3EVZA

Crystal structure of methyltransferase from pyrococcus furiosus
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
213
structure length
197
Chain Sequence
FSNRQARILYNKAIAKALFGLDIEYHPKGLVTTPISRYIFLKTFLRGGEVALEIGTGHTAMMALMAEKFFNCKVTATEVDEEFFEYARRNIERNNSNVRLVKSNGGIIKGVVEGTFDVIFSAPPYYGGKYGEEFSVKLLEEAFDHLNPGGKVALYLPDKEKLLNVIKERGIKLGYSVKDIKFKVGTWRHSLIFFKGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of methyltransferase from Pyrococcus furiosus
rcsb
source organism Pyrococcus furiosus
molecule tags Transferase
molecule keywords methyltransferase
total genus 65
structure length 197
sequence length 213
ec nomenclature
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05175 MTS Methyltransferase small domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 3evzA01
2IP2A 2O57A 2ZSUA 3A4TA 5DSTA 2IBTA 2AZTA 2B9EA 4R05A 1KR5A 4ER6A 2XYQA 3C3PA 1ZGAA 3I9FA 4HGYA 1NBIA 3KR9A 3BXOA 3ME5A 4RTKA 2UYCA 4HTFA 5EOVA 1VP9A 4YUXA 1WS6A 2GLUA 1JG3A 1X19A 2DULA 4E70A 1VBFA 3FUTA 1VLMA 4RVHA 3KPVA 2AOUA 5FADA 1ZGJA 1QAMA 4YUZA 3FTFA 1WXXA 5DRTA 1X1BA 5DM4A 3THRA 2AVDA 1R74A 4C04A 1SUIA 2CL5A 2PX8A 5KQRA 3KQQA 3TM5A 1FP2A 2LD4A 3NTVA 2ZW9A 3VYWA 3BKWA 1XTPA 10MHA 2PY6A 3NVKI 1XXLA 2NXJA 3EVDA 3KQMA 2GAFA 4UOEA 3CVOA 3AXTA 2P40A 3K6RA 4RTPA 1I4WA 4QVKA 5EMLA 5EKUA 2HTEA 4ISCA 4X61A 5T64A 3ID6C 3EGIA 3PFGA 3KR1A 5HIMA 5LR6A 1KYZA 1F38A 3FUUA 4HC4A 3TOSA 3SVZA 4BLWA 4RTJA 4Z2YA 5E2BA 1ZHFA 2ERCA 3HNRA 4ATNA 4AZVA 3MQ2A 4PONA 3FPHA 3ANXA 2PXCA 2FK7A 3BWYA 1FPQA 3E8SA 4C05A 2Y1WA 3A27A 1MHTA 2XBMA 2PT9A 5CVDA 3CJQA 2OYRA 3D2LA 3UWPA 5DXAA 4F85A 5CIYA 3T7TA 4LECA 1XCLA 4LWOA 3LDUA 4X1OA 5HIJA 3NW9A 4GEKA 5GWXA 4DCMA 5M5BA 3LDFA 4RX1A 3OU2A 1BHJA 2ZIFA 4DZRA 3HVKA 3M6VA 1X1CA 3SSOA 1YFLA 1NV8A 4A6DA 2PLWA 3C0KA 3WSTA 4P7KA 4G56A 4V0QA 3FUXA 4YV2A 3TFWA 3B3FA 1PRYA 3H2BA 5F2OA 2NXCA 1JG1A 1UFKA 3EVEA 2ZZMA 1FP1D 1UWVA 3HCAA 2YVLA 5H02A 2Z6AA 4HG2A 2HWKA 1ZG3A 3BKXA 1IXKA 2FYTA 2FRXA 2ZBQA 3BWMA 3M4XA 4FR0A 5GOZA 4BLUA 3PX2A 3A25A 2UYQA 3A26A 2ONZA 2P1DA 3BZBA 4CKEA 4FSDA 3B3GA 5K8VA 2QY6A 3CBGA 4GOND 3UJDA 5ICGA 5EHGA 4KIFA 3HCCA 4PYKA 1NE2A 2QE6A 3R24A 4R8RA 3U81A 5LQRA 1JQDA 1IM8A 2AOXA 1R00A 2P8JA 3BWBA 4KDCA 5E1BA 3UJ7A 3QV2A 4DA4A 1KYWA 2PX2A 3ELWA 2ZVJA 3EVBA 3GCZA 3DMGA 4PGHA 4C07A 5FCDA 5ERGB 1EAMA 4GQBA 2CWWA 4KVZA 2CMHA 2K4MA 2P3OA 3SXJA 3LKZA 5KQSA 1WG8A 2C7OA 3I53A 3PT9A 5E9JA 3CJRA 5CUQA 1ORIA 5EEGA 4AZTA 4RTQA 2IH5A 1TPYA 3G2MA 4E31A 3IHTA 3M6UA 3CCFA 1L9KA 5E9QA 2EG5A 2VS1A 2CMGA 3GIWA 2NP6A 2WK1A 2C7RA 3DXYA 2ZULA 1SUSA 4GBED 2WA2A 5DM2A 1RI3A 3MAGA 2I62A 4X41A 4WXHA 4RYLA 5K0NA 4KWCA 4K6MA 1HNNA 5BW5A 2C7QA 2H11A 4Y2HA 3GNLA 2AOTB 3KHKA 9MHTA 3FPGA 3UJAA 4IV0A 1P91A 4GC9A 4R6XA 4RVDA 3FPJA 1Q0TA 3P2KA 3EGVA 3T7RA 4C4AA 2XYRA 5DTQA 3HEMA 5K0LA 3GXOA 3UA4A 4MIKA 5K03A 5K01A 3NJRA 3P2EA 3DXZA 1NW6A 3O7WA 4NECA 4M38A 5FULA 1KP9A 4E2YA 5IH3A 2N47A 3EVFA 1RI1A 3I64A 1JQ3A 1MJFA 3MCZA 1KHHA 4L7VA 4P7FA 3SR4A 3JWJA 4PYQA 1D2GA 1EJ0A 1NW5A 3B7PA 4DCGA 4QDJA 3G88A 3GRVA 3P9CA 4F84A 3CJTA 3KPYA 5LQAA 3BGVA 5T6BA 5CM2Z 1L3BA 1SKMA 7MHTA 3GWZA 1KPHA 3O4FA 3Q7EA 1YF3A 2JG3A 4KDRA 4GF5A 3HVJA 2GA9A 5EG5A 2EX4A 3OFKA 3FTDA 4HH4A 4RV9A 3T0IA 4CKBA 3JWHA 1WY7A 1X1AA 3LCUA 4PYNA 1ORHA 5EMJA 3QOXA 4OQDA 5CVVA 2PKWA 5EKXA 1R8YA 2VDWA 2P35A 3TM4A 5FQNA 1INLA 5FHQA 3PFHA 1JR4A 3IYLW 3M6XA 4DKJA 3KQPA 4RTSA 2VDVE 4FT4A 3UJ6A 3CKKA 4EK9A 5K0FA 5LQUA 2P3LA 3KR2A 4LWPA 3ER9A 1XJ5A 3KQOA 3KQSA 4ER3A 3BGDA 4DMGA 1WZNA 5LQCA 2GS9A 2PX5A 3BWCA 4XCXA 4E2WA 2B25A 2BM9A 5GIOE 4DQ0A 5CVUA 4EQZA 2B2CA 3NVMB 3CC8A 5CCBA 2HR1A 1D2HA 3EVZA 2OO3A 4OA5A 4PYJA 2A14A 3KQWA 1NW7A 1WXWA 4RTOA 4PCLA 3NWEA 4PYOA 2H1RA 3V97A 5FA5A 2HNKA 3P2IA 4HTFB 3UZUA 1G38A 5C1IA 3ELDA 1DCTA 3HA3A 3B5IA 4R8SA 1RI5A 3A7DA 5HFJA 2EJTA 3RODA 2HV9A 3B3JA 3UA3A 4YV0A 4XUCA 4DF3A 2NXNA 3KPUA 2V7EA 3AWIA 5GP1A 3LHDA 3HCEA 5DT2A 4DM3A 5HOQA 2QRVA 3G8BA 3OZSA 3P97A 4Y30A 5DPMA 1AQIA 1KIAA 2PX4A 5EZSA 5FQOA 3SSNA 3O31A 3LBYA 3OZRA 4OBXA 2OPBA 1JG4A 4IWNA 3GDHA 4OQEA 3PS9A 2IDKA 1D2CA 2EFJA 2B78A 3P9IA 2ZCJA 5E9WA 5DTMA 5FHRA 2I7CA 3OU7A 2ESRA 4OA8A 4GOLD 2P41A 3VC1A 3X0DA 1G8SA 3G89A 5JR3A 1U2ZA 4C03A 1M6EX 1OR8A 2YTZA 3Q87B 3FUVA 4AZSA 3SGLA 3LGAA 3LKDA 2FK8A 4MHTA 3LX6A 3SM3A 1P1BA 2GPYA 3KQTA 4P58A 5HIKA 4KW7A 3GU3A 5EQJB 1XDSA 4BP1A 2KW5A 2XVAA 3ELYA 3BGIA 5EVJA 4QTUB 1AF7A 2JHAA 2ONYA 5C0OE 2NP7A 1TW2A 4OBWA 5K05A 1XDZA 3MERA 3KU1A 5ICCA 1RI4A 4X63A 1EIZA 1JTEA 3JWIA 3LCVB 3E23A 4RVFA 3LSTA 3TKYA 3VC2A 4RTRA 2JJQA 4QQKA 3BUSA 2IIPA 2AN4A 3B89A 3R0QA 1QANA 2JHCA 3FPEA 5F2KA 3ELUA 3I58A 1G60A 1R6AA 2QM3A 3L8DA 2G1PA 3A7EA 3FTEA 1RJDA 1EG2A 4BLVA 3PTAA 3C3YA 4AX8A 2BR5A 2AS0A 5CD1A 1NV9A 4EVIA 3LPMA 5EHIA 5KS2A 3HM2A 4FZVA 5GM2A 4AUKA 1G8AA 2PXAA 3T7SA 2G72A 5JUWA 4PWYA 1VQ1A 3KR0A 3LCCA 3EMBA 1SQFA 2YR0A 2V74B 2O07A 2ZWVA 4GOMD 3IEIA 4C06A 3RW9A 4F86A 2PV0A 3AXSA 4HRAA 1QAQA 4QDKA 2ZTHA 4EKIA 2OB2A 1N2XA 3M6WA 4CWAA 2YXEA 4EMSA 3G2QA 1QAOA 3NDIA 5FTWA 4BY9E 3PB3A 1G55A 5EC8A 1UIRA 2ORED 4AZWA 3JWGA 3P9NA 3DLIA 4E33A 4PNEA 3EVCA 