3EVZA

Crystal structure of methyltransferase from pyrococcus furiosus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
197
Chain Sequence
FSNRQARILYNKAIAKALFGLDIEYHPKGLVTTPISRYIFLKTFLRGGEVALEIGTGHTAMMALMAEKFFNCKVTATEVDEEFFEYARRNIERNNSNVRLVKSNGGIIKGVVEGTFDVIFSAPPYYGGKYGEEFSVKLLEEAFDHLNPGGKVALYLPDKEKLLNVIKERGIKLGYSVKDIKFKVGTWRHSLIFFKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords methyltransferase
publication title Crystal structure of methyltransferase from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
total genus 65
structure length 197
sequence length 213
ec nomenclature
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3evzA01
2GPYA 2QY6A 4A6DA 3GRZA 3D2LA 3OCJA 3DH0A 5E1MA 1ZHFA 1SUSA 2AVDA 1INLA 4MWZA 5MHTA 5ICGA 5EOVA 2ONZA 4PCLA 5DWQA 3AY0A 5K0LA 3UBTA 1PRYA 2FCAA 1WY7A 2AOVA 3F4KA 3FUVA 2P3OA 3KPWA 5HILA 1RI1A 1QZZA 4C03A 5F2OA 1XVAA 3FTEA 4DZRA 2IDJA 1ZQ9A 4R8SA 2YXEA 3P9CA 5D1NA 3DOUA 5E1DA 4DF3A 5F2NA 1YZ3A 4HG2A 2IPXA 3P71T 4CTJA 1AV6A 1M0EA 5EGSA 4C08A 1FJXA 1VIDA 3A4TA 3FPJA 1UFKA 3QOWA 3LCVB 4QVGA 1KXZA 1XDSA 3A27A 4NECA 4P7KA 4EKIA 1JSZA 4YV1A 1JQEA 2B25A 7MHTA 4E2WA 3CC8A 3EVBA 2FHPA 3G88A 2ZIFA 2AOXA 3HCAA 4EMSA 1B42A 1X1AA 5HZMA 3EVEA 2I6GA 1JG2A 5GP1A 5DM1A 3FYDA 3Q87B 4GBED 4GC9A 3PX2A 5CCBA 5LQUA 1RI4A 3JWHA 4QPNA 1D2GA 3SXJA 3BGDA 1M6YA 5DRYA 5GM2A 4E2XA 1ZG3A 4QQNA 3FPGA 1YFLA 3IYLW 2OB2A 1OR8A 3T7SA 4PYLA 1V39A 3B3GA 2NP7A 2IH5A 5E1OA 1FPQA 5FTWA 2AN5A 1AQJA 3BZBA 3GJYA 2Q41A 3GWZA 3GRRA 3LDUA 4RTJA 1RJFA 2BH2A 2FYTA 1L3CA 2PJDA 3CJRA 5DSXA 4RTOA 1VL5A 4RVFA 3VYWA 3KQWA 2YR0A 3NW9A 1FP1D 3PX3A 1L3IA 4V0RA 3GRVA 4RWZA 3C6MA 2EFJA 3LL7A 2GLUA 2ZTHA 3MB5A 4E30A 3HTXA 5GM1A 2C7QA 2Y1WA 3T7TA 3MTIA 2NXCA 4M38A 1N7JA 3DXYA 3FPFA 4M37A 5BP7A 1BOOA 2VDWA 4RSRA 5CD1A 1RI5A 2PWPA 2ZVJA 3HP7A 2N47A 1G8AA 5JR3A 3G8AA 3NDIA 2QYOA 4RTMA 3I5UA 1P39A 5EG5A 2BM9A 3SGLA 2VS1A 2FK8A 3DR5A 1SG9A 3OE5A 4AZSA 4PWYA 1SUIA 3WSTA 4KRGA 2FPOA 4R6WA 1N7IA 1R74A 3UJCA 4BP3A 2KW5A 3GXOA 2YXLA 3R6TA 3K6RA 3EGEA 5FWAA 2PX4A 5EEGA 3O4FA 3UJAA 4ER7A 4PYKA 1KIAA 5EMMA 4YMHA 3T0IA 4GF5A 1NW8A 3UJ7A 3FRIA 4YUXA 5K0EA 3BWMA 1F3LA 2AN4A 1WXWA 3HVIA 4PYMA 5K0NA 4V0QA 1XCLA 2YXDA 3LSTA 4EK9A 4B17A 3QOXA 3I64A 4WVLA 3HCDA 3PB3A 5LQAA 4E31A 4RVGA 4JXJA 2GB4A 5M5BA 3KR2A 4E70A 3EGIA 1VBFA 1YF3A 3CKKA 1G38A 3EVAA 1L1EA 4RX1A 4PINA 1P1CA 4XUDA 1NE2A 2OZVA 1BHJA 5LSAA 1UIRA 3A25A 1NT2A 1VP9A 1JR4A 4PONA 2CMHA 3DTNA 1R8YA 4GOND 4HC4A 4K6MA 4FR0A 4ER0A 2H11A 3GRUA 5K0BA 5GIOE 3IV6A 3BWBA 2B78A 1P1BA 2O07A 4RTRA 1JTEA 3P8ZA 5BXYA 3ERCA 4DMGA 5K03A 4EKGA 2C7OA 1WXXA 4KVZA 2ZFUA 4P7JA 4C05A 2ZZNA 2QM3A 3LECA 1KYWA 2B3TA 2EJTA 5KYGA 2P41A 3G8BA 3HA5A 3PVCA 4E2YA 2OB1A 2WA1A 3G2OA 3CJQA 3G7UA 4QDJA 5E2AA 3UJBA 3IHTA 3FUWA 2JH8A 1P91A 3EPPA 1T43A 1YUBA 2ZIEA 3OU2A 1HMYA 4GUAA 3UWPA 3AXTA 3QV2A 3PLAE 4DM3A 3ANXA 1RI3A 1VQ1A 3VSEA 3C0KA 4OA5A 1AQIA 2AOUB 4CWAA 5GOZA 5T67A 1Q0SA 2O05A 3LGAA 4F85A 5C9ZA 4BLWA 5EZSA 2IBTA 5DSTA 2JHAA 1G60A 3DXZA 3OFJA 4IV0A 3TM5A 3TM4A 3KPJA 1DCTA 1M6EX 5FULA 3UJ6A 1NW6A 3M6XA 1G55A 2I62A 3I58A 5B1SA 3OFKA 4LWPA 3C3PA 3THRA 2HWKA 3HA3A 3O7WA 4AX8A 2V7EA 2YX1A 5K0CA 1EQAA 2ZLBA 5P8WA 3OE4A 5E9WA 5GIPE 1G6Q1 2ZZKA 3G2MA 3MCTA 4YV2A 5E8RA 5DM0A 3FUXA 3GU3A 2HR1A 2PBFA 1XTPA 4RYLA 2PVCA 5DPMA 4GC5A 5FA8A 2UYOA 3SR4A 1IM8A 4QDKA 1JQ3A 3S68A 4FSDA 4HGYA 2JJQA 1Z3CA 1MHTA 3EVGA 1Q0TA 3ORHA 5EHIA 4RTQA 5DLYA 2O57A 3HM2A 1BC5A 3B89A 3KPYA 2PWYA 5T6BA 4YUWA 2PGXA 3H2BA 4CKBA 5EQJB 2OXTA 4FSXA 1O9HA 3M33A 3PFGA 2K4MA 4GOOD 4KDCA 2NXJA 2ZBPA 1NV8A 3LDGA 3MGGA 4MQ4A 4PYIA 3SX0A 3HCCA 1DL5A 3I9FA 3K0BA 2XYQA 3UA4A 2OY0A 1KR5A 1X1DA 3Q7EA 5K8VA 2P8JA 5BW4A 3KKZA 2O06A 3CCFA 4LG1A 5CVJA 3SMQA 5HFJA 3KQYA 3NWEA 3THSA 3MCZA 1BKYA 4PIPA 4YV0A 3BKWA 3U81A 4A6EA 3KR0A 4DCMA 5CIYA 4P58A 1VP3A 3BWYA 2ORED 4OA8A 3I53A 3PS9A 1EJ0A 2OYRA 4E33A 2GS9A 2PKWA 1X1CA 3CVOA 1R6AA 2AN3A 3EVFA 2VDVE 3UZUA 3NVMB 2V74B 2IGTA 1JG1A 2HMYB 3A7DA 4IWNA 5ICCA 1NW5A 9MHTA 4FP9A 3SVZA 3ELWA 1XJ5A 2JH9A 5KQRA 3HCFA 5K0GA 2OKCA 4ER5A 2DULA 1VPTA 1HNNA 5DX0A 3JWGA 2OO3A 4X61A 5HOQA 5EVJA 3EVCA 5EMJA 1TPYA 4PGGA 4ER3A 1WG8A 1AF7A 3JWIA 4BLVA 2NYUA 4QQKA 5EIWA 2HV9A 4WXHA 4FT4A 4BLUA 5IKMA 2IBSA 3DMFA 4QVKA 5U4XA 1VLMA 4HSGA 1I4WA 3NWBA 4ZTBA 1FP2A 4AZVA 4X63A 3HVHA 5CM2Z 3EEOA 3EGVA 3LBFA 1X1BA 5EMKA 3P97A 3NDJA 3P2KA 4BP1A 5LQRA 5FQOA 2ADMA 2QRVB 3DP7A 2EX4A 4M7RA 3SSMA 5LQNA 3KQTA 1YZHA 3E8SA 3A26A 3LCUA 4LWOA 4M36A 1EIZA 4KWCA 3KPUA 4C04A 1Y8CA 3GDHA 3PT9A 1SKMA 4EQZA 5E1BA 2YUIA 5HEKA 1EJ6A 1NW7A 1NW3A 4KDRA 1XXLA 3UFBA 5KVAA 1ORHA 2OPBA 3E23A 4P7GA 2VP3A 3NMUF 2ZBQA 4AUKA 3ELDA 5EPEA 5DTMA 1JG4A 1KPHA 4OX9Y 5KQSA 4PCAA 3TMAA 2PX5A 3AXSA 8MHTA 3FYCA 1NKVA 2F8LA 4R8RA 2IP2A 3T7RA 2G70A 1R8XA 2IDKA 1RJGA 3LKDA 4Y2HA 5FHRA 3VC2A 1KYZA 1IXKA 1XCJA 3EVDA 5BW5A 1KHHA 3DLCA 2ZWVA 1TW2A 5EHGA 3DXXA 5K01A 4R6XA 2Z6AA 5DXAA 2AOTB 4C07A 5CUQA 5LQCA 5HIKA 3EMDA 1ZGAA 2ONYA 3AWIA 3LHDA 3NTVA 5DXJA 3UA3A 2ZCJA 2AOWA 2GA9A 3TOSA 2EJUA 4BY9E 3HCBA 3X0DA 3RODA 4X1OA 5FWDA 4Y30A 1TW3A 