3EVVA

Crystal structure of calcium bound dimeric gcamp2 (#2)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
411
structure length
385
Chain Sequence
SSRRKWNKTGHAVRAIGRLSSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Myosin light chain kinase, Green fluorescent protein, Calmod
publication title Structural Basis for Calcium Sensing by GCaMP2.
pubmed doi rcsb
source organism Aequorea victoria
molecule tags Signaling protein
total genus 100
structure length 385
sequence length 411
ec nomenclature ec 2.7.11.18: [Myosin light-chain] kinase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13499 EF-hand_7 EF-hand domain pair
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.238.10 Mainly Alpha Orthogonal Bundle Recoverin; domain 1 EF-hand 3evvA02
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 3evvA01
2WHTA 2BKHB 2VVIA 1KQVA 5DQMA 1HQVA 5AERA 2V4EA 3E3RA 2FOTA 3VRQA 1F0BA 1Q4BA 3RWTA 3V3DA 1IH0A 3PN7C 1B1GA 1JC1A 4EN1A 2WORA 1W7SA 5H89A 2LLUA 5HZTA 4W6SA 5H88A 3A8RA 3OHMB 2IOVA 1IGVA 3W1CA 1UHJA 1NYAA 4GGFA 2COLB 3KCSA 1XMZA 3LVCA 5HKYA 4ICBA 4RYWA 1QVIZ 1QIVA 5HYDA 4W6NA 1TNQA 3K1KA 1QJTA 2K7DA 4W6UA 2JWWA 3ZTFA 1XA9A 1CLLA 5HBDA 1G4YR 2JXCA 4GF6B 2QT2A 1DTLA 2OGRA 5F6TA 3SVCA 4XJKB 1TCFA 2Q91A 1UHIA 3O2PA 1XA5A 3CZTX 4I5LB 2Z6YA 2KDHA 1MYWA 2F3ZA 2FL1A 3DQ4A 2AWJA 3DQCA 1GFLA 1OXDA 3CFFA 4USLA 4OQWA 1SYMA 4FTGA 2G6EA 4W7DA 2LC5A 4W74A 1NUBA 5FVGA 1PSRA 1EMAA 1GGWA 1KSOA 1Q73A 4KPIA 3K21A 3VROA 1TNWA 1EMBA 1F09A 1TN4A 1ALWA 3AKAA 3KHEA 4GNKB 3VRRA 1IJ5A 2FJUB 5EXUA 2EMNA 2JNFA 5HW9A 1QY3A 1DT7B 2ICRA 3DVEA 2KAXA 3OX6A 4ORBB 4W7AA 4PFEA 1SW8A 2HQ8A 3DQ1A 3U8PA 4KF5C 4DXQA 5BPJA 1S26D 1YZWA 1YRTB 2MRDA 2M9GA 4EDSA 1BMOA 4HRHA 1Q4DA 4AQIA 3ZNIA 1IJ6A 1KYRA 3DF0B 2ZRTA 2KYCA 3GJ2A 4M2QA 2O60A 1HCJA 2BE4A 4MRXA 2NLNA 1UURA 2QLEA 1NPQA 2AMIA 2JOJA 2PMYA 1CDMA 1FI6A 3DVJA 5BT0A 5EXCI 2H8QA 2K0JA 1ZUZA 4W6FA 1IG5A 1XO5A 2ZO6A 1ZMZA 1FI5A 3DQKA 2CNPA 1J7RA 4LQTA 2QLGB 2KOTA 5KU1A 2AHAA 2KFGA 2HGYA 2WSNA 1OXFA 1IQ3A 1C4FA 2EGDA 4KA9A 4F0ZB 2A50B 1AJ4A 1MOVA 3CS1A 4EDOA 1MQ1A 2KFFA 3SSPA 1Y1UA 1OMDA 1LXFC 1Q80A 1Z1QA 1DJHA 1YUSA 2DDDA 1MR8A 2Z1OA 1ZACA 2DOQA 3PJ7A 3PALA 2RGIA 3U8CA 1WDCB 2JT8A 1QVIY 2OKWA 2L98A 2BBMA 2A48A 2QU1A 4I2YA 3ST3A 1EH2A 1LVCD 4YGAA 4DKMA 3SG4A 2KSPA 2LVJA 4ZF3A 3LVDA 3IQQA 5DPJA 2G2BA 4LJBA 5JJGA 2KQ6A 4W6OA 3ST4A 5FYXA 1QLKA 1M39A 3GK1A 1S5GZ 4HQ8A 4IK4A 2GW3A 1SL9A 1R6PA 4OCIA 4XJKA 2H5QA 2M1UA 5HGEA 3FS7A 1Q4EA 1CMFA 4KW8A 1G33A 3SSLA 2EMDA 2OS8C 1YVLA 3DQ9A 2VAEA 1FPWA 3IF7A 3PJBA 3NSIA 1MHOA 2WCEA 2M8UA 2WC8A 3LSAA 2KGRA 1CB1A 2FWQA 1SPYA 2BCBA 4GFTA 4DXIA 3WNXB 3AI4A 2HPSA 4KF4A 1DVIA 4PHKA 2QRFA 1H6RA 2JNXA 3MSEB 1Y6WA 1J7PA 4D1EA 3SVDA 3SVOA 2ZNEA 4JEOA 4J88A 3CTNA 5HLVA 5HZUA 3ADFA 1CFPA 2HCGA 4L12A 1RECA 1M31A 2KFHA 2LM5A 3S05A 3M22A 3SVBA 4IK9A 2LCPA 2SCPA 3NSKA 4P76A 1C07A 1BR4B 3TUYC 3VRPA 4B30A 3DQUA 1W7TA 1YHIA 3DQFA 3SG5A 1A29A 1CTRA 1RMMA 1JF2A 4JFGA 4W76A 4B5YA 1QV1A 1KQMC 4W6PA 1RTP1 2OKYA 3I5FC 1B8LA 4OVNF 4N1FA 3DD4A 5KSZA 4U2VA 3DQOA 4Q9WA 3DQLA 4GOBA 4YGEB 3C1VA 4W6KA 1NX1A 1NX0A 4NQGA 4PE7A 3D0YB 2BKIB 4L9MA 5EJUA 1JC0A 3DPWA 1KK8B 2YFPA 2KI6C 3KPXA 1CFFA 3EK4A 1CLMA 4L13A 3PSRA 2MLEC 2G9BA 3PM8A 3CFHA 1WLZA 5I2LA 4KF5A 3DQAA 3LK0A 1QLSA 4MBEA 2K61A 3VICA 2Q6PA 2ZFDA 2MA2A 1K9PA 4DXOA 3FWCA 1JSAA 3TUYB 3SVEA 5HKZA 2V53A 1K90D 2B3QA 4TZAA 1EJ3A 1CKKA 1KYPA 2D8NA 4CPVA 1OZOA 4M2PA 3NEZA 3SG2A 1J1EA 4W6TA 3VHTB 3U0MA 1OOJA 3DQ3A 1KQMB 5EHUA 3SG6A 1S5GY 1RM9A 1OZSA 1YX7A 3O4YA 1OXEA 2WSOA 4I5NB 1A2XA 2HRSA 3DQ7A 3E5WA 2KNEA 1BT6A 4P5OE 1QYOA 4MZJA 3BUMB 1Q4AA 4JGEA 2ZO7A 5DU0A 1UHNA 3KF9A 3GL4A 1S36A 3ZULA 2LHIA 2K2AA 2M49B 3I5IB 3DQIA 4MZKA 4PE1A 1Y1XA 4KGFA 1UUSA 2RH7A 3SVSA 2P4MA 3CFAA 1SKTA 4ZCUA 1CLBA 2OTBA 1LINA 2PXSA 4W6IA 1IWQA 3TDZA 1OMVA 4ZINA 4A4CA 3UG0A 3SG7A 2GGMA 2LUXA 1IQ5A 3FWBA 4BY5A 4W72A 1J1DA 4IL1A 5DY6A 3CBEA 3HX4A 2WCBA 4TZGA 4DRWA 2JXLA 3WHUB 2G3DB 3U0KA 1A75A 5FVIA 3I5GC 3DQJA 1LKJA 4PE4A 3BUWB 2MJWB 2DUHA 2GX0A 1PVBA 1R2UA 2SASA 1DGUA 1A4PA 2BCAA 2Y0GA 1GL4A 3D10A 4EULA 5D69A 1SNLA 3E5TA 2PASA 4YBHB 4JF9A 2JRFA 2PRUA 2QPTA 3D0YA 2WHSA 1GGZA 4H3LA 1DJWA 4W6CA 2L0PA 1XAEA 3DQ8A 4DUQA 1BU3A 1GGXA 1K95A 1MXLC 1FF1A 1W7JB 3BX9A 3I5HC 4Q7TA 3JTDC 3H1OA 1S6JA 4PALA 4HSZA 5AQBB 1TNPA 2LP3A 1M63B 2G5ZB 2ZN9A 5ER5A 2C9IA 3I5GB 4XOVA 1IRJA 4W6RA 1BR1B 3ED8A 1ZGOA 5TNCA 2WISA 1B8CA 3VHTA 3VRNA 1ZUXA 4PE0A 4CLNA 2ZNDA 3GOFA 5J2OA 1WDCC 3CLNA 1H4BA 2M7LA 1AHRA 3EVVA 2LVKA 1C7WA 4OV2A 3NT3A 4W77A 2DUEA 2L5XB 4FQOA 1DJXA 1MXEA 1EMFA 3BOWB 2LNKA 3BXKA 3SVNA 4ZBLA 2R2IA 1QYQA 5F9GA 1WRKA 3PATA 1MWNA 1S6IA 1CFCA 1EMCA 3SSKA 1B8RA 2K7BA 1X02A 5D7FA 2AWLA 2HETA 3I5HB 3OGOA 3JTDB 1YVHA 2GW4B 4ORCB 1EL4A 4PPKA 1BOCA 2AH8A 2O24A 4JC2A 3PJ5A 1TNXA 1K9UA 3VGOA 1AP4A 2KAYA 3U0LA 2JPTA 4A4BA 1SY9A 2G6YA 1W7UA 1KYSA 5J3XA 3IR8A 3BXCA 3CR2A 5AFPA 3OSRA 3SG3A 1QV0A 2FCEA 5H87A 4GBAA 1YR5A 1QXPA 2LMTA 3ST0A 3OB2B 1W7IB 5KTYA 1KWOC 2WCFA 2MHHA 3LL8B 2H61C 1L2OC 2Y4QA 1EMMA 4PDZA 1PK0D 4PPLA 4OY4A 4Q7RA 2BL0C 2ZMUA 1EG3A 4M2OA 4E68A 4NWSA 1BODA 1Q4CA 1TCOB 2DDCA 1JFKA 3ICBA 1DMOA 2ZN8A 4LW5A 4DIRA 3ZUJA 3LLEA 4YGBB 1F70A 2LANA 3CWGA 4YI9A 3PIBA 2Y5IA 2A47A 2F8PA 3DQ6A 4YI8A 4WQ2A 3EVRA 4Q04A 2I2RE 2LAPA 1PSBA 4CFQA 3O78A 2K7OA 4UPGA 2LVVA 3NSLA 2BCXA 1CMGA 4UTSA 4H3NA 4DXNA 2WNDA 1KK8C 4KEXA 3PFVA 4IK1A 1MF8B 1OSAA 3H4SE 2LUCA 1XFZO 3RLZA 4W6HA 3NSOA 2TN4A 4IK8A 1KP5A 2Z6ZA 2VZXA 1KWOB 4CIDA 4XGYA 4MEWA 2H5RA 1DJYA 1L2OB 3WHTB 4ZIOA 4IZNA 2CBLA 4HREE 1Z1PA 1XVJA 2BL0B 3TS5B 1NX2A 2MBXA 4HRGA 4JRBA 1RK9A 2V4EB 3DPXA 4W7CA 1RJVA 1KCYA 1QXTA 1V1GA 1WRLA 4OJ0A 5DQBA 3WLCA 1KFXS 3DF0A 4GUKA 1S6CA 3RM1A 2DD7A 3AAKA 2PVBA 2JC2A 1SCMC 3BOWA 4OR9B 1JBZA 2OTGB 2QZ0A 3LF3A 2WURA 5DTZA 2F2PA 2VADA 3CD1A 4XOWA 4HQCA 4MSPA 2L51A 2BE6A 1CDLA 5DTYA 4KW9A 3AAJA 4MRYA 1ZFSA 1RMPA 4YRUA 1DF0B 2G2SB 2I94A 4ZCVA 3NXAA 1JFJA 2QLGA 2A52B 3EK8A 4Q9XA 1BJFA 4W6DA 3GEXA 1S3PA 2LVIA 3JVTC 1QS7A 1EG4A 1D1OA 3SJSA 5LTPA 1AUIB 1SL7A 3HCMA 3SVUA 2PALA 4PPJA 2JZIA 1TRFA 3I5IC 1A03A 4WRIA 4GAOA 2YE1A 2EC6C 4KW4A 3QRXA 1YTZC 1LA0A 2CT9A 1JBAA 2NCPA 2KBIA 3DQDA 4Z4MA 5I2QA 2JADA 2HGDA 4BY4A 4DXMA 1AVSA 1SCMB 1U5IB 5IBWA 4KAGA 1OE9B 1RWYA 3WLDA 1J7OA 1K9KA 1DGVA 2Y1NA 2A56B 3E5VA 1MUXA 2L2EA 1UP5A 4OHSA 4R6DA 2LLSA 3SRYA 1YUUA 1PVAA 2E6WA 1L7ZA 2EMOA 3GJ1A 2NCOA 1K94A 3TZ1A 4AS8A 2LMVA 4C0KA 1ZOTB 2Y1MA 3SSVA 1UWOA 1XFXO 5BTTB 3JVTB 1CFDA 4C0JA 3BXBA 1J7QA 2KI4C 1OMRA 3NT9A 4W73A 1OQPA 2Q4UA 2F3YA 2YDZA 2JTTA 3BYAA 2FZUA 1JC2A 3UFZA 2LLTA 2EC6B 4HE4A 2DUIA 4CFRA 2H5OA 5DRGA 2MAZA 1JWDA 4H3MA 2BBNA 3CB9A 2HPWA 1GJYA 2H61A 1DJGA 4QJ5B 1CNPA 4MN0A 2DD9A 4Z4KA 3F45A 5CSJA 3AI5A 2C9JA 5AEQA 4QJ3B 4LJDC 1YHGA 4PHNA 4W7FA 1NX3A 1EMLA 1QTXA 1XFUO 2Q57A 4KGEA 5DKQA 1B9AA 2YE0A 5DTXA 1B7TZ 3KCTA 4W7XA 4H48A 4ANJA 4DS7A 2DUFA 1NSHA 4ORAB 3DQNA 2CCMA 2H9WA 4JQ0D 2OJKA 3DQEA 1H4UA 2QLHA 3AKOA 2KI4B 3G9AA 1DF0A 2AWKA 3OP0A 1M45A 3ZUFA 5G08A 3EVPA 2VVJA 1RFJA 2O29A 4XVPA 5DPHA 3LA1A 4W6LA 2IE2A 2PXWA 1RROA 4QJ4B 3SVRA 2QACA 3MGFA 1XSSA 3DQ2A 2O2BA 4ZFSA 2DUGA 1YX8A 1XFVO 4Q7UA 1V1FA 5EXBA 2PSRA 3U0NA 1SR6C 2P6BB 4W6JA 3M0WA 1MOUA 3PN7B 1S6ZA 1CM4A 1ZGPA 4GPLB 1QATA 3SV5A 2IS9A 3CR5X 4J8AA 1U5IA 1TOPA 3EVUA 1NP8A 3OX5A 3WCKA 1RRXA 3DQHA 2MLFC 2A53B 4DXPA 4PCWA 3BUXB 1YJ2A 4TNCA 5K89A 1EMEA 2M3WA 1K2HA 4RTCA 1J55A 1SCVA 2KGBC 1JBYA 4P1QA 1YFPA 4JPZB 2FCDA 2HF5A 2JT0A 1KFUS 4YGCB 3U8AA 1HUYA 4OGSA 5EBJA 1VRKA 1XK4C 3P28A 2H2KA 5BTTA 2M1KB 2NXQA 2ZMWA 5DTLA 2BECA 1K8UA 4B30B 2LV7A 4R1EA 3CGAA 5CSFA 1GQMA 3IP2A 1JUOA 1PULA 2M97A 4IK5A 5CSNA 1SR6B 2AUCA 3TMTA 1Y1AA 4C0LA 4DKNA 2JTZA 2KBMA 1CV7A 2G16B 1K96A 4J89A 3WXAA 3H1RA 3VK1A 1KK7Z 3KO0A 5AXIA 3LF4B 1LA3A 3NF0A 3CR4X 4IK3A 2K7CA 3CD9A 1CDPA 3SIAA 1B47A 1QASA 3KEVA 3TDIA 3GB3A 4LQUA 2JULA 4L1IA 4ETOA 1F71A 1NWDA 1B7TY 1KFUL 3DQ5A 2LMUA 2KYFA 5I8NA 1BFPA 2JQ6A 5EB7A 2H5PA 5CSIA 4HQ9A 2A54B 5EB6A 1C7VA 2I7AA 3TS5C 1K93D 2V4EC 1XFWO 3P8UA 2JU0A 4PHJA 4W7EA 5HKWA 1UHKA 2VRGA 2ZKMX 5PALA 3RWAA 1XYDA 1QX5B 1SRAA 1F4OA 1SMGA 1YUTA 1F54A 1JF0A 2LP2A 2NZ0A 2OTGC 4ZB1A 4GGFC 1S1EA 1BLQA 4RYSA 2VVHA 4I5KA 5LK4A 1WRZA 1BG1A 3OB1B 2CXJA 1YHHA 4GGNA 3PLFB 4LJDA 1SL8A 5LTQA 2LHLA 3I19A 1NIWA 3EK7A 4BDUA 1TTXA 2K8MB 1EXRA 1WLMA 5FHVA 4PHMA 1DJIA 5DPGA 2WHUA 3W1DA 3SIBA 2HJOA 5GQQC 2ARLA 3GK2A 2CTNA 3LS3A 1F55A 1N65A 5KTGA 2G3OA 5CPVA 2A46A 2HQKA 5DKNA 2IB6A 3DQMA 2KQYA 1KSMA 4NDCA 2WOSA 1SBJA 5FVFA 1G8IA 5JOLA 2M7NA 1QYFA 3FIAA 4P2YB 3GK4X 1RMOA 3ZWHA 4ZF5A 2M0RA 1AJ5A 3SSTA 3IQOA 2OPOA 3EKJA 5BQLA 1ODBA 2K2FA 3O6BA 1HT9A 3OSQA 4YGDB 3TMRA 1FW4A 4W7RA 2H6VA 1YRUB 1A75B 4AQJA 4W69A 4WQ3A 1UHHA 5B8IB 1XFYO 1UISA 2OS8B 4R6BA 3DPZA 3DVKA 1SK6D 5I2OA 1EMKA 3A4UB 5ER4X 1YJFA 2WIQA 1TIZA 4N1GA 1NCXA 4JWQA 4LJCA 2I18A 3BQ3A 2A4JA 2AAOA 3LVAA 4EMQA 2B1UA 3TDUA 4OKHA 3ST2A 4W6AA 2LE9B 2KAVA 1ALVA 5DPIA 1CDNA 1NCYA 4XYNA 1KK7Y 5HLOA 3LK1A 5AANA 1DJZA 2L4HA 3SSYA 2AWMA 3LCPC 4ZF4A 5DKRA 2HQZA 1N2DA 4GESB 3M24A 4AOMA 1ZGQA 1KFXL 1N0YA 4HVFA 1G7KA 2GX2A 1XK4A 1IKUA 4MLWA 1EMGA 1XQMA 4MZLA 3AKBA 3NEDA 2EHBA 4MVFA 2F2OA 1F8HA 2BTJA 1WY9A 2HFCA 2JT3A 4W6MA 4U8DA 1B9CA 1YURA 1FBVA 3DVMA 2OTEA 1NCZA 1PRWA 4DCKA 2E30A 4ORNA 4I5JA 2Z6XA 2G6XA 1AK8A 5HZOA 4H47A 4AR7A 3O77A 3EKHA 3SS0A 5HZSA 4NDBA 3I5FB 4N3DA 1B4CA 2ISDA 1E8AA 2POXA 1Y0VH 1F4QA 1M46A 3BUOB 5DRFA 2QLIA 2L50A 5T3IA 2B3PA 1CM1A 1PALA 3BXAA 2KI6D 3CGLA 1QIWA 3SSHA 3BUNB 1BF5A 4N5XA 2ZRSA 2HQWA 4NDDA 2F33A 1QX2A 4XL5A 5LTRA 2L4IA 2O5GA 4W6GA 2M29A 1QX7A 3A8SA 2GV5A 2IB5A 1H8BA 4W6BA 2GGZA 4W75A 2KHNA
