A;  1G8I A;  3PJB A;  2OTB A;  1DJG A;  2L50 A;  2K7C A;  1TCO B;  1Y1A A;  1RRX A;  2KQY A;  2H2K A;  2LHI A;  1OZO A;  1F4Q A;  4RYS A;  4Q7T A;  3DQA A;  1ZFS A;  2EMN A;  1WLM A;  2EGD A;  2KFH A;  4HRG A;  1KP5 A;  4N5X A;  1IQ3 A;  4KF4 A;  2BBM A;  3CD9 A;  1RMM A;  1KYP A;  1QTX A;  1KWO B;  3CGA A;  2QLI A;  5AAN A;  3BX9 A;  2L4H A;  1LKJ A;  3AI4 A;  3I5I C;  1NCY A;  1UHI A;  2JAD A;  3IF7 A;  1K9K A;  1SPY A;  3VRQ A;  3AAJ A;  2WHU A;  4PPL A;  4CLN A;  3SIA A;  1K9P A;  4KW4 A;  1CM1 A;  3BUO B;  4QJ3 B;  1HQV A;  1KQV A;  2HJO A;  3JVT C;  2OS8 C;  2F3Z A;  4OKH A;  3D0Y B;  4J88 A;  2ARL A;  1B4C A;  3JTD B;  4DXQ A;  2HQZ A;  2LM5 A;  4QJ5 B;  2KFG A;  2ZN8 A;  2FL1 A;  3KCT A;  5HZS A;  5GQQ C;  4W76 A;  1KK7 Y;  4MZL A;  3I5F B;  1Q73 A;  3M0W A;  4OCI A;  1BU3 A;  3GK1 A;  5EBJ A;  3CFF A;  3K21 A;  4YGC B;  2WCE A;  1SCM B;  4W6J A;  3PJ5 A;  3HX4 A;  1JBA A;  5DU0 A;  4W7X A;  1SY9 A;  4PHK A;  3PSR A;  4BY4 A;  3ZWH A;  4W6F A;  5DQM A;  2LP3 A;  3U8C A;  1KSO A;  1B7T Z;  4DXO A;  1CLL A;  3O2P A;  1Z1Q A;  1MUX A;  2ZFD A;  3ZUF A;  1JSA A;  2DD9 A;  3GK2 A;  1JFK A;  3DD4 A;  3E3R A;  1EMM A;  4CFQ A;  2JU0 A;  2M1K B;  3I5G B;  2Z6Y A;  4M2Q A;  1Y1U A;  1IWQ A;  3OX5 A;  1QVI Z;  1CFD A;  4BDU A;  3I5H B;  4W6D A;  2HRS A;  3DQ4 A;  3IP2 A;  1HUY A;  4F0Z B;  3GEX A;  3A8R A;  2KOT A;  2WCF A;  1K9U A;  1A75 A;  5AFP A;  4OVN F;  2LMV A;  3M22 A;  3O77 A;  3ST2 A;  1D1O A;  2PAS A;  1B8C A;  2YDZ A;  1RJV A;  2GGM A;  2KYC A;  4N3D A;  1HCJ A;  1CV7 A;  4H47 A;  4OR9 B;  1Y6W A;  1CTR A;  2KYF A;  1AK8 A;  1DVI A;  3LK0 A;  2BCA A;  4LW5 A;  1XQM A;  2B3P A;  3LF3 A;  4OGS A;  4AR7 A;  4PDZ A;  3A4U B;  1KYR A;  3IR8 A;  2ZRS A;  1BFP A;  4WRI A;  2H5Q A;  1QJT A;  1K94 A;  2DUE A;  1V1F A;  1EL4 A;  2D8N A;  1NX1 A;  2EC6 C;  4MLW A;  1SW8 A;  2G3D B;  2BKI B;  3NT9 A;  3U0L A;  2H61 C;  2Y5I A;  2KI6 C;  2JUL A;  2MHH A;  3DQJ A;  4TNC A;  1NWD A;  4GFT A;  2K7O A;  