2OZVA 3REOA 2ADMA 1XDUA 1Q0SA 3DR5A 5E1OA 1VL5A 5D1NA 2PT6A 3OZTA 1Y8CA 1NBHA 4QPNA 2WA1A 3G8AA 3KQVA 2R6ZA 1PJZA 3UBTA 1BC5A 5EPEA 4CKCA 4V0RA 2OY0A 5EMMA 3GJYA 4E30A 5U4XA 3FPFA 2VP3A 1AV6A 5LQJA 4GOOD 1SG9A 2VDUE 3MB5A 4X60A 2PVCA 3UJ9A 2FHPA 1R8XA 3UJ8A 4YUWA 1AQJA 2PSSA 2IBSA 3NWBA 4M7RA 1N7IA 4U7PB 3EEYA 4XUEA 3DOUA 4RWZA 5K0CA 3TR6A 1NKVA 1B42A 4QTTB 3DLCA 3THSA 4MQ4A 3TMAA 2CKDA 2HMYB 3K0BA 5CCXA 2PXXA 1QYRA 1L3IA 3OCJA 2BM8A 2OBFA 4M37A 2ZIEA 4ER7A 2BR3A 2P3QA 2ZZKA 1O9GA 1NT2A 3EMDA 2ZIGA 3EPPA 3EEOA 2FCAA 2YUIA 2EJUA 2AVNA 3CGGA 3OE4A 5DLYA 2PGXA 3KQYA 4LG1A 5BP7A 3G5TA 1N7JA 3MHTA 2ZZNA 1O9HA 3MTEA 3FRHA 3KPJA 5FWAA 4KIGA 5EIFA 4FS8A 5EIWA 3DUWA 1BKYA 1V39A 2ZBPA 3GGDA 2OB1A 4YUYA 4MTLA 5EEHA 3DMFA 5DM1A 2PBFA 2PJDA 3F4KA 2OKCA 1RI2A 5KYGA 5GIPE 1SVUA 5DX8A 3I5UA 5FA8A 2QRVB 3DMHA 2R3SA 3R6TA 4PINA 2O0LA 4PGGA 3OU6A 4RVGA 5K0BA 5D1HA 2IH2A 3ER8A 4E2XA 4OX9Y 4CTKA 1L1EA 2O06A 3LDGA 3MCTA 5HIIA 3LBFA 3UFBA 5HILA 3ERCA 2Y1XA 4WVLA 1BOOA 1XVAA 1RJGA 2B3TA 2UYOA 3KKZA 5IKMA 5C9ZA 3G5LA 1JG2A 1HMYA 3DP7A 1YUBA 1EQAA 5E2AA 1RJFA 3FYDA 3MTIA 2GH1A 3TLJA 2ZWAA 3GRZA 2XYVA 4M36A 3NDJA 2P7IA 4ZTBA 3S68A 3AY0A 1O54A 3TQSA 4PIPA 4HGZA 4QQNA 1VE3A 4CTJA 2F8LA 1TW3A 2NYUA 3NMUF 3DTNA 3DULA 3TKAA 2G70A 3SSMA 3HTXA 1L3CA 2NXEA 2PWPA 5P8WA 3C6KA 4PCAA 4PYLA 3SX0A 4R6WA 2Z6QA 1X1DA 2AR0A 4FSXA 2VZ9A 5DSXA 2G71A 1NW3A 2YX1A 3RIEA 5LQNA 3FZGA 4B17A 2O05A 1DUSA 3DH0A 4KRGA 8MHTA 1JQEA 3G7UA 3GRUA 1Z3CA 4JXJA 1YZHA 3E7PA 4PIMA 2UZ4A 3HCBA 2C7PA 1NW8A 3HA5A 2JHPA 1P39A 2IPXA 4O29A 5E1DA 5HZMA 4XUDA 5DM0A 5FUBA 3DXXA 3FTCA 5DX0A 4POOA 3MGGA 4QPPA 3HA7A 1FJXA 1YZ3A 3EVGA 2BZGA 2ZFUA 2JH8A 3GRRA 1JTFA 5EZQA 2FPOA 1DL5A 4PYMA 5K0JA 4P7GA 5F2NA 1RJEA 3PVCA 1H1DA 1QZZA 2DPMA 5E8RA 4YV1A 1T43A 2YXLA 4IKPA 1SQGA 2AOTA 2YQZA 4RSRA 4EKGA 1R18A 1FBNA 1G6Q1 5CVJA 3UJCA 4YUVA 5B1SA 2GB4A 5LSAA 1KXZA 3UJBA 2G8NA 2IGTA 1F3LA 5EGSA 3PLAE 4FGZA 3GRYA 2AN3A 5BW4A 5BXYA 4QVGA 3PX3A 3TRKA 4H0NA 2QYOA 3EGEA 4MWZA 5G02A 3P71T 1YFJA 1I9GA 5ICEA 5EMKA 4ER0A 4GUAA 2BH2A 3P8ZA 4E2ZA 2ZBRA 3KPWA 3C6MA 3HVIA 2UYHA 2AOWA 2JH9A 2BR4A 5FWDA 3HVHA 2Q41A 1KPIA 3IV6A 3OFJA 5DTRA 2AOVA 5DWQA 4ER5A 1ZQ9A 3V8VA 1M0EA 4U7TB 5ICFA 5DX1A 1JSXA 5LQKA 2AN5A 3HCDA 1P1CA 2YXDA 3M33A 4RTLA 4RTMA 1JSZA 5E1MA 3FYCA 4A6EA 3AJDA 3OPNA 1KPGA 1IY9A 2H00A 4FT2A 3HCFA 3E05A 2Z6UA 3P9KA 5GM1A 5DRYA 4FP9A 2IFTA 4C08A 3FRIA 1EJ6A 3GO4A 4YMGA 4YMHA 2I9KA 1VIDA 3R3HA 3OE5A 3SMQA 2IH4A 3QOWA 3BT7A 3TPZA 3HP7A 2P7HA 3LL7A 1XCJA 3M70A 5E8JA 4BP3A 4E32A 1M6YA 4GC5A 1VP3A 4PYIA 5KVAA 5K0GA 1YB2A 3EVAA 4P7JA 2NNWB 5HEKA 4RTNA 3G2PA 3LECA 2IDJA 3FUWA 2OXTA 1I1NA 4IV8A 4HSGA 3G2OA 3VSEA 2PWYA 5T67A 5K0EA 2ZLBA 2I6GA 5DXJA 2XVMA 5CVEA 2AOUB 3ORHA 1VPTA 4CXMA 2E5WA 5MHTA 1ZKDA 3R9XB 5GINE 5K09A
chains in the Genus database with same CATH superfamily
4I9GA 1EBFA 3UJNA 1VZ2A 1CHNA 4R2HA 3RTDA 4MVYA 5BR4A 3I2YX 1SXJA 3CLTD 3DBVO 3ZGLA 2NSJA 2EHDA 2GZ1A 1V9SA 5TB5A 4YJ3B 2JCYA 3DE6X 1JDNA 3JD0A 1FRFS 2BGMA 2MINB 3CRZA 4WFKA 2I4IA 3RRXA 5K6RA 3T3HA 3K05A 2QTTA 5B1DA 5I7OA 3RUAA 1W35A 2AOUA 4HDSA 3EF1A 3OC0A 4LXQA 3O6VA 3TK1A 2OCLA 4NY1A 5FNZA 3O3MB 4Y2JA 1Q7RA 3WP1B 3K1AA 4A5OA 3STHA 1GXSA 3IBSA 1FP2A 2JGIA 5CFQA 3O93A 4QUGA 3DL7A 3T9EA 1U6KA 2HCRA 3VR5A 3WRVA 4WJLA 5JSFA 2GAIA 3K9NA 2B98A 2D0IA 1TD1A 2QV7A 3HMQA 1FFHA 1UK9A 2RE8A 2F3QA 1OLSA 4RTPA 3PKJA 1RU3A 2V55B 4ETNA 1FJ2A 3A05A 1ZOLA 1IULA 3LPNA 3QG5A 4V2UA 4UXIA 5CD9A 4HC4A 4F4FA 1U8UA 2QX9A 4MCIA 3TOSA 1MIOB 3UXMA 5ED4A 3K96A 5E2BA 5A9TA 2O23A 1BIFA 1FSGA 1H0SA 2OLEA 4NCIA 1IJFA 4Q3KA 5AI8A 1ZFNA 1VMAA 3IUYA 3NBMA 5TNXA 5JWOA 2EERA 1XJ0A 2PU5A 2VLIA 3FJOA 2WF9A 3BWYA 4X3CA 4YH1A 3LCJA 4F5DA 1QH1A 4W5RA 1E0JA 1P33A 2JI9A 4LWOA 5D86A 4L4UA 5HIJA 2QENA 3SJBA 4XSHA 1WA5A 3J81k 4PSVA 5FOXA 3NBQA 4WZBB 1PZFA 2HREA 3WQBA 2JI8A 1A8QA 2ZIFA 1QFMA 4MI3A 4I9UA 3URKA 4FMCB 1ZM4A 4LVOA 1WNTA 4PG7A 3AQIA 3LK6A 5DIZA 4CT5A 3ZTYA 1JV2B 4MHOA 1YQ9A 4YV2A 4JH0A 4CCWA 1X7WB 1W581 2NO6A 4EKEA 4HO1X 5FBZA 3WMXA 2RC5A 4IIHA 3LVFO 5JD4A 1Z06A 1MC4A 1DRWA 1N6HA 1N5MA 3K2IA 3LHFA 4KUHA 1FYEA 1VLZA 4FR0A 1U9IC 2EKZA 2ZBQA 3G0OA 5FOTA 3KSRA 4ZI7A 3CPSA 3HUUA 5EXSA 1JH9A 4F84A 4TV8A 1QDUA 1Q1ZA 2OAP1 3HY6A 4KE8A 1RYHA 2G09A 3WRXC 4EELA 2ZJFA 2UVQA 3U1BA 1XYYA 2YNMC 1ZOOA 4YRKA 3PE4A 1XJWA 1BS1A 1TRHA 2IHUA 2GEJA 4QZVA 2YVKA 1VSTA 4G65A 4MKXA 2O2GA 1Q44A 2BJVA 1P5RA 4QFBA 5ERGB 3W4KA 1NIPA 4YASA 4JI6B 3BILA 4X64B 3T1HB 5CYGA 2W22A 1Z6PA 2QA5A 3HO8A 4R3NA 3M9WA 4QQRA 2XWBF 3ICPA 1E4YA 4MA0A 4E31A 2BL4A 5EQTA 1IUOA 1GPNA 1JSRA 1ZH8A 2EG5A 2J08A 5BPHA 3WGOA 8ADHA 1RXYA 5KB3A 1RHJA 4OY3A 3OD1A 1VI5A 2C7BA 2VZLA 4CFSA 5DM2A 2YJGA 4ALKA 3JQAB 1EVEA 4LTNA 5H4GA 5LP6F 2J5BA 2WV9A 3STVA 2NVUB 1ZSNA 4BQIA 2X7HA 1P7YA 4KWCA 3QITA 3D6HA 1V16A 2GVDC 2ZYTX 4BGUA 3TQOA 3GNLA 2C97A 1Z6AA 3ZD7A 4CL3A 2G88A 1F0KA 2EZ4A 3WWPA 4R6XA 5BT8A 5FWYA 5KBYA 5LZ8A 3GZTB 1YUMA 2HB6A 1AKNA 1KZYC 4NEHB 3VH2A 3B1KA 4GI2A 4DABA 4J7AA 4L08A 3HWX1 4B3DA 1Y9AA 1H1LA 4HZGA 4WPGA 1N3YA 3UICA 2OESA 5FULA 4D9EA 2CXPA 3U3JA 4JIGA 1NRIA 1RI1A 2W2KB 5L4NA 