3GCZA 5DTRA 1KPIA 1KPGA 1N2XA 2JHCA 2WK1A 1IY9A 3KQMA 4FT2A 2BZGA 1ORIA 1NV9A 2CWWA 3B3FA 2ZBRA 5EIFA 5K09A 2NP6A 1WZNA 1SQGA 1ZKDA 3IEIA 4ATNA 5JUWA 3RW9A 2PT9A 3LDFA 5HIMA 4HH4A 2PY6A 1X19A 4KW7A 5E8JA 2AVNA 3BWCA 2AOUA 2IFTA 3G5TA 2AR0A 3KQQA 2JHPA 3B7PA 4U7PB 3MHTA 2ZULA 4DA4A 5FA5A 3E05A 5CVDA 2DPMA 3OPNA 3ELUA 1JG3A 3P9IA 5CVVA 5LR6A 3FTFA 2PLWA 2G72A 1QAMA 1SQFA 3FUTA 2Z6QA 4OBXA 2E5WA 2P40A 2IH4A 3G2PA 2IH2A 4HRAA 3KR1A 1EG2A 3TFWA 5FHQA 3BT7A 5EC8A 2UYQA 3JWJA 2IIPA 3P2EA 1D2HA 3BGVA 2CMGA 3KR9A 4PNEA 1DUSA 3V97A 1YB2A 3HNRA 3BKXA 3LCCA 4CXMA 3ER9A 5LQJA 3EMBA 3G2QA 2YVLA 5K0JA 3DUWA 3OU7A 2B9EA 5FADA 3DLIA 3O31A 4RTSA 1FBNA 3CBGA 4DCGA 1QAQA 2Y1XA 2JG3A 2UYHA 2BR5A 3MTEA 5EZQA 2G1PA 4R05A 3TKYA 3FTDA 1RJEA 4QPPA 2CL5A 4FS8A 2ZZMA 4RV9A 2XBMA 4ER6A 3GNLA 2C7PA 3AJDA 4RVHA 1RJDA 1R18A 3SSNA 3MQ2A 1ZGJA 5E9JA 4YUZA 5CCXA 2FK7A 2ZWAA 5H02A 2P3QA 3DMHA 5FCDA 3P9NA 4E32A 1F38A 3L8DA 3TPZA 4EVIA 2R3SA 3HCEA 4X41A 3LBYA 3TKAA 1U2ZA 4MHTA 5CVEA 4CKEA 2H1RA 2ZSUA 3KQPA 3LKZA 2G71A 5D1HA 4PYQA 5DX1A 5T64A 3KPVA 3FPEA 1I1NA 1WS6A 2PT6A 4MTLA 2HTEA 5E2BA 2P1DA 3HVJA 4RTKA 4GOLD 2XYRA 2ZW9A 3OZSA 3KHKA 3R24A 3SM3A 3V8VA 5ICEA 2XVMA 4YUVA 1JTFA 1R00A 2PX2A 2I7CA 4E2ZA 4DKJA 2PXAA 3HVKA 2Z6UA 4RTNA 2G8NA 1XDZA 1O9GA 2P7HA 5DM2A 4F84A 2NXNA 3C6KA 1QANA 2NXEA 1D2CA 4ISCA 3FPHA 3M6VA 2QE6A 4PYJA 3R9XB 1L9KA 1VE3A 2AS0A 2WA2A 3TLJA 2XYVA 3DMGA 4Z2YA 2GH1A 4CTKA 2C7RA 2P7IA 4CKCA 2YQZA 4RVDA 2PSSA 3NVKI 1NBIA 2PV0A 4GQBA 5F2KA 5CVUA 5GINE 2HNKA 1H1DA 3KQOA 2CKDA 3FRHA 3CJTA 3LPMA 4L7VA 4XUEA 5DT2A 3MAGA 5DRTA 2ESRA 2ZIGA 3TR6A 4YMGA 2QRVA 2YTZA 2ERCA 5DTQA 3C3YA 5EKUA 4PGHA 4AZWA 5DM4A 2XVAA 3M6WA 3FUUA 3LX6A 5HIJA 3UJ9A 3B5IA 3TQSA 4PIMA 2BR4A 4U7TB 3HA7A 2VZ9A 4LECA 3BGIA 3ELYA 3R0QA 3GO4A 3RIEA 2PXXA 1YFJA 3ID6C 3BUSA 2A14A 3UJ8A 3KQVA 1JSXA 4PYOA 2FRXA 2GAFA 2VDUE 4KIGA 1L3BA 5EKXA 4XCXA 4UOEA 4C4AA 3OU6A 4XUCA 3E7PA 5K0FA 4P7FA 4YUYA 2LD4A 3OZRA 1I9GA 1QAOA 4PYNA 1XDUA 1EAMA 2P3LA 5E9QA 3REOA 1KP9A 4FGZA 4RTLA 3GGDA 4POOA 4IKPA 4IV8A 5ERGB 2PX8A 3FZGA 5FQNA 3M4XA 3PTAA 4H0NA 2R6ZA 3MERA 4DQ0A 1RI2A 3G89A 2AOTA 3EEYA 4G56A 5FUBA 2BM8A 3KU1A 2UZ4A 5DX8A 5ICFA 1MJFA 3GRYA 1O54A 3SSOA 4GEKA 5LQKA 4RTPA 4OQDA 3OZTA 4MIKA 10MHA 3G5LA 3B3JA 1SVUA 2OBFA 3VC1A 4F86A 2PXCA 2AZTA 5G02A 3M6UA 2BR3A 3EVZA 3A7EA 2B2CA 3CGGA 4FZVA 3R3HA 1UWVA 3KQSA 4GOMD 3TRKA 4OBWA 4QTUB 3HEMA 3M70A 3GIWA 1JQDA 3PFHA 1QYRA 3FTCA 3UJDA 1G8SA 4QTTB 5C1IA 4HGZA 2I9KA 5HIIA 4HTFB 1NBHA 3ER8A 3DULA 4O29A 3ME5A 4HTFA 1PJZA 3BXOA 3P2IA 4OQEA 4AZTA 5KS2A 4C06A 5K05A 4X60A 5EEHA 3P9KA 4KIFA 2H00A 5EMLA 2EG5A 2UYCA 5GWXA 2P35A 3NJRA 5C0OE 2NNWB 5IH3A 2O0LA
chains in the Genus database with same CATH superfamily
4A2PA 4OU4A 3NCTA 3M83A 4ND8A 4S12A 4HH0A 4CMEC 1S4MA 2CE2X 2ZGVA 3NIGB 1F8UA 3H0EA 2PLRA 4MAAA 5DMXA 4MWZA 1QBKC 5HE9A 2W42A 4NENA 3AHEA 4Z9FA 5H9VA 4D45A 3KNZA 5HILA 1U3UA 2QQ5A 1U0JA 3BH6A 4M0EA 4TWIA 1Q5PA 1VBNA 4R9SA 3MSXA 5BQ5A 1J9EA 1XVAA 5KNDD 5BQOA 1LLDA 1YUNA 4KMOA 4HRXA 4OH7A 1S0UA 1SKUA 2XIQA 4JODA 4P8RA 5F2NA 1KKLA 4X45A 1N4DA 3ZV5A 4C08A 1FUYB 1OYWA 2TS1A 3MBOA 5KU7A 4FJ2A 1GGFA 1FYWA 4YV1A 1FTWA 4LIPD 4MDEA 5LB2A 2QVCA 3P0FA 3EVBA 2OK8A 4KXVA 4X3CA 2FN4A 1B42A 1FRNA 4OI1A 1SOUA 2F6RA 4FDAA 2DFTA 4OP3A 1LTKA 1K3TA 4QUJA 4GC9A 5IAJA 3NEYA 3KJGA 3GFFA 1PQWA 1JRLA 2D2XA 2GJKA 5DCYA 3SJ7A 5JI2E 3KSBC 6YASA 1HQKA 5BSWA 2XNHA 4X1YB 3WADA 3EQ7A 4KLAA 1R10A 2O8VA 2CNDA 4BNZA 2RK3A 2H16A 4A73A 1YFLA 4L8VA 4FGSA 2C5LA 4KQ6A 2FW7A 3SJUA 3TX6A 1SELA 3NBMA 3FF4A 4GYYA 4OJTA 5LUBA 4G97A 4WUVA 2I2XB 4OJNA 4PO9A 1RTKA 2O5VA 3GLQA 3L8YA 4NZZA 4YRKA 2NP7A 4U7DA 1UOQA 2JAPA 2CJPA 2GZ2A 3L7JA 5JE8A 1KOJA 2Z8ZA 4IW3B 4MJXA 3O93A 1CFZA 2JJ2A 1JKFA 5IJWA 2F90A 5DEIA 4RA6B 4E5KA 1Z5NA 2FPMA 4DLWA 3GLRA 7ABPA 1QGED 4HQLA 4O4LB 4BQFA 1L5GB 3EIHA 5MN6A 3TTXA 3VYWA 1E79A 1T9AA 4WNCA 1G18A 1L3IA 1OTYA 4KDFA 3RVPA 4WKOA 1A97A 1DCFA 4H35A 5BYJA 5ICCA 2HWUA 3HJHA 4I5GA 5EL0A 1K92A 5GM1A 2O2JA 5AYVA 1CUJA 1IEQA 4BQPA 4BNDA 1Z0SA 3HH8A 2ZJ1A 3W5JA 3U48A 4ARZB 4AMUA 1L7NA 3QRWA 5JW6A 5AT1A 2WKSA 3JYNA 3RU9A 1RI5A 2YHIB 3HWRA 3U3JA 1P5JA 3OZAA 3USES 3IP1A 4K1XA 2NU8A 2DTEA 4OK5A 1UMDA 2H0AA 3SIRA 2O5CA 3IJRA 1TMKA 1P4AA 3TNJA 2YWDA 3WRWA 3TIXB 3ZH9B 4AL4A 5GADl 1EP3B 3O7MA 2ZBVA 3ASUA 1X1SA 5DHTA 1UK8A 5ER9A 2HYDA 1CQIB 4YDSA 4ZYZA 2GYVA 1Z5PA 2W5UA 3LD9A 4N49A 1JPNA 3WIOA 3CTPA 4AXXA 4TRMA 1G5QA 2H7CA 1R74A 2PMWB 2PSEA 2PUTA 2WG2A 3AUXA 3FYTA 4GPTA 4S2EA 1U81A 4LZLA 4WCFB 4UTNA 5EEGA 1LDNA 2I7XA 4NBVA 4Y2SA 3NBXX 2XUZA 4GE0A 1MJ5A 1UWKA 4Z4GA 4WSOA 3QGMA 4DQDA 2V6GA 3FFBA 3LDAA 3FGPA 3AOGA 3NASA 4GSYA 1WEHA 4GPZA 3LH5A 5EE5B 3ZU4A 2WWRA 5M2QA 2CKMA 2ZRDA 1WZIA 4PZZA 4Q9KA 1KAMA 3EOBI 3U49A 4ZK2A 1DLIA 3RS5A 3HRHA 3P20A 1Z8DA 4E31A 1SHTX 2XY4A 4RVGA 3JALB 3IALA 1VBFA 1JFRA 4GIBA 3AL0C 3D02A 3U3XA 1G38A 4M99A 5AH0A 2O7SA 3VO9A 5BMOA 2X8JB 2XT0A 1O57A 3KKKA 1LF5A 2PH1A 3GBSA 3S2FA 4KZKA 3V4LA 3MIZA 1P31A 3C4VA 4YAWA 1XKXA 1ZITA 4EY8A 5GIOE 2G67A 3E5NA 3KZ1E 2MSNA 4KSCA 3H1GA 3QBDA 4A92A 3FY4A 5CLHA 4WOPA 1J07A 