2L51 A;  3O6B A;  1SK6 D;  2ZMW A;  1REC A;  3DQD A;  1WDC B;  4HQC A;  4R6B A;  1B8L A;  2HQK A;  2K7B A;  4CID A;  1QYF A;  5LTP A;  2VVH A;  3JTD C;  4ZF5 A;  2MAZ A;  3CFH A;  1U5I A;  2KGB C;  2G6X A;  2BE6 A;  2IOV A;  3CLN A;  2LV7 A;  3D0Y A;  2Q6P A;  4IK8 A;  2M1U A;  3FS7 A;  3DVM A;  2A46 A;  2JZI A;  2B3Q A;  4W7D A;  1DT7 B;  2VVJ A;  1SL7 A;  3ADF A;  3U0K A;  1OMV A;  4AOM A;  4DKN A;  1K8U A;  5KTY A;  4W6S A;  2G6E A;  1EXR A;  4GAO A;  1RK9 A;  4R6D A;  3BUM B;  2E6W A;  1G4Y R;  1XFX O;  4IK5 A;  2DOQ A;  3VRN A;  1XK4 C;  4Q7R A;  1YUR A;  5DKR A;  3BXC A;  1H4U A;  2NZ0 A;  1TTX A;  4JEO A;  1IQ5 A;  2EMD A;  1PVB A;  2A52 B;  3PFV A;  4NQG A;  4H3L A;  1IJ5 A;  2RGI A;  4HQ9 A;  1XK4 A;  1J7P A;  1EMC A;  5BPJ A;  2WSO A;  3PM8 A;  1QXT A;  2NLN A;  4IK9 A;  4KAG A;  3DQL A;  5HLV A;  1YHI A;  2M9G A;  3W1C A;  3EK4 A;  4HRH A;  1AJ4 A;  1MR8 A;  2CT9 A;  5DKN A;  5F9G A;  3DQN A;  1DJX A;  2JQ6 A;  3DQF A;  4PPK A;  5IBW A;  4EDO A;  3LL8 B;  2M97 A;  1UP5 A;  1TIZ A;  1H8B A;  2DUI A;  3KHE A;  1XSS A;  4UTS A;  2O24 A;  3NSI A;  1MXL C;  4W6P A;  3DQ8 A;  3FIA A;  3LS3 A;  1BOC A;  5JOL A;  3EKH A;  1F09 A;  4KF5 C;  1DGV A;  3SVB A;  3FWC A;  2GW4 B;  4P2Y B;  2AMI A;  3SG3 A;  4OV2 A;  1GQM A;  2JTZ A;  5HZO A;  1ALV A;  2F3Y A;  3I5I B;  3GOF A;  1XYD A;  2LMU A;  3M24 A;  1YVH A;  1F0B A;  4KF5 A;  1DJH A;  4YI9 A;  3WHT B;  1JC2 A;  3DPW A;  4P5O E;  5BQL A;  5JJG A;  4I5L B;  5AER A;  4BY5 A;  1CFP A;  3CBE A;  2Z6Z A;  3U0N A;  3BYA A;  2H8Q A;  2C9J A;  5DPJ A;  4JGE A;  3K1K A;  1Z1P A;  3KPX A;  2VAD A;  1OXF A;  2H6V A;  2F2P A;  3PAT A;  4NDC A;  3RM1 A;  2YE0 A;  1AP4 A;  2CTN A;  1L2O C;  5I2L A;  2LP2 A;  4W6N A;  1J1D A;  4EMQ A;  3H1R A;  4W7A A;  2PSR A;  2KGR A;  5EB6 A;  1CB1 A;  1QAT A;  2LVV A;  1YUT A;  1MOU A;  4DKM A;  1J7O A;  3CB9 A;  1SKT A;  4LJD A;  4B30 B;  3GL4 A;  2DUH A;  1TNP A;  3CD1 A;  1KSM A;  2WOS A;  5DPH A;  1LA0 A;  2M49 B;  2EMO