1FSPA 3O03A 3V8QA 4ZMRA 2B69A 3R4VA 4EHFA 3WQHA 4PYQA 4TRMA 1I1HA 5DBHX 4A8HA 5EERA 2HSJA 1N1DA 4PSAA 5B53A 4M88A 1NFRA 2WJZB 4MH0R 7ABPA 5IBQA 2WU0A 3CZ4A 2REQB 3TAUA 3BRSA 3VSAA 4AAYA 1ZNXA 5TEVA 1QLHA 2ZYRA 4MQFA 1X7ZA 4KQ9A 4TSFA 4OHWA 2VO1A 4HX9A 1IHUA 1KEUA 3N7UA 4OQDA 2Q7DA 3N0RA 4XD7D 1DC6A 4D42A 5J59A 3UJHA 5G41A 4RHTA 1A72A 4DKJA 2LDBA 2WUFA 3T54A 2G8LA 1FJGB 4PVCA 2E37A 1BRTA 2PJUA 2QMEA 3CKKA 3IRUA 1W0KD 1J49A 4KI7A 5AW3A 3A37A 5KYXA 1S8AA 1YZYA 1HLPA 1N6RA 3UCEA 1RVV1 3U0BA 1RZ3A 3CE9A 2XIJA 3RLIA 4B8ZA 1BRMA 3KQSA 1ZGCA 2AFHE 4KNWA 2P9JA 3D8HA 2AQ8A 1E1RA 1XUOA 3AB7A 3F5DA 2KM1A 2QUJA 4LVNA 4GZ6A 5JO9A 5JSHA 4F9EA 1CJSA 2JBHA 3H16A 2PH1A 4K81B 4B2IA 4DNXA 2AXEA 2OO3A 2ZRJA 1FP4A 2RKBA 1HYQA 1XD8A 1U0TA 1E98A 2Z3VA 1NBOA 4PVDA 4CUZA 2PUAA 1ODKA 3GPDG 3DEYX 1XTBA 3HSSA 4URZR 5DFAA 1NVEA 1X38A 2K87A 2A88A 2YV3A 3P2IA 2R4UA 5ALMA 1JB9A 1BX0A 1U99A 1JFLA 1AHHA 1I1QB 1UT6A 1JQ5A 2BN4A 3JVVA 1RPZA 3OCWA 1RYZA 3W5IA 1U2GA 1L5QA 2NZXA 1USUA 3NDRA 5DBEX 3ZBPA 1XMOB 1N32B 3KPUA 2VJCA 4FDUA 1JDVA 3QU5A 2QMYA 3VM6A 3HCEA 2WZQA 4ZAYA 3A0UA 1Z17A 3M34A 1B16A 5HOQA 3RADC 4Z4FA 3N39C 5EZSA 5FBRB 4FE3A 4BNYA 4F46A 1E3IA 3GD7A 4YMSA 3JD4A 3ZK7A 5JADA 4JYBA 3E9QA 4I55B 2EFCB 4GPZA 2ZBUA 2OMEA 2BFDA 4IS3A 3EIWA 4MIYA 1I7PA 3PNKA 1YBHA 1G4UR 2BJWA 2YJ5A 3GNTA 4FNMA 4BVFA 4E88A 5H9WA 2HAEA 4N0DA 5ILOA 2H5LA 4FLFA 4MW6A 4BNDB 1IPFA 3WYEA 5JR3A 1U2ZA 5JZBA 2A0FA 2VSXA 3PG5A 3K2QA 3NZEA 1GAXA 1GA6A 2FPSA 5HZKA 1R0ZA 1Z4JA 3AOEA 3GJ6A 3Q6IA 4EHHA 4G97A 2BFWA 4E12A 5BNIA 5JQWA 5MDHA 3TZCA 3STWA 5C18A 2IX9A 2XVAA 2W6MA 1ST2A 3ELYA 1VE7A 3IC5A 2JHAA 4BLPA 2WJAA 5KCZA 1DTWA 1R0YA 4H31A 1OKKA 3QTTA 2GOYA 1O6ZA 3IDZA 1GLGA 4R0VA 3V32A 1V7QA 4P4UA 4BO5A 3GLGA 1RKQA 3EA0A 2C0QA 2QZJA 3W2FA 4JGIA 4B3RB 2LPMA 3BXHA 3OEED 3TJZA 3VU8A 2RK3A 2XDQB 4FOTA 5TXGA 3G6WA 3W1VA 2JGRA 3TBFA 2AG0A 4AY3A 3DVAA 4BN4A 1WSBA 4NNJA 5EQFA 3ZCRA 1NJ6A 2H29A 3KQNA 5HQ3B 3O73A 1CNEA 2AFHB 2Z9BA 2XNKA 3P2JA 5C32A 1L5KA 2D5BA 4FZVA 4UZSA 1G8AA 3QVKA 3ZJTA 3A3KA 4QTYA 4YAFA 5AKHA 1GTRA 1ZIPA 2G72A 3M9XA 1JKFA 4HDOB 3NLLA 1TQDA 2BGKA 1PFVA 2C98A 1DLIA 1WQ1R 4N7BA 4YUAA 4WLEA 5TVGA 4M99A 1EP3B 3F71A 3F3MA 5CHYA 4XVUA 4JZYA 3T3OA 3SOZA 4Z4CA 1GRCA 3PGKA 4A8JB 2Z30A 3J7TA 1TVCA 3N0VA 3VOSA 1MW8X 2OG1A 1AXGA 2GKOA 1KMHB 2YXEA 3L0BA 1GTL1 3Q3CA 4R5HA 3VYVA 3VYSB 4ZCIA 5KOYA 4URXR 1TYDE 3KE8A 1JXOA 2HCFA 3ZTTA 2J4DA 1LTQA 4QUBA 2A9VA 1ZWKA 2QVGA 3FPCA 4FN4A 3TCNA 4AZWA 4BE9A 5K8LA 5DM70 4BKOA 5EY5B 2A3NA 4NH0A 5D1NA 4YYEA 3C7AA 2IXGA 4UEWA 5ARDA 2RHDA 2WJPA 3H1GA 4UAUA 1UJCA 3NT2A 5L7YA 5I7FA 2G9QA 2LKDA 5HK9A 3NTLA 1ZR2A 1P6QA 2OZKA 4F06A 3RIYA 2B7CA 4YQZA 1BVHA 3D8UA 1AQJA 4ZVRA 2QX6A 1XRJA 2YW2A 4MI1A 1QYDA 2DHRA 2Q99A 3KTFA 5JC1A 3DNPA 3I5YA 3GG9A 1NKVA 3FF4A 4ZEWA 3WYAA 4LWQA 2Q6OA 2OV8A 4N5MA 4MDHA 4MARA 4NMLA 1LK7A 3RRYA 3THSA 3EGCA 1MVOA 3ZWKA 4TXHA 1EA7A 5EMHA 2FHSA 4DLSA 3WAJA 2CBXA 2OAEA 3VV2A 2A9RA 4S04A 2QRGA 5CLHA 4S05A 3C8HA 2VA9A 1WZ2A 1KETA 1ZYUA 2OCXA 2OYSA 2OBXA 2YICA 3Q3IA 3W3AA 4IGIA 2JJ8A 3ZLJA 3W5BA 4H7KA 3IQWA 4KQKA 2GZMA 1D2AA 1PT8A 1QO7A 3HV0A 4ZOLA 1QOPB 1ZMXA 2VRNA 3R7DA 1YVUA 1GT91 5FWAA 5K2OA 1GTVA 3LIIA 5J2TF 3A3OA 1OE0A 3BF8A 2YIDA 4IMPA 3VYTB 1I7QB 1UKYA 2HZ7A 4A82A 1Q83A 3UHPA 1XTJA 3WMWA 2VBCA 2OKCA 5H3HA 1E9EA 1JJIA 1MVLA 1YO6A 4FCCA 1KEKA 3I61A 3L7NA 5BRNA 2C29D 5IX8A 4H4DA 4JXZA 3ZQ6A 2OVFA 4YMLA 3HA2A 5L3RA 3P9PA 4PHFA 4W5NA 3DD5A 4OX9Y 4CTKA 3MCTA 3PNSA 2AMYA 4UVHA 2CYAA 2PR7A 3C6YA 4DCNA 1J22A 4RZIA 5DCLA 1W88A 1JDSA 1MB3A 1AZTA 4G0VA 3VKGA 3PQ4A 1Q6ZA 3IEXA 5KHLB 3UMGA 4CDNA 1E1RD 1XA3A 2GYUA 1DFHA 1FLAA 1K98A 1XJQA 2RIPA 1E1KA 1YQXA 2VP5A 2Y92A 3AESB 1VBMA 2FV8A 3CLSD 3FYUC 3NDJA 1R10A 1RAGA 1ODSA 4CTJA 2Q6IA 4J9VA 3CU5A 1ELOA 1GR1A 4HDRA 3ROFA 4EIWA 5LKAA 2BBOA 3HXKA 2B30A 2CUTA 2EJBA 1L3CA 1O6FA 4AT1A 5AW4A 3EZXA 3NCTA 4QDOA 4RSMA 1EP1B 1T26A 3TIXB 2DFNA 2NSDA 1DUIA 2HT6A 2ZREA 2C2OA 4ZQCB 3RLFA 3AF3A 3EK2A 1OYVA 3HDTA 1FNNA 1NI3A 3CNQS 1YZHA 1QGED 2Z8YM 2Q9UA 2WG0A 4PR3A 5L4SA 3PHLA 2X9GA 4JCCA 2ZWMA 2K5UA 3FTPA 4Q3OA 4QX6A 2ADFA 5FUBA 3VH4A 5IXJA 1LSJA 3KFVA 4G5XA 2AWNA 5FV7A 3CVUA 3MTBA 4QXMA 2D2FA 1ADJA 1BFKA 1YDFA 5E4JA 4KE7A 3ONEA 4MKGA 3UUGA 3EVGA 4B73A 5DP1A 1ZAKA 1XWIA 2H1WA 2FPOA 4O5AA 4CF6A 3BC1A 3ITNA 1Z7GA 3ZU2A 1XZGA 1YRAA 3DLBA 2E4YA 1P2TA 2YXLA 4H9GA 3HYCA 4Z1OA 4E7PA 4H08A 5LJLA 2ASEA 3QKSA 1OH5A 3LBAA 4I4TA 4X66B 5F64A 3W3AH 2FPWA 4PLYA 2QD3A 2XZOA 5LCXA 1VHJA 2ZIZA 3CLRC 2VPYA 1HI9A 2VP2A 3FGNA 3DOFA 3HYTA 1P2SA 3FTQA 4LQLA 2J4CA 1K8RA 2X0NA 2C7VA 1IXZA 2D7CA 5FFFA 1LBHA 3T7JA 3VJLA 4AJHA 3PLAE 1PD1A 2ZYDA 1LTHR 1S6YA 4B7AA 4PRYA 3WICA 3WZ2A 3P71T 3RS7A 5BVHA 2ZM5A 2BRUC 5BMVA 4L5AA 1Q21A 3ISVA 3OCUA 1G8HA 4IIYA 1EK6A 5DB4A 1ZVKA 2AOWA 5MFZA 3GFFA 4C6SA 2Q6VA 2VYNA 5FWDA 4E5KA 1KI7A 4GIBA 1NQAO 1YB4A 5M29A 4U7DA 3NRCA 3HVRA 4MDYA 4GMDA 2I2XB 3FG9A 4ZQIA 3E48A 5D2CA 4CMEA 1I33A 4M0DA 4P4SA 1QMPA 4KXQA 3IP8A 3OQJA 2W00A 3D0RA 1M66A 2PPLA 1KYIA 5KX5F 2JGDA 5COQA 1ADFA 1IOWA 3P9KA 4HF7A 3IBYA 4EY3A 2JVKA 1C50A 4JWKA 3WWCA 4X6LA 4YMHA 3L93A 4H4CA 3CRNA 5ALIA 