chains in the Genus database with same CATH superfamily
2WHTA 3S0FA 2BKHB 3QMEA 2VVIA 1KQVA 5DQMA 1HQVA 5AERA 2V4EA 3E3RA 2FOTA 3VRQA 1F0BA 1Q4BA 3RWTA 3V3DA 1IH0A 3PN7C 1B1GA 1JC1A 4EN1A 2WORA 1W7SA 5H89A 5DICA 4FQTA 2LLUA 5HZTA 4W6SA 5H88A 3A8RA 3OHMB 2IOVA 1IGVA 3W1CA 1UHJA 1NYAA 4GGFA 2COLB 3KCSA 2P71A 1XMZA 3LVCA 5HKYA 4ICBA 4RYWA 1QVIZ 1QIVA 5HYDA 4W6NA 1TNQA 3K1KA 1QJTA 2K7DA 4W6UA 2JWWA 3ZTFA 1XA9A 1CLLA 5HBDA 1G4YR 2JXCA 4GF6B 2QT2A 1DTLA 2OGRA 5F6TA 3SVCA 4XJKB 1TCFA 2Q91A 1UHIA 3O2PA 1XA5A 3CZTX 4I5LB 2BNXA 2Z6YA 2KDHA 1MYWA 4IJ7A 2F3ZA 2FL1A 3DQ4A 2AWJA 3L4LA 3DQCA 1GFLA 1OXDA 3CFFA 4USLA 4OQWA 1SYMA 4FTGA 2G6EA 4W7DA 2LC5A 4W74A 1NUBA 5FVGA 1PSRA 3CDNA 1EMAA 4OZDA 1GGWA 2L5YA 1KSOA 1Q73A 4KPIA 3K21A 3VROA 1TNWA 1EMBA 1F09A 1TN4A 1ALWA 3AKAA 3KHEA 4GNKB 3VRRA 1IJ5A 2FJUB 5EXUA 2EMNA 2JNFA 3S0AA 5HW9A 1QY3A 1DT7B 2ICRA 3DVEA 2KAXA 3OX6A 4ORBB 4W7AA 4PFEA 1SW8A 2HQ8A 3DQ1A 3U8PA 4KF5C 4DXQA 5BPJA 1DEKA 1S26D 1YZWA 1YRTB 2MRDA 3R1VA 2M9GA 4EDSA 1BMOA 4HRHA 1Q4DA 4AQIA 3UNWA 3ZNIA 1IJ6A 1KYRA 3DF0B 2ZRTA 2KYCA 3GJ2A 2WCMA 4M2QA 2O60A 1HCJA 2BE4A 4MRXA 2NLNA 1UURA 2QLEA 1NPQA 2PQLA 2AMIA 2JOJA 2PMYA 1CDMA 1FI6A 3DVJA 5BT0A 5EXCI 2H8QA 2K0JA 3DYEA 1ZUZA 4W6FA 1IG5A 1XO5A 2ZO6A 1ZMZA 1FI5A 3DQKA 2CNPA 1J7RA 1DC1A 4LQTA 2QLGB 2KOTA 5KU1A 2AHAA 2KFGA 2HGYA 1IIOA 2WSNA 1OXFA 1Z4HA 1IQ3A 1C4FA 2EGDA 4KA9A 3DY9A 1TUZA 4F0ZB 2A50B 1AJ4A 1MOVA 3CS1A 4EDOA 1MQ1A 2KFFA 3SSPA 1Y1UA 1OMDA 1LXFC 1Q80A 1Z1QA 1DJHA 1YUSA 2DDDA 1MR8A 2Z1OA 1ZACA 3R1PA 2DOQA 3SS4A 3PJ7A 3PALA 2RGIA 3U8CA 1WDCB 3NHTA 2JT8A 1QVIY 2OKWA 2L98A 2BBMA 2A48A 2QU1A 4I2YA 3ST3A 1EH2A 1LVCD 4YGAA 4DKMA 3SG4A 2KSPA 2LVJA 4ZF3A 3LVDA 3IQQA 5DPJA 2G2BA 4LJBA 5JJGA 2KQ6A 4W6OA 3ST4A 5FYXA 1QLKA 1M39A 3GK1A 1S5GZ 4HQ8A 4IK4A 2GW3A 1SL9A 1R6PA 5FI2A 4OCIA 4XJKA 2H5QA 2M1UA 5HGEA 3FS7A 1Q4EA 1CMFA 4KW8A 1G33A 3SSLA 2EMDA 2OS8C 1YVLA 3DQ9A 2VAEA 1FPWA 3IF7A 3PJBA 3NSIA 1MHOA 2WCEA 2M8UA 2WC8A 3LSAA 2KGRA 1CB1A 2FWQA 1SPYA 2BCBA 4GFTA 4DXIA 3WNXB 3AI4A 2HPSA 4KF4A 1DVIA 4PHKA 2QRFA 1H6RA 2JNXA 3MSEB 3SS3A 1Y6WA 1J7PA 4D1EA 3SVDA 3SVOA 2ZNEA 4JEOA 4J88A 3CTNA 5HLVA 5HZUA 3ADFA 1CFPA 2HCGA 4L12A 1RECA 1M31A 2KFHA 2LM5A 3S05A 3M22A 3SVBA 4IK9A 2QEOA 2LCPA 2SCPA 3NSKA 4P76A 1C07A 1BR4B 3TUYC 3VRPA 4B30A 3DQUA 1W7TA 1YHIA 3DQFA 4JKTA 3EG5B 3SG5A 1A29A 1CTRA 1RMMA 5FI6A 1JF2A 4JFGA 4W76A 4B5YA 1QV1A 1KQMC 4W6PA 1RTP1 2OKYA 3I5FC 1B8LA 4OVNF 4N1FA 3DD4A 5KSZA 4U2VA 3DQOA 4Q9WA 3DQLA 4GOBA 4YGEB 3C1VA 4W6KA 1NX1A 1NX0A 4NQGA 4PE7A 3D0YB 2BKIB 4L9MA 5EJUA 1JC0A 3DPWA 1KK8B 2YFPA 2KI6C 3KPXA 1CFFA 3EK4A 2WCLA 1CLMA 4L13A 3PSRA 3DXLA 2MLEC 2G9BA 3PM8A 3CFHA 1WLZA 5I2LA 4KF5A 3DQAA 3LK0A 1QLSA 4MBEA 3S0GA 2K61A 3VICA 2Q6PA 2ZFDA 2MA2A 1K9PA 4DXOA 3CZ0A 3FWCA 1JSAA 3TUYB 3SVEA 5HKZA 2V53A 1K90D 2B3QA 4TZAA 1EJ3A 1CKKA 1KYPA 2D8NA 4CPVA 1OZOA 4M2PA 1OOFA 3NEZA 3SG2A 1J1EA 2L2CA 4W6TA 3VHTB 3U0MA 1OOJA 3N7HA 3DQ3A 1KQMB 5EHUA 3SG6A 1S5GY 1RM9A 1OZSA 1YX7A 3O4YA 1OXEA 2WSOA 4I5NB 1A2XA 2HRSA 3DQ7A 1TWOA 3E5WA 2KNEA 1BT6A 3S0EA 4P5OE 1QYOA 4MZJA 3BUMB 1Q4AA 4JGEA 2ZO7A 5DU0A 1UHNA 3KF9A 3UO9A 3GL4A 1S36A 3ZULA 3OBVA 2LHIA 2K2AA 1C3YA 2M49B 3I5IB 3DQIA 4MZKA 4PE1A 1Y1XA 4KGFA 1UUSA 2RH7A 3SVSA 2P4MA 3CFAA 1SKTA 4ZCUA 1CLBA 2OTBA 1LINA 2PXSA 4W6IA 1IWQA 3TDZA 1OMVA 3L4AA 4ZINA 4A4CA 3UG0A 2WC6A 3SG7A 2GGMA 2LUXA 1IQ5A 3FWBA 4BY5A 4W72A 2PYQA 1J1DA 4IL1A 5DY6A 3CBEA 3HX4A 2WCBA 4TZGA 4DRWA 2JXLA 3WHUB 2G3DB 3U0KA 1A75A 5FVIA 3I5GC 3DQJA 1LKJA 4PE4A 3BUWB 2MJWB 2DUHA 2GX0A 1PVBA 1R2UA 2WCHA 2SASA 1DGUA 1A4PA 2BCAA 2Y0GA 1GL4A 3D10A 4EULA 5D69A 2BAPA 1SNLA 3E5TA 2PASA 3B87A 4YBHB 4JF9A 2JRFA 2PRUA 2QPTA 3D0YA 2WHSA 1GGZA 4H3LA 3BFAA 1DJWA 4W6CA 2L0PA 1XAEA 3DQ8A 1XFRA 4DUQA 1BU3A 1GGXA 1K95A 1MXLC 1FF1A 1W7JB 3BX9A 3I5HC 4Q7TA 3JTDC 3H1OA 1S6JA 3IVTA 4PALA 4HSZA 5AQBB 3B86A 1LS8A 3CZ1A 1TNPA 1GM0A 2LP3A 1M63B 2G5ZB 2ZN9A 5ER5A 2C9IA 3I5GB 2QEHA 3CZ2A 4XOVA 1SSEB 1IRJA 4W6RA 1BR1B 3ED8A 1ZGOA 5TNCA 2WISA 1B8CA 3VHTA 3VRNA 1ZUXA 4PE0A 1W9ZA 4CLNA 2ZNDA 3GOFA 5J2OA 1WDCC 3CLNA 1H4BA 2M7LA 1AHRA 3EVVA 2LVKA 1C7WA 4OV2A 3NT3A 4W77A 2DUEA 2L5XB 4FQOA 1DJXA 1MXEA 2K60A 1EMFA 3BOWB 2LNKA 3BXKA 3SVNA 4ZBLA 2R2IA 1QYQA 5F9GA 1WRKA 3PATA 1MWNA 3S0DA 1S6IA 1CFCA 1EMCA 3SSKA 1B8RA 5HL1A 2K7BA 1X02A 1T14A 5D7FA 2AWLA 2HETA 3I5HB 3OGOA 3JTDB 1YVHA 2GW4B 4ORCB 1EL4A 4PPKA 1BOCA 2AH8A 2O24A 4JC2A 3PJ5A 1TNXA 1K9UA 3VGOA 1AP4A 2KAYA 3U0LA 2JPTA 4A4BA 1SY9A 3CABA 2G6YA 3PJIA 1W7UA 1KYSA 3PM2A 3R72A 5J3XA 3IR8A 3BXCA 3CR2A 5AFPA 3OSRA 3SG3A 1QV0A 2FCEA 5H87A 4GBAA 1YR5A 5D3OA 1QXPA 3L47A 2LMTA 5EL2A 3ST0A 3OB2B 1W7IB 2WC5A 5KTYA 1KWOC 2WCFA 2MHHA 3LL8B 2H61C 1L2OC 3VB1A 2Y4QA 1EMMA 4PDZA 1PK0D 4PPLA 4OY4A 4Q7RA 2BL0C 2ZMUA 1EG3A 3B6XA 4M2OA 4E68A 4INWA 4NWSA 1BODA 1Q4CA 1TCOB 2DDCA 1JFKA 3ICBA 1DMOA 2ZN8A 4LW5A 4DIRA 3ZUJA 3LLEA 4YGBB 1F70A 2LANA 3CWGA 4YI9A 3PIBA 2Y5IA 2A47A 2F8PA 3DQ6A 4YI8A 4WQ2A 3EVRA 4Q04A 2I2RE 2LAPA 1PSBA 4CFQA 3O78A 2K7OA 4UPGA 2LVVA 3NSLA 2BCXA 1CMGA 4UTSA 2P70A 4H3NA 4DXNA 2KPHA 2WNDA 1KK8C 4KEXA 3PFVA 4IK1A 1MF8B 1OSAA 3H4SE 2LUCA 1XFZO 3RLZA 4W6HA 3NSOA 2TN4A 4IK8A 1KP5A 2Z6ZA 2VZXA 1KWOB 4CIDA 4XGYA 4MEWA 2H5RA 1DJYA 3S0BA 1L2OB 3WHTB 2WCKA 4ZIOA 4IZNA 2CBLA 4HREE 1Z1PA 1XVJA 3FE8A 2BL0B 3TS5B 2KLDA 1NX2A 2MBXA 4HRGA 4JRBA 1RK9A 2V4EB 3DPXA 4W7CA 1RJVA 1KCYA 1QXTA 1V1GA 1WRLA 4OJ0A 5DQBA 3WLCA 1KFXS 3DF0A 4GUKA 1S6CA 3RM1A 2DD7A 3AAKA 2PVBA 2JC2A 1SCMC 3BOWA 4OR9B 1JBZA 2OTGB 2QZ0A 3LF3A 2WURA 5DTZA 2F2PA 2VADA 3CD1A 4XOWA 4HQCA 4MSPA 2L51A 2BE6A 1CDLA 5DTYA 4KW9A 3AAJA 4MRYA 1ZFSA 1RMPA 4YRUA 1DF0B 2G2SB 3FE9A 2I94A 3D74A 4ZCVA 3NXAA 1JFJA 2QLGA 2A52B 3EK8A 4Q9XA 1BJFA 4W6DA 3GEXA 1S3PA 2LVIA 3JVTC 1QS7A 1EG4A 1D1OA 3SJSA 5LTPA 1AUIB 1SL7A 3HCMA 3SVUA 2PALA 4PPJA 2JZIA 1TRFA 3I5IC 1A03A 4WRIA 4GAOA 2YE1A 2EC6C 4KW4A 3QRXA 1YTZC 1LA0A 2CT9A 1JBAA 2NCPA 2KBIA 3DQDA 4Z4MA 2JPOA 5I2QA 2JADA 2HGDA 4BY4A 4DXMA 5I94A 1AVSA 1SCMB 1U5IB 5IBWA 4KAGA 1OE9B 1RWYA 3WLDA 1J7OA 1K9KA 1OOHA 1DGVA 2Y1NA 2A56B 3E5VA 1MUXA 2L2EA 1UP5A 4OHSA 4R6DA 3RZSA 3NHIA 2LLSA 3OGNA 3SRYA 1YUUA 1PVAA 2E6WA 1L7ZA 2EMOA 3GJ1A 2NCOA 1K94A 3TZ1A 4AS8A 2LMVA 4C0KA 1ZOTB 2Y1MA 3SSVA 1UWOA 1XFXO 5BTTB 3JVTB 1CFDA 4C0JA 3BXBA 1J7QA 2KI4C 1OMRA 3NT9A 4W73A 1OQPA 2Q4UA 2F3YA 2YDZA 2JTTA 3BYAA 2FZUA 1JC2A 3UFZA 2LLTA 2EC6B 4HE4A 2DUIA 4CFRA 2H5OA 5DRGA 2MAZA 1JWDA 4H3MA 2BBNA 2GTEA 3D75A 3CB9A 2HPWA 1GJYA 2H61A 1DJGA 4QJ5B 1CNPA 4MN0A 2DD9A 4Z4KA 3F45A 5CSJA 3AI5A 2C9JA 5AEQA 4QJ3B 4LJDC 1YHGA 4PHNA 4W7FA 1NX3A 1EMLA 1QTXA 1XFUO 2Q57A 1TUJA 4KGEA 5DKQA 1B9AA 2YE0A 5DTXA 1B7TZ 3KCTA 4W7XA 4H48A 4ANJA 4DS7A 2DUFA 1NSHA 4ORAB 3DQNA 2CCMA 2H9WA 4JQ0D 2OJKA 3DQEA 1H4UA 2QLHA 3AKOA 2KI4B 3G9AA 1DF0A 2AWKA 3OP0A 1ORGA 1M45A 3ZUFA 5G08A 3EVPA 2VVJA 1RFJA 2O29A 4XVPA 5DPHA 3LA1A 1DELA 4W6LA 2IE2A 2PXWA 1RROA 4QJ4B 3SVRA 2QACA 3MGFA 1XSSA 3DQ2A 2O2BA 4ZFSA 2DUGA 1YX8A 1XFVO 4Q7UA 1V1FA 5EXBA 2PSRA 3U0NA 3CYZA 3B88A 1SR6C 2P6BB 4W6JA 3M0WA 1MOUA 3PN7B 3DZTA 1S6ZA 1CM4A 1ZGPA 4GPLB 1QATA 3SV5A 2IS9A 3CR5X 4J8AA 1U5IA 1TOPA 3EVUA 3SS5A 1NP8A 3OX5A 3WCKA 1RRXA 4PT1A 3DQHA 2MLFC 2A53B 4DXPA 4PCWA 3BUXB 1YJ2A 4TNCA 5K89A 1EMEA 2KLEA 2M3WA 4KYNA 1K2HA 4RTCA 1J55A 1SCVA 2KGBC 1JBYA 4P1QA 1YFPA 4JPZB 2FCDA 2HF5A 1QWVA 2JT0A 1KFUS 4YGCB 1OOIX 3U8AA 1HUYA 4OGSA 5EBJA 4F7FA 1VRKA 1XK4C 3P28A 2H2KA 5BTTA 2M1KB 2NXQA 2ZMWA 5DTLA 3BFHA 2BECA 1K8UA 4B30B 2LV7A 4R1EA 3CGAA 5CSFA 1GQMA 3IP2A 1JUOA 1PULA 2M97A 4IK5A 5CSNA 1SR6B 2AUCA 3TMTA 1Y1AA 4C0LA 4DKNA 2JTZA 2KBMA 1CV7A 2G16B 1K96A 4J89A 3WXAA 3H1RA 3VK1A 1KK7Z 3KO0A 5AXIA 3LF4B 