3EW3B

The 1:2 complex between a nterminal elongated prolactin and the extra cellular domain of the rat prolactin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
203
structure length
203
Chain Sequence
b'MQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
publication title Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
total genus 27
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B01
1JF1B 3QWRA 1Q8MA 4OIBA 4ETQB 4E5XA 2NZIA 2PO6C 4KDVA 3I84A 2PYFA 3VXUB 3Q48A 1BGXH 2ZOKA 3VFMA 5FKAA 3ZYOA 1YMMB 3PQYA 2QADC 3S3JA 3HRPA 1UZ8A 5F1KC 3TBVA 2NY0B 1NSNH 3G6JA 4PJHA 2VSDA 4N9OB 2IFFH 4NZUH 4JFHE 3QXUA 4IRJA 3Q1SH 5A2FA 2FJGA 4LMQI 1ZMYA 3TFKD 2GJ6D 1P53A 4JGMA 3G5YA 1T2JA 3QYCA 2DIAA 3GMLA 4JEGB 4JO4H 4X8JA 4OCYH 5KTEH 1UQSB 2KPNA 2C5DC 4GKNB 2EDBA 2E6QA 4RBPH 1SBSH 2DM2A 5T1KD 2IWGA 2HT2C 4JHZA 2D3VA 4KK9D 1V7NH 5DUMH 4JY5L 4NQVB 4XMLL 4RA3A 4KQ4L 4P57A 3O9WB 2P24B 4HWBL 5DK0B 4BM7A 4R2GD 4GRWF 3MJ9A 1KTLA 3ARTA 5DHXB 4TUKH 1RURL 3V0WH 4CW1B 4YHLH 3F6IA 5D7LD 5SX4H 3WEXB 1J0IA 5K9OA 4QRTA 2IG2L 1MWAH 3PWLB 1X44A 3GSQA 2EE3A 2ICWJ 4HHAB 4K8RC 3CFJB 1MQKH 1BIIB 1RQ5A 3IU4H 3QRGL 5D1QA 3VFRA 1I1AB 1NANI 3SDDD 5L7XH 1MSPA 1OTTD 5JR1H 1C7SA 3U48A 5IT2L 3H2WA 4QXTA 1EA9C 3F7RA 1QFUH 5IOPA 1CGSL 2DMCA 5C0IB 1EZVY 2YR3A 1G7IA 5EWIL 5F3HA 2V2XB 4BELD 2Y25A 3QIUC 5CZKA 2XKNB 2EDOA 5AZ2L 4Z7VA 1ROWA 2GTZA 5E9DA 4HK0B 4NQEA 3P4OB 3NCFB 1JWMA 1KIPA 4I18B 4LDEB 3VXOB 3PIQA 4YHZL 3UBXG 1HYSC 1B2WH 3PDOA 4H88L 2NQCA 5A2LH 3UEZA 3UO1L 3LKRB 1T7VA 3H9SD 3OJDA 1MPAH 4KV5E 3KPNB 2HLFD 4LLYA 2AEIT 1KXVC 2YD9A 3B2VL 1OGAA 4R96A 3VFGH 3MRRB 1W0VA 4FXKA 5FDWB 5HHNB 4I2XB 1AD9B 3QEUB 3C08L 2BNQD 4XNXL 2P8LA 4H5SB 1F4YH 32C2B 4G9FA 2PW1B 5EUOB 1GPOH 1WBXB 5CD3A 1NC2D 3GHBL 4KWUA 3DSFH 3RWIA 5HHPA 1A6ZB 5JPNA 1RI8A 1EO8H 1UB5A 2HKFL 3MBXH 5D6DC 5I8KH 4MD0B 5F7NC 4GT7A 3GMPB 1IC7L 1KCRH 2CIIB 3FTGB 5C6TL 5CLWA 1C12A 3ZDYE 4M7LT 3GB7B 5DJ8B 3SGDI 4JZNA 1QG3A 1KV3A 4M6MH 2UVEA 4PP2B 4IHOB 1QRNE 1MY7A 4HKZB 3BW9B 1E6OH 3PDDA 4JRXB 5KAQF 5GGSB 1E4KA 5IHLB 4LCIH 2YPLA 2ZSWA 3WS3A 4OF6A 1P5UA 4EKXA 3LQAC 1BEYL 1HNGA 5EFIB 5C0NC 5I1HH 4Q7DA 3ROOA 1CF8H 4FQXC 4N68A 1T0NA 3CDYA 1KCKA 4ODWB 3V6OE 3BZEB 1QFHA 1DBJH 1Q0XL 4CAGA 4QF1B 3MRPB 4JR9L 3KPSE 1OARL 4P2OB 2CUIA 2I26N 1A7NL 2CK0H 4FFWD 1G9ML 1VEOA 2DQGL 2E6PA 5D7IA 2XA8H 1F6AB 5EUOF 1JI2A 4NNYB 1ZVYA 1Q38A 2ERJC 3OHXA 1DQLL 4GLRI 1D5MB 3MMEA 3MCLL 3A0OA 2NCMA 5FUOH 5CWSA 3AVEA 2OLDA 1KN2L 2ZOLA 3QUMA 4OFYA 3GRWL 1GXEA 3WE6A 1QQDA 1O5DT 5BS0D 4R97C 5IHUL 3D3VB 3A6CL 2CMRH 1MHCB 3ARFA 4Z18A 5DRWB 3QI9C 2MOVA 2G75A 2HMIC 3KPRE 4I3SH 1A9EA 2WIIB 3QXWA 1UKTA 2KBGA 3F7QA 4S1DD 1P4IH 2DI9A 3MUHL 1D6EA 1CLCA 2V5YA 3IDGA 3O4OB 4KAQH 1S9VB 4W4OC 1W72H 3TYGH 1LO4L 1TNMA 4JQIL 5ENWA 2NW3B 3P0YH 3P11L 3QAZB 1G84A 5MP6H 4KJPC 3U4AA 2EDXA 4WUUA 1FJ1A 1WIPA 3ULUL 4ZD3L 3BRGC 3C6LD 2LTQC 1C5BH 1F4WL 4RX4D 2XKSA 4MCYB 4NKOB 4Y4KB 3TF7C 1PGRB 1IJ9A 4WFEE 2BCKA 1QZ1A 2APBA 2JJWA 5SWSD 1IAOA 3L3IB 2YHGA 1HH6B 4G3YL 4OD3H 2ZG2A 2B4CH 2OCFD 3IFOA 4L8DB 1QA9A 3PP4H 3HLAA 4TN9A 1T04B 1J1OL 4YWGL 4R3SB 3RVVC 4YEFA 3CVIL 3MJ6A 3Q6GH 3MROA 1YPZE 3OKDA 5JIPA 1P84J 2BRQA 5FFLA 5IMKA 1ND0A 5IQ9B 1YEJL 3BQUA 1KFAL 4IMLB 4ZSOE 5B39G 4L8BB 5CEXB 2OYPA 3F7VA 2DRUA 2B20A 4RMTA 3H3KA 5HHVH 1WEJL 1KGCE 3LRGA 1XGQA 1C1EH 3FOMB 2YD1A 1CD8A 3UJJL 4KRPD 4UNTA 1S78C 4E42B 1IGCL 4OCXL 3SGKC 3BDYH 3HRZB 4ODHH 5FKPA 3X3FH 1L4IA 4P9HL 1GC1C 1H8OA 4QTHA 2BMKB 1YDPA 3CXHK 1JE6A 3T65A 4OUUA 1YEGH 1F6LL 1YY8B 1YNLL 4PRID 1A6WL 4Z7UA 3SQBA 1T66D 4Q9QL 1BFVH 1HQ4B 3BPOB 1EEYA 3NIGE 3LIZL 4DGVL 2NR6C 1S5IL 4XHJD 4KMLB 3IDMA 1RK1A 3CU1A 1B9ZA 3TBWA 5F21B 3O45A 4X7SH 4XXDA 1NCAL 1AJ7L 4BSVB 1XCQA 3VWKB 5CGTA 1FV1A 1G7QA 3VGAC 2R1WB 5LAXB 1XF5A 2YA1A 3KPTA 3FONB 3MV11 3Q0HA 3QUXB 1SM3L 3GBMH 3LV3B 4YXKH 4XAKE 4YGVA 3B3IA 3EO1A 4IRJC 4JJ5A 1JWUB 2CR6A 2NY5C 3OXRB 3TBSA 5IB1A 4H8WH 4OIIH 4IOFD 5D1ZB 4I9WE 4EOWL 2F53E 1NUNB 4JFQB 4P2RB 2QSCH 3ZYIA 1OL0A 1J86A 1HHKB 4MXQC 2E7HA 4XBEL 5SV4A 3S98A 4DN4H 3ULVL 1IE5A 3RIAF 4JM2A 3WNNA 1D5ZA 3ARDA 3F58L 3O3AB 5E00A 1DTUA 4K3EH 1JPFB 2MFNA 1AY1H 1NJ9A 3HI5H 1N2RA 4WDIB 5EU6B 2E3VA 3TV3L 4D3CL 1MFCL 1LDPH 3BISA 4QYOA 1FG2A 1LP9B 2VABA 3QUZB 3F6LA 1CFVL 1DLFL 3FHQA 3MV7A 3CC5A 5CBAB 3T0VA 3L3KB 1KCSL 4HS8H 1RZJC 5ABDE 3ZMRA 2IMNA 2PO6B 3RL1A 1D9KD 3O4LE 3UYPA 4BZ2L 3EZJB 4JFED 5FYLL 2EH7H 4YPGB 4DVRH 2NY2D 1YYLH 5K9KA 4JFPB 5D1QC 4G8EA 5DJDB 5IVZA 3ZKND 5E2JA 4G6JH 1MCSA 4ERSL 2X44D 1U2CA 2P5EB 3LAFA 1JGDA 4KJWD 1QSEB 2J12B 3NN8B 2M2DA 4U6VL 2C1OB 3GM8A 3VFWA 5GQBA 3QH3A 3FN9A 5IMLB 1I7ZA 3TWCL 5ERWB 4X5WA 4X4YA 5B4MD 1WLHA 4YC2B 2R69H 4UBDD 5CLTA 3OKNB 2ICES 5DLML 5BV7H 4AQOA 4DVBA 1VFBB 4WENB 5F7EL 1C5DB 1JRHH 1LP9F 1HCFX 2V5TA 3CXHJ 4XBPA 4NZTL 5IFJA 2VL5B 1PFCA 2O5YL 1JZ6A 4CJ0A 2YD2A 1EMTL 3QCVH 1JNLH 1WFOA 3LN4B 4Z8FH 1FNLA 3CIQA 4U1LA 5E6IC 3CDGA 5DVLA 4S1SH 3ARZA 4HBCH 4Y4FA 1DQJA 1FE8H 5I8EB 1I9IL 5LG1A 2E7MA 3RPKA 2YPVL 1A7BA 5D2NE 4UT9H 4GG6A 