1OWOA 3C98A 4AKEA 3AT1A 1R4AA 1ZC3A 2O7VA 1WV0A 3IX7A 2H4ZA 5DOZA 3AB8A 3RS5A 2JKZA 3LCRA 3TPZA 3M3PA 2B8WA 3GG2A 3VJKA 1H6BA 1WO8A 2HA5A 4RMHA 1NKTA 1QX3A 1YR9A 2WUWE 4P7JA 3BJZA 3W2EA 3WIVA 4AZ3B 3W5DA 3R09A 1N2EA 1P1HA 3GJZA 4BLTA 3VDMA 3PVZA 2I99A 2X15A 4KDFA 1PX0A 5F2EA 3PNLA 5JJCA 3SC4A 1ZCFA 2NAPA 5ES4B 4M0EA 5SY4A 1KR5A 1SQ5A 3OP1A 2LXNA 3IAEA 1UBMS 2G83A 2HXYA 4F93B 3NBFA 5THXA 1VRVA 4Y2QA 2X5OA 1IVSA 2ENWA 2NG1A 1J0DA 2DQYA 2VHYA 1A5AB 3EWNA 1GTZA 4GHWA 1YULA 1G9SA 2D0OB 4KU4A 2I4TA 2FZWA 4HJRA 4J0EA 1E9FA 1U5BA 3WADA 3ZD8A 2VQSA 4RVHA 1C4KA 2I4OA 1ONSA 1U28C 5FADA 5J4KA 3IL2A 2I3AA 3RNLA 5KNBA 2XV1A 4GXTA 3HXQA 4Z3OA 4CGZA 5G0WA 1YL7A 3M81A 2A5JA 2OV4A 1XP5A 3G79A 3FDZA 3TM5A 5D7BA 3ND8A 4J75A 1JBEA 1TRKA 1YL6A 1X1QA 1W5EA 1U3UA 2Q49A 4DYVA 3FNHA 3SHVA 4B82A 4K9PA 1ZDMA 2FPGB 2IYXA 1KJZA 4DNQA 2K2WA 5J1SB 1A9XA 3AXTA 4JGGA 2G77B 3BIXA 1SFRA 3OHSX 4YLGA 4Z8YA 5FL3A 2ABWA 1GD1O 2IYZA 3B7GA 1DQYA 1H05A 1I4WA 3PIRA 5EE3A 2HTEA 1HURA 3ROPA 4ARAA 3HJFA 1DOHA 1B8PA 1XVVA 4B6QA 3R3VA 4UW9A 3IUQA 3ZVNA 2CJFA 3L4SO 3FCXA 2R5NA 1T2AA 4JL8A 2PWAA 4BZZA 3PNOA 5GPBA 4EB6B 1IY2A 3HACA 5JYDA 3BSSA 1L5HA 2J9FA 4AM8A 3OLVA 2P4HX 3EXIB 5F4ZA 4RV5A 3OQOA 1ZXXA 1WE2A 3H9JA 1M0WA 3FSGD 3N2GB 3ONFA 4HMQA 1PE0A 2FG7C 4FFMA 3A6KA 4UEKA 2P0EA 3CFYA 5FOSA 4HDAA 1T9ZA 1RFLA 2TS1A 4ZZIA 4AO6A 2G5TA 3R0IA 4Q6BA 1KMMA 5BN5B 3QF4B 3TE7A 3OEHA 3OTQA 2QR5A 2QOEA 1MPTA 3BB4A 2P5TB 5A62A 4HH3C 5BQPA 4BFLA 5GMOA 4Z7JA 1YBAA 3MYYA 4WXYB 4ZODA 1Z5VA 3RS8A 1AA9A 1YFLA 3KKPA 3Q72A 4HBZA 2VPQA 2WD9A 4CQNA 2OBLA 5JIBA 4OLAA 1C4WA 1SHKA 5DU2A 1ABEA 4JI1B 1H5UA 1RS0A 2C00A 4TMWA 3R0VA 4HLUC 5BXQC 1J7KA 4CEJA 4H7HA 1GVHA 2ZRPA 3AQ4A 3M4XA 1XDDA 1JHXA 3BH0A 3C1OA 5C1IA 3W5UA 4BNWA 2OG2A 2QX4A 4OP1A 3MJVA 1I7LA 1ZBQA 3QKWA 5ALWA 3L4EA 1TYZA 1YOVA 3K5HA 5TR9A 1KEPA 3UWOA 1NZDA 2GEDA 1PT5A 4OGGA 4KQXA 4V02A 5ESXA 1FDIA 4BUCA 2I03A 1AHIA 5JH7A 3AGPA 1JAZA 3QFCA 3IQIX 4HQKA 4X84A 3K0AA 1SBTA 1WDTA 4K05A 3PJRA 2CMHA 4PICA 4V1CI 1PEDA 1SWWA 2QL5A 4BECA 3GZJA 2OV2A 2XPCA 5E9JA 5KCMA 1XTTA 5BR7A 1OMOA 1TKBA 3NOXA 4DLNA 1R8SA 1CJBA 3AZOA 3IJPA 1ZL0A 4XWGA 5B6JA 2WIJA 3B5JA 4ND4A 4CIAA 1W1UA 4BNZA 6PFKA 3MRTA 2SKEA 2PX6A 1E8MA 4Q4AB 4Z51A 5IKXA 3SZLA 2IBMA 4MS1A 2HBYA 4GZ3A 1BN6A 1H5QA 4ZMSA 5CFOA 3K5WA 2C2BA 4D9FA 4G86A 1TA4A 1M6NA 5KHOC 1PS8A 4K9KA 3NU1A 4OBBA 2E1RA 4URHA 1KKUA 5DNVA 4TRJA 1RP1A 3UJAA 3LC2O 4G0OA 5GJWC 2BUBA 1CZKA 1E1YA 3A6FA 3V1NA 2NTJA 2O0MA 3DDCA 3DC2A 3LYAA 3P2KA 5T6MA 3AUFA 2J4FA 3ZQ4A 3EA5A 1C9MA 2XXAA 1GU0A 1SCNE 1V9LA 1UBHS 1R4MB 5AFSA 1ZS9A 2O3JA 3VVMA 3P2EA 1Q0PA 4LE2A 3B9QA 1AK2A 1KQ3A 3EVFA 2FOIA 4TGLA 3QEJA 2PD4A 2IYUA 4CCAA 5CT9A 2B1IA 2IZ1A 3Q9SA 1F5NA 4RXUA 4FWTA 1ZX1A 4TZKA 3B13B 4I8DA 5J5CA 4HFJA 1U7HA 5ENZA 5K99A 3G8DA 4GX1A 121PA 2R2GA 4DG8A 2OCAA 2XKKA 1BYUA 2OZLB 1DO2A 4D45A 5L53A 2H7VA 2IHBA 3WFIA 2DQZA 1RC1A 2BFCB 4M8IA 3G13A 2V03A 4I8IA 1WL8A 4OIFA 1WDKA 5IT5A 1ZC4A 5FI5A 4DN6A 3DO6A 4J3FA 4GWLA 4ZT6A 4BYGA 1K6MA 4N65A 1JR4A 2DP4E 1IM2A 3FPAA 2VJBA 4B09A 5K0FA 1BCSB 1W4BA 5U9CA 1RWWA 4GLFA 1YFKA 1GFIA 2WYWA 3ILYA 5T8KA 2MINA 1Y3BE 4XOIA 3NH9A 5JS2A 1JB1A 1O6BA 1OIVA 3G02A 3N28A 5CVUA 5JCXA 2ADOA 2B2CA 2GO7A 4G5RA 4PC3A 4LRTB 5EXEA 1ZNZA 1OT5A 2FX5A 1DQNA 3DV9A 3EVZA 2A14A 3T4UA 1NW7A 1M1NB 1P0MA 1ADBA 1WHTB 2GKGA 2IEAA 3JYQA 1YONA 4NDZA 5C37A 5ETJA 1L5LA 1IHOA 2Y0DA 3I8XA 3SJ7A 4JEIA 3VNUA 1UMKA 4P81A 1LF0A 2BFDB 2CUZA 2ZWIA 5LUBA 4F21A 4OF4A 2LP4Y 1HYHA 2VK4A 3QF7A 1UBLS 4GR9A 1RTTA 4LX0A 4IX9A 4D1YA 3BIOA 1BQEA 1RACA 2WI8A 3JTMA 1BDBA 2AQKA 2P0YA 2PE5A 3L8GA 4PY2A 4DQXA 2QRHA 2ZRBA 3MSXA 1F0NA 3WGIA 3EC7A 1UKVY 3RC2A 3HPQA 3PJFA 4DXAA 3OZVA 1KRWA 2Q3HA 2C3UA 1C80A 1HETA 4IXMA 2WIFA 5E2IA 4N7JA 1U7WA 2QQGA 5JJBA 1KAHA 3TSZA 4PBRA 3EFEA 5AJTA 3D4NA 4Z8XA 2BM0A 5ITZB 2CHGA 3DW3X 5D00A 3E1KA 1KVSA 3C6QA 3CR8A 1QKIA 5KJCA 1DE0A 2DLCX 4EMBA 3OU7A 2JJ2D 2P9CA 3RFUA 1GZ3A 2KE5A 4R2LA 5IBPA 4EPTA 1G5IA 4L9RA 1ISJA 3KZVA 5JZOA 2BMAA 1YS1X 4NJMB 1YZQA 3B6JA 3MJDA 3O3NB 3BXEA 1XEAA 3W34A 2DFKB 4PEVA 4P58A 5HIKA 1PR4A 3DVAB 3PJDA 3GZNB 4KW7A 2OR3A 3BBPA 1PTJA 2XXBA 2EAUA 3KRTA 4WCDA 3IMCA 5BUSA 2V58A 5DNUA 5DCUA 5K05A 2J3MA 3LXRA 4P0QB 4LHEA 3KV1A 3O5AA 4CLXA 3VXKA 1T35A 4EJSC 1UPBA 2ZUSA 4G1VA 4BNJA 1SBYA 3TKYA 3RC8A 3LSTA 3IH5A 2AUTA 2YWFA 2X8AA 3MM4A 4NABA 4AXXA 2IIPA 4DCTA 3GVCA 1SCAA 4MRAA 4H60A 3UPUA 5H3LA 4HDNA 2JHCA 1FMTA 3D43A 1ZL2A 1Y5RA 3PXDA 4Q3BA 1SCKA 2NU8B 3SBOA 1MNAA 4S12A 1Y7TA 3QX9A 5DGTA 2A3RA 4JYCA 1ZD8A 2AS0A 2EGUA 1S1MA 5EHIA 4E14A 3NYWA 5IJ0B 5KVVA 3H4VA 1EUDB 4MQMA 2H4FA 4B5KA 3K2BA 1BS9A 4KODA 5ESDA 2P91A 2YWEA 3RGWS 4CDMA 3KQKA 4HWRA 1DAKA 1AUPA 4NG5A 2FLWA 2WHQA 4TPKA 3CX7A 3KR0A 2XUDA 4ALJA 3ZDCA 3PI7A 1MQ8B 2VUUA 4UAJA 5L3QA 4RLFA 2CT8A 1MENA 3LPAA 3NUGA 1OAOA 4P9NA 1VPEA 5IKOA 4D9KA 2WF7A 1VFNA 5ILGA 4UXHA 5A5VA 4RY0A 5JQGB 1PFUA 4PLTA 5ADHA 2IS2A 1H22A 2UXBB 3U4MA 1SMKA 1ABBA 4IEIA 4PS1A 5FORA 1UMCB 1WW3A 1COWD 3AERA 3CBQA 2ECFA 3DLIA 4NOLA 4PNEA 3LLSA 4JYAB 1ESZA 2BJHA 4ROTA 3KYIB 3PCTA 4MQ5A 2LTAA 3NHLA 4UQPA 4KZKA 3BDVA 1U8XX 1JT2A 3D02A 4YJ2B 