1LA3A 3NF0A 3CR4X 4IK3A 2K7CA 3CD9A 1CDPA 3SIAA 1B47A 1QASA 3KEVA 3TDIA 3BFBA 3GB3A 4LQUA 2JULA 4L1IA 4ETOA 1F71A 1NWDA 1B7TY 1KFUL 3DQ5A 3K1EA 5FI7A 2LMUA 2KYFA 5I8NA 1BFPA 2JQ6A 5EB7A 2H5PA 5CSIA 4HQ9A 2ERBA 2A54B 2QEVA 5EB6A 1C7VA 2I7AA 3TS5C 1OOGA 1K93D 2V4EC 1XFWO 3P8UA 2JU0A 4PHJA 4W7EA 5HKWA 1UHKA 2VRGA 2ZKMX 5PALA 3RWAA 1XYDA 3D73A 1QX5B 1SRAA 3NGVA 1F4OA 2FJYA 1SMGA 1YUTA 1F54A 1JF0A 2LP2A 2NZ0A 2OTGC 4JD9A 4ZB1A 4GGFC 1S1EA 1BLQA 4RYSA 2VVHA 3D78A 4I5KA 5LK4A 1WRZA 1BG1A 3OB1B 2CXJA 1YHHA 4GGNA 3PLFB 4LJDA 1SL8A 5LTQA 2LHLA 3I19A 1NIWA 3EK7A 4BDUA 1TTXA 2K8MB 1EXRA 1WLMA 5FHVA 4PHMA 1DJIA 5DPGA 2WHUA 3W1DA 3SIBA 2HJOA 5GQQC 2ARLA 3GK2A 1DQEA 2CTNA 3LS3A 1F55A 1N65A 5KTGA 2G3OA 5CPVA 2A46A 2HQKA 5DKNA 2IB6A 1C3ZA 3DQMA 2KQYA 1KSMA 4NDCA 1Z2CB 2WOSA 1SBJA 5FVFA 1G8IA 5JOLA 2M7NA 1QYFA 3FIAA 4P2YB 3GK4X 1RMOA 3ZWHA 4ZF5A 2M0RA 1AJ5A 3SSTA 3IQOA 2OPOA 3EKJA 5BQLA 1ODBA 4INXA 3Q8IA 2K2FA 3O6BA 1HT9A 3OSQA 4YGDB 3TMRA 1FW4A 4W7RA 2QDIA 2H6VA 1YRUB 1A75B 3O4XA 4AQJA 4W69A 3D77A 4WQ3A 1UHHA 5B8IB 1XFYO 1UISA 2OS8B 4R6BA 3DPZA 3DVKA 1SK6D 5I2OA 1EMKA 3A4UB 5ER4X 1YJFA 2WIQA 1TIZA 4N1GA 1NCXA 4JWQA 4LJCA 2I18A 3BQ3A 2A4JA 3R1OA 2AAOA 3LVAA 4EMQA 3D76A 2B1UA 3TDUA 4OKHA 3ST2A 4W6AA 2LE9B 2KAVA 1ALVA 5DPIA 1CDNA 1NCYA 4XYNA 1KK7Y 5HLOA 3LK1A 5AANA 1DJZA 2L4HA 3SSYA 2AWMA 3LCPC 4ZF4A 5DKRA 2HQZA 1N2DA 4GESB 3M24A 4AOMA 1ZGQA 1KFXL 1N0YA 4HVFA 1G7KA 2GX2A 2H8VA 1P28A 1XK4A 1IKUA 4MLWA 1EMGA 1XQMA 4MZLA 3AKBA 3NEDA 2EHBA 4MVFA 2F2OA 1F8HA 2BTJA 1WY9A 2HFCA 2JT3A 4W6MA 4U8DA 1B9CA 1YURA 1FBVA 3DVMA 2OTEA 1NCZA 1PRWA 4DCKA 2E30A 4ORNA 4I5JA 2Z6XA 2G6XA 1AK8A 5HZOA 4H47A 4AR7A 3O77A 3EKHA 3FE6A 3SS0A 5HZSA 4NDBA 3I5FB 4N3DA 1B4CA 2ISDA 1E8AA 2POXA 2QEBA 1Y0VH 1F4QA 3V2LA 1M46A 3BUOB 5DRFA 2QLIA 2L50A 3BJHA 5T3IA 2B3PA 1CM1A 1PALA 3BXAA 2KI6D 3CGLA 1QIWA 3SSHA 3BUNB 2WCJA 1BF5A 4N5XA 2ZRSA 2HQWA 4NDDA 2F33A 1QX2A 4XL5A 5LTRA 2L4IA 3B7AA 2O5GA 4W6GA 1OW4A 2M29A 1QX7A 3A8SA 2GV5A 2YGUA 2IB5A 1H8BA 4W6BA 2GGZA 4W75A 2KHNA
chains in the Genus database with same CATH topology
2WHTA 2BKHB 2VVIA 1KQVA 5DQMA 1HQVA 5AERA 2V4EA 3E3RA 2FOTA 3VRQA 1F0BA 1Q4BA 3RWTA 3V3DA 1IH0A 3PN7C 1B1GA 1JC1A 4EN1A 2WORA 1W7SA 5H89A 2LLUA 5HZTA 4W6SA 5H88A 3A8RA 3OHMB 2IOVA 1IGVA 3W1CA 1UHJA 1NYAA 4GGFA 2COLB 3KCSA 1XMZA 3LVCA 5HKYA 4ICBA 4RYWA 1QVIZ 1QIVA 5HYDA 4W6NA 1TNQA 3K1KA 1QJTA 2K7DA 4W6UA 2JWWA 3ZTFA 1XA9A 1CLLA 5HBDA 1G4YR 2JXCA 4GF6B 2QT2A 1DTLA 2OGRA 5F6TA 3SVCA 4XJKB 1TCFA 2Q91A 1UHIA 3O2PA 1XA5A 3CZTX 4I5LB 2Z6YA 2KDHA 1MYWA 2F3ZA 2FL1A 3DQ4A 2AWJA 3DQCA 1GFLA 1OXDA 3CFFA 4USLA 4OQWA 1SYMA 4FTGA 2G6EA 4W7DA 2LC5A 4W74A 1NUBA 5FVGA 1PSRA 1EMAA 1GGWA 1KSOA 1Q73A 4KPIA 3K21A 3VROA 1TNWA 1EMBA 1F09A 1TN4A 1ALWA 3AKAA 3KHEA 4GNKB 3VRRA 1IJ5A 2FJUB 5EXUA 2EMNA 2JNFA 5HW9A 1QY3A 1DT7B 2ICRA 3DVEA 2KAXA 3OX6A 4ORBB 4W7AA 4PFEA 1SW8A 2HQ8A 3DQ1A 3U8PA 4KF5C 4DXQA 5BPJA 1S26D 1YZWA 1YRTB 2MRDA 2M9GA 4EDSA 1BMOA 4HRHA 1Q4DA 4AQIA 3ZNIA 1IJ6A 1KYRA 3DF0B 2ZRTA 2KYCA 3GJ2A 4M2QA 2O60A 1HCJA 2BE4A 4MRXA 2NLNA 1UURA 2QLEA 1NPQA 2AMIA 2JOJA 2PMYA 1CDMA 1FI6A 3DVJA 5BT0A 5EXCI 2H8QA 2K0JA 1ZUZA 4W6FA 1IG5A 1XO5A 2ZO6A 1ZMZA 1FI5A 3DQKA 2CNPA 1J7RA 4LQTA 2QLGB 2KOTA 5KU1A 2AHAA 2KFGA 2HGYA 2WSNA 1OXFA 1IQ3A 1C4FA 2EGDA 4KA9A 4F0ZB 2A50B 1AJ4A 1MOVA 3CS1A 4EDOA 1MQ1A 2KFFA 3SSPA 1Y1UA 1OMDA 1LXFC 1Q80A 1Z1QA 1DJHA 1YUSA 2DDDA 1MR8A 2Z1OA 1ZACA 2DOQA 3PJ7A 3PALA 2RGIA 3U8CA 1WDCB 2JT8A 1QVIY 2OKWA 2L98A 2BBMA 2A48A 2QU1A 4I2YA 3ST3A 1EH2A 1LVCD 4YGAA 4DKMA 3SG4A 2KSPA 2LVJA 4ZF3A 3LVDA 3IQQA 5DPJA 2G2BA 4LJBA 5JJGA 2KQ6A 4W6OA 3ST4A 5FYXA 1QLKA 1M39A 3GK1A 1S5GZ 4HQ8A 4IK4A 2GW3A 1SL9A 1R6PA 4OCIA 4XJKA 2H5QA 2M1UA 5HGEA 3FS7A 1Q4EA 1CMFA 4KW8A 1G33A 3SSLA 2EMDA 2OS8C 1YVLA 3DQ9A 2VAEA 1FPWA 3IF7A 3PJBA 3NSIA 1MHOA 2WCEA 2M8UA 2WC8A 3LSAA 2KGRA 1CB1A 2FWQA 1SPYA 2BCBA 4GFTA 4DXIA 3WNXB 3AI4A 2HPSA 4KF4A 1DVIA 4PHKA 2QRFA 1H6RA 2JNXA 3MSEB 1Y6WA 1J7PA 4D1EA 3SVDA 3SVOA 2ZNEA 4JEOA 4J88A 3CTNA 5HLVA 5HZUA 3ADFA 1CFPA 2HCGA 4L12A 1RECA 1M31A 2KFHA 2LM5A 3S05A 3M22A 3SVBA 4IK9A 2LCPA 2SCPA 3NSKA 4P76A 1C07A 1BR4B 3TUYC 3VRPA 4B30A 3DQUA 1W7TA 1YHIA 3DQFA 3SG5A 1A29A 1CTRA 1RMMA 1JF2A 4JFGA 4W76A 4B5YA 1QV1A 1KQMC 4W6PA 1RTP1 2OKYA 3I5FC 1B8LA 4OVNF 4N1FA 3DD4A 5KSZA 4U2VA 3DQOA 4Q9WA 3DQLA 4GOBA 4YGEB 3C1VA 4W6KA 1NX1A 1NX0A 4NQGA 4PE7A 3D0YB 2BKIB 4L9MA 5EJUA 1JC0A 3DPWA 1KK8B 2YFPA 2KI6C 3KPXA 1CFFA 3EK4A 1CLMA 4L13A 3PSRA 2MLEC 2G9BA 3PM8A 3CFHA 1WLZA 5I2LA 4KF5A 3DQAA 3LK0A 1QLSA 4MBEA 2K61A 3VICA 2Q6PA 2ZFDA 2MA2A 1K9PA 4DXOA 3FWCA 1JSAA 3TUYB 3SVEA 5HKZA 2V53A 1K90D 2B3QA 4TZAA 1EJ3A 1CKKA 1KYPA 2D8NA 4CPVA 1OZOA 4M2PA 3NEZA 3SG2A 1J1EA 4W6TA 3VHTB 3U0MA 1OOJA 3DQ3A 1KQMB 5EHUA 3SG6A 1S5GY 1RM9A 1OZSA 1YX7A 3O4YA 1OXEA 2WSOA 4I5NB 1A2XA 2HRSA 3DQ7A 3E5WA 2KNEA 1BT6A 4P5OE 1QYOA 4MZJA 3BUMB 1Q4AA 4JGEA 2ZO7A 5DU0A 1UHNA 3KF9A 3GL4A 1S36A 3ZULA 2LHIA 2K2AA 2M49B 3I5IB 3DQIA 4MZKA 4PE1A 1Y1XA 4KGFA 1UUSA 2RH7A 3SVSA 2P4MA 3CFAA 1SKTA 4ZCUA 1CLBA 2OTBA 1LINA 2PXSA 4W6IA 1IWQA 3TDZA 1OMVA 4ZINA 4A4CA 3UG0A 3SG7A 2GGMA 2LUXA 1IQ5A 3FWBA 4BY5A 4W72A 1J1DA 4IL1A 5DY6A 3CBEA 3HX4A 2WCBA 4TZGA 4DRWA 2JXLA 3WHUB 2G3DB 3U0KA 1A75A 5FVIA 3I5GC 3DQJA 1LKJA 4PE4A 3BUWB 2MJWB 2DUHA 2GX0A 1PVBA 1R2UA 2SASA 1DGUA 1A4PA 2BCAA 2Y0GA 1GL4A 3D10A 4EULA 5D69A 1SNLA 3E5TA 2PASA 4YBHB 4JF9A 2JRFA 2PRUA 2QPTA 3D0YA 2WHSA 1GGZA 4H3LA 1DJWA 4W6CA 2L0PA 1XAEA 3DQ8A 4DUQA 1BU3A 1GGXA 1K95A 1MXLC 1FF1A 1W7JB 3BX9A 3I5HC 4Q7TA 3JTDC 3H1OA 1S6JA 4PALA 4HSZA 5AQBB 1TNPA 2LP3A 1M63B 2G5ZB 2ZN9A 5ER5A 2C9IA 3I5GB 4XOVA 1IRJA 4W6RA 1BR1B 3ED8A 1ZGOA 5TNCA 2WISA 1B8CA 3VHTA 3VRNA 1ZUXA 4PE0A 4CLNA 2ZNDA 3GOFA 5J2OA 1WDCC 3CLNA 1H4BA 2M7LA 1AHRA 3EVVA 2LVKA 1C7WA 4OV2A 3NT3A 4W77A 2DUEA 2L5XB 4FQOA 1DJXA 1MXEA 1EMFA 3BOWB 2LNKA 3BXKA 3SVNA 4ZBLA 2R2IA 1QYQA 5F9GA 1WRKA 3PATA 1MWNA 1S6IA 1CFCA 1EMCA 3SSKA 1B8RA 2K7BA 1X02A 5D7FA 2AWLA 2HETA 3I5HB 3OGOA 3JTDB 1YVHA 2GW4B 4ORCB 1EL4A 4PPKA 1BOCA 2AH8A 2O24A 4JC2A 3PJ5A 1TNXA 1K9UA 3VGOA 1AP4A 2KAYA 3U0LA 2JPTA 4A4BA 1SY9A 2G6YA 1W7UA 1KYSA 5J3XA 3IR8A 3BXCA 3CR2A 5AFPA 3OSRA 3SG3A 1QV0A 2FCEA 5H87A 4GBAA 1YR5A 1QXPA 2LMTA 3ST0A 3OB2B 1W7IB 5KTYA 1KWOC 2WCFA 2MHHA 3LL8B 2H61C 1L2OC 2Y4QA 1EMMA 4PDZA 1PK0D 4PPLA 4OY4A 4Q7RA 2BL0C 2ZMUA 1EG3A 4M2OA 4E68A 4NWSA 1BODA 1Q4CA 1TCOB 2DDCA 1JFKA 3ICBA 1DMOA 2ZN8A 4LW5A 4DIRA 3ZUJA 3LLEA 4YGBB 1F70A 2LANA 3CWGA 4YI9A 3PIBA 2Y5IA 2A47A 2F8PA 3DQ6A 4YI8A 4WQ2A 3EVRA 4Q04A 2I2RE 2LAPA 1PSBA 4CFQA 3O78A 2K7OA 4UPGA 2LVVA 3NSLA 2BCXA 1CMGA 4UTSA 4H3NA 4DXNA 2WNDA 1KK8C 4KEXA 3PFVA 4IK1A 1MF8B 1OSAA 3H4SE 2LUCA 1XFZO 3RLZA 4W6HA 3NSOA 2TN4A 4IK8A 1KP5A 2Z6ZA 2VZXA 1KWOB 4CIDA 4XGYA 4MEWA 2H5RA 1DJYA 1L2OB 3WHTB 4ZIOA 4IZNA 2CBLA 4HREE 1Z1PA 1XVJA 2BL0B 3TS5B 1NX2A 2MBXA 4HRGA 4JRBA 1RK9A 2V4EB 3DPXA 4W7CA 1RJVA 1KCYA 1QXTA 1V1GA 1WRLA 4OJ0A 5DQBA 3WLCA 1KFXS 3DF0A 4GUKA 1S6CA 3RM1A 2DD7A 3AAKA 2PVBA 2JC2A 1SCMC 3BOWA 4OR9B 1JBZA 2OTGB 2QZ0A 3LF3A 2WURA 5DTZA 2F2PA 2VADA 3CD1A 4XOWA 4HQCA 4MSPA 2L51A 2BE6A 1CDLA 5DTYA 4KW9A 3AAJA 4MRYA 1ZFSA 1RMPA 4YRUA 1DF0B 2G2SB 2I94A 4ZCVA 3NXAA 1JFJA 2QLGA 2A52B 3EK8A 4Q9XA 1BJFA 4W6DA 3GEXA 1S3PA 2LVIA 3JVTC 1QS7A 1EG4A 1D1OA 3SJSA 5LTPA 1AUIB 1SL7A 3HCMA 3SVUA 2PALA 4PPJA 2JZIA 1TRFA 3I5IC 1A03A 4WRIA 4GAOA 2YE1A 2EC6C 4KW4A 3QRXA 1YTZC 1LA0A 2CT9A 1JBAA 2NCPA 2KBIA 3DQDA 4Z4MA 5I2QA 2JADA 2HGDA 4BY4A 4DXMA 1AVSA 1SCMB 1U5IB 5IBWA 4KAGA 1OE9B 1RWYA 3WLDA 1J7OA 1K9KA 1DGVA 2Y1NA 2A56B 3E5VA 1MUXA 2L2EA 1UP5A 4OHSA 4R6DA 2LLSA 3SRYA 1YUUA 1PVAA 2E6WA 1L7ZA 2EMOA 3GJ1A 2NCOA 1K94A 3TZ1A 4AS8A 2LMVA 4C0KA 1ZOTB 2Y1MA 3SSVA 1UWOA 1XFXO 5BTTB 3JVTB 1CFDA 4C0JA 3BXBA 1J7QA 2KI4C 1OMRA 3NT9A 4W73A 1OQPA 2Q4UA 2F3YA 2YDZA 2JTTA 3BYAA 2FZUA 1JC2A 3UFZA 2LLTA 2EC6B 4HE4A 2DUIA 4CFRA 2H5OA 5DRGA 2MAZA 1JWDA 4H3MA 2BBNA 3CB9A 2HPWA 1GJYA 2H61A 1DJGA 4QJ5B 1CNPA 4MN0A 2DD9A 4Z4KA 3F45A 5CSJA 3AI5A 2C9JA 5AEQA 4QJ3B 4LJDC 1YHGA 4PHNA 4W7FA 1NX3A 1EMLA 1QTXA 1XFUO 2Q57A 4KGEA 5DKQA 1B9AA 2YE0A 5DTXA 1B7TZ 3KCTA 4W7XA 4H48A 4ANJA 4DS7A 2DUFA 1NSHA 4ORAB 3DQNA 2CCMA 2H9WA 4JQ0D 2OJKA 3DQEA 1H4UA 2QLHA 3AKOA 2KI4B 3G9AA 1DF0A 2AWKA 3OP0A 1M45A 3ZUFA 5G08A 3EVPA 2VVJA 1RFJA 2O29A 4XVPA 5DPHA 3LA1A 4W6LA 2IE2A 2PXWA 1RROA 4QJ4B 3SVRA 2QACA 3MGFA 1XSSA 3DQ2A 2O2BA 4ZFSA 2DUGA 1YX8A 1XFVO 4Q7UA 1V1FA 5EXBA 2PSRA 3U0NA 1SR6C 2P6BB 4W6JA 3M0WA 1MOUA 3PN7B 1S6ZA 1CM4A 1ZGPA 4GPLB 1QATA 3SV5A 2IS9A 3CR5X 4J8AA 1U5IA 1TOPA 3EVUA 1NP8A 3OX5A 3WCKA 1RRXA 3DQHA 2MLFC 2A53B 4DXPA 4PCWA 3BUXB 1YJ2A 4TNCA 5K89A 1EMEA 2M3WA 