2VDLH 3VXMB 3B83A 2OK0L 4PJCE 2OS7A 4W4NA 1HEZA 4X9FA 4MDIA 4LVNB 4LHUG 2GT9A 4Y2DA 4N0UE 1NC4A 4NKMA 3K8MA 3LN5A 5EU4A 1KN4H 5HVGB 5JW4N 2H9GA 2F58L 1TPXB 1OGTB 3N1MC 1E4KC 1J87A 1FFOB 2FL5B 1WTLA 1K2DA 4NNXA 1RUKH 1BPVA 1ZT1A 4ZO8A 5J1AA 3S88H 2PETA 2IGFH 4HLJA 2GJ6E 2BSED 3ULUF 4Y16D 3E1F1 2J8OA 3F5WA 3IXAB 2YUWA 1U58A 2NXYC 2FB4H 5IP4A 4KVCL 3MOQA 4XHQA 1U8PB 1CDIA 1MVFA 4PBWD 3BAEL 5I74C 3TO4D 3L5XL 4XWGH 5F9WC 4KI5C 1M6OB 4PIRF 4YK4B 1XF4A 3S4SG 3FQNA 5EOCL 4D9LL 5HYSB 1TTFA 5I1AA 1KB5A 4MAYD 5INDA 3WFDH 4CVZA 3DBXA 3RGVD 5FYJU 5D7LE 2CSPA 2Y07L 3QUYA 3IAQA 4WEBL 3EOBA 1JF5A 2OR9L 5H35A 3T4YA 1FO0A 1WCBB 3ARFC 4APQB 3V6OA 2X4OA 3BWAA 1FRGL 5EN2B 3CU7A 3D39D 3U36B 3VGGA 3QWQB 4TVSa 4P5TA 1I3GL 1JP5A 4KDTA 1IAIM 4MD4B 5LGJB 1NAKL 2C3HA 3WN5A 4YUEL 4QHMA 2Z8RA 4XNMA 1EFXA 3OAUL 5IFAL 3BUYA 4JKKA 2DYPB 4PGDB 4EI5C 4KTEL 4F2MA 1IGMH 5MENB 4M4PA 1WZMA 3FO0H 1DSFL 3V0AC 4IEFB 1KTDB 4XC1L 4Y5VA 2ERJB 3BEWA 1Y0LA 4K94H 1XF3A 3O2VH 1YUHA 1WITA 3MUZ1 5FCUH 1G9EA 2AEPL 4Q2ZA 3D25B 3HR6A 2A6IA 2MMXA 1S7WB 3KPRA 4XRCB 2Y6SC 5HJ3A 3MA9H 4LDLB 2J8HA 3UTZA 3U4EA 5CMAA 1TQBC 2KUTA 4S1RH 3BQUC 3QO0A 3V6FB 5IBLC 1U8HA 2AK4D 3V6ZA 1IQDA 3PWNB 3TEUA 2BVPB 2XWTB 5E0QA 1AR1C 2RJMA 4K3DL 2A0LC 5DMKB 1F42A 4L5FL 2HT4D 2C3VB 2ZUQB 2DKSA 4FG6C 5ANME 2ICWA 1NMBH 5KSAD 2CJUH 2ZNWA 3LEVL 3VFUA 2V5RA 5EO0A 3H3PH 4KHXH 3MYZA 1NCDL 3M07A 2J8UB 1IGJA 2A83A 5I71B 1R3HA 2BRRL 3GMMA 4J8RB 1X5JA 4LLMB 4O9HL 2IADB 2D7OA 3SDXA 3VFVB 1YPZA 1DL7H 3CMOH 4ZSOA 1NDGA 2EYTA 1KJ3H 1RUAL 1WSST 2AGJL 1G7LA 1ITBB 4O4YH 4ZQKB 4R4BB 4B50A 5HBBA 2B1AH 4OKVB 4CMMA 2ENSA 4J1UB 1IEHA 4PRNB 3B9EA 3DX9A 3F65A 2YRLA 2ZUUA 4NO3A 3Q5YA 5BO1L 2F5BL 2VXTL 3RPIB 3HAEH 2CKBA 4X7CC 1EH9A 3BD3A 5IMOA 2Y06H 1PKQB 2BY0A 1H15B 3MRFA 2J8UF 3RNQA 2WQ8A 3BDBA 2FEDC 1N5YH 2YBRB 5D6CB 5T1LA 5BS0E 1MUJA 2RB8A 4CN1A 1CBVH 2WP3O 3VRLE 5M94B 3DIFB 2X4RB 4JFFE 3QFDB 4M1GH 2XIDA 4TSCL 4JDVA 1JWSA 3U6RB 3M17B 1UC6A 1RIHH 2D4DA 4PB0H 5JW4R 3BXNB 4J3UA 1NSNL 2W0PA 4C83B 3JZ7A 3ELAT 2IFFL 4I48B 1CVRA 1LNUA 3QHTC 2GSIA 3BJLA 3WSQH 1JV5A 1S8DB 2YC1B 4KHTH 4QWWC 2D03H 3MRDA 1M4KA 5GGRB 4AQ1B 2Q3AA 4JDZA 1HSAA 4N1HB 4M5ZH 4HIHB 4JO4L 4OCYL 5C86A 1SBSL 5J13B 1FVCA 4OKDA 3PE9A 4KRNA 2ZUVA 5J7CC 4LARH 3CSYA 5BRZD 2WUCH 3IFLH 4OCSH 1V7NL 1MFEH 4Y19B 5DUML 1MQ8A 3IDIA 2HH0H 1HIMH 1P2CA 1QFWM 1U8LB 1FPTH 5DZNA 3C9NA 5HYJA 4TUKL 2D7TL 3V0WL 3DVGA 4HMDA 4YHLL 1V05A 4GH7B 1W2KT 2OL3L 2KKQA 3Q6FB 5HHMB 1QP1A 1P4LA 5C0RH 4IM8A 1AQDA 4KU1A 5GRYA 1MWAL 2Q8AH 3RZCD 4I3RH 1DE4A 5I8OH 4WJ5A 3O4LA 4FTVA 4N5UA 3C5ZA 1UFUA 3E8UH 3V5DB 1X4XA 4HWUA 4U6XA 1OD9A 1JYXA 4NUGH 1QPPA 4WNQA 1V5JA 1BBJA 5CIPA 4O02H 2GJZA 4YFEA 1EHLL 1SHMA 1BBDH 3KYMA 5JR1L 2Z8VC 1AGDB 4AENA 3VRJA 2NXZC 1KPRA 1QFUL 4A6YA 5LJYH 2HA1A 4WHTA 4NSKB 4HV8B 4RAVB 2X10A 1A1OB 5EIIA 4UZGA 1DEEA 3CFIC 1O0VA 4ZOBA 2VE6B 5DJ2B 3ZHDA 3TGXA 2BY3A 4GUPA 1HCVA 1KEGH 4XPFL 1B2WL 2KH2B 2LVEA 5IJVA 1K3IA 5CUSL 1MPAL 5FV2A 4UMGA 2Q7NA 5DEZA 3A6OA 1OY3B 4PV9A 5C07D 5ALBH 4F58H 1BVZA 2CO6B 1A7OH 1R0AH 3SOBH 1UZ6F 2AEQH 4PUBH 3SE4A 3HR5B 2HLAB 2YUVA 2F54D 5H2BA 4ZUUA 1S9YA 3TVMB 1GPOL 1TITA 1FVDB 4BKLA 1CQKA 4ZFFA 3DSFL 3P4LA 1LE9B 3QJFB 1EO8L 1MLBB 3MBXL 5I8KL 5FA3A 2FJFA 2P7TA 5D2NA 4LPYA 2EDFA 3TBYB 4PJCA 3V79C 5E6IB 1CN4A 2HKHH 5T5NG 4N0UA 4LRNH 3VXRD 4NP4H 3NH7H 1H3VA 2GYSA 1E6OL 5EZLB 1PZ5A 4H20H 3L5HA 1BQUA 2ADFH 1F00I 5KSBB 5DC9B 1CF8L 1AE6H 2GJ6A 3W9DA 4HJ0D 3V6OC 2MHAA 1WFNA 3KDMA 4JFEE 5IWLA 1DBJL 2WQRA 4BSWA 3T8XA 1LK3L 3JV4B 1N26A 2VDRL 2ZG3A 1FNGA 4P5TC 5DVNA 2CK0L 3UJIH 3HPLA 4OBRA 4ZO7A 5T1KA 2XA8L 3OMZA 2HT3C 3WN5C 2IC2A 4K07A 2XY1A 3AY4A 3IRPX 2I60H 5F1IA 4W6XB 3DMMB 4GW4B 1X5FA 2WZPD 1JHKH 3WUWG 5KVDH 2X4TA 4HIEB 1AXTH 3BPLC 3QZWA 5BCAA 5IHBA 5DHVA 2WK2A 4QHLB 5IBUB 2V2WB 5HHOD 3ZKMD 2DQEH 4LLDB 5E94A 4N9GA 5E08H 2XRAH 4PTUB 1Z0NA 5F9WB 5FM4A 3V4PH 4XC3H 5DD1L 4ZUTB 4FN0A 1MCPH 1ADQH 1R5WB 5CEZH 2CMRL 3QUKA 5J12C 4B41A 1JGEB 1R5VB 4TUJB 1BP3B 4I3SL 3IYLW 4ELMB 5B39A 2E9WA 5KSBF 3VH8G 1P4IL 5EU3A 3TPKA 5GGTA 2JJUA 4KAQL 1W72L 3TYGL 2VUOA 2GJJA 2XOTA 4FFZL 3MC0A 4M1CC 1DQQB 2A6DB 1YC7A 3P0YL 1Q72H 5MP6L 4LASH 3P4MB 3EJZD 3HPJB 3ZKXC 4GAYA 1C16A 1A14H 1F2XK 4EEEA 4KJYA 1P1ZB 1EEZB 1C5BL 4P23D 5IW3A 5HYQB 5ACMA 2NY6D 3I6KB 4WFGE 3G04A 3VW3H 2OL3B 3BGMB 1I7UB 4OD3L 4Q6IA 2DD8H 5C0BE 3WLBA 4D8PB 4QCIB 4K7PY 4PGBB 2P8PB 1N0XH 1EBAA 4EI5B 1MWAB 1NLBH 3DGCR 1IM3A 5FO9B 1AO7B 2FHBA 2JCCE 4V1DD 4RMRA 4R4ND 3ZTJH 4ENEC 4CNIB 5CJQH 4MSWB 3JVGA 4AEHH 4M3JA 5A3ID 5D8JH 4ELMF 5LCVH 5DD5H 3JWOC 1X5GA 3MRCB 4OD2A 4ORGA 4HAFA 5EPMB 3FB7A 1IEAA 1C1EL 4PR5A 5ANMA 2WUBH 4WIQA 2IBZY 4N0CC 3BDYL 1QLFB 4LU5H 4MNQD 5SWZD 1J5OH 1QEWB 1BFTA 4NPYA 1BZQK 3SKNA 3ARVA 4F37F 4GW1A 4F8TA 4DAGH 2O26U 3RIFK 3UP1A 1U8QA 4U0RC 5F9OH 4M3KB 4HBQA 3HI6L 5TH2B 3HMXA 1FZKB 1CICD 4XWOC 1JPGA 4QRQB 1XR9B 5IB5A 4JFDB 3VD3A 2HN7A 3C87A 2YWYA 3WL9B 1I7RA 4PP1C 4MLSA 4YHYB 2ZKHH 2FZ3B 4MX7B 3UTTD 4XBGB 3BKMH 5DVMA 5TJWK 4OLXH 1MHHB 5DRNB 1ZGLP 3O11B 