1Z5UA 3TN7A 3AEUA 3ZHQA 4CVNA 4OP3A 4CKCA 3AF6A 3V8RA 2A9FA 2HY7A 4NSNA 3H6GA 2X22A 3H4MA 2CVZA 3H8JA 4JOCA 5E6SA 3OM0A 3DM5A 2Q7XA 4MDEA 2B35A 1E99A 4P5EA 3BZUA 1X77A 4JOBA 4R3WA 4LSZA 5LD2C 2JJMA 3COYA 2ACKA 2PUHA 4G8DA 4RWZA 5FIUA 2A2ZA 3DFIA 1J70A 1MJNA 1PNVA 1UEJA 3QBJA 4ONEA 4DBLE 3QPDA 4NBUA 1Y1RA 4K2AA 5CITA 4LJ4A 4WZAB 3SDBA 1E3WB 2JNWA 3F96A 2H1VA 2ZVDA 3WX0A 3ZGVA 5CCXA 1GZ7A 3GK3A 1H3NA 1TJ4A 4D0LB 4PFQA 3K0CA 4FDAA 1P5ZB 3WFJA 1FCJA 1ZN2A 2VDOB 2BGUA 3TOXA 3W9BA 3EPPA 2VYVD 4C01A 3NEJA 2QRQA 4KV7A 2FCAA 3TZLA 4ZO9A 2QQEA 3P9QA 2AVNA 1Q0UA 3IAHA 1L4UA 2ZRGA 3GELA 4JJ7A 1HH4A 1U81A 2FGKA 3AL0C 2ENUA 4I1VA 1Q50A 3TL3A 2XZPA 4JKOA 1JPUA 1O9HA 4TX1A 3RK1A 4JBIA 4BTVA 1BVUA 1FTGA 9LDBA 8ABPA 1XZIA 2EJVA 1X8KA 3KD2A 4P36A 1N9GA 3VZPA 4EBBA 1AO0A 2VJYA 5AJVB 2VTBA 1Z34A 1DUVG 2FE1A 3OC6A 3NXSA 4KPGA 3WKEA 1VOTA 5KYGA 4H1HA 5GIPE 1AXRA 4B1FA 3PENA 1ECCA 4PGGA 2CK3D 2EP7A 3MWEB 1RXSA 2JCGA 1ND5A 1V7ZA 3OU6A 5G1PA 3VU9B 3MLBA 4ZPXA 3UVEA 1C7ZA 1PHRA 3LDGA 3VYUB 3PHHA 4WEQA 5I6DA 1RABA 1N77A 4LKRA 1ES9A 2NOAA 1O4WA 1JG2A 1YZGA 2IOYA 2FRDC 2POCA 3F2VA 4NZ9A 4RW0A 4U8HA 1JHDA 4IIFA 4Y0NA 5HMLA 1X80B 3V8MA 1EQUA 1WW8A 3RBAA 4NKRA 2OOSA 1W6UA 3V34A 1MRSA 4GZ5A 1OPRA 1H42A 4PIPA 3VU9A 1TEHA 4S1PA 1NQWA 3B6MA 3AHGA 1U0RA 3REGA 3UG6A 1NVFA 3NMUF 1Z5WA 3H3JA 1ECPA 1S4QA 3CEAA 3DO8A 4GRDA 2XB4A 2F67A 4KQJA 2RH4A 2V6FA 4RNDB 4R6WA 1E3JA 1L5MA 1Z6YA 2G08A 1FY2A 3FOAA 5SZKB 1EFRD 3UNXA 2CLFB 4DC9A 4TV9B 4OYHA 4TYPA 4U2KA 3SQXA 4GMHA 2WV7A 1CP2A 1WBBA 1I6WA 1FTNA 2H18A 1XXHA 3PDJA 1YQGA 4X90A 3WLLA 1O8CA 2HLPA 3UK6A 1XMPA 1PJ3A 2XTZA 1GUBA 3IUJA 1BAPA 1QUEA 2FMFA 3N7TA 1RQXA 1TL7C 4WASA 1XNQB 2GUGA 2WYHA 1WP9A 2CSUA 1WCXA 1PDOA 2WUEA 2E4UA 4HR7A 5CXSA 1NVBA 4F56A 3HGTA 4P3YA 4DJJA 1C7EA 4BX9A 1DL5A 2FSIA 2ZRLA 3EHEA 1V1MB 2B92A 3WMGA 3USZA 2WQ6A 1YQWA 4REOA 3OX1A 1ZSYA 5IANA 2R84A 4EFLA 1F6DA 1XA0A 3DP9A 2YQZA 1G6Q1 1MAAA 1FRZA 1F0PA 3OIFA 2OCDA 2R68A 4H0FA 1NJ1A 3QUTA 3K0SA 5IMBA 1I2AA 5FWYB 3GP3A 2FR8A 3THXB 3D3KA 1ZNQO 5IM4F 4O8ZA 1EINA 4RLQA 3QEMA 1ZD3A 1YRBA 3GMDA 2FP4B 1KS2A 2Y66A 1AM4D 4UM9B 1UZAA 4IOLA 3U62A 1XLWA 2BBTA 1NQUA 5DW0A 2ACEA 4Q3EA 3SZOA 1OW3B 1UL1X 4MRPA 3OMLA 5CT5A 1NUHA 2VQFB 4P86A 5LFAA 5KQPA 3OFJA 2VWPA 1XMJA 2B8TA 4NBVA 5FFMA 3WMRA 1SR8A 1ZQ9A 4KWIA 4RK7A 4DQUA 2DH5A 4X91A 2OHVA 1L5HB 3K9BA 4TN1A 2YXDA 4FM9A 4LCEA 2V7GA 2VSFA 2XWPA 3ZIUA 3VH1A 3E05A 1KP3A 1MJGM 1PWHA 1QG2A 4ND8B 2IFTA 1E0AA 2Q5HA 5CM8B 4G5QA 1SUEA 3FAKA 1D6MA 2XE4A 4X8HA 1RD4A 4Y1GA 2X1MA 2W6NA 3RS3A 1ISRA 4DV6B 3QKRB 2YCBA 1G3UA 3RHZA 3ZY4A 3IP1A 1PK7A 4XVCA 3CY6A 3WGLA 4XDYA 4BX8A 2BGTA 3CH6A 3DCYA 2OXTA 2MR5A 3TGLA 1UBOS 2GA8A 2XOKA 3H3XA 3NHSA 5CLQA 4GRAA 2MSNA 1YQQA 4LC9A 5H82A 3V4RA 4KXFB 5ECDA 4GVXA 3UBMA 4YXWD 2E5WA 3I9MA 5TC4A 3A4TA 3F7TA 3WISA 2CVOA 4BB5A 3FCEA 4FGUA 4ZZ0A 2F1IA 1NBIA 3A9TA 2Q3LA 5KYKA 4O2LA 5HOEA 1P75A 5J1TB 2JLYA 4RZQA 3DDNA 1U04A 4MXDA 2OYCA 4OLJA 4FKBA 4L02A 3DZKA 5DN9A 2A86A 3IIJA 1D09A 5FA6A 1QQTA 1SEPA 2QSZA 4GLBA 4ZOCA 3IDSA 2VA8A 3IKLA 3PGXA 3FB4A 4IVQA 4AMUA 3CVXA 5DHQA 3WL8A 3JY6A 2F62A 2VHUA 1WUTA 1W48A 1D1TA 2R6JA 3WP0A 1FMJA 1F2UB 2Z1MA 5HCNA 1CR4A 2RH5A 3KZXA 3OZBA 1SKYB 4ISCA 2AF3C 4NTZA 1PYOA 1RQRA 2AYYA 3BRQA 3I1YA 3LT5A 3QXHA 4ISBA 4NCKA 4P4LA 4TXLA 5JRDS 5LR6A 4N47A 5JU6A 2C0CA 3HJGA 3UB3A 4KUEA 1P4RA 5C31A 1KDPA 1I3LA 2GPAA 3LRTA 4BEWA 1QGOA 1B2RA 2B2XA 4OQXA 2XXJA 4GSYA 2M9MA 3PC3A 3FHJA 3JQ8A 2AMVA 3UUFA 1O0CA 1OWNA 2JEZA 2ZSFA 4CIXA 1L8XA 1NVVR 1C30A 2P5YA 2QVLA 3BMXA 4QXOA 3VH3A 1MZPA 2HDWA 4NYMQ 3H8SA 5G3YA 4FR2A 1R4MA 2JIMA 4Y1RB 4FFBB 2IVFA 4J94A 5K3AA 3SIPA 3UV6A 4X20A 4UBNA 2C4UA 5HHTA 2Y3IA 4MWSA 3JAWB 4Q82A 3CB4A 1H2XA 3HDQA 4Q9IA 5F4BA 5FBKA 3WSTA 4LJLA 4DYHA 2JIZA 1TE2A 1X92A 4MR9A 1CP3A 3MBOA 1TYEB 1WTCA 4LF7B 1EWVA 5ELLA 3B1ZA 1H2FA 3GVHA 3KZOA 5F2OA 2WU8A 4NC9A 3D8NA 3NJ4A 1UFKA 2PT7A 3RUDA 3ZXSA 4XWWA 4CEHA 1UPTA 2IV2X 1QU2A 3T9DA 1F06A 4LHYA 1A5BB 2CLSA 2QZZA 2JC3A 5AXAA 5AM2A 2P67A 3BWMA 1HO3A 3STYA 3HDVA 1J23A 1P5FA 5BOVA 1FTYA 1Y1LA 4P98A 2O48X 2Q3JA 3CEJA 3SC2A 1CLUA 1HT2E 4Z9XA 3N2NA 5AVVA 4MS3A 3D3QA 1J97A 5CXXA 4J16A 3ZBUA 5K3FB 2A9KA 2UZIR 3Q9LA 4PGHA 4YT4A 2UU9B 5A7FA 5EE5B 3MWYW 2C07A 3KYJB 3MJFA 2P3OA 2FZLA 3TINA 4J1TC 4I9NA 2PRSA 3DV0A 5HSGA 2O6LA 1WVMA 3KAJA 3LV8A 2AYXA 1XP8A 2VWHA 3V1LA 4D8YA 3UHAA 3OWXA 1T1JA 3RTEA 2PUDA 1XCGB 3VUFA 4GPAA 3F9CA 2WZCA 2DM6A 4G9BA 3GIWA 4CM4B 1NAIA 1VL2A 1GL9B 3D6TB 3DXYA 5TLSA 3HV2A 3WJAA 1T5OA 1FDOA 1L7EA 3ZCTA 4DGQA 4R2KA 3GN1A 1NI4A 3RDPA 2UUAB 1LEHA 1SKYE 1PZXA 3JQBA 4OJKA 1HRKA 4TWBA 4F4JA 1T9HA 1UZUA 3FWYA 1NUAA 4L16A 3HO6A 3NYQA 4LY3A 5BW5A 3L6DA 3DOHA 3D0KA 4P92A 3LY8A 5D85A 3DMPA 3FPGA 5TT0A 1JHVA 2NV0A 3A6JA 1T5DX 4LXHA 3RVQA 3GBPA 3A70A 5J2TB 4D9IA 5IH7A 2I80A 4F8JA 3BMCB 1SJ9A 4ZAVA 2CNDA 3H4TA 2PD3A 3GXOA 4MIKA 3T5BA 1WZIA 2Y0EA 4JR1A 3ORRA 4LTDA 4R1TA 2QT0A 4RFLA 1K0UA 3I2KA 3PXUA 3EPRA 5FYQA 3CLHA 3DM9B 2PSEA 4GG1A 4HQFA 1PG2A 1SUPA 2XMQA 4Q16A 3LDHA 2PGAA 3GRVA 2AYZA 3G2NA 3P9CA 1SVWA 2J33A 4QDJA 4TKLA 3S70A 2FSPA 1DG1G 5LXTA 3FTNA 3K9FC 2HHJA 2GLXA 