3U4QB 3IDAA 3A2LA 4NHOA 1WXEA 4Y2PA 5TQVA 3FOBA 3OKFA 5B30A 2Z6VA 1G20A 3I5YA 3VR1A 1MHTA 3PVCA 4EJSA 5K4HA 2WU0A 3KC2A 4CMGA 2FW6A 4P3PA 4ZFNA 2LCFA 4PFSA 1ZD5A 3U4IA 1M2HA 2OHJA 2PGNA 1PR3A 1NQTA 1VRWA 2ZIEA 2I2WA 3UGTA 3UWPA 3TTYA 3LI2A 2PCLA 5HS4A 5KOHA 2GD1O 5IM4F 2Q9AA 4RCZA 1CJVC 3F49S 4FX2A 1YI1A 3EFEA 2EBFX 1RI3A 2C2XA 1YS9A 3ANXA 4L76A 5CXSA 4TM8A 5EIBD 3JSAA 1ZBDA 2DEUA 4FZJA 5C9ZA 1IHOA 4TMXA 3VZQA 3O8DA 3OFVA 4MWBA 1MH1A 1KK2A 2F9LA 3ABQB 3OFJA 4KOAA 5HGJA 4KBFA 2BDTA 3AY6A 3RYHB 4A0RA 3C6BA 2ZBGA 4RVOA 4K8RB 1K5HA 3M6XA 5B1SA 1DO0A 4PLHA 1WDLA 1XU9A 2WIJA 3LO5A 2W9XA 3M4YA 4K0KB 3A0RB 1CNMA 5C7LO 2H52A 4LFAB 5IP5A 1DRKA 5FBWB 4L0DA 4NYIR 5FFNA 4A8TA 1QZXA 2OSBA 1KH2A 3ISVA 1R0LA 4KRYA 3V1MA 3IEKA 4HAXA 1TVKA 2BFDB 3AOEC 4LZJA 5F52A 3U7RA 4HN9A 1U9ZA 2LPMA 4HWGA 1NBOA 3NFRA 1UEXC 4L5YA 5HBRA 4DQVA 4HGYA 3W9SA 3PGMA 1Z3CA 2C0CA 4AC9A 5AJUA 4Q3EA 5A06A 4IKEA 3N8HA 4U63A 3JAWB 1YZUA 3EASA 2AB0A 1ZUNB 3OWXA 1IUPA 4F93B 1EHIA 2P67A 3E9MA 4KGDA 2FEOA 1Q84A 2IHUA 2NXJA 4BQQA 4D9GA 1QZTA 2GEFA 4PYIA 3GZTB 4RO0A 3L1UA 4YAUA 3TGLA 4U1RA 4JI8B 4GL2A 3KKZA 5AVXA 1V35A 3F71A 4FU0A 5KWVA 4YALA 1S8NA 1ZY2A 1J8VA 4DCCA 3IBFA 1Q12A 1TZBA 4J6FA 3S1AA 5C5DA 4CG2A 1WUHS 3BIJA 3BKWA 2FPPB 3GBVA 3KZMA 4OLFA 3SR0A 4JMLA 4PO3X 4S05A 3VZCA 1NVFA 3KLPX 3I53A 1RXIA 4KPGA 3KYBA 3B6IA 4E33A 2V3CC 8OHMA 1HSOA 2J4DA 4G65A 4XDZA 2VQDA 2YJ3A 4JIMA 1WCWA 4QXRA 5DHUA 4ENVA 5DN9A 3QLUC 1IL0A 1PR0A 9MHTA 3ELWA 4EB3A 1NVWQ 1WUJS 1C1DB 1J20A 2JVJA 4NCJA 5A5VA 2AFHB 2IXBA 3GCXA 1Q0UA 5AXBA 4KZPA 4RPKA 1W35A 3A2NA 4R2JA 3IHWA 5FUYA 2IH5A 2OLKA 3BSYA 3IAUA 3IP7A 1TB4A 5LYYA 1WV0A 3JYLA 3OZWA 2PBRA 2JIZA 3M6LA 2DHDA 5LMNB 3RBXA 1SXPA 3LUPA 2W6MA 2F9FA 3H9EO 4F3RA 3R5JA 1XK6A 1QIKA 4QQKA 4KQCA 1MJHA 3OA2A 3PKIA 4R9RA 3N74A 2FZEA 5EPUA 3O3MB 4HSGA 5U4XA 3W90A 1C4KA 4ZTBA 1XJ0A 2FQYA 4EVQA 4KE7A 2OWEA 4X1KA 5EMKA 3HPRA 1BDMA 2ADMA 3K5IA 4TROA 4RDIA 4QBGB 5IRCD 3KB8A 2GCNA 3Q15C 2B34A 2C00A 3T7DA 1KRHA 4ENPA 4MVCA 4X7PA 1SUPA 2JLCA 3IB6A 3KPUA 1Y8CA 5IKEA 1R4MA 3CLTC 4BC0A 5I6DA 1J6UA 1LQTA 1GUZA 1NW7A 3IUJA 5AW5A 5JJIA 2P0YA 4HDMA 3UFBA 4A0FA 5AUPB 1R0KA 2G0TA 4FKMA 4RVNA 4YK7A 2WAMA 5F5LA 2A0XA 1L8OA 1KMNA 3RUHA 1SR8A 4W5WA 1BXGA 3X1KA 1SXJA 3F8TA 3Q7PA 3VU9A 5KVCA 3GI1A 2HLDA 3GPCA 2W83A 1O6CA 2VUTA 4JR1A 2FEXA 4RZSA 5AUQA 4EECA 4IWYA 4F7WA 4JYAB 1UZNA 2IP2A 2DLCX 2G70A 1TCCA 2GBIA 2IHBA 4PW0A 5JWHA 4EKNB 1IMJA 1NP7A 5EWLA 2YWEA 1WP4A 4B0OA 1V16A 3IPLA 4B45A 4ZMSA 1IXSB 2C84A 1PK7A 4Q12A 1FPMA 4C07A 1BYIA 2FF5A 2PUHA 4WADA 2WUFA 1SA0B 5BYKA 2R47A 1V95A 3R6GA 3WIEA 2ZCJA 4AXBA 2JBAB 4YCCA 1RT9A 4W63A 3IO3A 3HCBA 2WLTA 4QDUA 1KMIY 3UT5A 4ITRC 4ZU6X 3DBHB 3CX6A 1WVGA 2XXAA 5ITZB 1DAKA 2XCSB 2VBFA 1Q7CA 1Z0ZA 1OLUB 1P77A 4YO7A 2BYTA 3CQ9A 3P1JA 4FFWA 2PT9A 1A5TA 4UEJA 5HW0A 5TB5A 3R7DA 2QRLA 4KAJA 5KTRA 5K8LA 4NFYA 1DBIA 2RHHA 1OYOA 3BWCA 4Y7DA 1S2IA 2FW9A 3V8EA 3WYNA 3UW1A 4U2EA 4DDKA 3WGJA 3N75A 3GGJA 4ZAWA 2AHRA 5DDIP 2EZ9A 4IUBS 5FA5A 3WNCA 4YQEA 2VSOA 3VNUA 1KZGB 2QL7A 2RBGA 3IQDB 2IY9A 2DBQA 1O94D 3SCZA 2JJ1D 4CF7A 1I7PA 2E5WA 3OJ0A 3DZKA 3D6HA 1EJ2A 4QUDA 4ND8B 2BHSA 3I0MA 1GAJA 3LX5A 4JOSA 5ILGA 1EGMB 2VCYA 2GWHA 4I4TF 1L8XA 1Q1AA 4XWKA 1YJ8A 4BLSA 3WGVA 2PEZA 3PUWA 2GBGA 4BMVA 4GX1A 1MW8X 4NENB 3BKXA 1N5IA 3LCCA 5ECYA 5LQJA 1ZRHA 1Z12A 1YBFA 4MUKA 3FHCB 1G42A 4NU8X 3D0RA 2Y6VA 2XJ4A 2G4LA 5C37A 4UAJA 5IHPA 1W1UA 2GEUA 2J09A 5E4YA 3HN2A 3BZWA 3HP1A 4CCWA 4WERA 5J43A 3U39A 4MIEA 1THGA 1P7ZA 1YCFA 2QOEA 1F6DA 3KT6A 4JAVC 4NOMA 4B4KA 1DI0A 4D3SA 5BURA 2VUIB 3D8TA 1V7CA 1UJ5A 1A96A 5B36A 2V9PA 3SC3A 3J81k 2XMRA 4DA0A 1X8JA 4KG7A 1QF7A 4EELA 4G67A 1ZGJA 1H4SA 3TE7A 2IZZA 1NLFA 2A3NA 4N8SA 5A03A 2W6ZA 4G8JA 4X85A 3GDFA 3E2MA 3TIGA 4JX8A 2IXTA 5D51S 3TOCA 3OPVA 4KVFA 3VUFA 3INRA 2NWQA 1I3OA 2O7QA 4LCJA 2OGSA 3G13A 1WS6A 1A8PA 3DE1X 2OKGA 4OP1A 4RTKA 2D8MA 2FG6C 1OXXK 1Q83A 4G2TA 1GPLA 2XYRA 4HYEA 3ZBQA 2Q8PA 3B1XA 3DAHA 2J3EA 3I52A 4B80A 2G8NA 1GCUA 1GL7A 1RIFA 3MWDA 4RTNA 1UK6A 5DM2A 1TO1E 4MGIR 4MYSA 4Q4AA 3WWYA 4IF4A 2P6OA 4E7OA 4GVXA 4WY5A 3DVSX 1KSHA 2C9DA 2GBPA 5LXTF 3TBKA 2V7BA 4CT4B 4MYRA 4B3CA 4AD8A 2V55B 1NYQA 2IYWA 4NZPA 2EOAA 3S81A 1AKMA 1ZMTA 2VYVA 4D98A 3C3KA 3MWLA 4N5IX 4FHCA 1R64A 3OY7A 4ZT7A 4AJHA 4EB8A 1HYEA 4BEJA 2W2VA 4BNDB 2CNLA 4C21A 4HDRB 5H16A 4YMGA 1Z6PA 5JS2A 1NLZA 2PRZA 1QX3A 1KGDA 1UMDB 2R5FA 1ECLA 3O8QB 1ZVKA 3UJ9A 1SHZA 4Y0AA 4YAFA 2BUCA 3HI6A 3EPJA 1Z4MA 3KDSE 4KLRA 3ID6C 4BNHA 2R1VB 3U7QB 3PIIA 1IZ9A 1Q1BA 1LJ8A 3OAAD 2OZKA 2QRZA 4HGOA 5EKXA 1U7TA 3R3XA 5KPJA 3NCHA 3OJWA 4F1WA 1Y81A 1KGSA 2QLLA 4OHBA 2OHFA 3D4NA 5KNDH 4E1AA 2O59A 1B1CA 2AZ4A 4EG6A 2P3LA 1PBNA 4V2IA 3REOA 4NAUA 5FOXA 3DHYA 3DFZA 2XCRB 1UBJS 1G7RA 1JJBA 2PX8A 2CHGA 2IYFA 3FZGA 3M4XA 4FMCF 4L1KA 4M83A 4H0NA 4PHFA 4DPKA 3PUVA 3T6KA 2BM8A 2R6CA 3UT0A 3C1UA 2AG1A 4YBRA 4C89A 3AFNA 5JCZA 4EY4A 1XQ1A 2Q4TA 3DZFA 2ACWA 2C82A 3M1YA 5DNDA 1C7JA 1VGRA 3L5OA 3E0QA 5A9SA 3R74A 3HABA 3CFYA 4TYMA 1C3LA 1GZ7A 3GCDA 5AK3A 1HE1C 3LQFA 4GQIA 4RMGA 4RJKA 4TV8F 5KSZA 2WJJA 4B6GA 4C0JA 1MX9A 1QVAA 3C97A 