1K2HA 4RTCA 1J55A 1SCVA 2KGBC 1JBYA 4P1QA 1YFPA 4JPZB 2FCDA 2HF5A 2JT0A 1KFUS 4YGCB 3U8AA 1HUYA 4OGSA 5EBJA 1VRKA 1XK4C 3P28A 2H2KA 5BTTA 2M1KB 2NXQA 2ZMWA 5DTLA 2BECA 1K8UA 4B30B 2LV7A 4R1EA 3CGAA 5CSFA 1GQMA 3IP2A 1JUOA 1PULA 2M97A 4IK5A 5CSNA 1SR6B 2AUCA 3TMTA 1Y1AA 4C0LA 4DKNA 2JTZA 2KBMA 1CV7A 2G16B 1K96A 4J89A 3WXAA 3H1RA 3VK1A 1KK7Z 3KO0A 5AXIA 3LF4B 1LA3A 3NF0A 3CR4X 4IK3A 2K7CA 3CD9A 1CDPA 3SIAA 1B47A 1QASA 3KEVA 3TDIA 3GB3A 4LQUA 2JULA 4L1IA 4ETOA 1F71A 1NWDA 1B7TY 1KFUL 3DQ5A 2LMUA 2KYFA 5I8NA 1BFPA 2JQ6A 5EB7A 2H5PA 5CSIA 4HQ9A 2A54B 5EB6A 1C7VA 2I7AA 3TS5C 1K93D 2V4EC 1XFWO 3P8UA 2JU0A 4PHJA 4W7EA 5HKWA 1UHKA 2VRGA 2ZKMX 5PALA 3RWAA 1XYDA 1QX5B 1SRAA 1F4OA 1SMGA 1YUTA 1F54A 1JF0A 2LP2A 2NZ0A 2OTGC 4ZB1A 4GGFC 1S1EA 1BLQA 4RYSA 2VVHA 4I5KA 5LK4A 1WRZA 1BG1A 3OB1B 2CXJA 1YHHA 4GGNA 3PLFB 4LJDA 1SL8A 5LTQA 2LHLA 3I19A 1NIWA 3EK7A 4BDUA 1TTXA 2K8MB 1EXRA 1WLMA 5FHVA 4PHMA 1DJIA 5DPGA 2WHUA 3W1DA 3SIBA 2HJOA 5GQQC 2ARLA 3GK2A 2CTNA 3LS3A 1F55A 1N65A 5KTGA 2G3OA 5CPVA 2A46A 2HQKA 5DKNA 2IB6A 3DQMA 2KQYA 1KSMA 4NDCA 2WOSA 1SBJA 5FVFA 1G8IA 5JOLA 2M7NA 1QYFA 3FIAA 4P2YB 3GK4X 1RMOA 3ZWHA 4ZF5A 2M0RA 1AJ5A 3SSTA 3IQOA 2OPOA 3EKJA 5BQLA 1ODBA 2K2FA 3O6BA 1HT9A 3OSQA 4YGDB 3TMRA 1FW4A 4W7RA 2H6VA 1YRUB 1A75B 4AQJA 4W69A 4WQ3A 1UHHA 5B8IB 1XFYO 1UISA 2OS8B 4R6BA 3DPZA 3DVKA 1SK6D 5I2OA 1EMKA 3A4UB 5ER4X 1YJFA 2WIQA 1TIZA 4N1GA 1NCXA 4JWQA 4LJCA 2I18A 3BQ3A 2A4JA 2AAOA 3LVAA 4EMQA 2B1UA 3TDUA 4OKHA 3ST2A 4W6AA 2LE9B 2KAVA 1ALVA 5DPIA 1CDNA 1NCYA 4XYNA 1KK7Y 5HLOA 3LK1A 5AANA 1DJZA 2L4HA 3SSYA 2AWMA 3LCPC 4ZF4A 5DKRA 2HQZA 1N2DA 4GESB 3M24A 4AOMA 1ZGQA 1KFXL 1N0YA 4HVFA 1G7KA 2GX2A 1XK4A 1IKUA 4MLWA 1EMGA 1XQMA 4MZLA 3AKBA 3NEDA 2EHBA 4MVFA 2F2OA 1F8HA 2BTJA 1WY9A 2HFCA 2JT3A 4W6MA 4U8DA 1B9CA 1YURA 1FBVA 3DVMA 2OTEA 1NCZA 1PRWA 4DCKA 2E30A 4ORNA 4I5JA 2Z6XA 2G6XA 1AK8A 5HZOA 4H47A 4AR7A 3O77A 3EKHA 3SS0A 5HZSA 4NDBA 3I5FB 4N3DA 1B4CA 2ISDA 1E8AA 2POXA 1Y0VH 1F4QA 1M46A 3BUOB 5DRFA 2QLIA 2L50A 5T3IA 2B3PA 1CM1A 1PALA 3BXAA 2KI6D 3CGLA 1QIWA 3SSHA 3BUNB 1BF5A 4N5XA 2ZRSA 2HQWA 4NDDA 2F33A 1QX2A 4XL5A 5LTRA 2L4IA 2O5GA 4W6GA 2M29A 1QX7A 3A8SA 2GV5A 2IB5A 1H8BA 4W6BA 2GGZA 4W75A 2KHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WHT A;  2BKH B;  2VVI A;  1KQV A;  5DQM A;  1HQV A;  5AER A;  2V4E A;  3E3R A;  2FOT A;  3VRQ A;  1F0B A;  1Q4B A;  3RWT A;  3V3D A;  1IH0 A;  3PN7 C;  1B1G A;  1JC1 A;  4EN1 A;  2WOR A;  1W7S A;  5H89 A;  2LLU A;  5HZT A;  4W6S A;  5H88 A;  3A8R A;  3OHM B;  2IOV A;  1IGV A;  3W1C A;  1UHJ A;  1NYA A;  4GGF A;  2COL B;  3KCS A;  1XMZ A;  3LVC A;  5HKY A;  4ICB A;  4RYW A;  1QVI Z;  1QIV A;  5HYD A;  4W6N A;  1TNQ A;  3K1K A;  1QJT A;  2K7D A;  4W6U A;  2JWW A;  3ZTF A;  1XA9 A;  1CLL A;  5HBD A;  1G4Y R;  2JXC A;  4GF6 B;  2QT2 A;  1DTL A;  2OGR A;  5F6T A;  3SVC A;  4XJK B;  1TCF A;  2Q91 A;  1UHI A;  3O2P A;  1XA5 A;  3CZT X;  4I5L B;  2Z6Y A;  2KDH A;  1MYW A;  2F3Z A;  2FL1 A;  3DQ4 A;  2AWJ A;  3DQC A;  1GFL A;  1OXD A;  3CFF A;  4USL A;  4OQW A;  1SYM A;  4FTG A;  2G6E A;  4W7D A;  2LC5 A;  4W74 A;  1NUB A;  5FVG A;  1PSR A;  1EMA A;  1GGW A;  1KSO A;  1Q73 A;  4KPI A;  3K21 A;  3VRO A;  1TNW A;  1EMB A;  1F09 A;  1TN4 A;  1ALW A;  3AKA A;  3KHE A;  4GNK B;  3VRR A;  1IJ5 A;  2FJU B;  5EXU A;  2EMN A;  2JNF A;  5HW9 A;  1QY3 A;  1DT7 B;  2ICR A;  3DVE A;  2KAX A;  3OX6 A;  4ORB B;  4W7A A;  4PFE A;  1SW8 A;  2HQ8 A;  3DQ1 A;  3U8P A;  4KF5 C;  4DXQ A;  5BPJ A;  1S26 D;  1YZW A;  1YRT B;  2MRD A;  2M9G A;  4EDS A;  1BMO A;  4HRH A;  1Q4D A;  4AQI A;  3ZNI A;  1IJ6 A;  1KYR A;  3DF0 B;  2ZRT A;  2KYC A;  3GJ2 A;  4M2Q A;  2O60 A;  1HCJ A;  2BE4 A;  4MRX A;  2NLN A;  1UUR A;  2QLE A;  1NPQ A;  2AMI A;  2JOJ A;  2PMY A;  1CDM A;  1FI6 A;  3DVJ A;  5BT0 A;  5EXC I;  2H8Q A;  2K0J A;  1ZUZ A;  4W6F A;  1IG5 A;  1XO5 A;  2ZO6 A;  1ZMZ A;  1FI5 A;  3DQK A;  2CNP A;  1J7R A;  4LQT A;  2QLG B;  2KOT A;  5KU1 A;  2AHA A;  2KFG A;  2HGY A;  2WSN A;  1OXF A;  1IQ3 A;  1C4F A;  2EGD A;  4KA9 A;  4F0Z B;  2A50 B;  1AJ4 A;  1MOV A;  3CS1 A;  4EDO A;  1MQ1 A;  2KFF A;  3SSP A;  1Y1U A;  1OMD A;  1LXF C;  1Q80 A;  1Z1Q A;  1DJH A;  1YUS A;  2DDD A;  1MR8 A;  2Z1O A;  1ZAC A;  2DOQ A;  3PJ7 A;  3PAL A;  2RGI A;  3U8C A;  1WDC B;  2JT8 A;  1QVI Y;  2OKW A;  2L98 A;  2BBM A;  2A48 A;  2QU1 A;  4I2Y A;  3ST3 A;  1EH2 A;  1LVC D;  4YGA A;  4DKM A;  3SG4 A;  2KSP A;  2LVJ A;  4ZF3 A;  3LVD A;  3IQQ A;  5DPJ A;  2G2B A;  4LJB A;  5JJG A;  2KQ6 A;  4W6O A;  3ST4 A;  5FYX A;  1QLK A;  1M39 A;  3GK1 A;  1S5G Z;  4HQ8 A;  4IK4 A;  2GW3 A;  1SL9 A;  1R6P A;  4OCI A;  4XJK A;  2H5Q A;  2M1U A;  5HGE A;  3FS7 A;  1Q4E A;  1CMF A;  4KW8 A;  1G33 A;  3SSL A;  2EMD A;  2OS8 C;  1YVL A;  3DQ9 A;  2VAE A;  1FPW A;  3IF7 A;  3PJB A;  3NSI A;  1MHO A;  2WCE A;  2M8U A;  2WC8 A;  3LSA A;  2KGR A;  1CB1 A;  2FWQ A;  1SPY A;  2BCB A;  4GFT A;  4DXI A;  3WNX B;  3AI4 A;  2HPS A;  4KF4 A;  1DVI A;  4PHK A;  2QRF A;  1H6R A;  2JNX A;  3MSE B;  1Y6W A;  1J7P A;  4D1E A;  3SVD A;  3SVO A;  2ZNE A;  4JEO A;  4J88 A;  3CTN A;  5HLV A;  5HZU A;  3ADF A;  1CFP A;  2HCG A;  4L12 A;  1REC A;  1M31 A;  2KFH A;  2LM5 A;  3S05 A;  3M22 A;  3SVB A;  4IK9 A;  2LCP A;  2SCP A;  3NSK A;  4P76 A;  1C07 A;  1BR4 B;  3TUY C;  3VRP A;  4B30 A;  3DQU A;  1W7T A;  1YHI A;  3DQF A;  3SG5 A;  1A29 A;  1CTR A;  1RMM A;  1JF2 A;  4JFG A;  4W76 A;  4B5Y A;  1QV1 A;  1KQM C;  4W6P A;  1RTP 1;  2OKY A;  3I5F C;  1B8L A;  4OVN F;  4N1F A;  3DD4 A;  5KSZ A;  4U2V A;  3DQO A;  4Q9W A;  3DQL A;  4GOB A;  4YGE B;  3C1V A;  4W6K A;  1NX1 A;  1NX0 A;  4NQG A;  4PE7 A;  3D0Y B;  2BKI B;  4L9M A;  5EJU A;  1JC0 A;  3DPW A;  1KK8 B;  2YFP A;  2KI6 C;  3KPX A;  1CFF A;  3EK4 A;  1CLM A;  4L13 A;  3PSR A;  2MLE C;  2G9B A;  3PM8 A;  3CFH A;  1WLZ A;  5I2L A;  4KF5 A;  3DQA A;  3LK0 A;  1QLS A;  4MBE A;  2K61 A;  3VIC A;  2Q6P A;  2ZFD A;  2MA2 A;  1K9P A;  4DXO A;  3FWC A;  1JSA A;  3TUY B;  3SVE A;  5HKZ A;  2V53 A;  1K90 D;  2B3Q A;  4TZA A;  1EJ3 A;  1CKK A;  1KYP A;  2D8N A;  4CPV A;  1OZO A;  4M2P A;  3NEZ A;  3SG2 A;  1J1E A;  4W6T A;  3VHT B;  3U0M A;  1OOJ A;  3DQ3 A;  1KQM B;  5EHU A;  3SG6 A;  1S5G Y;  1RM9 A;  1OZS A;  1YX7 A;  3O4Y A;  1OXE A;  2WSO A;  4I5N B;  1A2X A;  2HRS A;  3DQ7 A;  3E5W A;  2KNE A;  1BT6 A;  4P5O E;  1QYO A;  4MZJ A;  3BUM B;  1Q4A A;  4JGE A;  2ZO7 A;  5DU0 A;  1UHN A;  3KF9 A;  3GL4 A;  1S36 A;  3ZUL A;  2LHI A;  2K2A A;  2M49 B;  3I5I B;  3DQI A;  4MZK A;  4PE1 A;  1Y1X A;  4KGF A;  1UUS A;  2RH7 A;  3SVS A;  2P4M A;  3CFA A;  1SKT A;  4ZCU A;  1CLB A;  2OTB A;  1LIN A;  2PXS A;  4W6I A;  1IWQ A;  3TDZ A;  1OMV A;  4ZIN A;  4A4C A;  3UG0 A;  3SG7 A;  2GGM A;  2LUX A;  1IQ5 A;  3FWB A;  4BY5 A;  4W72 A;  1J1D A;  4IL1 A;  5DY6 A;  3CBE A;  3HX4 A;  2WCB A;  4TZG A;  4DRW A;  2JXL A;  3WHU B;  2G3D B;  3U0K A;  1A75 A;  5FVI A;  3I5G C;  3DQJ A;  1LKJ A;  4PE4 A;  3BUW B;  2MJW B;  2DUH A;  2GX0 A;  1PVB A;  1R2U A;  2SAS A;  1DGU A;  1A4P A;  2BCA A;  2Y0G A;  1GL4 A;  3D10 A;  4EUL A;  5D69 A;  1SNL A;  3E5T A;  2PAS A;  4YBH B;  4JF9 A;  2JRF A;  2PRU A;  2QPT A;  3D0Y A;  2WHS A;  1GGZ A;  4H3L A;  1DJW A;  4W6C A;  2L0P A;  1XAE A;  3DQ8 A;  4DUQ A;  1BU3 A;  1GGX A;  1K95 A;  1MXL C;  1FF1 A;  1W7J B;  3BX9 A;  3I5H C;  4Q7T A;  3JTD C;  3H1O A;  1S6J A;  4PAL A;  4HSZ A;  5AQB B;  1TNP A;  2LP3 A;  1M63 B;  2G5Z B;  2ZN9 A;  5ER5 A;  2C9I A;  3I5G B;  4XOV A;  1IRJ A;  4W6R A;  1BR1 B;  3ED8 A;  1ZGO A;  5TNC A;  2WIS A;  1B8C A;  3VHT A;  3VRN A;  1ZUX A;  4PE0 A;  4CLN A;  2ZND A;  3GOF A;  5J2O A;  1WDC C;  3CLN A;  1H4B A;  2M7L A;  1AHR A;  3EVV A;  2LVK A;  1C7W A;  4OV2 A;  3NT3 A;  4W77 A;  2DUE A;  2L5X B;  4FQO A;  1DJX A;  1MXE A;  1EMF A;  3BOW B;  2LNK A;  3BXK A;  3SVN A;  4ZBL A;  2R2I A;  1QYQ A;  5F9G A;  1WRK A;  3PAT A;  1MWN A;  1S6I A;  1CFC A;  1EMC A;  3SSK A;  1B8R A;  2K7B A;  1X02 A;  5D7F A;  2AWL A;  2HET A;  3I5H B;  3OGO A;  3JTD B;  1YVH A;  2GW4 B;  4ORC B;  1EL4 A;  4PPK A;  1BOC A;  2AH8 A;  2O24 A;  4JC2 A;  3PJ5 A;  1TNX A;  1K9U A;  3VGO A;  1AP4 A;  2KAY A;  3U0L A;  2JPT A;  4A4B A;  1SY9 A;  2G6Y A;  1W7U A;  1KYS A;  5J3X A;  3IR8 A;  3BXC A;  3CR2 A;  5AFP A;  3OSR A;  3SG3 A;  1QV0 A;  2FCE A;  5H87 A;  4GBA A;  1YR5 A;  1QXP A;  2LMT A;  3ST0 A;  3OB2 B;  1W7I B;  5KTY A;  1KWO C;  2WCF A;  2MHH A;  3LL8 B;  2H61 C;  1L2O C;  2Y4Q A;  1EMM A;  4PDZ A;  1PK0 D;  4PPL A;  4OY4 A;  4Q7R A;  2BL0 C;  