2OQJB 4K7FB 3NZHH 4I5BA 1CFQB 4KMTH 4AM0A 5DVKA 1M7DA 4F7EB 3GJFK 4DOHE 3CD4A 3GBML 3RWHA 2JK5B 4YXKL 4HGWB 3UCRA 5BOZG 1BJMA 4ODXA 4D9QE 5TGBB 4HJGB 4LHQB 3V4UH 4G6AC 2P46B 2WAHA 5JXEA 4JN1H 4ZFOA 2NY3C 3OAYH 1A6AB 5D1XB 4ZDHA 3HNVL 4DN4L 3OKLB 4Z7QE 5BS0A 1CU4H 1CFTB 1MI5B 5B3JE 3SCMB 2B0SH 5MEPA 4K3EL 3HI5L 1AY1L 4JFFA 1DZBA 2XTJD 3JWNC 1FNEA 4C59B 1ZHKA 3DRTB 1X6LA 4OZIE 1LDPL 2DTMH 1INQA 2HJLB 1UWGH 2Z8SA 1OAXL 2NYYD 3EFDL 1LE5B 1LEIA 1J18A 4BK5A 2AK4E 2VAAB 4H26A 2BY2A 2VXSH 2Q8BL 3MYJA 5GS1A 4Q0XH 3KPQB 3L1OH 4HF5H 2H32A 4ODVH 3TT1L 3C5ZC 4DKFH 3PABA 4X6EA 2JJSA 3QDJD 1ZAGA 2EH7L 1S7UA 4OCNC 4RMQA 1YYLL 4DVRL 3WS6A 3G08A 5DA4A 5FO8B 4YX2L 5I0ZA 2XA3A 5HVFB 3WFBL 4G6JL 4O2EA 4M7ZB 4X99B 5I1IL 4OFPA 4KKCD 4CDHA 3DVNA 1TJIH 4ZTPH 4HT1L 1U92B 3D6GA 3OTTA 3UYRH 5DEFA 3WXVL 4ZAKC 3HZKA 4NQSA 3HCVB 1B4JH 1M05A 2BSRA 1NCBH 4TQEH 3GIZH 2R69L 3OX8A 2F8OA 3OR7A 5IQ7L 4LHUA 5BV7L 2P47B 2D7PA 4GAGH 1W72B 2YN3A 2ADJA 4LSUH 1JRHL 4Z78A 4C4KT 3V8CA 4Z7WE 5F7DA 2DDQH 3EUUA 3RY5A 3SDCA 2ZCKH 4G6KL 1J1XH 1T0MB 2P43B 1W0WA 4OSUL 2X7LB 1JNLL 3QFJE 3MODH 3SE3A 3HI1B 4KXZI 3SE4C 3OKEA 3PDGA 4NN5C 2P5WB 3I6LD 4DK3A 1VDGA 3CMGA 1Z5LB 3DUUB 5SWQB 4YNYB 4P4RB 4WWID 5T3XH 1ETZA 1CG9B 5D2NC 3S4SA 4ZPVB 2FIKB 3JWOL 1U93A 4UT9L 3KPLA 2VDLL 2VDOH 2V5SA 2CIKA 5LVEA 2EYRA 1PJ9A 2GUOB 4XPTH 4YIQB 2AJXL 1KN4L 1JI1A 4NO0D 4N5ED 5CZVH 1N6QH 2R2HB 1OT2A 4QHKI 1MELA 2CH8A 1RUKL 2CR3A 5CD5D 4GRLD 5FV1L 2Q6WB 3PWJB 4G8IB 3HG1B 5IWLC 3MNVB 2FYYB 4HCRA 2PN5A 3SDAB 4L4TE 2FB4L 4N8PA 2DMBA 4GG8A 4HWEH 2Z31D 5I8CB 2AK1H 3BOVA 3NABL 1LO3H 4XCNA 5GRWA 1LEKA 3TN0A 3MACH 4XWGL 3GSNL 3PJSB 3AY4C 2PTUA 3NA9H 4KK9C 1YY9D 5F3BA 4G8FA 1F3JA 1OTSD 3DURA 4MD5A 1L0YA 1HQRA 1MCHA 5EBWB 4ALAH 1T4KB 4J3TA 4OJFH 3KJ4B 2ESVD 2N4IA 5DZLA 3NMEA 3W9EA 2CXKA 2I25N 3TZVD 2DQIL 4ISVB 1ZA3A 5I1LB 1SJHB 3U46A 4JFEA 3GBNH 3X12A 1TXKA 4C55A 2HFTA 2WWKO 4PYGA 3SDDC 3X17A 5J4MA 1OTTC 3U30C 1KOAA 3DUSB 1ZGLB 2BVOA 4FQHB 3NACH 1RHHA 3AMLA 4P46A 1VPOH 3SPVA 3QT2A 5FM5M 1IGML 1IAII 3ME0A 3C60B 1E4JA 2H2PC 1HILA 2CGRH 4LKCB 4YHKL 5L2JB 2VLKE 5JNYB 4YZFE 5I1CH 1BQHB 3MA7B 4Q6IC 1IQWL 5GRUH 2PXYA 4LPVA 2OJEB 4JGJA 3AS2A 5IMMB 2R4RL 1GIGH 2HLFC 3O6FD 5C0CE 1KIQA 4HC1A 3MA9L 5FDYA 4QNPF 5C0DB 3CCHA 3SQOH 4HXAH 1QUNA 4S1RL 4LAJH 4WGVB 1WBYA 5TPWH 1PQZB 3VXUD 4KGJA 1VFOA 3QA3A 5LGHL 4RNRA 2ADGA 2HFFB 4NO5A 4XNZC 5HY9A 5E56A 3FQRA 4YAQB 4PGZA 3UTSE 1BREA 1NMBL 4XPHH 3EO0B 2GFBA 2B2XH 1TTUA 3H3PL 3HE6A 3NCCB 1FNSH 1N8ZB 4XP9H 3WCYA 1RY7B 5C0BA 3RWEB 3GSVA 3SGJA 3VXRE 5BV7B 2NNAA 1CQYA 4P5KB 3S9DB 3G5ZB 4HKXA 1ZLUH 5DMGD 1A4KB 3CMOL 4XPGH 5DEGB 1KJ3L 2GITB 4PJ8B 1M7IA 3GI8H 4PJBE 1NCWH 4Y16A 1IGYA 4O4YL 4DCQA 6FABH 3CH8A 3N06B 4I77H 1HOCA 3NCJL 5ADOH 1T3FA 4QHUB 4PJ9B 1MCRA 2PCPA 3IRZA 4FFWC 5HGBA 3QJHB 5EZJB 1OAQL 4LSSL 4NQDD 5J56B 2LQRA 1FCCA 1X7QB 3IFPA 4HKJA 3AS0A 3C5JB 5EU5A 2QV2A 4Y5XB 2VLJA 3MJ7B 1I9EA 1MFBH 1T22B 4EUPH 2DQFA 5HHOE 4F7PB 3RDTB 4DKAA 5ISZD 1I1AD 4PJIB 4PJ5B 5EIVA 2CRYA 1DUYB 4GW5A 1CBVL 4LFHG 1A8JH 5AAWA 4HGMA 4OGYL 2VLMD 4R8WH 2GW5A 4LGRB 2AQ1A 2HFEB 4WI7A 4JCLA 2YD5A 3BE1H 1RIHL 3K81A 4PJGA 1A0QH 5D96B 4MB3A 4IOIB 1VEMA 4OT1L 5GS0D 5GS1C 4R7NB 1QFWH 3GSNB 1J8KA 1MVUA 3ZE1E 3WSQL 3NVQA 3NFNA 4KHTL 4RRPG 2JJSC 3OAZH 2D03L 4RFEB 4RAUB 4XZUA 5BZWB 1HDMA 3I3EA 3LPWA 1FFRA 3FO1B 3H7LA 4JZJA 1R3IL 1TVBB 4I4WB 3WD5H 2VKWA 1GGTA 4PJIF 2FBJH 5MEOA 2WUCL 3BP7A 3IFLL 1MFEL 1QPXA 3FB8A 4HH8A 2HH0L 4L8SC 1HIML 4V1DE 4GKSA 1FPTL 4OZIA 3D85B 1U3ZA 4F7CB 5J6HB 1AKJB 2AK4A 2OMBA 5JLZA 4LCWA 1L7TH 2DL2A 2HTLD 1RZGB 1CE1L 3MOAH 1XF1A 4PJXA 2Q8AL 3STLB 2AJ3A 1FLRH 3C2AH 4I3RL 2QR0A 1NLDH 5JQ6H 2F5AL 2Z35A 4KRPC 1NH6A 4JRXD 3SDCC 5DHYB 5GS2D 3GZKA 3LDBC 4MNQE 5SWZE 4O02L 2X4SA 3MJ8A 1BBDL 2OTWB 1I7TB 3SE3C 4CADB 5GGUA 4O2FA 1KB5H 2DLFL 2YD7A 5BXFB 1T66C 4G8GB 4D2NA 5JHDA 3WHXA 2XZZA 2W65B 3PP3H 4LF3A 3H42H 1ZS8A 4EN3A 4HUVB 4KKNA 2NPLX 1T20A 3GSRA 2VRAA 4L9LC 2BOBB 2IPUK 1FO0H 1YNKH 1T5WA 3FFCD 2XXCB 5E24E 2XICA 1AGBA 2WMPA 3MCKB 3AXLB 3UTTE 1FIEA 1T2XA 1KEGL 3P4NB 3BMVA 4Z7WA 2Z92A 1MCCA 3PWPE 2VUYA 5H37G 4M62H 3FJTA 5ALBL 3QFJA 4F58L 1A7OL 3RA7H 4IOFC 1I8IB 2QHLA 2R4SH 3SOBL 2AEQL 3HZYB 4LMQE 1G6RH 3S35L 4HW6A 4MXVE 2VDQL 1OM3L 4Q9CA 5FO7B 3MV9B 3FRPG 1FN4B 3TBTB 1K8DA 1RJZA 3K4AA 3L7EB 5E4EC 2ARJA 2ZSVB 4BZ1L 2O93L 1MHPH 1A2YA 3N1GC 3E6FB 3OXSA 3WUWA 2XTJE 4Y8AA 3TO2B 5MI0C 4Y1AD 1NBZB 2HKHL 1RZ7L 3PV6A 4NP4L 4YBLC 4U1HB 3BHBA 3OG4B 1UCBH 2M26A 3IDNA 4H20L 1AD0B 3KLAB 1JIBA 1OF2B 3I6GB 3L7FA 2VIRA 3JWDH 2DQCH 1A3RH 1AE6L 2H6PB 2NTFB 1P6FA 2Y9RT 4IMKA 4N1CA 1AGCA 3QDJE 2R2BB 5E1AB 4XNYL 4L4TA 5IW6B 3ZKNC 5F88B 4RWYL 1U95B 3RUGE 4OQTH 3R0NA 2FJHB 2D7NA 4JY4A 2R2CA 4EI6B 4MQ7A 1A7RH 4R4FH 1CD1B 5FECB 5CP3A 1TJGH 5I75B 4P46C 5F1SA 3TPUB 4UQ2A 1FCGA 2BXYA 3OR6B 1A9BA 1T1YA 2GSGB 5KVDL 1AXTL 1QBLH 3QEHB 4DZ8A 1BZ9A 1K5NB 4UNVA 2E9JA 3FN3A 4JCMA 2Q76A 2O5XH 2ITCA 5B4MC 2DQEL 4OF0A 3GFUA 4UBDC 3LQZA 4KQ3H 1EXUA 4P5MB 3LB6D 3MLRH 2IANB 3V4PL 5LQBH 3FFDB 