4OBWA 3RJMA 3UHAA 3M70A 2C58A 2F4VB 1QDEA 1SXHA 2CE7A 1ZNYA 1RSZA 1K0FA 1U2GC 2XGOA 2I8CA 3K94A 1WZEA 4QTTB 5JAZA 2FEMA 2I9KA 3MWEB 3NETA 5L7YA 3EGCA 3X1MA 1B0ZA 1BTOA 1XO1A 4NYJR 4EJSB 4FOSA 2CXQA 3F1LA 2VT2A 4C06A 5K05A 3A6PC 1BS9A 5F4BA 5EMLA 1W7AA 4ENUA 2Q46A 1NRWA 2D2EA 5KOHB 2OFXA 2YYZA 3NT2A 3T3HA 3MXTA 1U8ZA 3O8OA 4BFTA 3NJRA 1N2CA 5F7OA 3T7KA 3RYIB 3LQYA 4D96A 4FQ5A 4W7SA 1UDXA 1E9AA 4TZ6A 2CHQA 1P1FA 2XNJA 3AIKA 3HWWA 4XIJA 4Z7OB 4YCMA 4S1OA 3QKUA 1ISJA 3NWOA 3RTCA 5HUQA 4D6PA 2CY0A 2Y1CA 3A3YA 1CDZA 4XOUA 4Y6RA 2JLWA 2JFHA 1DDOA 3IQZA 3I6ZA 2SCUA 2XXBA 3P0JA 2NQ2C 1SM4A 2ID7A 5G3ZA 4UHDA 4TN1A 1RM0A 2IYUA 4BBAA 2C98A 2XCQA 2C2KA 2VSYA 1TVKB 4ILKA 4RD4A 5FP0A 3ZHUA 5D3MA 2R2AA 4A0GA 4DUGD 2B1RA 2FRVA 5LLSA 3ZHZA 1JQEA 1R7RA 4PNPA 4EMBA 4LFCB 2FHPA 3EDQA 2ZR0A 2WFZA 1G64A 1X1AA 3N2GB 4Q9LA 1UZAA 4J0HA 4UDOA 4NNPA 4AMGA 8ABPA 2N46A 2WABA 4FFLA 2WMYA 1IHYA 1IHUA 1TC2A 3L6BA 3NBFA 4KV9A 3LLSA 4QG7A 5IH7A 1ISMA 4XVUA 4HLUC 2FETA 4EABA 5F3WB 1KJ9A 1RYNA 2JI6A 3GF4A 4FFOA 2J3IA 2OL4A 1EB9A 3CKYA 1OR8A 2O8BA 4GP6A 4RSHA 3NTRA 4OAPA 5TGZA 1BA2A 1C30A 2WICA 5AICA 3GQBB 4EDHA 2GKOA 1IPFA 1PS0A 3OKAA 1CEYA 4NRDA 2FN3A 3BGWA 4X8HA 3ZXSA 2X86A 3EB9A 4IEEA 4CG3A 4CKXA 3GRRA 4MR9A 2E18A 3OECA 3O4RA 4FYHA 3SFVA 4B2IA 5A2QA 5LNK1 3LVQE 2JGEA 4ZVNA 2G25A 4NABA 4RSGA 5EYPA 3U6BA 4RVFA 4CZ2A 2YRXA 4EO9A 2W2NA 4PM4A 2WWYA 1JIUA 2PUWA 1PNTA 2QTTA 2WM3A 1EFKA 3R7WA 3ST7A 2P69A 1H9CA 1W5BA 2GFHA 1OAOC 2R1UA 2WMNB 2Z2ZA 3A1EA 3KZCA 4ZEWA 1M67A 2C7QA 3X2EA 1OXTA 5IUJC 2GVZC 1DCKA 2PMKA 3RB8A 4LY9A 1BOOA 2VDWA 2D1YA 3AL3A 1FLNA 3FSGA 1G8HA 3A05A 4H3HB 4KO8A 3T5MA 4YQYA 4D57A 1W73A 2N47A 4WT7A 5F9HA 3KJEA 3B3QA 1FCJA 1U6JA 1O2DA 5SYMA 2R1ZA 2OXRA 2AZXA 4H3VA 1P39A 4EG1A 1A2QA 1BZYA 1XA3A 2A33A 5KWIA 2FRDA 3P9ZA 4LOLA 2QJRA 1XTJA 1Y1QA 4Q03A 1SQ0A 1ZOSA 3HY6A 3TSZA 3QKSA 3WA6A 1O7JA 1DSSG 2J07A 4R6WA 3VZDA 3CHYA 4BP3A 1KC3A 5FWAA 3GXOA 3GJ8A 5G2OA 1CXZA 1XQ9A 4ZI7F 3QELA 4DJEC 1QX4A 2F3UA 1NJFA 2XODA 2K5UA 1S2OA 1G21E 2F3PA 4RZHA 5BSUA 2UKDA 3BXHA 4J0JA 1SH7A 3ZU2A 1HUQA 3RVMA 5FBKA 3AVYA 1LQUA 2FWRA 5AW0A 2LIVA 5CNMA 4BFCA 5KC9A 3RAPR 1IG0A 2L42A 2NLOA 3OM1A 4E08A 3ZI7A 4RVSA 1UFVA 1SXJB 2XTZA 3I64A 3HU1A 3VU9B 2F55A 1ZM9A 4N9QA 4PGMA 3M1LA 3QPVA 2XGSA 5EWMB 1U7UA 3OMXA 1X1QA 4GL4A 2XMGA 2BI7A 5DGDA 3AR6A 4EQ6B 4KXLA 3U31A 1NDUA 1RZ3A 4RX1A 4PINA 4MQUA 1V16B 3SLGA 4CM7A 5EESA 2ZCUA 4URVR 5B6JA 1ZCJA 4BUCA 1ND5A 5J63A 4A03A 4M0FA 4Z4FA 1B3RA 4DNFA 1MX5A 1O96A 1JIXA 4R8VA 3VBEA 5AVRA 2VVTA 1KI7A 5IJAA 1KY4A 3TZLA 3DMRA 5TMDA 4YIHA 4C7OB 2FTKE 1IN7A 4NLLA 4RM3A 1I4TD 1AJEA 1AKUA 3UT5B 1TM3E 4FGJA 4QAJA 3G8BA 3ZCSA 1S2NA 3TLEA 2OB1A 4I66A 3CJQA 5KVSA 1KQFA 5BV0A 2GESA 3L7LA 1P91A 3EPPA 1OGJA 3GCWA 3KHTA 4EHFA 2O8BB 1JBEA 5AESA 1MA3A 4LMRA 3NH6A 2CC2A 3FTNA 3UV6A 2CHUA 1I2CA 1SGWA 1C3JA 4IH9A 2ENWA 3N39C 4L0MA 4NYMQ 4CV0A 1JUDA 4J3JA 4ESVA 4DQLA 3CEPB 2HYIC 3QHQA 1RQXA 1FW8A 1C3VA 1SOVA 3M82A 4KXFB 3RVBA 3TM4A 2KX7A 1D03A 1GXSA 3EQ8A 2AI3A 6GPBA 1RKXA 1U8XX 5AI9A 4BNGA 5JD4A 2WYWA 2WUWE 2C54A 2I6TA 3I58A 3IERA 1K3FA 3LC7O 5AKLA 3OFKA 2PS0A 3NTXA 4I55F 3THRA 2QY9A 2WKPA 3NAMA 5K0CA 4CJXA 1WTAA 4MVJF 4X0EA 4YREA 1QQTA 4RHYA 1RBZA 1G6Q1 1YDGA 1K66A 4LJLA 4QU9A 1JFFA 5T4BA 4RHEA 4EEZA 1W47A 4TLAA 3IEMA 3AEQA 1ODJA 1E58A 3FUXA 2OZLA 3H19A 1UM9B 4RFSA 2NZYA 2CFRA 1V3VA 4B33A 1Y6QA 2BC9A 4CFSA 3HJAA 1SQ5A 1OU0A 1DIRA 3GVPA 4GGMX 1Z36A 3TTVA 1OUMA 4ZOCA 5EHIA 2QZ4A 1E63A 3K2BA 4NU5A 5FBHA 4WKPA 1KIMA 1DTSA 4RGYA 1QORA 4KGXA 3LXRA 4TGLA 4UVIA 4NXNB 3QIAA 1T5DX 5CT4A 3H8SA 1V4VA 3OZXA 4BMPB 3PZRA 4GDMA 2P27A 3ORYA 3SE7A 1OBFO 2M9MA 2WM8A 1I33A 2IX9A 3MGGA 3GJ3A 3N2EA 4JK3A 4MRPA 2WMOB 4DTCA 5AVZA 1T24A 4B7XA 5A1JA 2OUKA 1E5TA 3Q3CA 5JARA 2H2AA 1VPDA 1YJAA 2OOSA 3ZYCA 1RLTA 4BEBA 1Z7GA 1U1DA 2G5TA 4C0KA 3IT0A 1UMBA 4DB2A 4ACAA 4DLLA 3LFTA 4M87A 1H66A 2DWUA 2IJGX 4GWLA 4MKFA 1MC4A 3ZQKA 5REQA 1K4KA 1P7CA 3EUEA 3WAKA 4YAIA 1A9XB 2OHOA 2E5FA 1U2SA 4OAQA 2A7XA 2V74B 3K32A 1RWQA 2IGTA 2P2LA 2VXOA 4HUJA 2J32A 5HKBA 2B1JA 1YJCA 4BQEA 2QPLA 1X7YB 4FP9A 3D2BA 5CU7A 1RZVA 2ZIWB 3LA8A 3AI3A 2BH9A 4CEJB 4Q4AB 3EXG2 1U3GA 3BD7A 4PQRA 3W8RA 1ZX1A 1HNNA 2Z95A 3AGPA 3AFIA 5C31A 1GFWA 4BATA 1RPJA 4C4PA 4F71A 8ATCA 3QH4A 3OWOA 4GMFA 5BQ3A 1RLOA 3P19A 2O5EA 1E2NA 1OBHA 1U98A 1B1AA 2XEXA 3VVBA 3H2YA 3QHPA 3NTQA 5K8IA 4TMVA 4DARA 4CTNA 3AZPA 5JYBA 3SZ3A 2YNMD 5EIWA 3I9OA 4AZ3A 5KC8A 3F5FA 1RVDA 1AT1A 1QHGA 3EUFA 4U6SA 4N6GA 1FP2A 3W77A 4X63A 3MTQA 1YBAA 4AZVA 4DM7A 5B4VA 3LBFA 4W5QA 3IR7A 3TQTA 3A4LA 1T10A 4ZCTA 1DEXA 2RGUA 5LQNA 1T8RA 2DXIA 3GAMA 3G7NA 3SR3A 1FVOA 3GLFE 4BFXA 3TZQA 3ICEA 1N2ZA 3BPSA 4C04A 4HVTA 5JS6A 5HEKA 3Q88A 2HA3A 4OOEA 3JQAB 1GKUB 1GPH1 2VHJA 2OBLA 4BN4A 3SZLA 1Y9ZA 1UJ4A 2IY7A 3L0PA 1BU8A 5G40A 3KYDA 1HPLA 3VYSB 3OX4A 3Q3GE 5I5EA 1JDNA 1TM2A 2GTIA 4WJZA 5EKTA 5KYNA 1FTNA 4QUIA 1NPYA 1EXWA 1JU4A 3K4QA 2BEVA 4I6JA 4YAOA 4D9FA 3MWFA 3ZY5A 3FPKA 2HLPA 1DAIA 4IICA 4BFLA 3V80A 5BW5A 3DLCA 5B58C 2VLBA 2FXIA 3ISTA 2FEKA 1YDWA 4R6XA 2WYUA 4H7HA 1CERA 1TMYA 5ALOA 1E99A 2ZS9A 1OA1A 3R7LA 