4M1QA 4DNOA 1KPHA 1TCUA 4K9SA 3RM3A 2ORVA 1K7XB 4JSYA 3ED1A 4FYVA 5ULLA 4YAIA 1UFVA 1NXQA 2CLKB 3UG7A 3NWOA 2E3JA 4P6VF 4EPVA 2ZM6B 1YR2A 4MGKR 3DWEX 4MQBA 5BV0A 3IUEA 1A9OA 3PYMA 1VHLA 1VPWA 4E07A 4DRZA 1ZA1A 1JG6A 4KGXA 4MVJP 4FFOA 4QGBA 5FT9A 5A9SA 2WSSA 1BHSA 1XJ5A 5BMVF 4Q1BA 3AZPA 5TJHA 2GT1A 3ISJA 5HR5A 2VSOA 4XR9A 4FFNA 9LDTA 3ZHTA 2X9LA 1CQIA 4RIEA 1SG0A 2QX8A 4DDVA 3LP6A 1OH6A 1NHGA 3NANA 3OVMA 1YB5A 1N1GA 2FAXA 4XSVA 1WKBA 2WUVA 4ZQFA 1FRNA 4O2AA 2RGAA 5FUYA 3O8OA 4M1MA 3ZHXA 1HFWA 3DG9A 4OQFA 5T4EA 1OD6A 4R8KA 3K9QO 3BCSA 5DHTA 4R2MA 3VNBA 1J07A 1QHHB 4WXMA 1OYOA 1Y4AE 2WAMA 2XDAA 5CEJA 3BPSA 5LA6B 2H54A 4YT2A 5TPWB 3RODA 4J91A 2EYQA 3TSWA 8OHMA 3AWIA 1X87A 1YK1A 2HJWA 5JNUA 1A8UA 1TUGA 3L6UA 3GWGA 4IGKA 2QRVA 3B6KA 1P7PA 3OZSA 3ZU3A 1AQIA 2Z58A 4XFJA 1VMIA 3AFIA 1LWNA 4WADA 5BSEA 3C6XA 1UZLA 2OFXA 5H70A 1JNXX 3K09C 5JASA 2HLHA 2FSSA 2PZLA 5ILQA 5KOJB 2XWQA 3DBLB 2CLDX 3UMBA 4DB4A 4I4CA 1DXYA 2EWWA 1Z15A 1A7KA 3OOHA 4YONB 1C41A 2HSGA 3SZRA 5ALSA 1RIFA 3SG0A 1A1VA 3HCOA 4ZRDA 1IN1A 5EI5A 4RKQA 3HLYA 1DCFA 1P80A 2C92A 2YOGA 3I2JA 1PSZA 4ITUA 1H3FA 4OFBA 2XMDA 3HCPA 4TXMA 4W1RA 4AJJA 2DLNA 1QOZA 1QP8A 1SUBA 3CZAA 3RYFB 4YB8A 5FB3A 1DG3A 1HDXA 4U0JA 4WKCA 5EIHA 1BHO1 3BGIA 1MG5A 2ONYA 2GCGA 3N5KA 1NULA 3I3SR 4MHSA 2RI6A 3V7NA 4BVAA 1HKUA 2NU7A 1H4QA 1SD1A 3L7OA 4D9MA 3EGDA 4LZAA 3FWKA 3NIDB 3VR2A 2BGWA 1X3LA 2OHGA 3MGKA 1EIZA 5KOHB 3NHAA 1CTQA 1D0IA 2RMKA 1L4BA 4G2TA 4JJFA 4WGFA 2P27A 1JU3A 1IB0A 2FN9A 4ZKEA 3U1VA 4W8OA 3TECE 1K89A 3NETA 4YPOA 8GPBA 3GT0A 2YIVX 1UADA 2J9ZB 4GMXA 4NS1A 1QIIA 1A5ZA 2P0AA 4IHAA 2PS1A 4JUFA 2XWJI 2B4RO 2R48A 3I4FA 4HPJB 4RCYA 2Y67A 4R8VA 4BLVA 3H2ZA 2HW8A 1H9AA 1KAOA 1V1MA 3B6EA 3F3SA 2NAFA 2H5EA 1T0PA 1C1XB 3CZRA 3L41A 4KPUB 3SBXA 2A4KA 1GKIA 4PANA 3M5DA 3DFFA 4DC0A 4YDQA 1I9CA 3PIDA 4NMMA 4Q3LA 1G5TA 1LX6A 5D3KA 1T3ZA 4MO2A 3Q0IA 4AZ3A 1N4DA 1YQTA 2FW1A 2Y1CA 2XKAA 4Y9RA 5CA0B 4C06A 1SU7A 1A04A 3TIVA 1JAXA 4GR5A 1TVEA 3AXSA 3LT0A 2GN0A 4QYWA 4ZVQA 1QAQA 3ANSA 4IF4A 3WB1A 5GV7A 2GMWA 1P1KA 1MC8A 4KFSA 4EMSA 4YHBA 3OY7A 4QGSA 1SM4A 2II6A 1KVQA 2XUGA 2QSUA 1V43A 4MI6A 2LE0A 3I2GA 3BDAA 3CEMA 1U0OC 3UIEA 1Y8QB 3JALB 4FFWA 4EECA 4F7WA 2WWYA 3TSCA 2YN0A 4JLSA 4MCAA 1BGXT 1J5EB 1TM2A 2A30A 2AXQA 5IEBA 2P9TA 1KJJA 1I5OA 2OXFA 1Q6YA 3BSWA 2V8OA 5GOTA 3RC9A 4J2TA 3I4LA 1MX3A 2PTHA 3P32A 3QLTA 1KE1A 3SX4A 2PHZA 2GZ3A 3ZZ1A 4F9FA 1W36B 1SC6A 2PKRA 1E2DA 1KYVA 1QCYA 4NS4A 4OGLA 5FTMA 1CQXA 1JEYA 5EJ7A 1PI3A 1Y8QA 2ZJ1A 5JLAA 3T3MB 4B43A 1ENOA 5EPOA 1USWA 2WWIA 1W49A 4ZK2A 2O3UA 4BJ1A 1RCUA 3EIEA 3OCJA 5EP1A 3EAQA 3HFJA 4H6VA 2QRNA 4UEQA 3TOVA 1GGFA 1I2MA 1MABA 2KPOA 2V4ZA 3O2SB 3SS9X 4B6SA 4B48A 3PLRA 4IQGA 1MXHA 1P72A 1V3UA 2WZBA 4FNAA 2O8FB 2CFIA 1XNJA 4LE0A 4MQ6A 3D3EA 3ZZUA 3UK2A 2VQDA 1OBFO 2AG1A 2GCOA 3S0JA 1ZCAA 4YJGB 5K0SA 2ODAA 2QDXA 5DYTA 2EC5A 3F6SA 4LG1A 2PNJA 3U0VA 1JLRA 4BMXA 4KG7A 1I4LD 4Y2TA 4OCZA 1IUNA 2Y71A 4KIGA 1IAQA 1AQUA 1VECA 3DUWA 1U2PA 1OQAA 3D4PA 3K15A 5FUQA 3WB0A 1WMAA 3KYDB 3R0ZA 5EEHA 3RSFA 1S96A 4CU5A 1RHKA 2Q4RA 3L0DA 1QYXA 3P4UA 5CT8A 4V0OA 2EFDB 3IE0A 3LY9A 5FA8A 1XZEA 2XH8A 3AW8A 1MZVA 4PINA 2NPIA 2WPDD 3NBYC 4M0LA 3BTVA 4L8GA 4UXJA 5ALFA 4BTEA 5EE0A 1GPYA 3G0GA 1U3VA 3LX4A 4WACA 5H83A 1L1EA 1ZH4A 4C88A 3WL4A 1P0QA 2EGGA 4PBTA 1QFYA 4ACBA 3EDMA 1W0CA 5IZCC 3SSAA 1KDZA 2G9VA 3FYHA 3VR0A 4E51A 4EWLA 1SPXA 1RYNA 2I2BA 4DUZB 3DDZX 2WTNA 3N7AA 3FYDA 4NZPA 2IPLA 2OA0A 2YNMA 4GGMX 1OB2A 3BSYA 1FUKA 3NR2A 4YMIA 3HCNA 3RRJA 2ZPTX 2X19A 4AY2A 1Y33E 4J03A 1Q15A 1VE3A 3NP7A 2H16A 5F7JA 3MBKA 2HO4A 3UYLA 1ADCA 3CUUA 4RV4A 3I6QA 3VZDA 1GTSA 4Q37A 3WV5A 4Q21A 2I3GA 5IYZA 4JC8A 4FNOA 4U6QA 1H8HA 4YJGA 1HNZB 3UV7A 1GYPA 3EQ9A 4E5UA 2P4SA 2HPHA 3HBMA 1XLTC 4F5ZA 1M1YB 4GOXA 4B17A 4S0ZA 1WZCA 1PUIA 3QM1A 4Q01A 3UXYA 5KI6A 1ICIA 5LZ9A 2X0RA 4XTCS 2H7XA 2C7PA 2DBRA 3IPXA 2BV3A 2IPXA 3HY4A 2DWUA 4Y6LA 4NLLA 5DM0A 4QXQA 3L8MA 4MEBA 4Q4HB 2OK8A 4FIDA 2QF7A 4KKXB 3TWOA 3GEDA 1F6BA 4BQRA 4XWOA 3ADOA 1AHNA 1FJXA 2P9FA 3PHGA 5EZQA 4EHIA 3SFVA 4OREX 1YIDA 3PSAA 1OAAA 1HYGA 3NHJA 2V96A 3OM9A 4J0JA 3W2IA 2PFGA 4ICIA 2DPMA 5K3DA 1R9GA 3DB2A 2NU9A 4WY8A 4XM0A 2LNDA 3D8RA 3LH5A 4FC6A 4XXHA 5J2TA 1BG6A 1HQCA 3AF4A 1E2UA 3L4BC 4HNSA 4ZWNA 4DMUB 4HGOA 5KZMB 3CNOA 2GB4A 2GWHA 3KYCA 3VKWA 3VR3D 2EKBA 2UXCB 5K6TA 1F3LA 4ZZ1A 4UDNA 2CYCA 1LPOA 4Q4DA 1S8FA 1NVAA 2BT4A 3H9QA 4KLNA 4EA6A 5FPKA 3ZG6A 4ZPJA 4F2DA 5I9NA 1G8YA 2ATXA 2PKCA 2ZTUA 1ENZA 1TD9A 4Q48A 4Z0TA 1WVGA 3WIBA 3DBHB 3EYAA 3GJ5A 4MQEB 3BMQA 3O2QB 1DTWB 2W2LA 2PRZA 3K7EA 3X2FA 4AK9A 1DAMA 2ONKA 3O1JC 1K08A 2YJZA 4RA6A 1NT4A 3K0FA 5FPHA 1LGYA 3NNSA 4Y8VA 4QKQA 2XTMA 3PHJA 4Y18A 3RT7A 1BMFA 1IZ7A 4AG3A 1KAEA 3DXFA 4TTPA 3DL4A 4UTRA 2AN5A 3HCDA 1NR7A 3IBTA 4GLJA 3AMVA 3EOZA 2D13A 3OICA 4MB2A 2G04A 3CR7A 4IMJB 4UCXA 2GK3A 2RGWA 1Y8RA 3K4QA 4PV7A 1LJ8A 1F48A 3C43A 3KLNA 1S3IA 1TA9A 1A4IA 2DE0X 2AFHA 2PSJA 3W90A 1CJUC 4YN3A 4I81A 5ALRA 4DCPA 1GCUA 4RTLA 5CXUA 4MJXA 1NQXA 2PLRA 2VYQA 3PV0A 3U6KA 2ZUFA 5BUZA 2XBLA 1GTG1 4IIEA 4QOFA 1AN9A 4MPTA 1TT5A 1SOMA 3VSEA 1M2JA 1VB5A 1L5ZA 2C4MA 4DSZA 