2ZMU A;  1EG3 A;  4M2O A;  4E68 A;  4NWS A;  1BOD A;  1Q4C A;  1TCO B;  2DDC A;  1JFK A;  3ICB A;  1DMO A;  2ZN8 A;  4LW5 A;  4DIR A;  3ZUJ A;  3LLE A;  4YGB B;  1F70 A;  2LAN A;  3CWG A;  4YI9 A;  3PIB A;  2Y5I A;  2A47 A;  2F8P A;  3DQ6 A;  4YI8 A;  4WQ2 A;  3EVR A;  4Q04 A;  2I2R E;  2LAP A;  1PSB A;  4CFQ A;  3O78 A;  2K7O A;  4UPG A;  2LVV A;  3NSL A;  2BCX A;  1CMG A;  4UTS A;  4H3N A;  4DXN A;  2WND A;  1KK8 C;  4KEX A;  3PFV A;  4IK1 A;  1MF8 B;  1OSA A;  3H4S E;  2LUC A;  1XFZ O;  3RLZ A;  4W6H A;  3NSO A;  2TN4 A;  4IK8 A;  1KP5 A;  2Z6Z A;  2VZX A;  1KWO B;  4CID A;  4XGY A;  4MEW A;  2H5R A;  1DJY A;  1L2O B;  3WHT B;  4ZIO A;  4IZN A;  2CBL A;  4HRE E;  1Z1P A;  1XVJ A;  2BL0 B;  3TS5 B;  1NX2 A;  2MBX A;  4HRG A;  4JRB A;  1RK9 A;  2V4E B;  3DPX A;  4W7C A;  1RJV A;  1KCY A;  1QXT A;  1V1G A;  1WRL A;  4OJ0 A;  5DQB A;  3WLC A;  1KFX S;  3DF0 A;  4GUK A;  1S6C A;  3RM1 A;  2DD7 A;  3AAK A;  2PVB A;  2JC2 A;  1SCM C;  3BOW A;  4OR9 B;  1JBZ A;  2OTG B;  2QZ0 A;  3LF3 A;  2WUR A;  5DTZ A;  2F2P A;  2VAD A;  3CD1 A;  4XOW A;  4HQC A;  4MSP A;  2L51 A;  2BE6 A;  1CDL A;  5DTY A;  4KW9 A;  3AAJ A;  4MRY A;  1ZFS A;  1RMP A;  4YRU A;  1DF0 B;  2G2S B;  2I94 A;  4ZCV A;  3NXA A;  1JFJ A;  2QLG A;  2A52 B;  3EK8 A;  4Q9X A;  1BJF A;  4W6D A;  3GEX A;  1S3P A;  2LVI A;  3JVT C;  1QS7 A;  1EG4 A;  1D1O A;  3SJS A;  5LTP A;  1AUI B;  1SL7 A;  3HCM A;  3SVU A;  2PAL A;  4PPJ A;  2JZI A;  1TRF A;  3I5I C;  1A03 A;  4WRI A;  4GAO A;  2YE1 A;  2EC6 C;  4KW4 A;  3QRX A;  1YTZ C;  1LA0 A;  2CT9 A;  1JBA A;  2NCP A;  2KBI A;  3DQD A;  4Z4M A;  5I2Q A;  2JAD A;  2HGD A;  4BY4 A;  4DXM A;  1AVS A;  1SCM B;  1U5I B;  5IBW A;  4KAG A;  1OE9 B;  1RWY A;  3WLD A;  1J7O A;  1K9K A;  1DGV A;  2Y1N A;  2A56 B;  3E5V A;  1MUX A;  2L2E A;  1UP5 A;  4OHS A;  4R6D A;  2LLS A;  3SRY A;  1YUU A;  1PVA A;  2E6W A;  1L7Z A;  2EMO A;  3GJ1 A;  2NCO A;  1K94 A;  3TZ1 A;  4AS8 A;  2LMV A;  4C0K A;  1ZOT B;  2Y1M A;  3SSV A;  1UWO A;  1XFX O;  5BTT B;  3JVT B;  1CFD A;  4C0J A;  3BXB A;  1J7Q A;  2KI4 C;  1OMR A;  3NT9 A;  4W73 A;  1OQP A;  2Q4U A;  2F3Y A;  2YDZ A;  2JTT A;  3BYA A;  2FZU A;  1JC2 A;  3UFZ A;  2LLT A;  2EC6 B;  4HE4 A;  2DUI A;  4CFR A;  2H5O A;  5DRG A;  2MAZ A;  1JWD A;  4H3M A;  2BBN A;  3CB9 A;  2HPW A;  1GJY A;  2H61 A;  1DJG A;  4QJ5 B;  1CNP A;  4MN0 A;  2DD9 A;  4Z4K A;  3F45 A;  5CSJ A;  3AI5 A;  2C9J A;  5AEQ A;  4QJ3 B;  4LJD C;  1YHG A;  4PHN A;  4W7F A;  1NX3 A;  1EML A;  1QTX A;  1XFU O;  2Q57 A;  4KGE A;  5DKQ A;  1B9A A;  2YE0 A;  5DTX A;  1B7T Z;  3KCT A;  4W7X A;  4H48 A;  4ANJ A;  4DS7 A;  2DUF A;  1NSH A;  4ORA B;  3DQN A;  2CCM A;  2H9W A;  4JQ0 D;  2OJK A;  3DQE A;  1H4U A;  2QLH A;  3AKO A;  2KI4 B;  3G9A A;  1DF0 A;  2AWK A;  3OP0 A;  1M45 A;  3ZUF A;  5G08 A;  3EVP A;  2VVJ A;  1RFJ A;  2O29 A;  4XVP A;  5DPH A;  3LA1 A;  4W6L A;  2IE2 A;  2PXW A;  1RRO A;  4QJ4 B;  3SVR A;  2QAC A;  3MGF A;  1XSS A;  3DQ2 A;  2O2B A;  4ZFS A;  2DUG A;  1YX8 A;  1XFV O;  4Q7U A;  1V1F A;  5EXB A;  2PSR A;  3U0N A;  1SR6 C;  2P6B B;  4W6J A;  3M0W A;  1MOU A;  3PN7 B;  1S6Z A;  1CM4 A;  1ZGP A;  4GPL B;  1QAT A;  3SV5 A;  2IS9 A;  3CR5 X;  4J8A A;  1U5I A;  1TOP A;  3EVU A;  1NP8 A;  3OX5 A;  3WCK A;  1RRX A;  3DQH A;  2MLF C;  2A53 B;  4DXP A;  4PCW A;  3BUX B;  1YJ2 A;  4TNC A;  5K89 A;  1EME A;  2M3W A;  1K2H A;  4RTC A;  1J55 A;  1SCV A;  2KGB C;  1JBY A;  4P1Q A;  1YFP A;  4JPZ B;  2FCD A;  2HF5 A;  2JT0 A;  1KFU S;  4YGC B;  3U8A A;  1HUY A;  4OGS A;  5EBJ A;  1VRK A;  1XK4 C;  3P28 A;  2H2K A;  5BTT A;  2M1K B;  2NXQ A;  2ZMW A;  5DTL A;  2BEC A;  1K8U A;  4B30 B;  2LV7 A;  4R1E A;  3CGA A;  5CSF A;  1GQM A;  3IP2 A;  1JUO A;  1PUL A;  2M97 A;  4IK5 A;  5CSN A;  1SR6 B;  2AUC A;  3TMT A;  1Y1A A;  4C0L A;  4DKN A;  2JTZ A;  2KBM A;  1CV7 A;  2G16 B;  1K96 A;  4J89 A;  3WXA A;  3H1R A;  3VK1 A;  1KK7 Z;  3KO0 A;  5AXI A;  3LF4 B;  1LA3 A;  3NF0 A;  3CR4 X;  4IK3 A;  2K7C A;  3CD9 A;  1CDP A;  3SIA A;  1B47 A;  1QAS A;  3KEV A;  3TDI A;  3GB3 A;  4LQU A;  2JUL A;  4L1I A;  4ETO A;  1F71 A;  1NWD A;  1B7T Y;  1KFU L;  3DQ5 A;  2LMU A;  2KYF A;  5I8N A;  1BFP A;  2JQ6 A;  5EB7 A;  2H5P A;  5CSI A;  4HQ9 A;  2A54 B;  5EB6 A;  1C7V A;  2I7A A;  3TS5 C;  1K93 D;  2V4E C;  1XFW O;  3P8U A;  2JU0 A;  4PHJ A;  4W7E A;  5HKW A;  1UHK A;  2VRG A;  2ZKM X;  5PAL A;  3RWA A;  1XYD A;  1QX5 B;  1SRA A;  1F4O A;  1SMG A;  1YUT A;  1F54 A;  1JF0 A;  2LP2 A;  2NZ0 A;  2OTG C;  4ZB1 A;  4GGF C;  1S1E A;  1BLQ A;  4RYS A;  2VVH A;  4I5K A;  5LK4 A;  1WRZ A;  1BG1 A;  3OB1 B;  2CXJ A;  1YHH A;  4GGN A;  3PLF B;  4LJD A;  1SL8 A;  5LTQ A;  2LHL A;  3I19 A;  1NIW A;  3EK7 A;  4BDU A;  1TTX A;  2K8M B;  1EXR A;  1WLM A;  5FHV A;  4PHM A;  1DJI A;  5DPG A;  2WHU A;  3W1D A;  3SIB A;  2HJO A;  5GQQ C;  2ARL A;  3GK2 A;  2CTN A;  3LS3 A;  1F55 A;  1N65 A;  5KTG A;  2G3O A;  5CPV A;  2A46 A;  2HQK A;  5DKN A;  2IB6 A;  3DQM A;  2KQY A;  1KSM A;  4NDC A;  2WOS A;  1SBJ A;  5FVF A;  1G8I A;  5JOL A;  2M7N A;  1QYF A;  3FIA A;  4P2Y B;  3GK4 X;  1RMO A;  3ZWH A;  4ZF5 A;  2M0R A;  1AJ5 A;  3SST A;  3IQO A;  2OPO A;  3EKJ A;  5BQL A;  1ODB A;  2K2F A;  3O6B A;  1HT9 A;  3OSQ A;  4YGD B;  3TMR A;  1FW4 A;  4W7R A;  2H6V A;  1YRU B;  1A75 B;  4AQJ A;  4W69 A;  4WQ3 A;  1UHH A;  5B8I B;  1XFY O;  1UIS A;  2OS8 B;  4R6B A;  3DPZ A;  3DVK A;  1SK6 D;  5I2O A;  1EMK A;  3A4U B;  5ER4 X;  1YJF A;  2WIQ A;  1TIZ A;  4N1G A;  1NCX A;  4JWQ A;  4LJC A;  2I18 A;  3BQ3 A;  2A4J A;  2AAO A;  3LVA A;  4EMQ A;  2B1U A;  3TDU A;  4OKH A;  3ST2 A;  4W6A A;  2LE9 B;  2KAV A;  1ALV A;  5DPI A;  1CDN A;  1NCY A;  4XYN A;  1KK7 Y;  5HLO A;  3LK1 A;  5AAN A;  1DJZ A;  2L4H A;  3SSY A;  2AWM A;  3LCP C;  4ZF4 A;  5DKR A;  2HQZ A;  1N2D A;  4GES B;  3M24 A;  4AOM A;  1ZGQ A;  1KFX L;  1N0Y A;  4HVF A;  1G7K A;  2GX2 A;  1XK4 A;  1IKU A;  4MLW A;  1EMG A;  1XQM A;  4MZL A;  3AKB A;  3NED A;  2EHB A;  4MVF A;  2F2O A;  1F8H A;  2BTJ A;  1WY9 A;  2HFC A;  2JT3 A;  4W6M A;  4U8D A;  1B9C A;  1YUR A;  1FBV A;  3DVM A;  2OTE A;  1NCZ A;  1PRW A;  4DCK A;  2E30 A;  4ORN A;  4I5J A;  2Z6X A;  2G6X A;  1AK8 A;  5HZO A;  4H47 A;  4AR7 A;  3O77 A;  3EKH A;  3SS0 A;  5HZS A;  4NDB A;  3I5F B;  4N3D A;  1B4C A;  2ISD A;  1E8A A;  2POX A;  1Y0V H;  1F4Q A;  1M46 A;  3BUO B;  5DRF A;  2QLI A;  2L50 A;  5T3I A;  2B3P A;  1CM1 A;  1PAL A;  3BXA A;  2KI6 D;  3CGL A;  1QIW A;  3SSH A;  3BUN B;  1BF5 A;  4N5X A;  2ZRS A;  2HQW A;  4NDD A;  2F33 A;  1QX2 A;  4XL5 A;  5LTR A;  2L4I A;  2O5G A;  4W6G A;  2M29 A;  1QX7 A;  3A8S A;  2GV5 A;  2IB5 A;  1H8B A;  4W6B A;  2GGZ A;  4W75 A;  2KHN A; 
#chains in the Genus database with same CATH topology
 2WHT A;  3S0F A;  2BKH B;  3QME A;  2VVI A;  1KQV A;  5DQM A;  1HQV A;  5AER A;  2V4E A;  3E3R A;  2FOT A;  3VRQ A;  1F0B A;  1Q4B A;  3RWT A;  3V3D A;  1IH0 A;  3PN7 C;  1B1G A;  1JC1 A;  4EN1 A;  2WOR A;  1W7S A;  5H89 A;  5DIC A;  4FQT A;  2LLU A;  5HZT A;  4W6S A;  5H88 A;  3A8R A;  3OHM B;  2IOV A;  1IGV A;  3W1C A;  1UHJ A;  1NYA A;  4GGF A;  2COL B;  3KCS A;  2P71 A;  1XMZ A;  3LVC A;  5HKY A;  4ICB A;  4RYW A;  1QVI Z;  1QIV A;  5HYD A;  4W6N A;  1TNQ A;  3K1K A;  1QJT A;  2K7D A;  4W6U A;  2JWW A;  3ZTF A;  1XA9 A;  1CLL A;  5HBD A;  1G4Y R;  2JXC A;  4GF6 B;  2QT2 A;  1DTL A;  2OGR A;  5F6T A;  3SVC A;  4XJK B;  1TCF A;  2Q91 A;  1UHI A;  3O2P A;  1XA5 A;  3CZT X;  4I5L B;  2BNX A;  2Z6Y A;  2KDH A;  1MYW A;  4IJ7 A;  2F3Z A;  2FL1 A;  3DQ4 A;  2AWJ A;  3L4L A;  3DQC A;  1GFL A;  1OXD A;  3CFF A;  4USL A;  4OQW A;  1SYM A;  4FTG A;  2G6E A;  4W7D A;  2LC5 A;  4W74 A;  1NUB A;  5FVG A;  1PSR A;  3CDN A;  1EMA A;  4OZD A;  1GGW A;  2L5Y A;  1KSO A;  1Q73 A;  4KPI A;  3K21 A;  3VRO A;  1TNW A;  1EMB A;  1F09 A;  1TN4 A;  1ALW A;  3AKA A;  3KHE A;  4GNK B;  3VRR A;  1IJ5 A;  2FJU B;  5EXU A;  2EMN A;  2JNF A;  3S0A A;  5HW9 A;  1QY3 A;  1DT7 B;  2ICR A;  3DVE A;  2KAX A;  3OX6 A;  4ORB B;  4W7A A;  4PFE A;  1SW8 A;  2HQ8 A;  3DQ1 A;  3U8P A;  4KF5 C;  4DXQ A;  5BPJ A;  1DEK A;  1S26 D;  1YZW A;  1YRT B;  2MRD A;  3R1V A;  2M9G A;  4EDS A;  1BMO A;  4HRH A;  1Q4D A;  4AQI A;  3UNW A;  3ZNI A;  1IJ6 A;  1KYR A;  3DF0 B;  2ZRT A;  2KYC A;  3GJ2 A;  2WCM A;  4M2Q A;  2O60 A;  1HCJ A;  2BE4 A;  4MRX A;  2NLN A;  1UUR A;  2QLE A;  1NPQ A;  2PQL A;  2AMI A;  2JOJ A;  2PMY A;  1CDM A;  1FI6 A;  3DVJ A;  5BT0 A;  5EXC I;  2H8Q A;  2K0J A;  3DYE A;  1ZUZ A;  4W6F A;  1IG5 