2BKLA 4MLZA 1TO6A 3WLTA 3ZN2A 2ONYA 3AWIA 3UA3A 3HBAA 4FSHA 4Z4EA 1EMDA 1F14A 2PGOA 3W0LB 2V0NA 1AE1A 3THXA 1PUJA 1CDOA 1SCJA 4HLDA 5A9SB 1FSPA 5K2MA 3SJBA 4FT2A 2W70A 1NV9A 1OZFA 3L43A 1Y9JA 1RWXA 4P4UA 1I3CA 1DC8A 1O95D 1SKQA 1QF6A 2GN1A 3B5JA 4JYBA 4LSMA 2R7KA 3UAVA 3ZOZA 3PFBA 4URUR 1Q2XA 4ZC8A 4KAFA 2DFDA 1QVWA 1TMOA 3DONA 4UPDA 4C6TA 5ILOA 4I4CA 2OQ2A 4GMXA 3Q40A 3MJRA 1BMTA 2OPHA 2C3MA 5AHXA 2DHRA 1PP4A 3DSRA 5FBZA 5KX5A 5LR6A 1KAOA 4CE6A 2IU0A 4R9VA 3PF8A 1OILA 4TTPA 1J8FA 4ZYYA 2M6RA 4YRNA 2P40A 2WSIA 2XT6A 3I8OA 2AK2A 4NOKA 4R2WA 4Q93A 2NPFA 4BTVA 1L5MA 1ICEA 1LC0A 2NAPA 1TQDA 2YMMA 5DMHA 5ALJA 2W2LD 3KR9A 1HT0A 1HE3A 1I94B 1Z4QA 2EZ8A 2QENA 1JT2A 2RK6A 2SCUB 1XDWA 3DLPX 3IUYA 2A1IA 1U28C 2JCBA 3IQXA 4DCJA 4EG8A 1OT3A 4P9NA 2W6OA 2ZETA 1DUVG 1FBNA 3GWGA 4JD5A 4EHIA 1OYYA 3CF4G 2JG3A 1GCGA 1ST3A 1VOTA 4U2GA 1F9AA 3I5MA 2YS6A 4IIUA 4BYGA 4G89A 1UBLS 2CL5A 4YRMA 3S27A 1LK0A 3W8NA 3AJDA 4ZVQA 4MA5A 2IYAA 3IXLA 3ES9A 4A26A 3OLVA 4IS3A 5TPZA 4KXYA 4M1WA 3Q2IA 3IFSA 1TF5A 4LYYA 1DFGA 5FJJA 2XTJA 4ZAVA 3KL2A 3QEKA 4LNAA 3DVRX 2XSZD 3ZHQA 5FEMA 2WUEA 4MHTA 1E1RD 1WV1A 2AC7A 2BF7A 3EIUA 3MT0A 4XB2A 2G71A 2CNKA 5CPFA 2QLTA 5T64A 2RGXA 4EHAA 2BEUB 3R7FA 1WBBA 1ECPA 2CFOA 3BORA 4KUGA 4GOLD 4LMAA 1JSRA 4JT4A 3NUQA 1C30B 3SM3A 1U0NA 3V8VA 4RPLA 1FNDA 2JFFA 4AT1A 4TLMB 4CHTA 4LOHA 1DP4A 2PZEA 1JIQA 5CYGA 1W44A 2AFIA 3AU8A 3RSFA 4MR9B 1XDZA 4ZO8A 1MORA 1JVBA 2IPMA 2O5RA 1FLAA 2NSJA 4ISCA 1VL2A 3EUAA 2X3UA 3GAFA 3L8ZA 4B7CA 2JZCA 5EYPB 5IAOA 2A84A 4NXMB 1WB4A 3M4NA 1U8YA 1G8JA 2GH1A 3AJAA 3MS4A 3O2NA 3RUDA 1DADA 3ZJ5A 1F2TA 2E4XA 1X74A 1ICIA 3SI7A 1X1EA 1P0QA 4N0QA 4KODA 1JFLA 3QWBA 3GUUA 4IIYA 2GO1A 1L4HA 2HLNA 5DT2A 2B2XA 1D1SA 2B98A 2AFHE 2RGGA 2V65A 4OBEA 5DI3B 1TCBA 3TR6A 1KI2A 2VDWB 2YJ5A 4I36A 1F17A 1QR2A 2GETA 2V3WA 3EAQA 2XADA 3PQEA 2Z8XA 3OM9A 3B1JA 2XZPA 1YMQA 2OAQ1 3D8BA 3NIWA 3M6WA 4G5FA 5TR9A 2FP3A 1C0IA 3RC1A 3WIBA 4F3YA 1E64A 1G291 3HA7A 1IVNA 2E5LB 2JI9A 1GZUA 4IMIB 3GO4A 4EATA 2Q28A 4J94A 1SC6A 2RI6A 3QKSB 3RANA 4KE8A 4C6SA 1NMXA 2VAWA 3ORSA 1I1QB 5CBPA 3IVGA 4G0NA 2PVPA 5IXSA 3M1IA 4J2HA 1P9OA 1TF2A 2WWVD 1C9YA 4YC7A 1ZGCA 1NN0A 1V41E 5EP2A 3ZHXA 3GLIA 4RTLA 2R87A 2D2FA 2H48A 3WYGA 1TVMA 3INYA 4QO7A 5KYTA 3FZQA 3KOMA 3LRXA 2CJYA 3CA8A 3PT5A 4IFEA 4J1TC 5CK5A 4XRGA 4ENRA 4I19A 3HBNA 1DXYA 2XKJE 2XWJI 1QDLB 5FB3A 4NK4A 1IIBA 4A5SA 4OQDA 3LLCA 4CNQA 2IOFK 1QRTA 1DMRA 5KTMA 2ODAA 2OBFA 3WDLA 3EVZA 2AZDA 3CGGA 5BWCA 5T7BA 3KQSA 4HYYA 1PIWA 3URMA 1O96B 3MRVA 4MVJD 5BW6B 3PFHA 1PGOA 1FIUA 3FZNA 3TMKA 1QH8A 2JI4A 2WNIA 3UJDA 5BMVA 2W93A 4V1CB 2ZRLA 1VBKA 1AN9A 3L46A 1B8VA 3M89A 3WLEA 1T2UA 4XVHA 2Z98A 3U3MA 3AW8A 5JFTA 1SVNA 3WE7A 2WOJA 3CO0S 4QT4A 1XCGB 5DNYB 1NI3A 1YQEA 1FMLA 3BTSA 3DBLA 4F12A 4G8BA 4NMXB 1YMUA 2GN4A 5GWXA 1JIIA 1AY0A 1Z88A 2JIQA 2RBKA 2FPGA 3A4NA 2YFQA 4IUYA 5TE9A 2D00A 2HU2A 1K5DA 1EK1A 2C5FA 2QMZA 3C3CA 4KQ9A 4ZZ0A 5BVHB 1X7WA 2YFHA 4DADA 3DT9A 2JASA 5FUQA 1GRRA 2ONCA 5A5GA 4N18A 2O3QA 2P90A 3SBXA 4E4YA 4GMGA 5JSQA 1QVVA 2H1CA 3PWTA 1XTVA 5HRAA 1G5TA 5DWQA 2XDYA 3KJZA 2X42A 5CR9A 3EC1A 2W6NA 3ZW9A 2A9KA 3KPWA 1O3YA 2BGMA 1RI1A 3KOYA 1SBYA 4B3SB 1IN4A 1M9NA 2D0PB 3MMXA 4PZDA 1KL7A 1RAGA 1WHTB 2EC5A 1CHDA 4RA9A 1X14A 5AK4A 3H5OA 4ZAXA 3ND5A 1JFFB 5D1NA 5YASA 5JC1A 2ZYUX 1MH9A 3R7SA 2NT3A 4WDQA 1QFSA 3AEQB 4OPMA 4AUMA 4HI0E 1KY3A 3MFYA 4BX9A 1UFKA 3WL8A 4HF7A 4RFSB 1O6ZA 1Z5OA 2UVQA 4LGYA 4AMVA 1MABB 3U3RA 2MSDB 2C3YA 4RKRA 4RAQA 2P4SA 1FFDA 1ZIDA 3RV4A 2I6GA 4CF5A 5IJ9A 5KINB 1BHQ1 2OE2A 2DR2A 3HK2A 2CXOA 2EKPA 3P9PA 1THTA 3F67A 4U5QA 2WJAA 5E6RA 4XR9A 2FW8A 1ISRA 2HLHA 3LP6A 4ND7A 3WGUA 4FE4A 3H2SA 3RSHA 5EE1A 3QVMA 2P2ZA 1F0KA 4WZBE 4TYNA 1BQEA 5EJ7A 3H3JA 3FE2A 2CVQA 4XIIA 5G0UA 5GM2A 1DIHA 1VE7A 3R77A 3MT9A 2QSYA 1DBVO 1FP7A 4FGUA 4KQEA 4QQNA 3IYLW 5FUVA 4A0QA 4EL0A 3M4ZA 1YCGA 5I48A 2BWJA 2QMUA 2RHTA 3IP8A 3NHYA 1Z8HA 2OCAA 3KYIB 3NHRA 4HD8A 4KK3A 3WVNA 2QMYA 4U00A 2B94A 1QWOA 2FDXA 4B8YA 1M8FA 1NXOA 4UOQA 2FFQA 3I83A 5REQB 4CQMB 1I0ZA 5KNDA 3R3ZA 1J25A 3CJRA 1E3JA 1F4PA 1Z2DA 1P9NA 2WYOA 1CE8A 1LV7A 3CH5A 3H13A 3K5PA 4IVQA 4J16C 4GO1A 5AK0A 3S1LA 4BKRA 3SC2A 2FDCA 1D3AA 1QS0B 2XUIA 1P2DA 2V5VA 4MPJA 4E30A 2GLUA 5A4JA 2VUUA 2XOXA 3X44A 1F0NA 2OA0A 9ATCA 1EM6A 4YHHB 4NX2A 1S2MA 4IHJF 3DBOB 1LDEA 1D6JA 3BL6A 4ZC1A 4NCAA 5FOUA 1JPJA 3ZCUA 2QTHA 1OFTA 1VZ2A 3GUZA 3WC4A 1PV4A 4AZ3B 1IHXA 4P5PA 4OI0A 3O47A 1JLLA 1EFPB 2ZTMA 4DDVA 5HHTA 2ZUFA 1C80A 4GKAA 3LP5A 2OVBA 1I0IA 1VZ3A 4AJNA 5BYAA 5CP8A 3JD1A 5TSDA 4FFNA 1LPNA 2JF0A 4N5LA 2NU7B 3RSZA 1L1QA 1UQTA 1EI9A 1XRPA 2IPNA 3AKYA 2BCEA 2GF2A 2RAVA 4O2BB 1Z2EA 2C9YA 3SXUB 3UJ7A 4DWJA 1AVTA 2FV8A 1F3LA 2H3HA 5DCLA 1Y4AE 1H8ED 2NV6A 3Q2KA 4B9AA 4BGEA 4PYMA 2J67A 1XN1A 1XCLA 4OGGA 3N53A 3ZI0A 4ZVSA 4K6GA 1PYOA 2DPLA 4MXDA 3ROZA 4KNYA 4MP3A 2ZYGA 1ATIA 2XMSA 3KR2A 2CDBA 1Q1NA 4JLOA 4KXWA 3IAFA 4PAQA 4PR0A 2BEVB 4JENA 5SZKB 1M34A 1E9SA 2W8BB 3ABIA 5IC4A 1UC4B 1Y4UA 2FFHA 3IJPA 1L1EA 2IA5A 3OZCA 2YJ4A 3PE3A 1P1CA 3HHPA 1P6QA 1DARA 1TM1E 4RMIA 4LJSA 2RSLA 3RT7A 5L4SA 3VKFA 4XJVA 2CBGA 