A;  3P28 A;  1OQP A;  4DXM A;  4KW8 A;  2JXC A;  1RM9 A;  2ZND A;  1XFW O;  4Q9W A;  3PN7 B;  3KCS A;  1OMR A;  4GUK A;  4TZA A;  2KI6 D;  1M46 A;  2BKH B;  2NCP A;  3TUY B;  5I8N A;  3SG2 A;  2QLE A;  2IB5 A;  2LLU A;  1M39 A;  3E5T A;  1BLQ A;  1KK7 Z;  1L7Z A;  1W7I B;  3SG7 A;  1RRO A;  2Q91 A;  3SIB A;  1GGX A;  4YBH B;  1YZW A;  2ZO6 A;  3MSE B;  1PSB A;  1JF0 A;  4UPG A;  4PE1 A;  1LXF C;  1TNQ A;  3TMT A;  3WNX B;  2A4J A;  2KAX A;  1EMG A;  2AWJ A;  4W6K A;  3DQC A;  3ZUJ A;  2JT0 A;  3LVC A;  1N65 A;  5DTX A;  2EC6 B;  1QLK A;  3EK8 A;  1H4B A;  3SS0 A;  5EB7 A;  4JC2 A;  3TZ1 A;  4MEW A;  3NT3 A;  4PHM A;  1EME A;  1U5I B;  3DQ1 A;  3WLD A;  1SCV A;  3SVR A;  4PHJ A;  5HYD A;  4XJK A;  2GX2 A;  3OSR A;  1M31 A;  1C7V A;  2BL0 B;  1CMG A;  4DXP A;  1UUR A;  2MLE C;  4DXI A;  1J55 A;  2L2E A;  4W74 A;  5I2O A;  1JF2 A;  3OB2 B;  1HT9 A;  4PE7 A;  2HF5 A;  3WXA A;  3NF0 A;  2RH7 A;  4PPJ A;  1QX7 A;  4C0L A;  3SVE A;  3PAL A;  1AUI B;  3NSL A;  3ED8 A;  5LTR A;  1ZMZ A;  1SRA A;  4W6T A;  2OPO A;  5DTY A;  3BUX B;  2LUX A;  2K0J A;  1DMO A;  1KQM C;  5H89 A;  2LLT A;  5EXB A;  3RLZ A;  4KW9 A;  3TDU A;  4W6A A;  5G08 A;  3OB1 B;  2KBM A;  3GK4 X;  3VRP A;  4U2V A;  1YX7 A;  4ORN A;  2AWM A;  3UG0 A;  3EVV A;  1KFX S;  3DQM A;  3DF0 B;  3EVU A;  4C0K A;  4Q7U A;  2JOJ A;  2KFF A;  2KI4 B;  3SG4 A;  1XMZ A;  4W69 A;  3PN7 C;  4B30 A;  1CLB A;  1GFL A;  2BTJ A;  1B9C A;  2JT3 A;  4GNK B;  4DS7 A;  3TUY C;  1LVC D;  4L13 A;  4XVP A;  2K61 A;  1QS7 A;  2G9B A;  2LUC A;  1K95 A;  1AJ5 A;  1EG3 A;  1WRK A;  3U8A A;  4YGA A;  1YTZ C;  3DVJ A;  1BR4 B;  3TDI A;  1A4P A;  1OE9 B;  1DJI A;  2JRF A;  3SSY A;  3WLC A;  2PVB A;  4KPI A;  1QLS A;  3TS5 C;  1EG4 A;  4MN0 A;  2OTG B;  4MZK A;  4PFE A;  4NWS A;  4OHS A;  1MF8 B;  2FJU B;  3NSO A;  1UWO A;  5J2O A;  3ZTF A;  2Q4U A;  5FHV A;  1WLZ A;  4N1F A;  3AKO A;  2ZNE A;  2PXS A;  2G2S B;  4JRB A;  5CSI A;  2POX A;  1NX3 A;  1UHJ A;  2A50 B;  2AWL A;  