4IDJH 1MCPL 1ES0A 1H0DB 5TE4H 3RZCA 3ROLA 1I4FA 2ID5A 3DROA 3PWUB 4X9BA 4C56B 4F57H 5ESAA 5CEZL 2ICWI 4R2GB 1EPFA 2R2EA 3E3QE 3W2DL 3FT4A 3RWDB 3IJYA 1JZ5A 1NUFA 3CFDA 4X5LA 2CKBH 4M93B 2XYCA 3J7HA 3IJHA 4OGAD 3I75A 1OW0A 5CSZB 4YFDB 3I6LE 3QUXD 4U1SB 5I76A 1GHFH 2VLKA 3SDDB 3QDMB 2VXVH 5D7JB 2YMXL 2EEAA 1SEBB 5D1ZD 3VW3L 3PL6D 1HH9A 2DD8L 3SGJC 4MS8D 5C0GA 1N0XL 5C0CA 3QWOA 3FT3B 4ODTH 1U8OA 2O5ZL 1UJTA 3BRDA 2DIJA 1JHTB 2I07B 4Z0XB 3V95A 5E5RB 4AEHL 3DX6B 2NLJA 2WLZA 5D8JL 2D9QB 5LCVL 4Y16C 4BSJA 1UH2A 3QDHA 5B3NA 1XGYL 2X1WL 3UTSA 3TO4C 5JOPD 4MA1C 2WUBL 4QO1A 3QUZD 2OX5A 2IH3B 3LRSA 1BM3H 1FL6B 4Q9RL 2BNQB 5DQJA 5HGDB 4DAGL 4ZMAT 2GTWB 1B4RA 5EBLB 4H1LA 4MAYC 3VXRA 3EYVB 5J11B 1NC2B 4XNZB 4M5YH 1CI5A 2ESVE 3RGVC 3MLYH 2NY1B 4D94A 3O6KH 1NGXB 4E41D 1MCEA 1CXEA 3S35X 4AK1A 1MY5A 1QSED 3VXNB 2ZKHL 4PV8A 4PJBA 4P3DA 4X4XB 2A6JA 4LEOB 4Y7MA 2E8ZA 3MRKB 3BKML 2KZWA 5CIPH 2AJZB 3C6SB 4UV4H 3NZHL 5CJ5A 1BFOB 4KMTL 4A6YH 5IW1A 4XT1C 5D93B 3DETD 1CGXA 3NA4A 5CEYA 1P7QB 4A2MA 1ED3A 2Y36L 3ARGB 3VRIA 3W82A 1UWXK 1J0YA 3KLSA 3MZTA 4JN1L 3DYMA 4F3FA 1QBBA 1ZLSH 3BP6B 3MBEA 4K2UL 2I27N 4NM4L 2YXMA 2VLRE 2PYED 1NEZB 1NAML 4NWTH 2B0SL 2BVQA 4Q9BA 3NIFF 1VFAA 2P1YA 4JPIA 2AI0H 43C9A 1IGFL 1K4DB 3JV6A 3ZT7A 4FQIL 5F7WC 1A1MA 2EDQA 4L4VE 4LAQL 2DTML 3RIAK 1UYWH 1J0HA 4GRWE 4R26H 4NRZA 1TZGL 5T5FH 1GCFA 4S0SD 2I24N 3VXMD 3VXQA 3VXUE 1INEH 2HT4C 4XX1E 5C70A 1R3KB 3L1OL 3OGCB 4H25A 4HF5L 1YMME 3BKYH 4OBSA 4DKFL 4JRWA 1Q9OB 3QIWB 3KR3H 4J3WA 3BH9A 1N7MH 3EOAB 4HDIA 5KANI 4WV1B 3T0AA 1K85A 3MRNA 4P2QB 4RQQA 3WFEH 2OI9B 4EN3C 1VGEH 1BD2B 1TJIL 3R1GL 4V1DA 4ZTPL 1DANU 3C6LB 4WY7L 5SWSB 1B4JL 1YN6B 3MLUL 2IQAB 4D0CA 4TQEL 1BJ1J 2X1QA 1G7PB 1WZ1H 3FQWB 3RNKA 3TT3L 2GCYA 4GAGL 5ADPH 2G5BB 5L9DH 4Y88A 3GSXA 4YDLB 2DDQL 4QGYA 3VA6A 3CLFL 1BZ7A 2ZCKL 1CFNB 1J1XL 4MNQA 5SWZA 1WFTA 5MHSE 1VADA 4X80H 3GSOA 1WBZA 4YHNB 4APQD 5L6YL 2UVFA 4E5XB 2XWBB 1BECA 2RFXA 5DHVH 3V4VH 1L0XA 1UEMA 5FKAB 3KPOB 3PGDB 4XMKH 1RJYA 5IEHA 3TBVB 5FAAA 4OV5A 1UJ3C 3NGBC 5T3XL 3ULVD 5K59F 2AV1B 4ZUSA 2VLME 4WHDA 3UTTA 2NY7L 1NCTA 2VDOL 4LIQE 1JK8B 1ZWIA 5DD6B 1SJEB 3GNMH 5MEND 4YDVA 1UADC 1F58H 5E8OA 1DFBH 3P2TA 1RV6X 5GGTH 3PWPA 2XZCH 1N6QL 2G9HB 1U36A 2DWEA 6CGTA 3IDJB 1I3RB 1UM4H 2ED7A 1IL1A 4GRMA 4JKLA 5TDPB 4LLWA 1ZT4A 5DURB 2DBLH 1KTLB 1Z2KA 3BGFC 1A6TA 2FRGP 4HWEL 2FGWH 5DXWA 5FYLD 3RVTD 4I2XE 3TNNB 2AXGA 2AK1L 2WBWB 4JPKH 1YEHH 4G43A 2AV7A 3K7UA 3LSOA 1E4XL 4KKLD 4OFIA 4X0KA 5K9OB 5B38G 5EUOE 3NA9L 1YMHA 4YLQT 5ICZA 3GSQB 1KTRL 4JANB 4DKDC 2EXWD 5FEBA 1ZA6B 3CUPA 2Y5TB 2PTVA 4WRLA 4PGEB 1AIFA 3WYRA 3HFMH 1XIWD 5TE6H 3VFRB 4J4PD 3MX0A 3CFCH 4G5ZH 4QXTB 5E4EB 1T03H 1JZ2A 3GM0A 5CZXD 5HGHB 2ATKB 3RZCC 5L88L 5EC2A 3ZE0F 1HE7A 3QDJA 4JRXE 1G7IB 5F3HB 4DUWA 1ORSB 4P48A 2GTZB 4YBLB 5E9DB 1QFOA 4HUXB 4LLVA 3RUGA 3TCXA 4ONOA 3QG6A 5E03A 3FT2A 1KLGB 1KEMH 3BVNB 3T3PF 4IDLA 1ACYL 3EGSA 1JBJA 1QSFD 3HMXH 4F7TA 1TQCC 1D9KB 4R0LC 1NAMB 4AEIH 1VPOL 3QQ4A 2HRPH 3GMQB 2NY2B 4GMTH 5KOVC 3DTXA 5I66B 2IPTL 4Y5YA 1W0VB 2CGRL 4FXKB 4HLZH 4LNRA 3RZWA 5EIQA 2XZQH 5GRUL 5CINL 1S7QB 3U9UB 5I16A 1MAJA 1NCCH 1GIGL 4R90H 4XP1H 3W0WD 4M03A 5JPNB 2DBJA 3O6LL 1NQBA 1CE6A 1X5XA 3K3QA 4N0FA 4NRXB 2OJZH 3G5XA 4ELKA 4HXAL 3D3VE 4JHBA 4F9LA 2E7BA 2X42A 1SY6A 3QNXB 1MFAL 3D0LB 1VGKA 5TPWL 1G1CA 2J88L 2ZPKH 5HDLA 1E28A 3R06B 3DPBA 3MFFB 5CBEA 4AH2B 3GJEB 3NFSH 2X6MA 4HUWA 1FH5H 2A77H 3S5LA 4UV7H 3WFCH 4XPHL 1NGYB 1EHNA 2R1YB 2IBBA 4XP9L 3HS0A 4ODUB 3VWJD 3ILQD 1F6FB 2NX5A 3MV01 4MXWH 4BH8B 3BKCL 5J6GB 5C08D 2RQ8A 3JTTB 4PG9A 2H32H 5D7KE 2Z93B 3MMEB 4Y19D 3GI8L 5M7QA 1N64H 1NCWL 4HJ0C 3F7YB 1ZLWH 1NGWA 6FABL 4L9DA 5T1MA 1XGPA 5CWSB 1H3PL 3FAWA 5ADOL 5KBNC 5FCSH 2XZAH 2KQMA 1G7HA 4WFFD 3VXSA 2BERA 1IGTB 1I1RA 1XGUA 3F12B 2CDGB 1DQMH 1IFHL 4NKIH 5DJYA 5HHMD 5JW3H 2XT1B 4NHUB 1A7QH 1LILA 4N8CH 4WTWA 3CSPA 3KWWA 4WTXA 5D5MB 5JW4M 2G75B 4NQXA 1MFBL 1BJ8A 1CLZH 5TF1L 4AMKH 3T0ED 2JKXA 2A6KB 3A6BH 3ZKMC 3MV8B 5IKCA 3TZVA 3MBEC 4MJ2A 3IDGB 4F7MB 2HVJA 1XGTB 1U3HA 1X5ZA 4G80B 4LVOB 2JJVA 4RGNB 5D9SA 3UPRB 4PY7A 2DQUL 5FGSA 3OJMB 4WU5A 3BP5A 3VD7A 4ZUVB 2XFXA 5F96H 1DBAL 2YWZA 5EC1A 4QOKD 3FB5A 1A0QL 4PJFE 1S7SA 4U6YB 1MRCH 4U1IA 4UIKL 3V0VA 1U91A 5A1AA 5J9PA 3EJZC 2JELL 3D39B 3BIAX 1XR8B 3U7AA 3MROB 3ZL4H 4P23C 1AFVH 2V2TA 2E27H 2NY6C 5D5MF 3DRQB 1U8IB 3S6CA 3WD5L 1ZHNA 3ZT5A 5EZOH 2VLRA 2UYLB 1ZKAA 2VDMH 5BJTB 1I1YA 4P2RE 1JZ7A 4YHPB 3TVMD 2FBJL 4PJEB 2YPKB 3B6SB 3RTQD 2DTSA 1Q9KA 4OFKA 1T7WA 4L4VA 4R4NC 3TNMB 4BFIB 2ITDA 4S2SA 1XZ0A 1JF1A 5CHNB 4KTDH 3U9PH 5EU6E 4UTBH 4ETQA 5FOJA 5A3IC 3FQTB 4NUJB 1S7VA 2HRLA 3VXUA 4HCRH 4NBZB 4TOYL 3MOAL 4MB5A 5CKAA 4G9DB 4Z7UB 1YMMA 3C2AL 3MTRA 3CFKB 1NLDL 5JQ6L 1LP9E 1CXLA 1MIMH 3GSUB 3IDMB 2AXHA 3MRIB 3B9DA 4XAWH 5I73B 1RJLB 1FL5A 2XI9A 3QNZB 4GOSA 4OD1H 1G7QB 3FMGH 3FRPA 4X6CB 5SX5K 1D5IH 5KSAB 1XFPA 1XF5B 2P5EE 5DJZA 5I30H 4YDKH 1E4WH 1FO0L 4PJEF 1KCVH 4G7YH 1QSEE 4GXVH 3DMMD 5I1EH 5IM7B 3S3SA 4GAJH 3O9WA 2P24A 5DK0A 