3L7IA 2VAVA 2CMHA 4PONA 4HC4A 5K0BA 1BE1A 3HFSA 2B78A 3EZXA 4B0PA 5JTTA 1VJDA 1GZSA 2GSDA 3KVOA 5ALNA 2W8ZA 2QM3A 2C04A 4I9HA 5J59A 2VAPA 2Z8YM 2H57A 1RHQA 1JDZA 4WIAA 3SF0A 3H11A 2YMLA 4ZT4A 2H54A 2BDEA 2JH8A 2JEOA 1Z25A 4B31A 5LDDC 3PEWA 1Z63A 2QX8A 1ZINA 3AVQA 4MA0A 2I03A 4QQ8A 5DHPA 1KP2A 2A5GA 3DVLA 3E9ZA 4H4EA 5AJTA 5FPTA 4AQ7A 3W5AA 3UT6A 3CEHA 5C53B 2ZAIA 4CMBA 4YRGA 3ZXIA 3CIOA 1WABA 1V8FA 3L1JA 1RXSA 4OY3A 4S0ZA 4BVFA 4CWAA 4C6TB 1G20E 2O05A 3WBJA 3C7TA 3FYUA 3QUCA 3WLFA 4NCBA 1N7HA 2F00A 4MUEA 5BQFA 1JR6A 5C52B 3DZ8A 3MWGA 3UJ6A 1N9ZA 3WGZA 1GNPA 2WIGA 2I62A 3ZWKA 4HRYA 1LSOA 1JG7A 1Y7HA 1JJAA 3BD9A 4XDHA 4F6RA 4OQZA 3AUSA 5BR4A 3QNUA 4PG6A 4WH0A 5CDGA 2JANA 4YMTA 1MFPA 1CIVA 3EG9A 3GGCA 3WZMA 3HKBA 1UBTS 1KK1A 4I50B 3TLKA 4RACA 1H94A 2ID4A 2VEOA 2GKSA 3D8NA 1OWNA 3RC8A 4GKVA 4I5EA 4WFKA 5ER6A 4QDKA 4UAGA 1EVEA 2ECKA 1OW3B 4KXUA 4EM6A 4EJ0A 1FU8A 1H4TA 2QAIA 4CKBB 3EDOA 3RSLA 3QOYA 3M5DA 2R85A 3T3DA 3H2BA 3SE0A 1HWYA 3D3QA 3H99A 4EGQA 3M33A 3CMCO 5KYXA 4GOOD 4IO0A 1VSQA 1NXXA 3IBTA 3RBVA 2ZBPA 1J0DA 3VDMA 1DL5A 1NF3A 2OP1A 3AUJB 1TYAE 2OY0A 3HRIA 1EXMA 2VTDA 3MCVA 3OT1A 4PIVA 5EVCA 1HMPA 3F2VA 2HMUA 3HG7A 2B1IA 4US2R 3TL2A 2AMYA 3UN1A 3TVDA 2VC2B 4JL8A 2JK0A 3PJDA 1BKYA 2G1UA 2D5AA 1U3CA 1PJ8A 2HXYA 4EG3A 4CN8A 5C8YF 4EY7A 2G9UA 1UXGA 3ZIUA 5CIYA 3RFFA 4YAEA 5FNVF 4OJMX 4D9JA 3AKCA 3ZWNA 3UV3A 3V7WA 5JC8A 1TQHA 2A59A 5F76A 4MUYA 4BRSA 1SZDA 3WB1A 4FDVA 1Y3BE 1YS1X 2CUZA 4IFIA 3TDNA 1LSSA 3A7DA 1N0IA 3BDIA 3E35A 3GQVA 1E0KA 3EIQA 4IWNA 1P7VA 1SB8A 3KV1A 3U62A 3W5UA 1QHYA 4G85A 1DKLA 2O1EA 3F7OA 4QARA 2DULA 2FGKA 3PGKA 4FOOA 4BO4A 3T3MB 5L51A 1OX4B 1MJGA 3E9DA 4KXNA 5HQJA 4CN9A 4WXMA 3ZY2A 2HBQA 1Z0DA 4FMDB 4M9CA 2QTRA 4ZANA 2HJGA 4RJJA 4J0GA 1R9GA 5LWQA 1ZSNA 2AG5A 2NYUA 4FYPA 4BLUA 5GINE 1BDJA 3KFLA 2B8JA 1C1HA 4MB6A 6ADHA 1AN0A 3R0IA 2ZUEA 5LQRA 4A1FA 3CR8A 2CHVA 5K4AA 3SSMA 4HNUA 2YXPX 3RLIA 3ETLA 1N3LA 3DJYA 3CLKA 3GLTA 2VDKB 3GZ4A 1P2VA 4Q5IA 4CCAA 3OE1A 3GDOA 4COKA 4I6EA 1HDGO 3IA7A 2XNKA 5E4FA 5DGIA 2ZJOA 3UJ3X 1ZXBA 2GAAA 4HFMA 1JB9A 1EJ6A 2FZVA 5HF9A 4FEEA 1YB6A 4MVXA 3VR3A 3EAGA 1EDOA 3HEBA 4UBNA 3TK1A 1SOWA 5BWLA 5EHXA 5CBPB 1JHAA 4BLTA 3KOUA 1NR1A 1SG0A 1SXGA 2VXBA 4KR0A 3V8PA 1JR2A 4MYUA 1E4VA 5KJEA 3FYCA 2AKAB 4MUXA 3V2UA 4LBZA 1VB3A 4DLTA 3K5WA 3GEHA 4FHDA 4CCYB 1IXKA 4DUPA 4EW1A 4TSFD 2I8AA 3RI3A 2JLSA 4E4TA 1SPXA 1YTUA 5IANA 3RUCA 1BX3A 3FCXA 4CMIB 4HVCA 2XWPA 2O3SA 2PFGA 2YASA 3FWPA 4L51A 4P35A 4U9HS 5IZCA 1OI3A 5AR1A 1Y98A 3GROA 2YZ7A 1FA9A 1Z0AA 2A67A 3ODPA 3TOSA 5FLXA 4MQBA 1NT4A 1TD1A 1WHSA 4IJMA 2VATA 4Z9YA 4FEGA 5JRZA 2ZJYA 1C50A 5AVJA 4LZPA 4BN0A 2JLRA 2IW3A 2PSDA 4HDKB 3OOEA 4XD7D 1WPGA 5JUWA 4F8EA 1KK3A 1QH8B 3W06A 4KFCA 4HBGA 3KYCA 4CT0A 3WRXC 2C2BA 4XH9B 4BCBA 3EPRA 2Q5LA 1IOLA 3NKFA 3TMYA 1C5KA 1P1RA 4Q9IA 3HJCA 5HWSA 4DLNA 3DMTA 3UKDA 1M1ZA 4Y2TA 1NRIA 3R40A 1DRWA 4NCKA 4R83A 1NQOA 1ZICA 1K8RA 2XUAA 2WTUA 3G2NA 2D62A 1RPNA 4IZ6A 3PPYA 2PGLA 4ASUD 2BAGA 2OO5A 1X7WB 2BFAA 2ZROA 2ZXFA 2ODQA 3B78A 3BTOA 4KWEA 2UXDB 1AK2A 1Y4DE 5ICSA 2RJOA 3UCXA 2UYQA 2W6CX 3KD2A 5EIOA 3TTWA 1N2OA 3ICPA 2XKBA 4G5HA 1M8KA 3OHSX 1EYZA 5CDFA 5IZCC 1ZK3A 2OBMA 4KVAA 2GVDC 5THKA 3S40A 3DAYA 3ZHBA 3PHHA 4Y1RA 4FIZA 3H3FA 2X4LA 4G3XA 3MILA 4BBJA 5HKKD 3SYMA 2RAFA 4RABA 1C41A 4M9QA 5FADA 2YN2A 1CLUA 2J6CA 2CBXA 3IAM6 3PEEA 4OH1A 2ZUWA 4P32A 4PTLA 4RA9B 4RV4A 3FPCA 3HGQA 2YW9A 3CE6A 1BDBA 2UYHA 3MA0A 2VXYA 4C78A 2Q8NA 4BVGA 3RVSA 4EBBA 1CYDA 1P62B 2QRGA 1U9IA 2QUIA 1CQPA 3IRUA 3ZZ1A 1MEJA 1ORTA 1XRJA 1YRAA 1JFSA 4C0QC 1KERA 3ZWQA 5IT9A 2OCPA 2F17A 4QPZA 2I6XA 4ECAA 1DWPA 4NV3A 2H5LA 4YUZA 4KNVA 4XWWA 2KYRA 1AHHA 4GVLA 5FI0B 3FFAA 3P52A 2QYTA 5B1YA 4X41A 1ES9A 3SY8A 4BRWA 1O94A 1U2ZA 3U4HA 4UULA 2JJ1A 3LKZA 2D7JA 2IHVA 1MDFA 5JADA 4G5XA 1E1QD 2HRDA 1ACJA 2OO5C 1EK0A 3JYOA 4U9UA 4WNIA 4ALJA 1KVRA 5T57A 3NC0C 3K70C 2I71A 3OZSA 1DWQA 3CUUA 3D6TB 4ZT3A 3WNVA 1YI8A 4CDMA 4D4KA 1A5BB 3X1JA 4G37A 2QRJA 3SIPA 3R0JA 4YDRA 3P94A 3PZBA 4WOJA 1XC7A 1IONA 1M74A 1PSZA 3O0DA 3OZUA 3M3PA 4GQAA 4MVJH 4GP7A 4RHFA 2QE6A 2ZBEA 3ETDA 3DYVA 1PFQA 4TKZA 2O8DA 1S3GA 2X5NA 1VB5A 3O38A 2WKQA 3DMGA 2QAGC 1DRUA 4YRSA 5AHWA 2C97A 5GGXA 3DM5A 3NKVA 3RC2A 2HRBA 4EYQA 5J58A 4FBGA 3B6EA 2YN4A 4J8PA 4RFVA 2FUKA 4ZCRA 2D3WA 5EJ8A 2EEPA 4DG5A 1GG9A 4X7MA 1NLMA 4PGHA 5KDLA 5DM4A 2A5LA 1KFJB 3ENQA 3UOGA 3LX6A 3QFFA 3NJ8A 4XX1A 4KPYA 5CDUA 3TO5A 3HB1A 1USUA 2W4IA 4OYLA 4AS3A 4EI9A 5KTKA 4U8HA 3LHKA 4AY2A 4ZYUA 3KBOA 3NZEA 1JLLB 3LT2A 3HJGA 3QXHA 1CVRA 2QW8A 1S3FA 1F7VA 1LNSA 2FQ1A 1ZKMA 1RHUA 3ZWDA 3SDSA 4KSYA 1QFMA 2HA7A 2QI9C 2QZSA 4YJ3F 4D0SA 3Q5DA 5TMBA 1Q21A 1JAZA 1JQ5A 1C0LA 3FTPA 2FEWB 2PYDA 4TT8A 3BCHA 1PWHA 4IXWA 4B35A 1KP9A 3QU4A 1U65A 2ADFA 2ZUCA 4PAOA 4QJ4A 4E09A 5AVSA 1QP0A 4IV8A 3M5PA 1Z33A 2AQHA 1VMAA 3AUTA 4YTEA 1E5VA 5BPFA 1GLVA 1YU9A 1HG1A 1SVWA 5SICE 1RRVA 1V5GA 2ZB2A 3BXXA 3BDAA 5JSZA 2PS9A 3LOPA 1XTSA 2QN7A 3QTBA 2BBSA 1ZUWA 5EMHA 4E94A 1BHSA 4NG4A 3SIWA 3PUKA 2HIMA 1QQ6A 3EGXA 3NP7A 4MR8A 3F3SA 1EFLA 2PRSA 3V9AA 3N3BC 5IEBA 1NW9B 3TRKA 4CKYA 2MSKA 3V2GA 