A;  1XO5 A;  2ZO6 A;  1ZMZ A;  1FI5 A;  3DQK A;  2CNP A;  1J7R A;  1DC1 A;  4LQT A;  2QLG B;  2KOT A;  5KU1 A;  2AHA A;  2KFG A;  2HGY A;  1IIO A;  2WSN A;  1OXF A;  1Z4H A;  1IQ3 A;  1C4F A;  2EGD A;  4KA9 A;  3DY9 A;  1TUZ A;  4F0Z B;  2A50 B;  1AJ4 A;  1MOV A;  3CS1 A;  4EDO A;  1MQ1 A;  2KFF A;  3SSP A;  1Y1U A;  1OMD A;  1LXF C;  1Q80 A;  1Z1Q A;  1DJH A;  1YUS A;  2DDD A;  1MR8 A;  2Z1O A;  1ZAC A;  3R1P A;  2DOQ A;  3SS4 A;  3PJ7 A;  3PAL A;  2RGI A;  3U8C A;  1WDC B;  3NHT A;  2JT8 A;  1QVI Y;  2OKW A;  2L98 A;  2BBM A;  2A48 A;  2QU1 A;  4I2Y A;  3ST3 A;  1EH2 A;  1LVC D;  4YGA A;  4DKM A;  3SG4 A;  2KSP A;  2LVJ A;  4ZF3 A;  3LVD A;  3IQQ A;  5DPJ A;  2G2B A;  4LJB A;  5JJG A;  2KQ6 A;  4W6O A;  3ST4 A;  5FYX A;  1QLK A;  1M39 A;  3GK1 A;  1S5G Z;  4HQ8 A;  4IK4 A;  2GW3 A;  1SL9 A;  1R6P A;  5FI2 A;  4OCI A;  4XJK A;  2H5Q A;  2M1U A;  5HGE A;  3FS7 A;  1Q4E A;  1CMF A;  4KW8 A;  1G33 A;  3SSL A;  2EMD A;  2OS8 C;  1YVL A;  3DQ9 A;  2VAE A;  1FPW A;  3IF7 A;  3PJB A;  3NSI A;  1MHO A;  2WCE A;  2M8U A;  2WC8 A;  3LSA A;  2KGR A;  1CB1 A;  2FWQ A;  1SPY A;  2BCB A;  4GFT A;  4DXI A;  3WNX B;  3AI4 A;  2HPS A;  4KF4 A;  1DVI A;  4PHK A;  2QRF A;  1H6R A;  2JNX A;  3MSE B;  3SS3 A;  1Y6W A;  1J7P A;  4D1E A;  3SVD A;  3SVO A;  2ZNE A;  4JEO A;  4J88 A;  3CTN A;  5HLV A;  5HZU A;  3ADF A;  1CFP A;  2HCG A;  4L12 A;  1REC A;  1M31 A;  2KFH A;  2LM5 A;  3S05 A;  3M22 A;  3SVB A;  4IK9 A;  2QEO A;  2LCP A;  2SCP A;  3NSK A;  4P76 A;  1C07 A;  1BR4 B;  3TUY C;  3VRP A;  4B30 A;  3DQU A;  1W7T A;  1YHI A;  3DQF A;  4JKT A;  3EG5 B;  3SG5 A;  1A29 A;  1CTR A;  1RMM A;  5FI6 A;  1JF2 A;  4JFG A;  4W76 A;  4B5Y A;  1QV1 A;  1KQM C;  4W6P A;  1RTP 1;  2OKY A;  3I5F C;  1B8L A;  4OVN F;  4N1F A;  3DD4 A;  5KSZ A;  4U2V A;  3DQO A;  4Q9W A;  3DQL A;  4GOB A;  4YGE B;  3C1V A;  4W6K A;  1NX1 A;  1NX0 A;  4NQG A;  4PE7 A;  3D0Y B;  2BKI B;  4L9M A;  5EJU A;  1JC0 A;  3DPW A;  1KK8 B;  2YFP A;  2KI6 C;  3KPX A;  1CFF A;  3EK4 A;  2WCL A;  1CLM A;  4L13 A;  3PSR A;  3DXL A;  2MLE C;  2G9B A;  3PM8 A;  3CFH A;  1WLZ A;  5I2L A;  4KF5 A;  3DQA A;  3LK0 A;  1QLS A;  4MBE A;  3S0G A;  2K61 A;  3VIC A;  2Q6P A;  2ZFD A;  2MA2 A;  1K9P A;  4DXO A;  3CZ0 A;  3FWC A;  1JSA A;  3TUY B;  3SVE A;  5HKZ A;  2V53 A;  1K90 D;  2B3Q A;  4TZA A;  1EJ3 A;  1CKK A;  1KYP A;  2D8N A;  4CPV A;  1OZO A;  4M2P A;  1OOF A;  3NEZ A;  3SG2 A;  1J1E A;  2L2C A;  4W6T A;  3VHT B;  3U0M A;  1OOJ A;  3N7H A;  3DQ3 A;  1KQM B;  5EHU A;  3SG6 A;  1S5G Y;  1RM9 A;  1OZS A;  1YX7 A;  3O4Y A;  1OXE A;  2WSO A;  4I5N B;  1A2X A;  2HRS A;  3DQ7 A;  1TWO A;  3E5W A;  2KNE A;  1BT6 A;  3S0E A;  4P5O E;  1QYO A;  4MZJ A;  3BUM B;  1Q4A A;  4JGE A;  2ZO7 A;  5DU0 A;  1UHN A;  3KF9 A;  3UO9 A;  3GL4 A;  1S36 A;  3ZUL A;  3OBV A;  2LHI A;  2K2A A;  1C3Y A;  2M49 B;  3I5I B;  3DQI A;  4MZK A;  4PE1 A;  1Y1X A;  4KGF A;  1UUS A;  2RH7 A;  3SVS A;  2P4M A;  3CFA A;  1SKT A;  4ZCU A;  1CLB A;  2OTB A;  1LIN A;  2PXS A;  4W6I A;  1IWQ A;  3TDZ A;  1OMV A;  3L4A A;  4ZIN A;  4A4C A;  3UG0 A;  2WC6 A;  3SG7 A;  2GGM A;  2LUX A;  1IQ5 A;  3FWB A;  4BY5 A;  4W72 A;  2PYQ A;  1J1D A;  4IL1 A;  5DY6 A;  3CBE A;  3HX4 A;  2WCB A;  4TZG A;  4DRW A;  2JXL A;  3WHU B;  2G3D B;  3U0K A;  1A75 A;  5FVI A;  3I5G C;  3DQJ A;  1LKJ A;  4PE4 A;  3BUW B;  2MJW B;  2DUH A;  2GX0 A;  1PVB A;  1R2U A;  2WCH A;  2SAS A;  1DGU A;  1A4P A;  2BCA A;  2Y0G A;  1GL4 A;  3D10 A;  4EUL A;  5D69 A;  2BAP A;  1SNL A;  3E5T A;  2PAS A;  3B87 A;  4YBH B;  4JF9 A;  2JRF A;  2PRU A;  2QPT A;  3D0Y A;  2WHS A;  1GGZ A;  4H3L A;  3BFA A;  1DJW A;  4W6C A;  2L0P A;  1XAE A;  3DQ8 A;  1XFR A;  4DUQ A;  1BU3 A;  1GGX A;  1K95 A;  1MXL C;  1FF1 A;  1W7J B;  3BX9 A;  3I5H C;  4Q7T A;  3JTD C;  3H1O A;  1S6J A;  3IVT A;  4PAL A;  4HSZ A;  5AQB B;  3B86 A;  1LS8 A;  3CZ1 A;  1TNP A;  1GM0 A;  2LP3 A;  1M63 B;  2G5Z B;  2ZN9 A;  5ER5 A;  2C9I A;  3I5G B;  2QEH A;  3CZ2 A;  4XOV A;  1SSE B;  1IRJ A;  4W6R A;  1BR1 B;  3ED8 A;  1ZGO A;  5TNC A;  2WIS A;  1B8C A;  3VHT A;  3VRN A;  1ZUX A;  4PE0 A;  1W9Z A;  4CLN A;  2ZND A;  3GOF A;  5J2O A;  1WDC C;  3CLN A;  1H4B A;  2M7L A;  1AHR A;  3EVV A;  2LVK A;  1C7W A;  4OV2 A;  3NT3 A;  4W77 A;  2DUE A;  2L5X B;  4FQO A;  1DJX A;  1MXE A;  2K60 A;  1EMF A;  3BOW B;  2LNK A;  3BXK A;  3SVN A;  4ZBL A;  2R2I A;  1QYQ A;  5F9G A;  1WRK A;  3PAT A;  1MWN A;  3S0D A;  1S6I A;  1CFC A;  1EMC A;  3SSK A;  1B8R A;  5HL1 A;  2K7B A;  1X02 A;  1T14 A;  5D7F A;  2AWL A;  2HET A;  3I5H B;  3OGO A;  3JTD B;  1YVH A;  2GW4 B;  4ORC B;  1EL4 A;  4PPK A;  1BOC A;  2AH8 A;  2O24 A;  4JC2 A;  3PJ5 A;  1TNX A;  1K9U A;  3VGO A;  1AP4 A;  2KAY A;  3U0L A;  2JPT A;  4A4B A;  1SY9 A;  3CAB A;  2G6Y A;  3PJI A;  1W7U A;  1KYS A;  3PM2 A;  3R72 A;  5J3X A;  3IR8 A;  3BXC A;  3CR2 A;  5AFP A;  3OSR A;  3SG3 A;  1QV0 A;  2FCE A;  5H87 A;  4GBA A;  1YR5 A;  5D3O A;  1QXP A;  3L47 A;  2LMT A;  5EL2 A;  3ST0 A;  3OB2 B;  1W7I B;  2WC5 A;  5KTY A;  1KWO C;  2WCF A;  2MHH A;  3LL8 B;  2H61 C;  1L2O C;  3VB1 A;  2Y4Q A;  1EMM A;  4PDZ A;  1PK0 D;  4PPL A;  4OY4 A;  4Q7R A;  2BL0 C;  2ZMU A;  1EG3 A;  3B6X A;  4M2O A;  4E68 A;  4INW A;  4NWS A;  1BOD A;  1Q4C A;  1TCO B;  2DDC A;  1JFK A;  3ICB A;  1DMO A;  2ZN8 A;  4LW5 A;  4DIR A;  3ZUJ A;  3LLE A;  4YGB B;  1F70 A;  2LAN A;  3CWG A;  4YI9 A;  3PIB A;  2Y5I A;  2A47 A;  2F8P A;  3DQ6 A;  4YI8 A;  4WQ2 A;  3EVR A;  4Q04 A;  2I2R E;  2LAP A;  1PSB A;  4CFQ A;  3O78 A;  2K7O A;  4UPG A;  2LVV A;  3NSL A;  2BCX A;  1CMG A;  4UTS A;  2P70 A;  4H3N A;  4DXN A;  2KPH A;  2WND A;  1KK8 C;  4KEX A;  3PFV A;  4IK1 A;  1MF8 B;  1OSA A;  3H4S E;  2LUC A;  1XFZ O;  3RLZ A;  4W6H A;  3NSO A;  2TN4 A;  4IK8 A;  1KP5 A;  2Z6Z A;  2VZX A;  1KWO B;  4CID A;  4XGY A;  4MEW A;  2H5R A;  1DJY A;  3S0B A;  1L2O B;  3WHT B;  2WCK A;  4ZIO A;  4IZN A;  2CBL A;  4HRE E;  1Z1P A;  1XVJ A;  3FE8 A;  2BL0 B;  3TS5 B;  2KLD A;  1NX2 A;  2MBX A;  4HRG A;  4JRB A;  1RK9 A;  2V4E B;  3DPX A;  4W7C A;  1RJV A;  1KCY A;  1QXT A;  1V1G A;  1WRL A;  4OJ0 A;  5DQB A;  3WLC A;  1KFX S;  3DF0 A;  4GUK A;  1S6C A;  3RM1 A;  2DD7 A;  3AAK A;  2PVB A;  2JC2 A;  1SCM C;  3BOW A;  4OR9 B;  1JBZ A;  2OTG B;  2QZ0 A;  3LF3 A;  2WUR A;  5DTZ A;  2F2P A;  2VAD A;  3CD1 A;  4XOW A;  4HQC A;  4MSP A;  2L51 A;  2BE6 A;  1CDL A;  5DTY A;  4KW9 A;  3AAJ A;  4MRY A;  1ZFS A;  1RMP A;  4YRU A;  1DF0 B;  2G2S B;  3FE9 A;  2I94 A;  3D74 A;  4ZCV A;  3NXA A;  1JFJ A;  2QLG A;  2A52 B;  3EK8 A;  4Q9X A;  1BJF A;  4W6D A;  3GEX A;  1S3P A;  2LVI A;  3JVT C;  1QS7 A;  1EG4 A;  1D1O A;  3SJS A;  5LTP A;  1AUI B;  1SL7 A;  3HCM A;  3SVU A;  2PAL A;  4PPJ A;  2JZI A;  1TRF A;  3I5I C;  1A03 A;  4WRI A;  4GAO A;  2YE1 A;  2EC6 C;  4KW4 A;  3QRX A;  1YTZ C;  1LA0 A;  2CT9 A;  1JBA A;  2NCP A;  2KBI A;  3DQD A;  4Z4M A;  2JPO A;  5I2Q A;  2JAD A;  2HGD A;  4BY4 A;  4DXM A;  5I94 A;  1AVS A;  1SCM B;  1U5I B;  5IBW A;  4KAG A;  1OE9 B;  1RWY A;  3WLD A;  1J7O A;  1K9K A;  1OOH A;  1DGV A;  2Y1N A;  2A56 B;  3E5V A;  1MUX A;  2L2E A;  1UP5 A;  4OHS A;  4R6D A;  3RZS A;  3NHI A;  2LLS A;  3OGN A;  3SRY A;  1YUU A;  1PVA A;  2E6W A;  1L7Z A;  2EMO A;  3GJ1 A;  2NCO A;  1K94 A;  3TZ1 A;  4AS8 A;  2LMV A;  4C0K A;  1ZOT B;  2Y1M A;  3SSV A;  1UWO A;  1XFX O;  5BTT B;  3JVT B;  1CFD A;  4C0J A;  3BXB A;  1J7Q A;  2KI4 C;  1OMR A;  3NT9 A;  4W73 A;  1OQP A;  2Q4U A;  2F3Y A;  2YDZ A;  2JTT A;  3BYA A;  2FZU A;  1JC2 A;  3UFZ A;  2LLT A;  2EC6 B;  4HE4 A;  2DUI A;  4CFR A;  2H5O A;  5DRG A;  2MAZ A;  1JWD A;  4H3M A;  2BBN A;  2GTE A;  3D75 A;  3CB9 A;  2HPW A;  1GJY A;  2H61 A;  1DJG A;  4QJ5 B;  1CNP A;  4MN0 A;  2DD9 A;  4Z4K A;  3F45 A;  5CSJ A;  3AI5 A;  2C9J A;  5AEQ A;  4QJ3 B;  4LJD C;  1YHG A;  4PHN A;  4W7F A;  1NX3 A;  1EML A;  1QTX A;  1XFU O;  2Q57 A;  1TUJ A;  4KGE A;  5DKQ A;  1B9A A;  2YE0 A;  5DTX A;  1B7T Z;  3KCT A;  4W7X A;  4H48 A;  4ANJ A;  4DS7 A;  2DUF A;  1NSH A;  4ORA B;  3DQN A;  2CCM A;  2H9W A;  4JQ0 D;  2OJK A;  3DQE A;  1H4U A;  2QLH A;  3AKO A;  2KI4 B;  3G9A A;  1DF0 A;  2AWK A;  3OP0 A;  1ORG A;  1M45 A;  3ZUF A;  5G08 A;  3EVP A;  2VVJ A;  1RFJ A;  2O29 A;  4XVP A;  5DPH A;  3LA1 A;  1DEL A;  4W6L A;  2IE2 A;  2PXW A;  1RRO A;  4QJ4 B;  3SVR A;  2QAC A;  3MGF A;  1XSS A;  3DQ2 A;  2O2B A;  4ZFS A;  2DUG A;  1YX8 A;  1XFV O;  4Q7U A;  1V1F A;  5EXB A;  2PSR A;  3U0N A;  3CYZ A;  3B88 A;  1SR6 C;  2P6B B;  4W6J