4CUCA 5A40E 4U1GC 3TJHD 4ZPTB 4CW1A 4X7FC 4M00A 2EZ0D 3SGEH 2A38A 3CSGA 3HA0A 4DW2H 3WEXA 4Z7UF 1BVLB 4JB9H 4J12A 4YFLI 4JM2B 3ARDB 4U1MB 4Z0BH 3PWLA 3EO9H 1PKOA 4HHAA 5BMFH 5BVJB 3CFJA 1FNAA 5FYKH 1N2RB 1BIIA 1NFIB 2B8OT 1AC0A 1UB6B 1OSPL 4XNQB 1G6RL 3VDAA 3HC3H 3ULUE 1DDHB 1I1AA 3EYQD 4NOFA 5IBTH 4YE4H 5C0IA 4X6CF 3MV7B 3CC5B 3SKJH 3ZTJG 2F19H 2XTJC 4HC1H 1INDH 2V2XA 4UUJA 3H7BB 2CXGA 2XKNA 3N1QC 4BFBD 4S11A 4WI9A 7FABL 4HK0A 4CN4A 1G7JB 2NYYC 3P4OA 1BQSA 4I18A 4RMUA 3VXOA 3VXME 2CRMA 1DBKL 4OV6F 4AL8H 2OBGA 1RZKC 3ETBF 3ZDZE 5ECJE 2ENYA 1QHOA 3LKRA 3JWDL 3KPNA 5HHQB 2PF6A 4LLQB 2EIBA 4JM2F 1GOHA 5JIKA 3MRRA 4PGJA 3IAGC 5IB3B 5FDWA 2EEDA 3VXPB 4I2XA 3DV4A 2HG5B 4LSQH 3TH3T 4OFDA 1AD9A 3V5KB 1A3QA 4EUPB 3QEUA 1Y6KR 4OQTL 1FZMB 32C2A 2FEEI 3VG0H 1A7RL 4R4FL 2PW1A 3HC4L 5EUOA 4WGWB 1WBXA 4XGZB 4KKCC 1U8MB 1TJGL 1S5HB 3IFNH 4UT7H 3KJ6H 2R23B 2COQA 4UINH 5KJRL 5J3HD 5IFJB 4XH2B 2RR3A 4MD0A 4GFTB 3GMPA 5AG8A 3FTGA 2O5XL 3GB7A 5DJ8A 4KQ3L 2XG5A 3MLRL 5LQBL 1E0OB 4GBXB 4IHOA 4PP2A 3BT2H 3CDGB 5BRZB 5TE4L 1AI1H 4WUKL 2Y5EA 4WWKB 5D71L 4HKZA 4F57L 3BW9A 4JRXA 3ARED 3E3QC 4NFCA 5GGSA 4P9ML 4JFDD 3RKDD 4AT6B 1U8JB 4LQFH 4F9LC 3TH2T 3SE8H 4GG6B 4YQXH 4QF1A 3MRPA 4P2OA 5ETUB 2GT9B 4Y2DB 4HUMB 5GGVY 5EU4B 4QTIH 2YD4A 2H9GB 4NNYA 3SBWA 4XVTL 1GHFL 1D5MA 3NCEB 5JUEH 2DQDH 4HUKB 1FFPB 5T3ZH 5E8PB 5MENE 4JFXA 4EIZC 4R0LB 4KFZC 4U3CA 1G9NC 4N5EC 4ZFGH 4ODTL 1CVSC 1JGLH 4FABH 5HPOA 3D3VA 5CD5C 1MHCA 5DRWA 3L3JB 4GRLC 5DVOA 5GZOC 2V6HA 1QVOB 3QHZH 1V7MH 2WIIA 1JTPA 4PRHD 3SJVD 1V3KA 5INDB 4KVNH 5FYLE 4KKBD 4GG6F 4HKBB 3VGFA 4GXUM 5C0AD 1S9VA 1F8TH 1GGCL 4WEUD 5C07B 4GJTB 4DFIA 1E4XI 4QRPD 1BM3L 5I1JH 1SYVA 2YKLH 2NW3A 1YY9C 1SYSB 1FO0B 1PYWA 1OTSC 3D9AH 1F3DH 2GY7B 2F54B 1WWCA 2VC2H 3QR2A 5D2LB 4HWBA 4RBPK 2Y23A 2E9IA 4M5YL 4MCYA 4NKOA 4Y4KA 4I1NB 3HTLX 4Z5RB 1KJ2B 1PG7H 3L3IA 3MLYL 3TZVC 2J8UE 4F37K 2R29H 3C8HA 1HH6A 2D31B 5JXAL 1AP2B 8FABB 1U3HC 4L8DA 1NBYB 4FQPA 1T04A 1X5YA 2MQ3A 4HH9B 5HI3C 3RAJL 3RJDA 5KSUB 2DLHA 2EIEA 4W6YB 4M61B 2BXZA 4QXUL 5IQ9A 4GS7C 4IMLA 2JB5L 1KIRB 5CEXA 1G6RB 4OF7A 1F3RB 1EFQA 2J6EL 2D0HA 4Y5VB 2RCSL 3QQ9D 1MF2L 1Y0LB 5I2IA 3H9HB 1XF3B 1JZ3A 3FOMA 3CZJA 4Q2ZB 4KROD 3U82B 4ZXBD 4E42A 3LEXB 3HRZA 5L8LB 3R8BB 1CTOA 1KPVA 3ZHKA 3CX2A 1ZLSL 1JPTH 1LMKA 5D2LF 1TETL 1YY8A 4UNUA 1HQ4A 5ID1B 4NWTL 1FGVL 1HHJB 2UZIL 5EORH 2QEJA 1HN1A 5H8DA 1PKQE 15C8H 3O6FC 3ZLQC 2EECA 4OI7A 4OUOA 3H8NA 2XN9A 3UPCA 3QHFH 4J3SA 1UYWL 1QBMH 3QCUH 5EO0B 4R26L 4PJFA 3FZUD 4BSVA 4BFGA 2K7QA 5JMOC 3VWKA 5EOTA 1HWGB 3FB6A 1CLYH 3QPXH 2A83B 2R1WA 5EZIH 1AHWC 1D5BA 5LAXA 5C2BH 3BKYL 3FONA 2FH6A 5SV3A 4EVNB 3SDXB 4HS3B 4YEEA 3EDFA 3LV3A 4U1KB 3QIBA 2EE6A 3W5MA 1JWUA 3OXRA 5F9JB 1CDJA 5D1ZA 2VZTA 3KYNB 1ONQB 1QSVA 1J0JA 2OSLB 4P2RA 4HQQH 2BNRD 4CBPA 3SDAD 3GUTB 3WFEL 2BFVH 5FF6A 4FMKA 5DMGC 3O3AA 4P23B 3DX9B 2BK8A 5EU6A 2NY6B 2R0KH 3DVFA 4Y19E 5LXGL 5IG7B 3O9WC 2AJVH 1WZ1L 3O2DL 4U31A 3RVUD 5ADPL 5DSCA 1GOGA 3WIIH 3RNQB 1LP9A 1WWAX 1EVTC 5CBAA 1HHHB 5CP3H 5HHME 2C4FT 3L3KA 3REWB 4L3CA 3VFOA 2EO9A 2PO6A 4XP4L 3SDXF 2KQNA 4BUGA 5A43C 4NJAL 1LEGB 2ICEB 1KELH 4YPGA 1UZ6E 5F1OB 4JFPA 5DJDA 1I1AC 2FDBP 1IT9H 1Z9OA 3GRWA 2P5EA 2BVUA 1JJUA 3SDYH 5B38A 2EDKA 4NQCA 5AD0A 1JGUL 3NCBB 2G5RA 3NN8A 2C1OA 1T1ZB 5E1HB 1KENH 4XTRC 4ODSH 3O0RH 1QNZH 3LEYH 3GNML 5IMLA 4HIJB 5JDSB 5ERWA 3C60D 3IXTB 1KJMB 1F58L 4EDXB 2R8SL 5ESQB 1CICB 1DFBL 2LE9A 5GGTL 4MNGB 4I18C 5F6HJ 3OKNA 1FQ9C 3MZGB 1GGIH 4FA8A 1VFBA 3I85A 5GS0C 1K8IB 4M02A 1C5DA 1Q0YH 1VFUA 4KH2A 3MCG1 5B8CB 4U1GB 3IDIB 2C3GA 2DBLL 5FHBL 2FGWL 5HYJB 2Q7YB 5CP7B 3DVGB 3LN4A 4JPKL 1YEHL 3UBXB 4M6AA 3RY6A 3NFPA 3RWFB 3F8UB 1JYVA 2FWOA 3PGFH 2OZ4L 1P4LB 2HYMA 3DXAD 2WINB 1P5VA 4FTVB 1P69B 1V3MA 1HYRC 4U6XB 1IKFL 3W39B 2AJSH 1JNHB 5F1NB 5I8EA 1OP5H 1F11B 1ZHBB 3HFML 2GJZB 1YEIH 5TE6L 4NCC1 1NMAL 4JO1H 3L3GB 2HTLC 1KXQE 2HTKD 1ZTXH 3BWUC 1ZANL 3CK0H 3CXDH 4JY6A 3RBSA 2X89A 2BY1A 4U05A 1GZPB 1HSBB 3MLXH 4OLZL 5EIIB 5EBMB 3O3DB 2FL5A 3WJLA 1D6VL 4UB0H 5F7HA 3NAAL 1OPGH 4KUZH 4MDJB 1S9XB 1MCWM 5KSBE 1NGQL 4H1LH 3V7AE 1KEML 1ZVHA 1CWVA 3IXAA 4P2OC 2IQ9H 1BAFL 5IHZB 1RU9H 4PJ9D 1I75A 1QACA 4AEIL 1A4JB 2VDKH 5IJVB 5L0QB 4PJAB 5HHXH 5TF0A 1HHGB 3SBWC 4GMTL 5CS7A 1M6OA 4HSQA 1RULH 3K1DA 5DD3H 2WNGA 1CDUA 4DQOH 4QLRA 1EDQA 4KK6D 3TP4A 2BC4B 2UWEA 4K3GA 4MQSB 1VENA 3RDTD 1JN6B 5DWUH 4R90L 1YYML 3MLTA 3F7PC 4XP1L 5E7BA 3EKCA 2WV3A 2MTPA 4P59L 2FGZA 1G0XA 2OJZL 4OGXH 1WCBA 1LO5B 1YQVH 4UU9A 1MHEB 5JPMB 1S9WB 5EOQL 1IKNC 2CK2A 2ZPKL 3U36A 2B39A 1B0GA 4ELME 4S1QH 1FYTD 4ZFOL 1PX3A 3NFSL 4MD4A 3O4OC 1RHFA 2A77L 4OZGB 4YXHH 2DJ4A 3WFCL 4DGYH 2X4PB 5KG9A 3B8YA 2EC9T 3LMJL 3O6ML 3DX7B 3QAZC 2DYPA 4PGDA 4LVEA 1FC2D 4PJAF 1N4XH 4L3AA 3IU3A 3MLZH 2MHAB 4YXLH 4MA7H 2H1PH 2XTLA 2XPGB 2VZSA 4BSWB 3T8XB 4Y4KC 3U83A 43CAB 1K6QH 1KTDA 1KCUH 1T1XA 1UWEH 2BHUA 5EO9B 1PEZA 3D25A 1S7WA 2ILLA 2N7BA 4XRCA 3CLEH 5E2TH 3THMH 3EYSH 1AO7E 1OHQA 3I3DA 1GVIA 2VXQH 1LK2B 2A1WH 4RFNB 3VGBA 3V6FA 3QO1B 1FHGA 