3NEZ A;  2LNK A;  1PSR A;  5BTT A;  3S05 A;  3HCM A;  2GX0 A;  2BCX A;  1QYO A;  1UIS A;  2HGD A;  1TNX A;  2L4I A;  4I5N B;  4ANJ A;  3GB3 A;  5FYX A;  2M3W A;  1RWY A;  1B7T Y;  2H61 A;  5LK4 A;  5D69 A;  1KYS A;  3MGF A;  2BL0 C;  1F8H A;  2Y1M A;  1N0Y A;  2TN4 A;  1YUU A;  1ZGQ A;  4L12 A;  1ZUZ A;  1QY3 A;  4W7E A;  2COL B;  2H5O A;  3OP0 A;  4XGY A;  1QVI Y;  1JFJ A;  1TN4 A;  3CWG A;  2ZMU A;  1CNP A;  1BR1 B;  2OJK A;  1L2O B;  2K2A A;  4LJB A;  3A8S A;  3P8U A;  3SVD A;  1B1G A;  4XOV A;  4W6C A;  1JBY A;  2ZRT A;  4YGB B;  1EJ3 A;  5EJU A;  1W7U A;  2KBI A;  2FCE A;  1S5G Z;  2KSP A;  4CFR A;  1DGU A;  1NPQ A;  2MRD A;  2VAE A;  4ZB1 A;  1F54 A;  4M2P A;  1RTP 1;  1R6P A;  1XO5 A;  1QIV A;  4YRU A;  4W6O A;  3H4S E;  1EML A;  2DD7 A;  3V3D A;  4DCK A;  1F70 A;  3U0M A;  1QYQ A;  1Q80 A;  1IJ6 A;  1SL9 A;  2KI4 C;  5FVI A;  3LA1 A;  2DDD A;  4C0J A;  3OGO A;  4L9M A;  1LIN A;  1NX0 A;  2A54 B;  3TMR A;  1UHH A;  1K90 D;  2IB6 A;  4HE4 A;  4I5J A;  3DF0 A;  2HPW A;  4P1Q A;  4ZF3 A;  1KCY A;  5DPG A;  2V4E B;  1S26 D;  4HVF A;  4W73 A;  2WOR A;  5HKZ A;  1Y0V H;  2AUC A;  1QV1 A;  1K2H A;  3DQ9 A;  2OTG C;  2WND A;  4P76 A;  1OSA A;  4W6H A;  1RMP A;  3UFZ A;  4ETO A;  4CPV A;  4W77 A;  2L98 A;  1EH2 A;  1CFC A;  2G5Z B;  4W72 A;  3PIB A;  3IQQ A;  4W6M A;  5HZU A;  4Z4M A;  4XJK B;  3DQE A;  1QV0 A;  1B47 A;  1YX8 A;  2P4M A;  3DVK A;  3BQ3 A;  1NSH A;  3EVR A;  1MYW A;  4I2Y A;  3VK1 A;  3SVO A;  1B8R A;  1ZGO A;  1YVL A;  1WY9 A;  4W7R A;  4D1E A;  2FOT A;  1IGV A;  1NX2 A;  3FWB A;  1EMB A;  1XVJ A;  2ISD A;  3O4Y A;  3ST0 A;  2OKW A;  4A4B A;  2NCO A;  4ZIO A;  4MSP A;  2LE9 B;  3DQ7 A;  1SR6 C;  4USL A;  3NSK A;  2Z6X A;  2A47 A;  5EXU A;  1YJF A;  4Q04 A;  2DDC A;  2ZN9 A;  2GV5 A;  4NDB A;  2CCM A;  1XFY O;  1CM4 A;  1SMG A;  1XFU O;  3AAK A;  2GW3 A;  4W6R A;  1ALW A;  2KAY A;  1IG5 A;  2VZX A;  1CFF A;  1KK8 B;  1OXD A;  4JWQ A;  5I2Q A;  1G7K A;  1KQM B;  1S6Z A;  1TNW A;  3CR2 