3WK7A 3EDCA 5D5QA 5AJWA 5IKOA 3SQNA 3ZIDA 1NGSA 4MW4A 4NEHB 1N2BA 2YRFA 3OEWA 2PLFA 1SBIA 1R27A 1PFGA 4QM6A 5J4KA 2IPAB 2OD2A 4N4AA 1EUZA 4JOCA 3BREA 2D5LA 2DKFA 4OQEA 3H11B 1PW7A 4AZTA 3ROGA 2XTMA 4TUYF 1UKVY 3NVAA 3F3MA 3E22A 5JNRA 3ED5A 2RGWA 4Z2AA 1X87A 2ZT8A 3SVTA 1QO0D 5DULA 3RVQA 1UXHA 3TL6A 1C3EA 3VZRA 1QB8A 3THYB 1SRQA 2DJIA 1K9VF 4JEHA 1T8SA 1JX6A 4LGVA 3PI7A 4S1TA 3RTBA 4E1VA 1KEZA 3S29A 2CLFB 5IM4A 4M60A 4PXAA 3H0KA 3FYUB 1OYVA 5KKNB 3K09C 3MMSA 3ZV6A 3ER6A 1GFSA 2AVDA 4GPBA 4RIFA 1E3IA 3TVYA 5MHTA 3C85A 1N0UA 5H82A 5EA2A 4ZZ3A 1FXWF 1UJNA 2Z9BA 3DV9A 1UDAA 3N0VA 4TX1A 3TUZC 1SZJG 2DWOA 2JFOA 2Z2IA 1N2CE 4PZAA 2ZSIA 2OZEA 4WZZA 1OPRA 2XZTA 4TTSA 2XF2A 4KI0A 2VYQA 3EG9B 1ZGGA 3P9CA 4ZVKA 3NV9A 5E1DA 1EZ4A 1CKEA 4C3VA 4HN4B 4IY1A 3WMEA 4CL8A 1T6BY 2PFKA 3FCOA 1JSZA 4E07A 3G8CA 1DWUA 3RAGA 3HYSA 1B93A 4J75A 5CHEA 2Q3DA 2WVAA 2J4CA 3EVEA 1PL0A 1DJPA 3L4BA 3HKCB 2H1VA 4ZYTA 1DIGA 1FYVA 1P7YA 3T34A 1TYDE 5FPQA 5ENZA 3FMFA 4MWDA 3W04A 4MYHA 2R8OA 4HK4A 2EFDB 4X5OA 1Q92A 3T06B 1RWWA 1VMIA 1IC6A 4O4HB 5AK6A 1THMA 3IS3A 4FW9A 4H6XA 3ZVRA 1B8NA 2MYTA 4A8JA 2HMWA 1VDZA 5AHRA 2WSSD 1EFTA 4RESA 4CIXA 2IQ5A 5SZHB 2AEEA 3S2IA 1RPAA 1YGPA 3IKMB 3SLRA 4MW6A 3RUAA 3AVXA 4KVGA 4R81A 1CS0A 1FK8A 2PZMA 4WN3A 3L7KA 2ZI4A 5EIAA 4WY8A 3PEFA 2VDRB 3IAAA 1ABEA 3MRTA 3TGWA 3F6RA 1K8QA 5AKHA 4DUGA 1FQKA 4QZVA 4EA8A 5BN5A 3JYHA 3VZBA 2G08A 3IP6A 4M38A 5F2EA 4F4DA 4JLJA 3CS3A 3BXGA 1KJQA 4Y0VA 3SQMA 3IMGA 4DLBA 1TK2A 3BE6A 2EWWA 2Y0BA 1BS1A 2X58A 2AI2A 4XJTA 5FLKA 3UMYA 1G8AA 3L4BC 1AQLA 2VT6A 3SYKA 2R0QC 2R97A 4H2DA 1F8FA 5A5DA 5AKIA 1FY2A 1XE3A 3OZFA 4V0NA 1XVUA 3UHOA 1SG9A 3LBAA 1II8A 2DHEA 1G7TA 2XE6A 3H9JA 3IDFA 2RB5A 4Q9NA 2ATXA 5DHRA 2D1SA 2R6R1 2QQEA 3KXDA 5DIZA 3ZWOA 4BPRA 5A4FS 2X2EA 2YXLA 1W49A 1ZZEA 3EDRA 1HX7A 4JGGA 5EP4A 4BNXA 2H1SA 1DPGA 5EP1A 2FPIA 3M0EA 2VCEA 2AYXA 2J5KA 3DGEC 3C14C 3W8EA 2V7QD 3FMIA 4ID3A 3W5SA 1W9MA 1KAEA 2QB5A 4IJKA 2WINI 1BO6A 3RAFC 3O8BA 3RHFA 1GQ2A 1VYUA 1N33B 3CVJA 4MQ5A 3W4KA 4B81A 2VJOA 5DNAA 4DR6B 2W2PA 4B4UA 3IVAA 3PRHA 5IF9A 3GJRA 1J0AA 4JLUA 1WLYA 2IV7A 1XMSA 3EVAA 2JC3A 4Y2JA 1VHJA 2G28A 2GXUA 5BUCA 1TZ2A 3PXBA 4ZAGA 1BHJA 1SK8A 3VKVA 2P11A 4OOFA 4TS1A 3STVA 1JR4A 1XZHA 4DRZA 1MAAA 2Q1XA 3NBUA 1UL1X 4IGFA 2PLNA 3EEQA 2QZJA 5CX4A 5L8VA 4CL2A 3ERCA 3WKEA 1DQNA 1WHSB 1YRWA 2PTHA 5FA6A 3HS3A 5H3LA 1QRUA 4WZ6A 1IZZA 2JAHA 3DHEA 2JLYA 1RWNA 3BEOA 5FWYA 1F5NA 2FSFA 4FB5A 3F6PA 2X6TA 4TL8A 3ORRA 3TTSA 2R7LA 3K9BA 3GLKA 3QV2A 2OQVA 3C7KA 1GR1A 4NATA 3KQHA 1EVLA 3KK0A 5JATA 4M88A 4MV8A 5GOZA 2FMFA 1C4XA 1KSFX 3Q2OA 2UUCB 4YFVA 3GRFA 4LWQA 2I4RA 3TFQA 1MBZA 1R5BA 2XWBF 1TYCA 2FPKA 4Z4IA 2OBBA 4YROA 2CUKA 3PGXA 1UMKA 3KQLA 4RW0A 3FNEA 4EUKA 3LUFA 2V1XA 5IYZF 3V8RA 4I46A 4YONB 1IHDA 1GYQA 1PD0A 5EE9A 1CUFA 2FUEA 4IMRA 3AESA 3JQ9A 4F5DA 3MCTA 1E7SA 4BBPA 4KO3S 4G6ZA 2LCQA 3TLZA 2Y71A 4IHQA 4XFJA 4OHZA 2ZRNA 4I4TA 1Y8QB 2IHYA 3DW3X 4PBSA 4UDNA 3ZWVA 1NG9A 2UYOA 4O2RA 1JU9A 2H18A 2E55A 2JFBA 3G0CA 3SC2B 2QPAA 4MR7B 2BJHA 1F2UA 1AKYA 2PU5A 3ND9A 1NWCA 2PWYA 4GAEA 4IXMA 5T6BA 4RY0A 5I7RA 3H2KA 1R1DA 3HXPA 5DGTA 1WXQA 2IT1A 2IZ6A 4A6PA 4E5SA 1XELA 4MB0A 3LPAA 4G0WA 3JQFC 1OHHD 4FS3A 4MW0A 4IAOA 1PT6A 2EW8A 4RS4A 1ISSA 3ZGLA 1B6GA 3X1DA 3K0BA 3OQPA 3WHIA 1QG4A 1UKYA 3COYA 3BH0A 2CD7A 5DM70 1DEAA 1EZZA 1K8ZB 1THZA 4H60A 1T34A 1U7XA 1YA4A 2EAUA 1GVHA 2V8BA 3N59A 1CV2A 3OSZA 4JFAA 5C1PA 2NG1A 4X71A 2P9JA 1K6MA 2X76A 3KR0A 3OOYA 2HU7A 2H4WA 4CIDA 1Q14A 2GBCA 4R31A 3BWYA 4XLTA 4ENQA 1FE8A 2Q5EA 3TR5A 5JYDA 3BWDD 3I09A 2Z2KA 1UK9A 4CIVA 2AXPA 2GBLC 4AJLA 5ARBA 2UUPA 3CSSA 1L5KA 2D2IA 3UGQA 2A9PA 2VF5X 3EGDA 1NR7A 2YOFA 1ZD1A 1MAVA 2BIFA 2C3PA 3P4YA 4GECA 4QGBA 2C83A 4BWFB 4C22A 2JGNA 1LZLA 2WEKA 4S1NA 2BF4A 3IUEA 5CEJA 1X80A 1YQWA 2J5BA 3QKTA 3ZU3A 1EA5A 1ESDA 2CYBA 3K9GA 4F97A 1PQ4A 3ANSA 2DWPA 2O8DB 1OXUA 4D3XA 3OD1A 4W6QA 3HUFA 1JKJA 5EMJA 5HPYB 4DR2B 4PGGA 4DV1B 2VA9A 1SCUA 1WB6A 3ZV4A 1F0PA 2C9OA 3ESZA 4NY1A 1TVCA 5JZOA 1UR5A 2E1PA 4LSGA 5K5EA 1JZSA 4BJ1A 4ETNA 3RS2A 1AUVA 1BEEA 1XQYA 3GA7A 4BP1A 1FNCA 3RS0A 2C57A 3P2KA 2O2GA 2ZYRA 1XK7A 2QKYA 2FEAA 3L4SO 5FBVB 3E8SA 5LZ7A 3R4VA 4FOPA 3EQZA 4LF4B 4KAAA 2C20A 3KQKA 2UUAB 2JD1A 5IW8A 4DR3B 5CT6A 4CT5A 1X8KA 4HDAA 4DANA 2D3TA 3RSGA 1E2HA 4OKSA 3E23A 2JGLA 1PR4A 4DJAA 5TLSA 4ZIRA 1S9HA 4TQ9A 4LYHA 4JYPA 1NMZA 2PU7A 3W4IA 3OPMA 4GLBA 1JG4A 1KE1A 3BAFA 4OX9Y 1D9XA 4JXXA 2PX5A 4YCDA 2CSXA 3GJ5A 1JEJA 3II6X 3MT7A 1VJ5A 1H05A 3JZMA 3URKA 4Y2HA 2IDKA 1BXRA 1RJGA 3PD7A 1M7HA 1N6RA 1XVIA 2IUTA 4XDGA 1IUKA 5J5AA 4OHPA 3IAS6 3FB4A 4BNVA 2NSYA 1I4EB 2BBOA 3JVEA 5A0FA 2C7GA 3ROEA 1ENOA 1Z6XA 4MRRA 3QEMA 3TYXA 1IN8A 2GA9A 2X19A 2CF5A 1GEEA 4PZPA 2PZJA 3ZQJA 1DKQA 3IIIA 1NBEA 1TW3A 3PTZA 2JK1A 1CUIA 1KPIA 2WPDD 1YXMA 2OHGA 3EGXB 3GP3A 3K8ZA 1GGNA 3NEPX 1KEPA 4JLNA 4NMHA 1P1KA 1XNJA 4J9UE 4A1OA 4DIOA 1O97D 3RS3A 4Q18A 2ATEA 3C8HA 3C16C 4Z7NB 4BB5A 2OORC 2QG4A 2OECA 2QLFA 2XMBA 2YYYA 5JBQA 3FMOB 4IIEA 3UB2A 1H6AA 1BCRA 1MVLA 2HHAA 1USKA 1M6VB 1U2PA 3P9QA 1FDRA 4OXIA 3ZC3A 4CMAA 1SCQA 1P80A 4UTVA 4I08A 1YZNA 4BC1A 