1AKJD 1A21A 5E94B 5TQ2H 3RHWK 4N9GB 3PWNA 1DQML 2BVPA 2XWTA 1R3JB 4NKIL 5D7SH 1ERNA 2C3VA 1RMFH 5JW3L 4OZGF 1QRKA 4N8CL 3SHSA 2BJMH 3UJTH 3KYAA 4QT5A 1CLZL 4AMKL 5MEQB 1CYGA 3UC0L 2Z31B 1RJCA 5B39B 3A6BL 3N85H 4J4PA 2EO1A 1UVQB 4W81A 3HB3D 1IBGH 1U0QA 5IB4A 2EKSB 3VMNA 1BQHG 3NPSB 3JXAA 2G60H 4J8RA 4LSPH 4WI2A 3BPOC 4LLMA 5LGKA 4YDJB 4FQJH 5GISH 1PEWA 3ARRA 4JFDE 5F96L 3G6AB 3MRBB 1J8HD 4F33B 4OF5A 5FB8A 4LOUD 4ZQKA 3VWKC 4NWUH 4R4BA 1QR1B 2HJKB 3IKKA 2JB6A 4J1UA 4JHAH 5DO2C 4OZ4B 3NOIA 2Z0BA 4I13B 4CGTA 3QUXC 4RIRB 4FZEH 1AFVL 3S7GA 1AGFB 3RPIA 1FBIH 3QCTH 5D1ZC 1DLHA 5T1DH 2XQBH 2VDML 4MS8C 1SJVA 1PKQA 3IDXH 3BD5A 4Z9KB 4MJIB 3ULSB 4PR5B 2YBRA 3MNWB 2UUDH 2QJDA 5T33L 3IF1B 1KXTB 4AY0A 1MI5E 4KTDL 2X4RA 5ALCH 3U9PL 1Y6MR 4UTBL 3QFDA 4NPYB 4OB5H 1Z3GH 3BZ4B 1YEFL 2QSTA 4HCRL 3U6RA 1FIGH 4BQ9A 1A7PH 4M48H 3O6FB 1H8NA 1XCTB 3QUZC 2BSSA 3TC9A 4XCYA 3NPZB 4C83A 2NY4B 1G9MC 4Y4HB 1JPGB 4I48A 1MIML 4J7RA 3HUJA 4LPXA 4XP5L 4K71B 4NZRL 1X4ZA 1S8DA 2YC1A 3DGGB 1I9RL 4XAWL 1SMAA 3UTQB 4OD1L 5GGRA 4FHBD 3H6JA 2ZUWA 4UDTB 1AHWB 4HIHA 1ZVSB 5J89A 2C7UB 1D5IL 4MAUH 2YSSA 2ZCLH 3T0BA 4KK8D 1E4WL 4G7YL 3VCLB 3DLQR 4GXVL 4Y19A 5I1EL 1KPUA 3DV6B 3RBGA 5IROA 4HZLB 1U8LA 3P0GB 1FLTX 3WXWL 1Q9WB 2P45B 1NANH 4BA8A 4YC2C 4ZFOB 5C0JB 1TZIA 2QTEA 4DW2L 3DETC 2R0ZH 1JZ8A 2IAND 4JB9L 4M1DH 4Z0BL 1FFNB 3IGAB 4JVUA 1K4CA 3L6FB 4C56D 5BMFL 3ARUA 1GGBH 4FXGB 5DTFB 5FYKL 3V5DA 1FNEB 4FZ8H 3QIUD 2XY2A 3ULUC 2HFGH 1CT8B 4NQDB 1AGDA 1NFKA 4RFOH 4QXWA 3RY6C 4CU6A 4NSKA 5IBTL 2VXUH 3G9VA 3INUH 4H26B 1HKLH 1A1OA 2W38A 3OKKB 4RAVA 4YE4L 3UMTA 5CAYB 3MYJB 12E8H 4XCCL 2F19L 4FQCH 1INDL 3VD4A 2P5WE 1MCIA 3PABB 4DK6A 2VE6A 5DJ2A 5ISZB 3T1FA 3ET9F 1SY6H 1RUQH 5FXCH 3QDMD 2WIMA 3EJJX 5D7JD 3KVQA 4DJMA 3EDKA 4AL8L 4LVNC 5EDXA 3E2HB 1XF2B 2G2RB 2FATH 3R8QA 3WIFB 3RX7A 4JPWH 4Q97A 1TPXC 5HYEA 2FX7H 3WJLC 2KL6A 4LSQL 3EDDA 3HZKB 3QXAB 4ACPA 4P9HC 3KNBB 4XPAH 3SGDH 3HR5A 2HLAA 3OX8B 3KPPB 3OR7B 4LEXH 3S8WA 3HG1E 1CIDA 4LHUB 3TVMA 3IAPA 1G9NH 3IFNL 4Z78B 3KJ6L 5C7XH 3B2UD 1F4AA 1CZ8H 5FGCB 4JRYB 3LS4H 2EH8H 4YK4C 4TTGA 4OLVH 3L5WB 3TBYA 4JDTL 4PRAB 5E6IA 3T3MF 3D2UD 4FQXD 1EO5A 1MJJA 2C26A 4DKEL 5I1DB 1A6VL 1AI1L 5IJKA 3K80A 1KNOB 3MQIA 3CVHB 5EZLA 3JUZA 2DS4A 2NY1D 1UA6H 4LSVH 4GLRH 4X6DA 4QNPE 1ETZB 4ZYKB 5KSBA 3S4SB 2D7QA 5F97E 1U93B 4APQC 3SE8L 3KPLB 4YQXL 3ZSSA 1E6JH 3VDBA 4KRLB 3WNLA 5AYQA 2CIKB 3OWEA 4UAOB 1A64A 2EYRB 3JV4A 4NO2B 3AAZB 3T0XA 3O8XB 2XACC 1BX2B 4QTIL 4XP6H 2GK0B 3ULVC 5DS8B 3DMMA 1MCBA 1D5XA 1IM9D 2DQDL 5EUKB 3BSZH 2Z91B 1F2QA 1P7QD 4HIEA 5T3ZL 3JV5A 2AW2A 4TTDD 3BDXA 3ARGD 3FHAA 4OTXH 4QHLA 4EZMA 2V2WA 4GG8B 1I8LA 1EGJA 4IJ3B 3AU1B 3QP3A 4PTUA 5IVXB 3A67H 3FFCB 4XCNB 4ZUTA 1LEKB 1JGLL 4FABL 1R5WA 4FQLH 1MJUH 4P3CL 1N59B 1JGEA 1R5VA 4AIOA 4TUJA 5JO5B 3QHZL 2BVYA 3DURB 1T1WB 1S7RB 4ELMA 2VL4A 3RVTC 3IB4A 2W92A 2X4UB 4MMZC 4JHWH 1CXIA 1F8TL 4I0KA 4KKLC 3U4BH 1OT1A 1FDLH 3HNSH 3BN9C 1YECH 1DQQA 1VACB 2A6DA 4ZUWB 1CL7L 2Z4QB 3P4MA 2ZUQC 3D9AL 4NIKB 1LHZA 2VC2L 4EDWH 1P1ZA 1EEZA 1AC6A 3GHEH 3QIWD 1O7SA 1TVHB 1XIWC 1B90A 4J4PC 3I6KA 1YNTB 4PREA 2MNUA 5CZXC 5D72H 2OL3A 3ZHLA 1I7UA 3MJGX 4X7TB 3QEQB 5I71C 2BVOB 4D8PA 4L3ED 4PGBA 4EI5A 5H37H 4P2QD 1MWAA 1DBBH 5IVXF 4Y1AB 1QSZA 5FO9A 1AO7A 1BD2D 2D0GA 5CEZD 4RGMC 3SPVB 4RMSA 1S78D 4CNIA 5DUBB 3UROR 3QZWG 1HILB 3G5VA 2CUHA 3REVB 2V9QA 5AWNH 3MRCA 3QQNA 5DC4B 1ORQB 5E4IA 1I8KB 2PXYB 3O3BB 4IRSD 5JZ7D 2W0KA 5GGRY 1C08B 1QLFA 2FX9L 1QEWA 2RHEA 2EE9A 2SEBB 3QWRD 1JPTL 5HVWA 1JFQH 2MWCA 5DDHB 3WIHL 5TH2A 5EORL 5TFSL 3V6BR 2ADGB 4OCMC 1FZKA 3BZFA 2EYSB 4PJIE 4QRQA 3FQRB 3PQYD 4PJ5E 1XR9A 3T2OA 3WL9A 4GSDH 1TDQA 5BVPH 1AXIB 3QHFL 3FQXB 5DZOA 3QCUL 2EDEA 3MGOB 4O2CB 3HE6B 1I3UA 2FZ3A 4MX7A 3MXVL 1HXMA 4XBGA 4CVWA 2ARJQ 4BH7B 1MHHA 5DRNA 3U0TB 3MLWH 3O11A 4K7FA 5EZIL 1G7MB 1VESA 1CFQA 2DJUA 5C2BL 2NNAB 4F7EA 5C0FB 1DQTA 4Z76B 4X98B 1DVFB 4ESKA 2JK5A 3NCYP 4HKXB 5ESVA 4HGWA 1V3JA 4LIQH 3MRMA 4R7DB 4PJ7B 1A22B 1OLZA 3X3GH 1KJVB 5TGBA 4HJGA 5C71A 4TSAL 3ILQC 1IGYB 1RIVH 3SEPA 4HQQL 5DURD 1HOCB 4GQPH 3KXFE 1A6AA 2PCPB 5D1XA 3O3EA 5GGQL 2OXGA 2CRZA 1CFTA 1MI5A 5J13C 4HUUB 1I1CA 3IFPB 1YEEH 3SCMA 5KVFH 2R0KL 3C8KB 4RMWA 3OSKA 2VLJB 3PL6B 3EYUL 5IROC 2AJVL 3MRGB 1ZHLB 5LWYH 2HJLA 3WDJA 1LE5A 3WIIL 5D1QD 2DQFB 2PTTB 3C2SA 1WV7T 2VAAA 1RZIB 5E2WH 2HVKA 3LKSB 1REIA 3KPQA 1MJ8H 3T08A 3X14B 4HLZG 2HAZA 5D70H 4PB9H 1KELL 2ARWA 3T0EC 1DBML 5FO8A 2YEZB 4PJ7F 5E9DD 1IT9L 4NQED 2IBGA 2V9RA 3MRQB 4PJGB 4TULH 5L8JB 3SDYL 4X99A 2QQNH 2MCG1 5F7FA 1ODAA 4G8GE 1U92A 4ODSL 4I0CC 4OLYH 3BRFA 2MKLC 3O0RL 1QNZL 4D9RD 3RVWD 4QEGA 4UTAH 3HCVA 1KLUB 1NGZB 3GMNB 4JAMB 3MPCA 1MRFH 4XZUB 2PR4H 3RGHA 5E8NB 1HDMB 4KMQA 4E41B 1IGIH 5L2KB 4K9EH 4HS6B 4OZHB 1OAYL 5HTSA 1W72A 1OAUH 2F9BT 2FSEB 1NBVH 4UDUB 4NFBA 5FHAL 2CLRA 3BP7B 1KULA 3FB8B 4FMFA 4O51B 5ITBH 2IH1B 1T0MA 3ABZA 1U6AL 3AB0B 4G6MH 4WI6A 1A1NA 1JUFB 4LCWB 1G0DA 4YO0B 3TVMC 3TA3B 3FQUB 4PJGF 4PJXB 2AJ3B 3VMPA 1YJDH 3MV9E 2P5WA 4OCWH 2PW2B 1Z5LA 