5K0EA 1NA5A 1G7SA 3JX9A 2AQHA 2G3YA 1OX4B 4CXMA 2DT8A 1ZKDA 2OZPA 3LCCA 5D5HA 1KJ9A 1Z63A 1XJCA 1E5VA 3PWTA 1IBRA 2BEKA 2B9EA 2GBPA 2OBNA 3HGMA 5HBRA 3P9YA 2B4AA 4G63A 2VUIB 4MUGA 1E2EA 3BXOA 4ZVLA 3TPCA 3UOAB 1PJ2A 1GQRA 2AK3A 3CRMA 1E2FA 5HM8A 5EOVA 2IV3A 4NNOA 1CR6A 2YWCA 5ALZA 3K0KA 3P5BA 3IB6A 3JS5A 2HFKA 4JDUA 1KQGA 4RVUA 4BATA 3S1LA 5IBRA 1P45A 2JFGA 3K9LA 4FEAA 3RYCB 2XNJA 1VBFA 1WOYA 2IOFK 4KO8A 1E7RA 4A3SA 4AS2A 4B32A 3C1AA 3QIVA 4INOA 2ZATA 2AFIB 2I2AA 5EINA 3VPAA 4DLZA 2YY6A 2BMEA 5C4IA 4M1TA 3ZOKA 3K73O 3DDSA 4A03A 4YIHA 1CULC 2QPAA 2ZJ5A 2ODPA 3CN9A 2VPIA 1P2UA 3C3KA 3TYXA 3PQFA 4CW7A 4C0AC 3QSYA 3KDSE 4K9LA 3SLRA 4C7OA 2ZRQA 4MAMA 4F04A 2QVBA 3ROMA 3PYLA 2XGJA 3JQGA 1Y82A 2P40A 3QVXA 4RMNA 1DDOA 4D96A 2FEAA 5TDHA 3VAAA 4ZZ3A 1KO8A 1D6SA 5T64A 4Q47A 4XDZA 4A1OA 1TAUA 4XGRA 4US2R 3AETB 2JIBA 3QPAA 1ZUNA 1X7YB 1F12A 1FS5A 5DNYB 1MQAA 1ARZA 4A36A 1KYZA 4G0QA 1EX9A 3R75A 2CHUA 4TKUB 5EKTA 2NIPA 4ZKDA 4LJSA 3MQFA 4YFVA 1BA3A 3CNEA 1CDOA 3S3TA 4ZYUA 2OP1A 4O2AB 3P20A 5T41A 3UKDA 1FXSA 4NV0A 4BNDA 2Q2VA 4LHWA 2XBMA 3UWSA 3H6KA 5KPJA 1KQPA 3L4JA 2BDUA 1P2VA 2HSDA 2UXDB 3S2EA 1OROA 2QMHA 5TQVA 1ESNA 1KMQA 1UP4A 3QE3A 3Q3EA 1PIWA 5J2UF 2M6LA 4KH0A 3WLSA 4HDNB 2XOEA 2A5GA 1Z33A 2XF2A 3FA2A 3Q2OA 3ZWOA 3ZHOA 4CTMA 4EKYA 1MB2A 4Q39A 2FMHA 5I48A 1Y1QA 4RDIA 1ACLA 4IHJB 1SVNA 1XZLA 1MXFA 1OA1A 2G1AA 1AZSC 4PRKA 4L9AA 2H2AA 4DQLA 1XPUA 2CVPA 5AUPB 5DNAA 3S1AB 3TXXA 2YZNA 2ODBA 1II8A 3RASA 3N0WA 4P32A 4M0KA 1YCHA 4MPRA 2IYNA 4RKYA 4WDQA 5JEDA 2GBIA 4RTNA 1QVZA 3LKBA 4NONA 3ZHVA 1W47A 5FBHA 3BZBA 4CKEA 4AZ0B 5KQMA 3UMYA 3CBGA 1MC1A 3AF1A 3DAOA 1H6AA 1VSBA 3FDJA 4LHZA 1GPMA 2GRUA 1HYEA 2XUZA 2Z2YA 5D3MA 5FBQB 1C9JA 3Q9NA 4KXXA 3UMJA 4DA4A 2HYDA 1SHZA 1QR2A 3HXLA 3WWOA 3ZWBA 4CFYA 3CONA 3O38A 2JA2A 1SNYA 1P9WA 4EI7A 3GA0A 3ZGYA 3T1YB 3IODA 1WG8A 3QOFA 3PE3A 5UKDA 1NYLA 2YWRA 4RTQA 3FGZA 5CDSA 2PUGA 2W6ID 3Q2IA 4EQ6A 4IXTA 2OGTA 3O92A 3S2FA 2HDOA 2BEWA 4UNQA 5D3MB 1TC1A 2VS1A 4WK0B 3BGOS 3I09A 4GOKA 3JAWA 4CHGA 3KJQA 4X85A 2QT1A 1S1CA 3NQ41 4MW4A 4KXUA 4Q00A 3UV3A 5ER9A 4ERNA 4TWIA 5TQ0A 5IARA 3H1TA 1V6CA 2H11A 3TW0A 4J0IA 5DASA 2Q0QA 4E21A 4GW3A 1RYDA 2W6QA 3PC2A 1RPJA 1XEWX 1Z5ZA 4GC9A 4KO4S 4B3MB 3NHBA 4BJ6A 1JLLB 1GG2A 2C9DA 4N0QA 2QMZA 1Q0TA 3ORYA 4JUCA 3G7SA 3HEBA 4ON9A 5LC1A 2ATIA 4RKWA 3TLCA 4C89A 1B3RA 2AZ4A 3O7WA 5K01A 3QVJA 1B7GO 4HPXB 4TM7A 4L6CA 4EBFA 3V46A 2YMPA 1H2BA 1RIIA 1GGKA 1CWUA 3WYCA 4ND6A 1HDOA 3B51X 1JIQA 3HFGA 1DC5A 1GRRA 3COVA 3NKLA 3ZJYA 1N5KA 5EP3A 5BYAA 4FYKA 1SKMA 4Z7OB 3KEFA 1VL1A 1WDWB 5JWRA 4KXNA 2MSCB 4IH9A 5EG5A 4KQMA 2RHOA 4RV9A 3R7NA 2E2WA 2M6SA 1GGHA 1UPFA 3SWWA 1IBCA 1JAYA 1GGEA 1TIKA 2JGDB 2XUHA 1B8OA 1E0SA 1B6SA 2HQSA 2Q3CA 3E6AA 1T9BA 3R44A 5L8VA 1TZ2A 2P35A 2GPTA 2HCTA 1LNQA 4QUDA 3WHLA 5I3CA 4NYIQ 1AA6A 3WJ1A 4UUMA 3X1MA 3MEQA 3O3OB 1T91A 3IQEA 3HYRA 1WR8A 3C3DA 1BX3A 4BB9A 4FOPA 5GVRA 1XZMA 3VHLB 4RVOA 4P3NA 4MI9A 4XCXA 2ZQZA 1FC0A 2Z1DA 4QUHA 4DBVO 3EW7A 2ZTMA 2DC1A 4XEUA 4CPDA 2D4AA 4S1TA 4QNMA 2WIGA 2Q6TA 4ZT7A 2YHBA 5CGQB 3C74A 1CF2O 3C3EA 3L92A 3LPLA 5EWLA 4ZDIA 5CCBA 2OFWA 2I6SA 1RQPA 4PYJA 4FIZA 5IS2A 3ASYA 2FGJA 1HPLA 4LRXA 3EBLA 5DMXA 2HYIC 2H1RA 3I92A 5IW8A 5AW9A 4XDGA 4QXRA 1F2VA 5SZJA 3X1XA 2W48A 2EARA 4JP5A 5CDGA 2QNIA 1FFGA 3CUVA 2JHFA 3ROXA 2UKDA 3GLHA 2JI6A 3H9BA 3HUDA 5SZHB 3N1UA 3DAHA 4WXEA 3UK7A 4IGEA 1DGQA 1GPJA 2DCUA 4MLPA 3JQCA 3SSNA 4D8XA 4DV2B 4KR2A 4W9MC 621PA 3BIJA 3OZRA 1T8TA 3ZLUA 4GWGA 4C4SA 1BO6A 2CJWA 5AOVA 5IC4A 3MWGA 1CRPA 2D5AA 3C16C 4K9MA 1GZHB 2WSBA 4BNVA 1EDBA 4XR4A 3V4SA 4RD2A 4BB6A 4DAEA 2PEZA 3BWVA 4DANA 3Q8KA 3LJKA 4RS4A 4NF2A 2ZANA 3RKRA 2H4YA 4BZXA 1TTPB 3NI2A 4AN0A 4OHOA 4L4SA 4RC9A 5F5LA 2Z2XA 4DMCA 1BXRB 2OHIA 1G7RA 2WTAA 2XTNA 1GAJA 4KBYA 4RK6A 4JYMA 4I3GA 4NFSA 3RJZA 3WLNA 3M6LA 3M2PA 1YZTA 3LX6A 4IIJF 2D8MA 1U6JA 2FSGA 3NHKA 2I78A 5G4KB 4DLXA 1L5VA 3INRA 1E4EB 1EX7A 1RXUA 4TXJA 4P2BA 1G63A 4YYZA 4KFTA 1I7SB 4RA6B 1UODA 1CX9B 1U7TA 4DSAA 1RI4A 3AHHA 4PSDA 3NATA 3AW9A 4MR7B 2EJWA 4M1YA 5HKKD 4DJ5X 3EG5A 1CU1A 1QGYA 1A2OA 2XHEA 5BNTA 1SAYA 3GLHE 4Y9DA 4MROA 1MB9A 1W36D 1ZHOA 5FPYA 1D7OA 2JI4A 1GQ2A 2C8KA 4H27A 3NTXA 3T5GA 4CLEA 5EJ9A 3MWDA 4LJ7A 3RT1A 5SYMA 2VK8A 4N03A 4F5WA 1THTA 2XQGA 1E79D 5LDDC 4FOLA 2O3RA 2OBYA 1LTKA 3GLIB 2D7DA 1FLDA 2G0NA 1Q0ZA 1TLLA 3HM2A 3HQ4O 4E2FA 2WICA 4FSHA 1V3VA 1RBMA 1UP7A 2PXAA 3U5ZB 3T9CA 1HE8B 2X14A 4IJVA 2YBEA 5LL6P 2MU1A 521PA 1OX5A 1OHHD 4BDTA 2D1RA 1FS4A 2WJ4A 4G0UA 3L1VA 1UDWA 2MMCA 1N6IA 3MRSA 5DN6D 3WLPA 4KQCA 4WTOA 3EE6A 3NKVA 3VO2A 1QH8B 4GEGA 3L49A 2OWEA 4CHTA 3G2QA 5BMOA 5DT9A 2PGJA 4DSOA 3KETA 1IH8A 2HTFA 1V2GA 4FDMA 2W4QA 3T4XA 1V47A 5I4IA 2RGYA 1XEXB 4S1OA 4TKZA 5LPNA 2R6FA 1VCMA 4ESHA 3PIIA 5IVHA 1E1NA 3QXJA 3KQVA 1HRDA 1B8UA 1YR6A 2Y0BA 1PJZA 3MCUA 3RC1A 3TE6A 3TNJA 2XMGA 1UH5A 4LV5B 3RHFA 2H2FA 3C3WA 4BJ5A 1RRCA 3DSRA 1GAQA 1NXOA 1UKCA 3LS2A 5KNCD 1N4AA 1ZI9A 4HY3A 2B34A 2I1WA 3AP2A 3UJ9A 1A27A 4YUWA 3DVSX 1TU3A 3E9CA 4H3SA 3SBDA 1HE2A 3EEYA 3AKDA 3VHRA 3CSDA 2VP0A 2OO5C 1MJ5A 3E3LA 4OHBA 2XUPA 1RWNA 4FEEA 4QTTB 4Q9JA 1GG5A 4I1RA 