A;  1F4O A;  4W7C A;  2F2O A;  4OJ0 A;  2G3O A;  4YGD B;  4W6I A;  4W6G A;  1WRZ A;  3SVN A;  4WQ3 A;  4YI8 A;  1PRW A;  1A29 A;  1FPW A;  3BOW B;  3ST4 A;  2OKY A;  2WCB A;  4QJ4 B;  5EHU A;  5HKW A;  4LQU A;  3D10 A;  2PRU A;  5T3I A;  1QX2 A;  3SSH A;  1JC0 A;  2BE4 A;  3CFA A;  5DY6 A;  3WCK A;  1XA9 A;  1K96 A;  4Q9X A;  3W1D A;  2VVI A;  2DUG A;  4ZCU A;  1FBV A;  4AQJ A;  3DQ5 A;  2QLG B;  1FI5 A;  3QRX A;  3TS5 B;  2V4E C;  2C9I A;  1XA5 A;  1G33 A;  2K8M B;  4HQ8 A;  2AAO A;  1OOJ A;  4W6L A;  1OXE A;  1B9A A;  4H3N A;  2JNF A;  2IE2 A;  1Q4D A;  2QT2 A;  1MHO A;  3DQ2 A;  4EUL A;  1K93 D;  5BTT B;  1J7Q A;  1QX5 B;  2A48 A;  2V4E A;  2I7A A;  1A2X A;  5CSJ A;  1MWN A;  2R2I A;  4N1G A;  1UHK A;  4KA9 A;  3SRY A;  3EVP A;  5AXI A;  1MOV A;  3DQ3 A;  3BXB A;  1NIW A;  4XL5 A;  3LF4 B;  1VRK A;  5HW9 A;  3WHU B;  3SSL A;  1CDN A;  3H1O A;  4XYN A;  2IS9 A;  4GF6 B;  1C7W A;  1YUS A;  3EK7 A;  4MRY A;  2QZ0 A;  1C4F A;  2BEC A;  4LQT A;  1TCF A;  5DTZ A;  5H88 A;  1DJW A;  4PCW A;  2LCP A;  3DQH A;  5KU1 A;  2A56 B;  2KQ6 A;  1S6I A;  4J8A A;  1NCX A;  1GJY A;  3AI5 A;  2WUR A;  2K7D A;  3NED A;  3ZUL A;  4WQ2 A;  1DF0 B;  3PJ7 A;  4IK3 A;  3BXK A;  2Q57 A;  2MBX A;  4TZG A;  5HKY A;  3LVD A;  2WC8 A;  2ZO7 A;  1KK8 C;  1YRT B;  1BF5 A;  3CR5 X;  4J89 A;  3E5W A;  2FWQ A;  3RWA A;  1DJY A;  1MXE A;  2EHB A;  4MVF A;  2Y0G A;  4IL1 A;  4ICB A;  2WHS A;  5HZT A;  3GJ1 A;  3VGO A;  1SYM A;  2H5R A;  2O29 A;  1Q4C A;  4ORC B;  1BT6 A;  4NDD A;  5H87 A;  4EN1 A;  4U8D A;  5BT0 A;  1PK0 D;  4IK4 A;  2M8U A;  4W6B A;  4RYW A;  5DQB A;  4JFG A;  1GGZ A;  2O5G A;  3VRO A;  1EMA A;  1CDM A;  4DRW A;  4PAL A;  4ZCV A;  3BOW A;  1IKU A;  4GES B;  2HPS A;  4HRE E;  1NUB A;  5F6T A;  1XFZ O;  3VHT B;  3SVU A;  4IK1 A;  2WIQ A;  3G9A A;  4Z4K A;  4IZN A;  1YHG A;  3NXA A;  1RFJ A;  3AKA A;  5DRG A;  4ORB B;  2K2F A;  2V53 A;  4GGF C;  1S6J A;  2WSN A;  2L5X B;  3SJS A;  3DPZ A;  1Q4B A;  1UHN A;  2CNP A;  