3DUUA 4AG4H 5SWQA 4YNYA 4P4RA 4WI4A 2CLZB 4EXKA 4NQTA 2YPLD 3OL2A 4ZPVA 2FIKA 2B7DT 5GRZA 4YR6B 3GSWB 1CGVA 1FAKT 5F7UA 1ZTXL 2PYEB 3CK0L 4O2FB 4ZO9A 3CXDL 3UZQA 2GUOA 4HIXL 5J0BA 4HX1B 2W9DL 4DN3L 1UXSB 5IJKC 2P48B 3MLXL 5EU7C 5JHDB 4LF3B 1ZS8B 4OZHF 2R2HA 4PRPB 7CGTA 3GSRB 2E7CA 4LPWA 1OPGL 4KUZL 4U1JB 3U7WH 4HAGA 4XMLH 1YEDA 2Q6WA 4UOW1 4G8IA 1AGBB 1MREH 1L6ZA 4HWBH 5DJ0A 3HG1A 3MNVA 2FYYA 3LN9A 4M8QB 4B5EA 3LKOA 4X9GA 2IQ9L 5I8CA 5F9DC 2IALB 1RU9L 2LABA 3CDFA 5HHXL 1BLNB 1OQXA 3PJSA 4PJXF 5IESH 3DMMC 2IG2H 3NZ8B 4OI8A 5T3XD 2X5PA 2L4OA 5DD3L 2UZYB 3T4AB 1G6VK 2VQ1B 5DRXB 1AGEA 3TJHC 5EBWA 1T4KA 5HI4D 5FM5O 1VFMA 3MV8D 1I8LC 2EZ0C 5DWUL 1MRDL 4IBLT 1K8DB 1L7IH 2LU7A 4YBQD 3BPNC 3TYFA 1YQVL 4RGND 5I17B 1I1FB 4C56E 5I1LA 1SJHA 3WUWB 2BDNL 4OLUL 3S3PA 1QRNA 4I3GA 1WT5C 2RBLA 4NDMA 2VDNL 2K9UA 1CDCA 1L6XA 2F74B 4S1QL 3LKQB 3PV6B 4QRSB 5T5NF 3BHBB 3DUSA 3UTPD 1S3KH 2EDRA 5INCA 4YXHL 4DGYL 3PXHA 3MGTB 3N9GL 3ESVF 3DVIA 4OM0L 3UO1H 3VFSB 1N4XL 3IT8D 3OAYK 4ZNEE 3KPSA 3MLZL 3C60A 4YXLL 4MA7L 2H1PL 4LKCA 5GJSH 3VH8B 5L2JA 3I9GL 4IIQB 5JNYA 3QDME 3LH2L 4TPRL 1BQHA 1K6QL 3MA7A 4UILH 4PLNC 4JY4B 5C8JB 1KCUL 4MQ7B 4TVPH 2OJEA 5IMMA 1EIBA 1J11A 2APWA 2XXMB 3GHBH 3CLEL 4UQ2B 5E2TL 4FG6D 1T1YB 3EYSL 4BFEA 1BOGB 4HK3J 5FIEA 5C0DA 4Y2OA 4ZTOL 3L3HB 3I50H 5JORA 3QXVA 5TQ2L 1PQZA 2I9LB 3ARWA 3QEGH 2HFFA 3MR9B 1XGRB 3H9SE 3DROB 3HE7B 5J3HC 2QSVA 5IB2A 3O2WH 3EO0A 2R2EB 3FT4B 3OF6D 1N8ZA 2MCPL 3N85L 1A6UL 2BNQE 1IBGL 5HI5D 4X83A 3RWEA 1ZSDB 4KGLA 4JR9H 2G60L 4LCCB 3IJHB 1IC1A 4MVBC 3WMSA 3ULVF 3NIFE 3U0WH 2DQGH 3G5ZA 5GISL 1A4KA 3EW3B 2H26B 1XIWB 4YHYC 5DEGA 2GITA 2IPKA 4PJ8A 2JTDA 3MCLH 3VMOA 4Z7OF 4QHNA 1HH9B 3VI4F 4QHUA 4PJ9A 5F7LB 1KN2H 4JHAL 5GRJH 3QJHA 5EZJA 2FEDD 3QWOB 4RGMB 2NZ9D 2FH8A 3C5JA 4FZEL 2Z9TA 4Y5XA 4JM2D 1IEBB 3ARDD 1FBIL 3KGRA 1U9KA 5CSBA 4ONGL 3QCTL 2NLJB 2XQBL 1QSFB 1T22A 1U2HA 3IDXL 4OQ1A 4XVJH 3RDTA 4F7PA 3VGHA 1PD6A 1TCRB 3MSPA 4PJ5A 4PJIA 5D1XC 4P4KB 3RY4A 1DUYA 3SCMC 3MV7D 4NZDA 5ALCL 3KYKH 3P11H 2VISB 4OB5L 1Z3GL 1P4BH 1MAKA 1NKOA 2R56L 1ZLVH 1HNFA 1I8MB 3ULUH 4ZD3H 1FIGL 1UKQA 1A7PL 4M48L 3MLPA 3W0WB 4G3YH 2EIZB 5DK2B 4K8RH 3GSNA 4HMCA 1CDHA 1P7KB 1J1OH 1Q9LB 4EXPX 4YHIA 4RZCB 4RFEA 2A6JB 1BGXL 4HIIB 5FYJH 3ARBB 3KXFA 4RAUA 3UAJC 5BZWA 2W60B 2EDLA 1TVBA 3BP4B 3OZ9H 4I4WA 5EA0H 2ZCLL 4NYLB 1FC1A 3MO1B 4M7ZC 4NZUL 3Q1SL 2CDFB 1ZE3C 2W59A 4PLJD 2BSTB 4P2QE 5K59E 2F53A 1BD2E 4LLUA 3UJJH 4I0PB 5E99H 3VWJB 5CEZE 1IGCH 3Q3GB 4XB7A 5GIRB 3D85A 4MWFB 3VRIB 4JQXC 4P9HH 4F7CA 5KTEL 5C9JB 5J6HA 1MFDH 1AKJA 5SWSE 5I9QC 5DR5H 5C08B 1KUMA 1RZGA 2DF3A 4V2BA 3J8F7 3QQ9C 4GBXD 1JCKA 4HMEA 2APVA 2BVQB 5BZDB 2CLVA 4FXLA 4WWKD 4G7VH 4KUCF 1GGBL 4H0GA 2DICA 4Y4FD 4FQQA 2WWMD 3OKOB 1NPUA 2E6JA 2UY6A 2OTWA 1I7TA 2HFGL 1N3NB 1NCAH 4RFOL 5FOBB 4U4BA 5BXFA 2VXUL 3VXQB 4G8GA 3OV6A 2PUQT 2B4CC 2W65A 12E8L 2VB5A 4HUVA 4M6OH 4Y2DD 1MQKL 5GSRA 1NC4D 4PRBB 3T0EB 4S2SB 3RI5K 2Y1VA 3QISA 3IU4L 2MPAH 3EYOB 5JW5A 3BIKB 5L7XL 2MSPA 3C5SB 4BQ8A 4NKDB 3MCKA 3S34H 3AXLA 2WBJB 2VKXA 4PRIE 4OZFG 4EOWH 3LQMA 3P4NA 3CPLB 4POZD 3ZTNH 2FATL 5C09B 4WHCA 3DO7B 3ZE0E 2V17H 3LQAH 4ZAKA 2FECL 4C58B 3F58H 5E70A 4QOKB 1ULVA 4GXUN 1U8NB 2XKUA 5JOFB 1I8IA 2P49B 3UZVB 3HZYA 3TV3H 1KG0B 4D3CH 4M9PA 4X6FB 3L9RA 1MFCH 3SDAC 3T3PE 3WNPA 4X7EC 2X1OA 3MV9A 1FN4A 3TBTA 5C7XL 1HINH 3L7EA 2ZSVA 1OCWH 1DLFH 3VFGL 3P9LB 2B1HH 3L3OB 1ZGLM 3L95B 3QUYD 3LS4L 1KCSH 3E6FA 4OLVL 5E95B 3TO2A 3GSOB 1F4YL 4BZ2H 3RVUC 4KY1H 3MRHB 3TCLB 5FK9A 1ZLUK 3RTQB 3KJ4C 4U1HA 3ORJA 2EXYD 1HHIB 1AD0A 3KLAA 5DJ6B 1BF8A 1UA6L 4MQXD 1KCRL 1AXSB 1J1PH 3I6GA 1J0KA 3EYFA 1EFXD 2H6PA 2NTFA 4M6ML 3ESUF 2R2BA 4H8WC 3CAFA 5E1AA 3QB7C 4PJDB 3RWCA 3SKUD 5IW6A 3TWCH 5F88A 5E9DE 3GGWB 2FJHA 3DI2B 4EI6A 2VN7A 4LCIL 5DLMH 5I6XC 5FECA 3MXWH 1HZHH 1QLRA 5F7EH 5I1HL 3TPUA 3BSZL 5ILTH 3IDYC 2GSGA 4NZTH 1U8KB 3QEHA 1K5NA 3C60C 1GYAA 4BJLA 4LCYB 2GK2A 1H8SA 4FFVD 2VOTA 1A6TB 1OSZB 5E5MA 2GAZB 4P5MA 1H0DA 4X8XA 3T2NH 2YD8A 4C56A 3PWUA 3VFTB 1MJUL 1YMHB 4XI5D 4U33A 4G42B 5FUOL 3RWDA 3CUPB 1I9IH 3BIBX 4ZS6D 4JHWL 5D7LA 1AIFB 3JUYA 4PJDF 4RSVA 2IF7A 2OK0H 2CRIA 5F8RC 3WLWC 1FDLL 3BPNB 3E0GA 3OAZK 3IETB 2W1NA 1BOYA 2Q86B 1DUZB 5CSZA 5EC2B 1PY4A 4MJ6B 3I02A 3NTCH 4ZNEA 5I15H 3B9KB 2F58H 1GC1H 4EDWL 3GHEL 5HDBF 3SDDA 3QDMA 4ENED 2FD6H 3BPCA 3BD4A 4LLVB 3I3BA 1SEBA 3GIVB 4ZOAA 5DYOB 3FT2B 1E27B 5HXMA 4PLOB 4D0BB 1X3DA 3M1BB 5BV7C 1KGCD 4L1HA 3D87B 1KF9B 3FT3A 1UT9A 3BAEH 4KPHH 4AZ8A 3L5XH 5H94B 3EIFA 2ATPB 4Z0XA 1JHTA 2I07A 3DTXB 4Y5YB 4PJ8C 3DX6A 2Q1EA 5AWNL 5EOCH 2B4CL 3ECBB 2NW2B 4D9LH 3PP4L 3H9SA 4PJ9C 5AAMA 4JG0H 4LBEB 1F4HA 4WO4B 3Q6GL 2IH3A 3LKNA 2NY5H 4WEBH 5T1LD 1FL6A 5GSVB 4NC1E 1TTGA 2VZVA 3LD8B 4PP1D 4Y5XC 2BNQA 2E5EA 3G5XB 2YD6A 3QDAA 4WHYG 3R4DA 5T3XE 3H0TB 2GTWA 4X6BB 3PP3K 5D5ME 5EBLA 3VGEA 1FRGH 3EYVA 5HHVL 1VGKB 4WTZG 1NC2A 4QXGH 4C4KO 4NC2B 3GMRA 3RDTC 1FZOB 3MV8E 1I3GH 1SVZA 3QXDB 2OMNA 1NAKH 1CCZA 1NGXA 4ODHL 1QOKA 4YUEH 2GEEA 3X3FL 4RGNE 2P8MA 4LSTH 1WVZA 