5HDQA 5HTKA 4AVYA 3RAFC 1HLFA 1PS9A 4EGFA 5JJLA 3EXG2 3F5FA 1QNLA 3VVBA 1I4EB 1QYRA 1EWTA 1G3IA 2HN9A 4LXUA 1ZLYA 4BVGA 1WV1A 5FTLA 1F14A 4DLTA 2OZLA 1XOIA 2GAAA 4M49A 1ZM7A 5JCPA 5JAUA 4U2GA 1BZYA 2IT1A 4PO8A 1NN0A 4UM5A 3AR9A 5KVSA 1YTLA 3NBZC 5EA2A 1GRQA 4TL8A 2H5IA 1JVSA 2YWGA 1JX6A 3KQYA 2NV6A 5K4AA 4ENQA 1C8BA 2ZRKA 3FRHA 2NW6A 2WKRA 5GINE 3CVWA 3STXA 4MUFA 4Z0HO 1H23A 2CMFA 2PPVA 3AU8A 4DKXA 5KJ6A 3F4KA 1RI2A 3QLUA 4LNUB 2GFIA 2JLBA 3BJIC 5D1HA 3VPXA 1MFPA 2X13A 2ZAGA 4BCBA 3DCNA 4PC1A 4B3HA 4E2XA 2HM7A 2ZIXB 3PEWA 1ZN7A 4PPNA 4WCFC 2Z57A 3MMXA 5C81A 1E62A 1OKKD 2TMYA 3IAS1 3R5FA 5CDFE 2AG5A 3CLKA 4I66A 2NTEA 1KMIY 3VKHA 2NUTB 5EHXA 2D1YA 1XCPA 4HAYA 3N3BC 4RF2A 3UC5A 4DQVA 2IQIA 1IHYA 1P0CA 2CNOA 2GHTA 2RCNA 3K4PA 4JAVC 4C20A 4YCJA 4HGZA 4EY6A 4JSRA 1S2IA 3D8SA 3AFMA 3CG4A 3EWAA 1GUFA 1KR2A 1MV8A 2JBAB 1T3LA 5CCDA 3RRZA 3T1OA 3Q7RA 5DYNA 5ALTA 1X1DA 1N7GA 4YBZA 1JHYA 5MN5A 3FZQA 2ZJBA 3ZXXA 2X2PA 5KMGB 1Q3HA 3EIHA 1K1EA 3UXHA 3EFBA 3TB6A 4MA5A 1PV2A 4XGNA 5C5EA 5BOSB 1RLUA 2X0IA 3ENZA 5ALEA 5I9BA 3QQPA 5JCZA 3FWPA 4MV7A 1P2BA 3NHYA 3OZFA 2FU5C 3AONB 4O29A 2XTAA 3LNTA 1RHUA 5TS3A 5LDHA 2R8YA 4Y2YA 1YR7A 2PL3A 1YR8A 3MGGA 2HJVA 4LXTA 1HYBA 4Q19A 4X97A 3UT5A 3BL5A 3L9XA 4Q4JB 2ZUTA 4PZDA 4QQ8A 2FN8A 1W5SA 2PMBA 4ZT5A 4YQFA 3SF8A 1FTWA 2G5CA 3DQZA 1CY7A 5F2NA 3LU1A 1ZI8A 2NU7B 1ESMA 3U3OA 4OM8A 4LYJA 5E8RA 1T43A 5ALVA 4JLAA 1IWOA 1Z82A 1XZQA 1BYIA 2KLHA 3I9OA 1VJ5A 4YUVA 2HBQA 2HHLA 2BMJA 3TLXA 5JEEA 1RYFA 3PFIA 4PIVA 5LSAA 1KXZA 1GV1A 2C57A 3H04A 1EWQA 2DFDA 4JC0A 3LLVA 2IGTA 5M7EA 3TQHA 1I36A 1DT3A 2AHRA 5JZSA 3R74A 1T13A 3CWZA 5JECA 3D3NA 2BOVA 2QYOA 1C81A 3GUYA 3ZWCA 4DHWA 3ZNPA 2OFOA 5SV2A 1TMGE 4E6PA 4G0PA 1V5GA 1E5LA 2FW7A 1ODLA 3GFGA 3E2PA 1Z2AA 1NPYA 2J3QA 3ONDA 4MW5A 3U7HB 3E5NA 1ZWLA 3RTCA 3QVVA 1EK0A 1FUUA 1FTQA 1RPNA 1H8ED 3FVTA 1OA0A 3IUNA 4KV9A 3KCNA 1GRVA 3JZFA 2WU4A 3GYBA 3LQFA 5BYJA 3TZBA 3NAZA 1PQUA 1ZMBA 3THWB 3VBEA 3WTCA 3U44A 3GFBA 1E3LA 1WM1A 3Q8LA 3ER6A 1DB3A 1GV0A 2HEIA 3CX3A 2OHXA 2O3QA 4DIBA 4EMTA 2GNOA 1ISIA 2PQMA 2WF5A 3QLEA 1TK9A 1YI8A 4DGSA 2ZJOA 3UW3A 1AKTA 4OB8A 2B94A 4I5IA 1C9DB 4HT3B 1PD0A 4LBYA 3TD2A 1SC3A 4CKYA 3GPLA 2BFAA 3GJXC 4TL6A 4KX3A 2Q1SA 1J25A 3U7RA 2NPFA 3K72B 1QP0A 2GM3A 3EVAA 5GONB 4F8YA 5FBWB 2NZJA 2IZ5A 2JARA 3G2OA 1UR5A 4WBNB 4JELA 2W2OA 2I6GA 5TF4A 3SYLA 1FUYB 1FP6A 5F76A 4NDAA 4YVFA 2E4VA 5EJFA 1O96B 1WXIA 5F9FA 5HDBB 3W7AA 1PYDA 3SHFA 1F6WA 3LI2A 1JI3A 1E3MA 2FPKA 3I9FA 1EUZA 3NC0C 2FFRA 1R0KA 3QHAA 1WJGA 1YNSA 1I32A 3S1AA 1Z36A 1UEXC 3ESZA 4HUQB 5KYTA 3AEXA 2PR2A 3QF4A 2FKAA 2XRYA 2YY5A 4TUYA 1RKVA 3SQNA 3G9XA 3VKUA 1SKAA 3ROKA 1RAAA 2BSAA 3GJQA 4Y1FA 5AMXA 5JPDA 1K97A 5K8JB 1K6EA 1XROA 4FI3C 4BGVA 2LD4A 2ODEA 3E8XA 3IHWA 3NTVA 2YYAA 5I7RA 1Q95A 4LE1A 1UBCA 5DYGA 2A5DA 2FNAA 3G49A 2BMWA 1N8NA 1OSNA 2WDPA 1N3LA 1CVIA 3HE3A 2LW7A 3KQMA 2E4XA 1LVHA 3NOQA 2ZUUA 4RGYA 3PU6A 721PA 3K6RA 3U49A 1IOZA 2VIIA 2YZGA 3T0FA 1XYGA 3OT5A 1TUEA 4OHFA 4QVKA 5AP9A 2OXCA 3DLPX 4P4SB 4L72A 1DNPA 4UBKA 1AKQA 4X1KA 5HIMA 3DJYA 3OPMA 5JNVA 4YRBA 2PD6A 2VNAA 1KBOA 1DT5A 1EI9A 3F9RA 3NNDA 4GBJA 4NENB 1UWLA 3C48A 4AZVA 3W1WA 4BVBA 1FBTA 1ZH2A 4PONA 4MMXB 5KYNA 2VHZA 3ANXA 3HJRA 4U3JB 3BL8A 4F8EA 1QRUA 1H2ZA 1L7BA 3KZNA 5IHPA 1CUUA 1AK9A 1T4BA 2CLOB 1N8SA 3CGWA 2VKQA 3ANLA 5IU6A 5LN1A 4CNQA 2XGGA 3D2BA 4UBOA 3DGEC 3A1VA 4QEDA 4CM6A 1GAEO 1H4TA 2AMLA 5BNZA 5EJAA 3V2HA 1NRJB 1PFGA 3I83A 3QNWA 4C1BA 3PUIA 4JB8A 4RX1A 2ONJA 2EU8A 2JJ1D 4FUQA 4ZC8A 3VZBA 1FP7A 4D02A 1ZIOA 1G0OA 4LNAA 1EP2B 4BMCA 1EGQA 4G56A 5B1HA 1YNOA 3KXIA 4OLFA 1LPNA 1O6CA 3RV3A 3S40A 3LRPA 2INGX 1BWPA 1PRYA 2LBPA 1GO2A 4X1IA 3TFWA 2P78A 2ZJ3A 1FLVA 4LJYA 3T1NA 2ZZMA 4LXIA 2IPNA 3VR4H 1KDYA 3FOWA 2HPVA 2WJ6A 1RT9A 3DQQA 3SQOA 5IULC 2KBEA 3A14A 3WLQA 1C9NA 5KREA 3E9DA 1WTAA 1TM1E 4URYR 1N2OA 2C9CA 4GOND 2BYTA 4G0WA 1AH2A 1CRQA 3DE3X 5EHGA 3LBNA 1NE2A 3R24A 4I1IA 2QTBA 1XHFA 2P8JA 3BWBA 3GF4A 5JDCC 4MVJI 5ITSA 4YR9A 5HG0A 1LBQA 1U90A 2X3UA 1G8GA 1L7XA 3B20A 3EVBA 1TTHA 4J7UA 3Q88A 5BY2A 1YVRA 4L4XA 2RIRA 1A9ZA 3ESDA 3L0ZA 4NJEB 1WD7A 2B82A 4R2IA 2X5XA 2ZRFA 4KO2S 3PT9A 4AU1A 3T7AA 3BIWA 2WJ3A 3MZ0A 4QHYA 4C4TA 1VYUA 4DLYA 1TPYA 4MIEA 4TWZA 1F51E 1KTVA 1HGXA 3CCFA 3EF3A 3KUUA 4X95A 3N8DA 2C4WA 3LGXA 2R6AA 2ZULA 1J39A 1XZBA 1FXUA 1Q7CA 1QM5A 3MINA 4C4PA 2GEBA 2RH8A 1Z47A 1VFPA 3MAGA 3RJMA 1O9BA 2IZ6A 3O8OB 4F3RA 3TTWA 3WXMA 9GPBA 1AKRA 2VOJA 2XGSA 3MNFA 4D0SA 2E9SA 1A8SA 4JT8A 2WY2D 3GQVA 4NAHA 1A1SA 4R84A 4CBVA 5C7YA 1H4VB 1P5HA 2P2DA 2VOEA 5F1YA 4OXKA 4FR5A 4BNIA 1X1EA 1NNEA 4X44A 5EJGA 3FOFC 4X45A 2OCKA 1G98A 3HEMA 3A1WA 1QORA 4LK2A 2F6RA 5DBOA 1LWOA 4E2YA 1T0JB 1IBLB 4KNVA 2N47A 3MOIA 3SJZA 3NAQA 3RHSA 1MJFA 4P7FA 5AXCA 3C4JA 5A5FA 4N82A 3TB4A 1XEXA 3LL4A 1XZFA 3BK1A 1DAGA 1S2LA 3JR7A 5CM2Z 3RSLA 4PX9A 1U65A 3SAJA 3TRIA 7MHTA 3RSQA 2R86A 1YF3A 1IG3A 1EE1A 3EGXB 4JUDX 4KR0A 4U02A 1PJSA 5TT1A 3G1WA 3PEFA 4AKIA 3D54D 1V41E 1TI7A 4ABYA 5KHAA 1M2FA 3UB4A 5FPQA 4XLLA 1RLTA 3ULKA 2VDWA 2XB6A 4JC5A 5KYUA 4CLHA 4J4HA 4FT4A 3OJXA 4ZOLF 1TU0A 3V7FA 3C3BA 5JXGA 4DIKA 4BV3A 5E4TA