2SAS A;  3VRR A;  4AS8 A;  3CZT X;  3DQ6 A;  2JXL A;  4FQO A;  5HGE A;  2LMT A;  2QLG A;  3DPX A;  4GGF A;  2Y4Q A;  3ZNI A;  4ZF4 A;  3KEV A;  3DQO A;  1AVS A;  3GJ2 A;  2PAL A;  3DVE A;  1CDP A;  1S6C A;  2QAC A;  1JC1 A;  2FZU A;  1YJ2 A;  4W6U A;  1S1E A;  1BOD A;  3ICB A;  2LHL A;  5HLO A;  4GGN A;  2LVJ A;  1R2U A;  4LJC A;  1N2D A;  1FW4 A;  4ZIN A;  2CBL A;  3SG5 A;  2AH8 A;  4A4C A;  4DIR A;  2O2B A;  1X02 A;  4R1E A;  1GL4 A;  1H6R A;  4DXN A;  2NXQ A;  1XFV O;  2HQ8 A;  3EKJ A;  4EDS A;  4M2O A;  1KWO C;  1ZOT B;  2WHT A;  3LSA A;  2JWW A;  3SSP A;  2GGZ A;  4PE4 A;  4PE0 A;  3CTN A;  1QXP A;  1SR6 B;  1OMD A;  1BJF A;  1UUS A;  1A03 A;  2OTE A;  1FI6 A;  5HBD A;  5AQB B;  1PUL A;  1W7J B;  4ZFS A;  1IH0 A;  2Z1O A;  3VIC A;  1KFX L;  1Y1X A;  2SCP A;  2JPT A;  4H48 A;  2G6Y A;  5ER4 X;  4JQ0 D;  1ZGP A;  1F55 A;  3SST A;  3BUW B;  1TOP A;  1QAS A;  1NCZ A;  3SVS A;  1CLM A;  1ZUX A;  3OSQ A;  2HGY A;  2AHA A;  2PMY A;  1ZAC A;  4GPL B;  3I5F C;  1QIW A;  1DF0 A;  4GBA A;  1CDL A;  1BG1 A;  2ZKM X;  1SL8 A;  1M45 A;  2M7N A;  4L1I A;  4FTG A;  1SCM C;  1W7T A;  1M63 B;  1YHH A;  1YFP A;  2G16 B;  3LVA A;  4E68 A;  2KAV A;  2WIS A;  4ZBL A;  4B5Y A;  1ODB A;  1C07 A;  1Q4A A;  2F33 A;  4ORA B;  2LVK A;  5FVF A;  5D7F A;  3ST3 A;  1J7R A;  5AEQ A;  3I5G C;  4H3M A;  2H5P A;  2LLS A;  2M0R A;  3KO0 A;  2BCB A;  5TNC A;  4KGE A;  3I5H C;  2CXJ A;  2HET A;  3DQK A;  1XAE A;  3DQU A;  4OQW A;  2VRG A;  5FVG A;  2P6B B;  2HQW A;  3VHT A;  2M7L A;  2KNE A;  3SSK A;  4YGE B;  5DKQ A;  3E5V A;  4OY4 A;  3LCP C;  4MBE A;  2I2R E;  2PXW A;  1KFU S;  1AHR A;  5B8I B;  3DQI A;  1S3P A;  3OHM B;  1TRF A;  2Y1N A;  1WRL A;  2QPT A;  3SVC A;  1V1G A;  1Q4E A;  5DPI A;  5ER5 A;  3CS1 A;  2ICR A;  1S5G Y;  1PVA A;  2JNX A;  3U8P A;  3SSV A;  2L0P A;  2DUF A;  4HSZ A;  5DRF A;  3LK1 A;  1RMO A;  3PLF B;  2B1U A;  1EMF A;  2QU1 A;  2F8P A;  1FF1 A;  4RTC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...