A;  3M0W A;  1MOU A;  3PN7 B;  3DZT A;  1S6Z A;  1CM4 A;  1ZGP A;  4GPL B;  1QAT A;  3SV5 A;  2IS9 A;  3CR5 X;  4J8A A;  1U5I A;  1TOP A;  3EVU A;  3SS5 A;  1NP8 A;  3OX5 A;  3WCK A;  1RRX A;  4PT1 A;  3DQH A;  2MLF C;  2A53 B;  4DXP A;  4PCW A;  3BUX B;  1YJ2 A;  4TNC A;  5K89 A;  1EME A;  2KLE A;  2M3W A;  4KYN A;  1K2H A;  4RTC A;  1J55 A;  1SCV A;  2KGB C;  1JBY A;  4P1Q A;  1YFP A;  4JPZ B;  2FCD A;  2HF5 A;  1QWV A;  2JT0 A;  1KFU S;  4YGC B;  1OOI X;  3U8A A;  1HUY A;  4OGS A;  5EBJ A;  4F7F A;  1VRK A;  1XK4 C;  3P28 A;  2H2K A;  5BTT A;  2M1K B;  2NXQ A;  2ZMW A;  5DTL A;  3BFH A;  2BEC A;  1K8U A;  4B30 B;  2LV7 A;  4R1E A;  3CGA A;  5CSF A;  1GQM A;  3IP2 A;  1JUO A;  1PUL A;  2M97 A;  4IK5 A;  5CSN A;  1SR6 B;  2AUC A;  3TMT A;  1Y1A A;  4C0L A;  4DKN A;  2JTZ A;  2KBM A;  1CV7 A;  2G16 B;  1K96 A;  4J89 A;  3WXA A;  3H1R A;  3VK1 A;  1KK7 Z;  3KO0 A;  5AXI A;  3LF4 B;  1LA3 A;  3NF0 A;  3CR4 X;  4IK3 A;  2K7C A;  3CD9 A;  1CDP A;  3SIA A;  1B47 A;  1QAS A;  3KEV A;  3TDI A;  3BFB A;  3GB3 A;  4LQU A;  2JUL A;  4L1I A;  4ETO A;  1F71 A;  1NWD A;  1B7T Y;  1KFU L;  3DQ5 A;  3K1E A;  5FI7 A;  2LMU A;  2KYF A;  5I8N A;  1BFP A;  2JQ6 A;  5EB7 A;  2H5P A;  5CSI A;  4HQ9 A;  2ERB A;  2A54 B;  2QEV A;  5EB6 A;  1C7V A;  2I7A A;  3TS5 C;  1OOG A;  1K93 D;  2V4E C;  1XFW O;  3P8U A;  2JU0 A;  4PHJ A;  4W7E A;  5HKW A;  1UHK A;  2VRG A;  2ZKM X;  5PAL A;  3RWA A;  1XYD A;  3D73 A;  1QX5 B;  1SRA A;  3NGV A;  1F4O A;  2FJY A;  1SMG A;  1YUT A;  1F54 A;  1JF0 A;  2LP2 A;  2NZ0 A;  2OTG C;  4JD9 A;  4ZB1 A;  4GGF C;  1S1E A;  1BLQ A;  4RYS A;  2VVH A;  3D78 A;  4I5K A;  5LK4 A;  1WRZ A;  1BG1 A;  3OB1 B;  2CXJ A;  1YHH A;  4GGN A;  3PLF B;  4LJD A;  1SL8 A;  5LTQ A;  2LHL A;  3I19 A;  1NIW A;  3EK7 A;  4BDU A;  1TTX A;  2K8M B;  1EXR A;  1WLM A;  5FHV A;  4PHM A;  1DJI A;  5DPG A;  2WHU A;  3W1D A;  3SIB A;  2HJO A;  5GQQ C;  2ARL A;  3GK2 A;  1DQE A;  2CTN A;  3LS3 A;  1F55 A;  1N65 A;  5KTG A;  2G3O A;  5CPV A;  2A46 A;  2HQK A;  5DKN A;  2IB6 A;  1C3Z A;  3DQM A;  2KQY A;  1KSM A;  4NDC A;  1Z2C B;  2WOS A;  1SBJ A;  5FVF A;  1G8I A;  5JOL A;  2M7N A;  1QYF A;  3FIA A;  4P2Y B;  3GK4 X;  1RMO A;  3ZWH A;  4ZF5 A;  2M0R A;  1AJ5 A;  3SST A;  3IQO A;  2OPO A;  3EKJ A;  5BQL A;  1ODB A;  4INX A;  3Q8I A;  2K2F A;  3O6B A;  1HT9 A;  3OSQ A;  4YGD B;  3TMR A;  1FW4 A;  4W7R A;  2QDI A;  2H6V A;  1YRU B;  1A75 B;  3O4X A;  4AQJ A;  4W69 A;  3D77 A;  4WQ3 A;  1UHH A;  5B8I B;  1XFY O;  1UIS A;  2OS8 B;  4R6B A;  3DPZ A;  3DVK A;  1SK6 D;  5I2O A;  1EMK A;  3A4U B;  5ER4 X;  1YJF A;  2WIQ A;  1TIZ A;  4N1G A;  1NCX A;  4JWQ A;  4LJC A;  2I18 A;  3BQ3 A;  2A4J A;  3R1O A;  2AAO A;  3LVA A;  4EMQ A;  3D76 A;  2B1U A;  3TDU A;  4OKH A;  3ST2 A;  4W6A A;  2LE9 B;  2KAV A;  1ALV A;  5DPI A;  1CDN A;  1NCY A;  4XYN A;  1KK7 Y;  5HLO A;  3LK1 A;  5AAN A;  1DJZ A;  2L4H A;  3SSY A;  2AWM A;  3LCP C;  4ZF4 A;  5DKR A;  2HQZ A;  1N2D A;  4GES B;  3M24 A;  4AOM A;  1ZGQ A;  1KFX L;  1N0Y A;  4HVF A;  1G7K A;  2GX2 A;  2H8V A;  1P28 A;  1XK4 A;  1IKU A;  4MLW A;  1EMG A;  1XQM A;  4MZL A;  3AKB A;  3NED A;  2EHB A;  4MVF A;  2F2O A;  1F8H A;  2BTJ A;  1WY9 A;  2HFC A;  2JT3 A;  4W6M A;  4U8D A;  1B9C A;  1YUR A;  1FBV A;  3DVM A;  2OTE A;  1NCZ A;  1PRW A;  4DCK A;  2E30 A;  4ORN A;  4I5J A;  2Z6X A;  2G6X A;  1AK8 A;  5HZO A;  4H47 A;  4AR7 A;  3O77 A;  3EKH A;  3FE6 A;  3SS0 A;  5HZS A;  4NDB A;  3I5F B;  4N3D A;  1B4C A;  2ISD A;  1E8A A;  2POX A;  2QEB A;  1Y0V H;  1F4Q A;  3V2L A;  1M46 A;  3BUO B;  5DRF A;  2QLI A;  2L50 A;  3BJH A;  5T3I A;  2B3P A;  1CM1 A;  1PAL A;  3BXA A;  2KI6 D;  3CGL A;  1QIW A;  3SSH A;  3BUN B;  2WCJ A;  1BF5 A;  4N5X A;  2ZRS A;  2HQW A;  4NDD A;  2F33 A;  1QX2 A;  4XL5 A;  5LTR A;  2L4I A;  3B7A A;  2O5G A;  4W6G A;  1OW4 A;  2M29 A;  1QX7 A;  3A8S A;  2GV5 A;  2YGU A;  2IB5 A;  1H8B A;  4W6B A;  2GGZ A;  4W75 A;  2KHN A; 
#chains in the Genus database with same CATH homology
 2WHT A;  2BKH B;  2VVI A;  1KQV A;  5DQM A;  1HQV A;  5AER A;  2V4E A;  3E3R A;  2FOT A;  3VRQ A;  1F0B A;  1Q4B A;  3RWT A;  3V3D A;  1IH0 A;  3PN7 C;  1B1G A;  1JC1 A;  4EN1 A;  2WOR A;  1W7S A;  5H89 A;  2LLU A;  5HZT A;  4W6S A;  5H88 A;  3A8R A;  3OHM B;  2IOV A;  1IGV A;  3W1C A;  1UHJ A;  1NYA A;  4GGF A;  2COL B;  3KCS A;  1XMZ A;  3LVC A;  5HKY A;  4ICB A;  4RYW A;  1QVI Z;  1QIV A;  5HYD A;  4W6N A;  1TNQ A;  3K1K A;  1QJT A;  2K7D A;  4W6U A;  2JWW A;  3ZTF A;  1XA9 A;  1CLL A;  5HBD A;  1G4Y R;  2JXC A;  4GF6 B;  2QT2 A;  1DTL A;  2OGR A;  5F6T A;  3SVC A;  4XJK B;  1TCF A;  2Q91 A;  1UHI A;  3O2P A;  1XA5 A;  3CZT X;  4I5L B;  2Z6Y A;  2KDH A;  1MYW A;  2F3Z A;  2FL1 A;  3DQ4 A;  2AWJ A;  3DQC A;  1GFL A;  1OXD A;  3CFF A;  4USL A;  4OQW A;  1SYM A;  4FTG A;  2G6E A;  4W7D A;  2LC5 A;  4W74 A;  1NUB A;  5FVG A;  1PSR A;  1EMA A;  1GGW A;  1KSO A;  1Q73 A;  4KPI A;  3K21 A;  3VRO A;  1TNW A;  1EMB A;  1F09 A;  1TN4 A;  1ALW A;  3AKA A;  3KHE A;  4GNK B;  3VRR A;  1IJ5 A;  2FJU B;  5EXU A;  2EMN A;  2JNF A;  5HW9 A;  1QY3 A;  1DT7 B;  2ICR A;  3DVE A;  2KAX A;  3OX6 A;  4ORB B;  4W7A A;  4PFE A;  1SW8 A;  2HQ8 A;  3DQ1 A;  3U8P A;  4KF5 C;  4DXQ A;  5BPJ A;  1S26 D;  1YZW A;  1YRT B;  2MRD A;  2M9G A;  4EDS A;  1BMO A;  4HRH A;  1Q4D A;  4AQI A;  3ZNI A;  1IJ6 A;  1KYR A;  3DF0 B;  2ZRT A;  2KYC A;  3GJ2 A;  4M2Q A;  2O60 A;  1HCJ A;  2BE4 A;  4MRX A;  2NLN A;  1UUR A;  2QLE A;  1NPQ A;  2AMI A;  2JOJ A;  2PMY A;  1CDM A;  1FI6 A;  3DVJ A;  5BT0 A;  5EXC I;  2H8Q A;  2K0J A;  1ZUZ A;  4W6F A;  1IG5 A;  1XO5 A;  2ZO6 A;  1ZMZ A;  1FI5 A;  3DQK A;  2CNP A;  1J7R A;  4LQT A;  2QLG B;  2KOT A;  5KU1 A;  2AHA A;  2KFG A;  2HGY A;  2WSN A;  1OXF A;  1IQ3 A;  1C4F A;  2EGD A;  4KA9 A;  4F0Z B;  2A50 B;  1AJ4 A;  1MOV A;  3CS1 A;  4EDO A;  1MQ1 A;  2KFF A;  3SSP A;  1Y1U A;  1OMD A;  1LXF C;  1Q80 A;  1Z1Q A;  1DJH A;  1YUS A;  2DDD A;  1MR8 A;  2Z1O A;  1ZAC A;  2DOQ A;  3PJ7 A;  3PAL A;  2RGI A;  3U8C A;  1WDC B;  2JT8 A;  1QVI Y;  2OKW A;  2L98 A;  2BBM A;  2A48 A;  2QU1 A;  4I2Y A;  3ST3 A;  1EH2 A;  1LVC D;  4YGA A;  4DKM A;  3SG4 A;  2KSP A;  2LVJ A;  4ZF3 A;  3LVD A;  3IQQ A;  5DPJ A;  2G2B A;  4LJB A;  5JJG A;  2KQ6 A;  4W6O A;  3ST4 A;  5FYX A;  1QLK A;  1M39 A;  3GK1 A;  1S5G Z;  4HQ8 A;  4IK4 A;  2GW3 A;  1SL9 A;  1R6P A;  4OCI A;  4XJK A;  2H5Q A;  2M1U A;  5HGE A;  3FS7 A;  1Q4E A;  1CMF A;  4KW8 A;  1G33 A;  3SSL A;  2EMD A;  2OS8 C;  1YVL A;  3DQ9 A;  2VAE A;  1FPW A;  3IF7 A;  3PJB A;  3NSI A;  1MHO A;  2WCE A;  2M8U A;  2WC8 A;  3LSA A;  2KGR A;  1CB1 A;  2FWQ A;  1SPY A;  2BCB A;  4GFT A;  4DXI A;  3WNX B;  3AI4 A;  2HPS A;  4KF4 A;  1DVI A;  4PHK A;  2QRF A;  1H6R A;  2JNX A;  3MSE B;  1Y6W A;  1J7P A;  4D1E A;  3SVD A;  3SVO A;  2ZNE A;  4JEO A;  4J88 A;  3CTN A;  5HLV A;  5HZU A;  3ADF A;  1CFP A;  2HCG A;  4L12 A;  1REC A;  1M31 A;  2KFH A;  2LM5 A;  3S05 A;  3M22 A;  3SVB A;  4IK9 A;  2LCP A;  2SCP A;  3NSK A;  4P76 A;  1C07 A;  1BR4 B;  3TUY C;  3VRP A;  4B30 A;  3DQU A;  1W7T A;  1YHI A;  3DQF A;  3SG5 A;  1A29 A;  1CTR A;  1RMM A;  1JF2 A;  4JFG A;  4W76 A;  4B5Y A;  1QV1 A;  1KQM C;  4W6P A;  1RTP 1;  2OKY A;  3I5F C;  1B8L A;  4OVN F;  4N1F A;  3DD4 A;  5KSZ A;  4U2V A;  3DQO A;  4Q9W A;  3DQL A;  4GOB A;  4YGE B;  3C1V A;  4W6K A;  1NX1 A;  1NX0 A;  4NQG A;  4PE7 A;  3D0Y B;  2BKI B;  4L9M A;  5EJU A;  1JC0 A;  3DPW A;  1KK8 B;  2YFP A;  2KI6 C;  3KPX A;  1CFF A;  3EK4 A;  1CLM A;  4L13 A;  3PSR A;  2MLE C;  2G9B A;  3PM8 A;  3CFH A;  1WLZ A;  5I2L A;  4KF5 A;  3DQA A;  3LK0 A;  1QLS A;  4MBE A;  2K61 A;  3VIC A;  2Q6P A;  2ZFD A;  2MA2 A;  1K9P A;  4DXO A;  3FWC A;  1JSA A;  3TUY B;  3SVE A;  5HKZ A;  2V53 A;  1K90 D;  2B3Q A;  4TZA A;  1EJ3 A;  1CKK A;  1KYP A;  2D8N A;  4CPV A;  1OZO A;  4M2P A;  3NEZ A;  3SG2 A;  1J1E A;  4W6T A;  3VHT B;  3U0M A;  1OOJ A;  3DQ3 A;  1KQM B;  5EHU A;  3SG6 A;  1S5G Y;  1RM9 A;  1OZS A;  1YX7 A;  3O4Y A;  1OXE A;  2WSO A;  4I5N B;  1A2X A;  2HRS A;  3DQ7 A;  3E5W A;  2KNE A;  1BT6 A;  4P5O E;  1QYO A;  4MZJ A;  3BUM B;  1Q4A A;  4JGE A;  2ZO7 A;  5DU0 A;  1UHN A;  3KF9 A;  3GL4 A;  1S36 A;  3ZUL A;  2LHI A;  2K2A A;  2M49 B;  3I5I B;  3DQI A;  4MZK A;  4PE1 A;  1Y1X A;  4KGF A;  1UUS A;  2RH7 A;  3SVS A;  2P4M A;  3CFA A;  1SKT A;  4ZCU A;  1CLB A;  2OTB A;  1LIN A;  2PXS A;  4W6I A;  1IWQ A;  3TDZ A;  1OMV A;  4ZIN A;  4A4C A;  3UG0 A;  3SG7 A;  2GGM A;  2LUX A;  1IQ5 A;  3FWB