4E6PA 1F9EA 4FK8A 2JGDA 3B7PA 2XWSA 5FFFA 1Z68A 5FPSA 4N7MA 3KEGA 4YQFA 5KPDA 2E85A 3CLRC 3CH7A 3F2IA 3PRJA 3FZEA 5KWJA 2HCBA 2PLWA 1SUEA 4BV3A 2O0JA 2P3SA 2Z6QA 4YA6A 1D4OA 4YNBA 3BMOB 2VQ3A 4HLCA 4FFMA 4BXOA 4JI2B 5E7MA 1A76A 2EYQA 3UWDA 4DFDA 5DN6D 4OD0A 2F1IA 3TB4A 4QYTA 1FOEB 3QTTA 1AO3A 3IIJA 2Z2XA 2NUAA 3RS7A 4JC5A 3MLEA 4XRRA 5AXCA 3R4CA 4RE6A 1DKOA 5D5HA 4Z53A 3SJZA 1EINA 4G81A 1DG3A 4Y6PA 1KDYA 1OXSC 3RIXA 2OGUA 2ABWA 1O95A 4IXDA 1VA4A 3FN4A 1RTTA 3PA6A 1W88A 3H86A 5LDHA 5F23A 2G1PA 1PHRA 4LE0A 4F4HA 2XYGA 2VJPA 2XBUA 2ZZMA 2L2QA 4OL9A 3N6VA 4P36A 1CIJA 2VZEA 3AP2A 3WL5A 3AF0A 4YDQA 3JX9A 3MJHA 3O4HA 4LI3X 1SD2A 3S7TA 1MQSA 3W5BA 2Y9PB 3V1NA 2OV8A 2GDJA 2VTKA 1C7RA 4MI1A 3NUZA 3PC8C 3A9RA 4WTOA 3ZWWA 3RPEA 3L7CA 3OUTA 4LJAA 2BHNA 5JAOA 3DHVA 3BRCA 1TA4A 1WD7A 3L6UA 1VHDA 4AYXA 2JIBA 2P1DA 3R8FA 3HI4A 4O1MA 3ANYB 1F6WA 1AHPA 2BFWA 3VDNB 3OUUA 4QATA 4A8JB 4XQ9A 2FZLA 1XAHA 2E87A 3HSKA 4EP1A 4CW7A 1I1HA 2IHZA 1QK4A 4I9UA 4UAVA 1E2LA 2ZBUA 1RXEA 1SFRA 3AETB 3HCRA 3HJTA 1CT9A 1NXWA 2YZMA 4DSAA 3HFJA 4I8XA 1QV6A 1Z22A 4JCCA 4B34A 1CS0B 1H2EA 4EL5A 3LDHA 1L5ZA 1L9KA 1LBEA 3F78A 5IT4A 5ALYA 3UHJA 4Q9HA 1XHLA 1Z2AA 5LM3A 2YQZA 4RVDA 2X2FA 5DLQC 1EPUA 4YP1A 3TI7A 2H1OA 1Y5IA 1E6LA 2AFIE 4FFSA 3TLMA 2O8EA 1CVLA 4R68A 5EXXA 2BONA 2CFSA 4GOJA 2J3KA 1OI7A 3DF7A 1WIWA 5DASA 3WWEA 5BO5A 5B3LA 1ORVA 4NL4H 4YR7A 3DT8A 3G5AA 2Q7DA 4ZYWA 1LWNA 1A71A 1UIMA 2CLMB 5HIJA 1UXKA 1CJSA 2QN8A 4EFKA 2DFNA 2W2XA 3EY9A 5E7JA 2QBYA 2XSZA 2H5JA 2R8EA 1MXHA 4PHGA 4Q1DA 1XZEA 2QROA 2B83A 5DB4A 4BFVA 1N9KA 4D1YA 1MNAA 3DVQX 3PUJA 5G4LA 4BLQA 3UJ8A 2DHQA 4HEJA 5JNTA 3BE8A 3JQBA 4XCXA 4JB3A 4NC9A 1AQYA 3ESYA 1QGYA 2O1SA 3U2QA 3D1VA 4B46A 1U9CA 3PE4A 1QAOA 1E62A 2FMUA 5JH7A 1KAHA 3AG5A 3OHPA 4ZI7A 1OLOA 1IZ0A 1FBTA 4LDNA 2WIFA 1V8DA 3S2SA 3COSA 3GGDA 3UWOA 5JAHA 3E4DA 3L0DA 1T6YA 3Q7QA 4NJMA 1BYUA 2CDNA 2WZCA 2XDWA 3G1WA 3SK0A 3MAJA 5BRNA 1WE2A 3TTTA 2R66A 3ENNA 2NXWA 3GEBA 2H08A 4X92A 1P0PA 2ORVA 2RHGB 4MIKA 1Q3KA 4NMWA 4REQA 3GLIE 2WHPA 3B3JA 1A7JA 3SX2A 1T9GS 2FE1A 2C3UA 1AURA 1WM1A 1V2GA 3AKDA 3ZU5A 4FZVA 5A6VA 4QBKA 4ROTA 1LV8A 2B5VA 5I9NA 5ALXA 1HTTA 4MAMA 3UUEA 3EMKA 3ZBTA 1CR2A 1USWA 2O2YA 1PDVA 2A88A 1VG9B 2JLUA 4HGZA 3C45A 4RD1A 4AZWA 3OTIA 4D4GA 3WLPA 2QSUA 3I01A 4P38A 1NMSA 2I3DA 2Y0EA 4OIFA 4CHGA 4YMUA 1YDEA 2D5CA 4YX9A 1YB5A 3P2IA 4L9SA 4AFNA 1JGTA 5FAXA 4DY4A 3CPSA 3P9KA 3I6BA 1CF9A 1XXHA 4P3XA 1J23A 4BVJA 1ULUA 2DSTA 2EFYA 2ZJ4A 3I73A 3F5DA 1GSOA 3K1JA 4QDXA 4CLHA 5L45A 2FJ0A 3LTEA 3KKMA 2GQ0A 1ZWKA 2HA6A 2O6LA 3AL2A 2QT9A 3PJGA 1Y3AA 1LK7A 3FWNA 3FB1A 2INGX 4M4SA 2ZI3A 3EXIA 4IJ6A 1RE0A 3D2LA 4WCVA 3DH0A 1CZOA 4XFDA 3RKSA 5HUJA 1Y3HA 2X6RA 3B2NA 5FR2A 2XQVA 5C8VA 2PE5A 4XB1A 1VMEA 3STTA 3F6EX 1UFQA 2PMCA 4IX1A 3Q5GA 1NHGA 2R8YA 3NWPA 3KEQA 3L02A 3F4KA 1EGQA 4ZVPA 5AQ1A 4FD3A 3ZCTA 4C03A 4CI0B 1YRHA 1EUQA 1C8KA 2X1HA 4KGVA 4OXXA 1KI3A 1JQBA 2YXEA 3AESB 3FKSD 4I55A 4S24A 1ILWA 4G36A 4MVJA 1JBKA 2GPTA 3FVWA 4R98A 1SZCA 1KZ6A 2WHQA 5ADWA 4ZQHA 1GLGA 4PQGA 1Z6QA 2FLWA 2B25A 2BY4A 3WGYA 4HQFA 4OYYA 1DAEA 2HRCA 2A9OA 2ZUVA 3C87A 4REMA 1JG2A 2GD2A 4P4SB 5LQSA 3Q0IA 1F2UB 1GPYA 4QYXA 1B41A 4TMFA 4MJLA 2QM8A 2PRIA 2Q1SA 3PX2A 2AEFA 2AFRA 5F35A 4CLRA 5CB0A 3KLNA 5EINA 1LZKA 4MEAA 3HVUA 5ARCA 5F77A 3GLGE 3CZQA 3FETA 2ZM5A 3N05A 3WWZA 1GM5A 2PWBA 4KBGA 2GDZA 2X6QA 4FJ0A 5CDYA 2FAXA 1V39A 2LZ0A 1DS6A 3ADPA 3B3GA 3Q11A 1H3EA 1GA6A 2JVIA 3MQ4A 4AJ2A 3GOHA 5JASA 3RRMA 1Z7BA 2O2SA 3GVIA 4ZARA 5EJEA 3W7AA 2FYTA 2CUTA 2ZAMA 3ABOB 4RADA 1JEYA 4B4WA 2YBEA 2BH2A 5FYQA 5H4GA 1PJSA 1QE3A 3B70A 4HLQB 1BW9A 3CONA 4MICA 3CUKA 1P6XA 2ST1A 3CX8A 3CT6A 3RS9A 3ZW8A 3ZDRA 2QN3A 4N1AA 2AC4A 1Q7TA 3MTIA 2ZYAA 4BNTA 2I2BA 3KETA 4GNKA 2O8FA 3JYPA 1U7OA 3K6KA 1A2BA 1IU9A 1Z06A 5JHGB 3SFTA 3OO0A 3JWEA 1JKJB 5IM5A 3T54A 5JR3A 1SCUB 1REQA 1T3ZA 3AM4A 1EZ1A 2Q2QA 1CLEA 5LXTB 1AKWA 3HXLA 2HIHA 4WX2B 1WVMA 3TD2A 1P5HA 2DBRA 3BHNA 3DR5A 3BRSA 2K2WA 2BN4A 1Y5LA 3NGLA 4LXTA 3WSTA 4W5JA 4CGYA 4E22A 3ICOA 5JRJA 1MGPA 5L3RA 4DVJA 2CEKA 4XZ3A 5JCPA 4TXMA 2KW5A 2Q0HA 4JI6B 3ADBA 3O1LA 4TSKA 5KQGA 2IY8A 1SIUA 4EPXA 1HDIA 3NDPA 3GUCA 2D1TA 1KOGA 2CZGA 1OFGA 2W0SA 2J85A 1WB5A 3MOIA 5ALIA 3VU8A 1HZJA 4ETIA 3A2KA 3FJYA 1V5WA 2I55A 2LKDA 3TLBA 1XB2A 4NPCA 1JJIA 5TEWA 1GGVA 5JAPA 2O54A 3K1ZA 3NHMA 1CETA 1PTJA 1ZHOA 2PUBA 4B17A 3R2JA 1P2SA 1QHSA 1ZP6A 2AG8A 2BFFB 2X9GA 3CUTA 4EPWA 1ZI9A 4UUAA 4AU1A 5BR1A 3AEKB 5M5BA 5A6SA 2A7QA 2W2OA 1B0PA 3LX8A 1BXRB 4W5HA 2QTNA 3AB8A 2VKQA 1FNBA 2RHCA 3GXBA 3LRTA 4PF1A 5EEHA 2EDAA 4UW9A 1TAQA 1DTWB 1E9DA 3EARA 3O1HB 4CDGA 7YASA 1UBCA 3RNOA 4DMRA 3HV0A 4FR0A 3CUSA 4N7JA 4G5RA 3QEMB 1Z45A 5E95A 2IXGA 1Y9DA 4MWOA 2I4IA 1L7EA 1T8PA 5EIHA 3VR4D 2HHLA 4BVAA 4DHWA 1M34E 3GG9A 4LC1A 4C05A 1H9BA 3KHSA 1PF7E 1V7PC 5EZYB 1P7PA 1JALA 2V98A 3ITKA 4KRXA 4Z9AA 2NQ8A 5IAEA 4LVUA 8AT1A 2IRWA 5MGNA 3BL8A 3FX2A 1SHKA 3EULA 4HTAA 4TV8B 3GGSA 3TQRA 1C8BA 3BD6A 3MGCA 3KWFA 1KZ4A 1KE2A 3V55A 4MQFA 1BCRB 3WJ7A 4B71A 3S28A 2HCRA 3T7CA 3WBFA 3ZWXA 1H8EA 2RHMA 3G5MA 4BZQA 3M6FA 4MNTA 4WHMA 4EVRA 2AE1A 4UU0A