A;  4BY5 A;  4W72 A;  1J1D A;  4IL1 A;  5DY6 A;  3CBE A;  3HX4 A;  2WCB A;  4TZG A;  4DRW A;  2JXL A;  3WHU B;  2G3D B;  3U0K A;  1A75 A;  5FVI A;  3I5G C;  3DQJ A;  1LKJ A;  4PE4 A;  3BUW B;  2MJW B;  2DUH A;  2GX0 A;  1PVB A;  1R2U A;  2SAS A;  1DGU A;  1A4P A;  2BCA A;  2Y0G A;  1GL4 A;  3D10 A;  4EUL A;  5D69 A;  1SNL A;  3E5T A;  2PAS A;  4YBH B;  4JF9 A;  2JRF A;  2PRU A;  2QPT A;  3D0Y A;  2WHS A;  1GGZ A;  4H3L A;  1DJW A;  4W6C A;  2L0P A;  1XAE A;  3DQ8 A;  4DUQ A;  1BU3 A;  1GGX A;  1K95 A;  1MXL C;  1FF1 A;  1W7J B;  3BX9 A;  3I5H C;  4Q7T A;  3JTD C;  3H1O A;  1S6J A;  4PAL A;  4HSZ A;  5AQB B;  1TNP A;  2LP3 A;  1M63 B;  2G5Z B;  2ZN9 A;  5ER5 A;  2C9I A;  3I5G B;  4XOV A;  1IRJ A;  4W6R A;  1BR1 B;  3ED8 A;  1ZGO A;  5TNC A;  2WIS A;  1B8C A;  3VHT A;  3VRN A;  1ZUX A;  4PE0 A;  4CLN A;  2ZND A;  3GOF A;  5J2O A;  1WDC C;  3CLN A;  1H4B A;  2M7L A;  1AHR A;  3EVV A;  2LVK A;  1C7W A;  4OV2 A;  3NT3 A;  4W77 A;  2DUE A;  2L5X B;  4FQO A;  1DJX A;  1MXE A;  1EMF A;  3BOW B;  2LNK A;  3BXK A;  3SVN A;  4ZBL A;  2R2I A;  1QYQ A;  5F9G A;  1WRK A;  3PAT A;  1MWN A;  1S6I A;  1CFC A;  1EMC A;  3SSK A;  1B8R A;  2K7B A;  1X02 A;  5D7F A;  2AWL A;  2HET A;  3I5H B;  3OGO A;  3JTD B;  1YVH A;  2GW4 B;  4ORC B;  1EL4 A;  4PPK A;  1BOC A;  2AH8 A;  2O24 A;  4JC2 A;  3PJ5 A;  1TNX A;  1K9U A;  3VGO A;  1AP4 A;  2KAY A;  3U0L A;  2JPT A;  4A4B A;  1SY9 A;  2G6Y A;  1W7U A;  1KYS A;  5J3X A;  3IR8 A;  3BXC A;  3CR2 A;  5AFP A;  3OSR A;  3SG3 A;  1QV0 A;  2FCE A;  5H87 A;  4GBA A;  1YR5 A;  1QXP A;  2LMT A;  3ST0 A;  3OB2 B;  1W7I B;  5KTY A;  1KWO C;  2WCF A;  2MHH A;  3LL8 B;  2H61 C;  1L2O C;  2Y4Q A;  1EMM A;  4PDZ A;  1PK0 D;  4PPL A;  4OY4 A;  4Q7R A;  2BL0 C;  2ZMU A;  1EG3 A;  4M2O A;  4E68 A;  4NWS A;  1BOD A;  1Q4C A;  1TCO B;  2DDC A;  1JFK A;  3ICB A;  1DMO A;  2ZN8 A;  4LW5 A;  4DIR A;  3ZUJ A;  3LLE A;  4YGB B;  1F70 A;  2LAN A;  3CWG A;  4YI9 A;  3PIB A;  2Y5I A;  2A47 A;  2F8P A;  3DQ6 A;  4YI8 A;  4WQ2 A;  3EVR A;  4Q04 A;  2I2R E;  2LAP A;  1PSB A;  4CFQ A;  3O78 A;  2K7O A;  4UPG A;  2LVV A;  3NSL A;  2BCX A;  1CMG A;  4UTS A;  4H3N A;  4DXN A;  2WND A;  1KK8 C;  4KEX A;  3PFV A;  4IK1 A;  1MF8 B;  1OSA A;  3H4S E;  2LUC A;  1XFZ O;  3RLZ A;  4W6H A;  3NSO A;  2TN4 A;  4IK8 A;  1KP5 A;  2Z6Z A;  2VZX A;  1KWO B;  4CID A;  4XGY A;  4MEW A;  2H5R A;  1DJY A;  1L2O B;  3WHT B;  4ZIO A;  4IZN A;  2CBL A;  4HRE E;  1Z1P A;  1XVJ A;  2BL0 B;  3TS5 B;  1NX2 A;  2MBX A;  4HRG A;  4JRB A;  1RK9 A;  2V4E B;  3DPX A;  4W7C A;  1RJV A;  1KCY A;  1QXT A;  1V1G A;  1WRL A;  4OJ0 A;  5DQB A;  3WLC A;  1KFX S;  3DF0 A;  4GUK A;  1S6C A;  3RM1 A;  2DD7 A;  3AAK A;  2PVB A;  2JC2 A;  1SCM C;  3BOW A;  4OR9 B;  1JBZ A;  2OTG B;  2QZ0 A;  3LF3 A;  2WUR A;  5DTZ A;  2F2P A;  2VAD A;  3CD1 A;  4XOW A;  4HQC A;  4MSP A;  2L51 A;  2BE6 A;  1CDL A;  5DTY A;  4KW9 A;  3AAJ A;  4MRY A;  1ZFS A;  1RMP A;  4YRU A;  1DF0 B;  2G2S B;  2I94 A;  4ZCV A;  3NXA A;  1JFJ A;  2QLG A;  2A52 B;  3EK8 A;  4Q9X A;  1BJF A;  4W6D A;  3GEX A;  1S3P A;  2LVI A;  3JVT C;  1QS7 A;  1EG4 A;  1D1O A;  3SJS A;  5LTP A;  1AUI B;  1SL7 A;  3HCM A;  3SVU A;  2PAL A;  4PPJ A;  2JZI A;  1TRF A;  3I5I C;  1A03 A;  4WRI A;  4GAO A;  2YE1 A;  2EC6 C;  4KW4 A;  3QRX A;  1YTZ C;  1LA0 A;  2CT9 A;  1JBA A;  2NCP A;  2KBI A;  3DQD A;  4Z4M A;  5I2Q A;  2JAD A;  2HGD A;  4BY4 A;  4DXM A;  1AVS A;  1SCM B;  1U5I B;  5IBW A;  4KAG A;  1OE9 B;  1RWY A;  3WLD A;  1J7O A;  1K9K A;  1DGV A;  2Y1N A;  2A56 B;  3E5V A;  1MUX A;  2L2E A;  1UP5 A;  4OHS A;  4R6D A;  2LLS A;  3SRY A;  1YUU A;  1PVA A;  2E6W A;  1L7Z A;  2EMO A;  3GJ1 A;  2NCO A;  1K94 A;  3TZ1 A;  4AS8 A;  2LMV A;  4C0K A;  1ZOT B;  2Y1M A;  3SSV A;  1UWO A;  1XFX O;  5BTT B;  3JVT B;  1CFD A;  4C0J A;  3BXB A;  1J7Q A;  2KI4 C;  1OMR A;  3NT9 A;  4W73 A;  1OQP A;  2Q4U A;  2F3Y A;  2YDZ A;  2JTT A;  3BYA A;  2FZU A;  1JC2 A;  3UFZ A;  2LLT A;  2EC6 B;  4HE4 A;  2DUI A;  4CFR A;  2H5O A;  5DRG A;  2MAZ A;  1JWD A;  4H3M A;  2BBN A;  3CB9 A;  2HPW A;  1GJY A;  2H61 A;  1DJG A;  4QJ5 B;  1CNP A;  4MN0 A;  2DD9 A;  4Z4K A;  3F45 A;  5CSJ A;  3AI5 A;  2C9J A;  5AEQ A;  4QJ3 B;  4LJD C;  1YHG A;  4PHN A;  4W7F A;  1NX3 A;  1EML A;  1QTX A;  1XFU O;  2Q57 A;  4KGE A;  5DKQ A;  1B9A A;  2YE0 A;  5DTX A;  1B7T Z;  3KCT A;  4W7X A;  4H48 A;  4ANJ A;  4DS7 A;  2DUF A;  1NSH A;  4ORA B;  3DQN A;  2CCM A;  2H9W A;  4JQ0 D;  2OJK A;  3DQE A;  1H4U A;  2QLH A;  3AKO A;  2KI4 B;  3G9A A;  1DF0 A;  2AWK A;  3OP0 A;  1M45 A;  3ZUF A;  5G08 A;  3EVP A;  2VVJ A;  1RFJ A;  2O29 A;  4XVP A;  5DPH A;  3LA1 A;  4W6L A;  2IE2 A;  2PXW A;  1RRO A;  4QJ4 B;  3SVR A;  2QAC A;  3MGF A;  1XSS A;  3DQ2 A;  2O2B A;  4ZFS A;  2DUG A;  1YX8 A;  1XFV O;  4Q7U A;  1V1F A;  5EXB A;  2PSR A;  3U0N A;  1SR6 C;  2P6B B;  4W6J A;  3M0W A;  1MOU A;  3PN7 B;  1S6Z A;  1CM4 A;  1ZGP A;  4GPL B;  1QAT A;  3SV5 A;  2IS9 A;  3CR5 X;  4J8A A;  1U5I A;  1TOP A;  3EVU A;  1NP8 A;  3OX5 A;  3WCK A;  1RRX A;  3DQH A;  2MLF C;  2A53 B;  4DXP A;  4PCW A;  3BUX B;  1YJ2 A;  4TNC A;  5K89 A;  1EME A;  2M3W A;  1K2H A;  4RTC A;  1J55 A;  1SCV A;  2KGB C;  1JBY A;  4P1Q A;  1YFP A;  4JPZ B;  2FCD A;  2HF5 A;  2JT0 A;  1KFU S;  4YGC B;  3U8A A;  1HUY A;  4OGS A;  5EBJ A;  1VRK A;  1XK4 C;  3P28 A;  2H2K A;  5BTT A;  2M1K B;  2NXQ A;  2ZMW A;  5DTL A;  2BEC A;  1K8U A;  4B30 B;  2LV7 A;  4R1E A;  3CGA A;  5CSF A;  1GQM A;  3IP2 A;  1JUO A;  1PUL A;  2M97 A;  4IK5 A;  5CSN A;  1SR6 B;  2AUC A;  3TMT A;  1Y1A A;  4C0L A;  4DKN A;  2JTZ A;  2KBM A;  1CV7 A;  2G16 B;  1K96 A;  4J89 A;  3WXA A;  3H1R A;  3VK1 A;  1KK7 Z;  3KO0 A;  5AXI A;  3LF4 B;  1LA3 A;  3NF0 A;  3CR4 X;  4IK3 A;  2K7C A;  3CD9 A;  1CDP A;  3SIA A;  1B47 A;  1QAS A;  3KEV A;  3TDI A;  3GB3 A;  4LQU A;  2JUL A;  4L1I A;  4ETO A;  1F71 A;  1NWD A;  1B7T Y;  1KFU L;  3DQ5 A;  2LMU A;  2KYF A;  5I8N A;  1BFP A;  2JQ6 A;  5EB7 A;  2H5P A;  5CSI A;  4HQ9 A;  2A54 B;  5EB6 A;  1C7V A;  2I7A A;  3TS5 C;  1K93 D;  2V4E C;  1XFW O;  3P8U A;  2JU0 A;  4PHJ A;  4W7E A;  5HKW A;  1UHK A;  2VRG A;  2ZKM X;  5PAL A;  3RWA A;  1XYD A;  1QX5 B;  1SRA A;  1F4O A;  1SMG A;  1YUT A;  1F54 A;  1JF0 A;  2LP2 A;  2NZ0 A;  2OTG C;  4ZB1 A;  4GGF C;  1S1E A;  1BLQ A;  4RYS A;  2VVH A;  4I5K A;  5LK4 A;  1WRZ A;  1BG1 A;  3OB1 B;  2CXJ A;  1YHH A;  4GGN A;  3PLF B;  4LJD A;  1SL8 A;  5LTQ A;  2LHL A;  3I19 A;  1NIW A;  3EK7 A;  4BDU A;  1TTX A;  2K8M B;  1EXR A;  1WLM A;  5FHV A;  4PHM A;  1DJI A;  5DPG A;  2WHU A;  3W1D A;  3SIB A;  2HJO A;  5GQQ C;  2ARL A;  3GK2 A;  2CTN A;  3LS3 A;  1F55 A;  1N65 A;  5KTG A;  2G3O A;  5CPV A;  2A46 A;  2HQK A;  5DKN A;  2IB6 A;  3DQM A;  2KQY A;  1KSM A;  4NDC A;  2WOS A;  1SBJ A;  5FVF A;  1G8I A;  5JOL A;  2M7N A;  1QYF A;  3FIA A;  4P2Y B;  3GK4 X;  1RMO A;  3ZWH A;  4ZF5 A;  2M0R A;  1AJ5 A;  3SST A;  3IQO A;  2OPO A;  3EKJ A;  5BQL A;  1ODB A;  2K2F A;  3O6B A;  1HT9 A;  3OSQ A;  4YGD B;  3TMR A;  1FW4 A;  4W7R A;  2H6V A;  1YRU B;  1A75 B;  4AQJ A;  4W69 A;  4WQ3 A;  1UHH A;  5B8I B;  1XFY O;  1UIS A;  2OS8 B;  4R6B A;  3DPZ A;  3DVK A;  1SK6 D;  5I2O A;  1EMK A;  3A4U B;  5ER4 X;  1YJF A;  2WIQ A;  1TIZ A;  4N1G A;  1NCX A;  4JWQ A;  4LJC A;  2I18 A;  3BQ3 A;  2A4J A;  2AAO A;  3LVA A;  4EMQ A;  2B1U A;  3TDU A;  4OKH A;  3ST2 A;  4W6A A;  2LE9 B;  2KAV A;  1ALV A;  5DPI A;  1CDN A;  1NCY A;  4XYN A;  1KK7 Y;  5HLO A;  3LK1 A;  5AAN A;  1DJZ A;  2L4H A;  3SSY A;  2AWM A;  3LCP C;  4ZF4 A;  5DKR A;  2HQZ A;  1N2D A;  4GES B;  3M24 A;  4AOM A;  1ZGQ A;  1KFX L;  1N0Y A;  4HVF A;  1G7K A;  2GX2 A;  1XK4 A;  1IKU A;  4MLW A;  1EMG A;  1XQM A;  4MZL A;  3AKB A;  3NED A;  2EHB A;  4MVF A;  2F2O A;  1F8H A;  2BTJ A;  1WY9 A;  2HFC A;  2JT3 A;  4W6M A;  4U8D A;  1B9C A;  1YUR A;  1FBV A;  3DVM A;  2OTE A;  1NCZ A;  1PRW A;  4DCK A;  2E30 A;  4ORN A;  4I5J A;  2Z6X A;  2G6X A;  1AK8 A;  5HZO A;  4H47 A;  4AR7 A;  3O77 A;  3EKH A;  3SS0 A;  5HZS A;  4NDB A;  3I5F B;  4N3D A;  1B4C A;  2ISD A;  1E8A A;  2POX A;  1Y0V H;  1F4Q A;  1M46 A;  3BUO B;  5DRF A;  2QLI A;  2L50 A;  5T3I A;  2B3P A;  1CM1 A;  1PAL A;  3BXA A;  2KI6 D;  3CGL A;  1QIW A;  3SSH A;  3BUN B;  1BF5 A;  4N5X A;  2ZRS A;  2HQW A;  4NDD A;  2F33 A;  1QX2 A;  4XL5 A;  5LTR A;  2L4I A;  2O5G A;  4W6G A;  2M29 A;  1QX7 A;  3A8S A;  2GV5 A;  2IB5 A;  1H8B A;  4W6B A;  2GGZ A;  4W75 A;  2KHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...