4X4XA 4QRRB 3MJ9H 4LEOA 1KYOK 3MRKA 1CGUA 1YEGL 2AJZA 4NFDA 3MLWL 1BFVL 5E6YA 5JHLH 2W0LA 1DSFH 2NX5B 3AREB 3VFPA 5D96C 2NY3D 3WO4B 1N5AA 1HI6B 3LY6A 5HD8D 1RZJH 3TIEB 3OJVC 5KS9B 4X7SL 2AEPH 4PG9B 1GGYA 1P7QA 4H0IA 1KIUA 2VWEE 4XMPH 3TIDA 3D39E 3BO8B 1RIVL 3BEVA 4N8VG 5HYJD 3AS1A 3BP6A 3VXSB 1EX0A 1XGUB 3MGAA 1YEEL 4ZFZB 1LWRA 4L5FH 4PGCA 4H8WL 4OIIL 4PJEE 4J6RH 2P4AB 4CVUA 3KWWB 1K4DA 3O4LD 4FTVD 3LEVH 5LWYL 2QSCL 4H1LG 1XMWA 1NCDH 4M9OA 3SO3B 1ZEAH 5ICXA 2APFA 3DWTA 5E2WL 5F70A 5IF0B 3OG6B 2BRRH 1R3KA 4Z7UE 2C1PB 3OGCA 4LP5A 5GHWH 5MERA 2IAMB 5DMJB 5IK3A 4LK4A 1Q9OA 5D70L 4PB9L 4PYHA 4PRHB 3SJVB 5KS9F 1TLKA 3NIDF 1ACZA 1FORH 5C0AB 3IDUA 3E6HB 3EOAA 3NCMA 5EC1B 3HB3C 1RZ8B 4TULL 4WV1A 1S7SB 4QRPB 3OB0K 4U1IB 2QQNL 4HS8L 2FHCA 2ZJSH 4P2QA 1U91B 4JFOB 4X6CE 5EG6C 3C6LA 2DM3A 2HJFB 3DNKA 4OLYL 1NMCB 4RX4A 3PGCA 3M8OH 4NOBA 4UTAL 3WHE1 5SWSA 1YN6A 5IEKB 1F90H 1MRFL 2IQAA 2PR4L 4LOUC 1J05B 1DN0B 2DI8A 4KXZH 1IGIL 4K9EL 3PUCA 2XWJB 1I1YB 2V5MA 3P0VH 3DECA 4EQ2A 4L8SA 3EFFB 5ITBL 1CFNA 4JO3H 3WNKA 1QO3B 4G6ML 4ZODA 4YHNA 5I9QB 1BIHA 1EHXA 4TSCH 2XWBA 1S7VB 4K23H 3HMWH 4AEEA 4BK4A 3FOLB 1Q94A 1IAKB 1EGJH 1DP0A 4KROB 1KYOJ 2WSKA 3KPOA 3PGDA 4ZXBB 1YJDL 2AXFB 5F89B 4OCWL 3V9FA 4AG4L 4XVSH 5KVGH 4HPYH 4IRZH 4NN6C 3FKUS 3QCVL 1LD9A 3JV0A 1Z0MA 4UQ3A 2AV1A 3OBAA 3MV7E 1BVKB 3VE0B 4Z8FL 1JK8A 4PRIA 5DD6A 1SJEA 3X13B 1FL5B 5I1KH 3QUMH 4S1SL 3HZMB 4HBCL 4XXCC 3IS1X 2G9HA 4L9LA 1FE8L 3IDJA 3K46A 1I3RA 1O7VA 5DJZB 2N1KA 2X9WA 1FNFA 4HUNB 3U7WL 5TDPA 3I2CH 3ILPB 4XPBH 1MREL 1IRAY 2J5LB 5ICYB 1PY9A 3TNNA 2D7TH 1FAIH 4J3VA 5F72S 1WFUA 4JREB 2OL3H 4KK8C 3GK8H 1N0LA 1JYNA 5IESL 5I75C 5IFHH 3S88L 3TFKC 1PX4A 2IGFL 4JANA 5DD0H 1ZA6A 3S96B 3LKPB 3GDBA 2Y5TA 3IKCB 2BNRB 4PGEA 4HULB 1EHLH 4MA3B 5CJBA 3BKJH 3OQ3B 3FL7A 2YRPA 4O58H 5HGHA 1L7IL 3P77B 2ATKA 2E8YA 2DWDB 5BRZE 4IOSD 3RWGB 2GHWB 4R2GC 5AYUH 4UUJB 1IAIH 1ORSA 1OP3H 3WFDL 4HUXA 3CH1A 3LPFA 2H2PD 1SQ2N 2R15A 1MNUH 1T5XB 3X11B 1KLGA 4GG6E 3JSSA 3BVNA 4M93C 1S3KL 2Y72A 4TNWF 5DJAB 5SX4I 3U7YH 5CFHA 4XPFH 3H9ZA 1D9KA 4U7SA 1NAMA 5CUSH 1LDSA 3GMQA 4NN7B 5I66A 5GJSL 5D7JC 3DV4B 1OOAA 1EJOH 1II4E 1JPSH 5F6HI 3CSBA 4UILL 4M43H 5I6XB 4NCDA 4TVPL 3MNZB 3SKMB 3BYTA 4CL7A 1S7QA 3U9UA 1P84K 1URLA 4HFWB 1B3JA 3IDYB 3FRUB 4MJID 4U1NB 2X9YA 4NRXA 4HEME 4X7DC 1XH3B 2FECI 4BQCA 3FO0L 3ZE2F 1IC4H 3S36H 4MGXA 3QNXA 4HWZB 2VDPH 1WICA 3I50L 5GRXG 1NDMB 3D0LA 4WW2C 2X9XA 2VITB 3R06A 4K94L 3O2VL 3QEGL 5FCUL 3MFFA 4AH2A 2A74B 3BX7C 3GJEA 4L29B 3B2UC 2VERN 3O2WL 2NY4D 1NGYA 1NGPH 5C07E 4Y4HD 4U6TA 4HG4K 2R1YA 3ZKSD 1RSFA 4UOW0 3U0PB 4ODUA 4QRUB 2F54E 1RK0B 3NCYS 1MCFA 1UENA 3PNWB 5D2LE 5J11C 3DXAB 4O5LH 1LK3H 2VDRH 4BH8A 5J6GA 2ZG1A 1OAZH 2EDTA 2CJUL 2NY1C 5E8EB 5ELIA 4JLRB 3U0WL 3JTTA 4KHXL 2LFGA 2Z93A 2ADIB 2X1XR 3DOSA 3KS0H 3F7YA 3U2SB 3H3BC 4JFXB 5JXED 1TZHB 1IGTA 5GRJL 2JCCA 3F12A 2CDGA 4B53A 1X4YA 5D93C 2LVCA 1DL7L 3MRLB 5DD1H 1EAPA 3PWVB 3VXTB 1J88A 3MREA 4TUOB 3RHWF 4NHUA 4FQ1H 5D5MA 4JFFD 5E2UH 3RL2A 4TTDC 3ARGC 3RWJB 2Q20A 1UCTA 3EJYD 2A6KA 2B1AL 5C0EB 1JYWA 4XVJL 1UKSA 3MV8A 3TO4A 4DZBB 2I9TB 1F4XH 1HXYA 1TNNA 2J4WH 4F7MA 4GMSH 2B5IB 1WISA 3S5LG 1XGTA 4G80A 4NNPH 2OR8A 4M6NH 3UPRA 4FFZH 4D0DB 1SYVB 3KYKL 4ZOCA 1DCLA 5ID0B 1PYWB 1P4BL 4MAYA 3MUGB 2Z8WC 2Y06L 4ZUVA 2XV6B 3RGVA 1BQLH 3MLSH 1N5YL 4U6YA 2DI7A 4ONHB 1VEPA 4OAWB 1UM5H 4W6WB 3WJJC 3B43A 4K8RL 2XNAB 2Y7QB 4NKQB 4Z77B 5DRZB 4M1GL 1EJ6A 3JBG7 2BX5A 3D39A 1XR8A 4NBYB 3SDXE 2OTUA 5FYJL 1J9CT 3QIWC 1FYTB 5FM8A 5M95B 4S1DC 1G0YR 4NRYB 3V52H 4PB0L 2R9HD 3K8LA 3DRQA 1U8IA 4Y0GA 3OZ9L 5EA0L 3GO1H 2CO7B 4WV1C 5FGBA 2UYLA 2VLLB 5BJTA 5I18H 4LNVA 5DFTA 4LHUD 4YHPA 3HZVA 4PJEA 2YPKA 5I2IB 4RDQG 3B6SA 2OI9C 4PRDB 3C6LC 5E99L 3TNMA 4JPVH 5HGGS 4BFIA 3SDCD 1B0RB 5CHNA 4M5ZL 2O61B 4JRYD 4M7LH 1KPVB 1MFDL 5F93C 3W5NA 3FQTA 4NUJA 4OZFA 5DR5L 3SKOA 4HG4J 3D18B 4LARL 4G9DA 3AS3A 3HI6H 2WM0A 2DLTA 3CNKA 4OCSL 4GAFB 3CFKA 5DK3A 4IRSC 4YDLC 4G7VL 5JZ7C 3L5IA 5DQ9B 3GSUA 3T0DA 5HVHB 3MRIA 3OF6A 2XN9B 4KJQD 3PG2A 4PJFB 1RJLA 1H5BB 3QNZA 1MLCA 4F15B 5EOTB 5C0RL 3FB6B 2QQKH 1CGTA 1FZJB 1RIUH 2C9AA 3KPMB 5KSVB 4X6CA 5I8OL 3O8XD 4M6OL 3E8UL 5KSAA 3VG9B 1D5BB 4JFYB 3DUHA 1IAMA 3QNYB 1ZT7B 2DMKA 4NUGL 1NCNA 1X5HA 3JTSA 2MPAL 2QKIB 3ZDXF 3QIBB 4MCZB 1T2QH 5IM7A 1S7TB 3S34L 3T77B 3B5HA 2LV4A 4ZPTA 5GXBB 3ZTNL 4MNGE 4XHJC 2V17L 3HNVH 3LQAL 5TQ0H 5DJXA 1BVLA 5FF6B 5J57B 1J8HB 4U1MA 3TN0D 1WWWX 5BVJA 4JQVA 1NFIA 1WC7A 1UB6A 4MNHB 2A9MH 5AEAA 4XNQA 4UIMB 1YN7B 3DYPA 1DDHA 1OAXH 4PJFF 4XX1G 3EFDH 3B8SA 5DSCB 5HYJE 1HINL 3RU8H 2CDEB 2W0FB 1OCWL 4MMXC 5HPMB 2B1HL 3QDGB 5KN5B 2Q8BH 3VGDA 4JM4H 4L3CB 1R0AL 3VFNB 1M71B 4JO2H 3TT1H 4PTTA 4PUBL 3VFOB 3H7BA 2VR5A 4FTVE 2RAMA 4KY1L 1RZFH 1G7JA 1TMCB 3BZDA 2IPUG 4EBQH 4YX2H 3FCTB 1GZQB 3RP1A 1P9MA 2QADB 3WFBH 4IS6B 2H8PA 1UJ3A 1GAFH 3V5HB 4NN6B 1B6DA 3BJ91 3U1SH 4JN2B 3QEQD 1ZLWK 5B38B 3CFEB 5I1IH 1J1PL 4NQCB 5AD0B 3WFHA 5A16B 4P46D 2OTPA 5GZND 5HHQA 4LLQA 3IJSA 4HT1H 2A73A 5FYKD 4BUHA 5IB3A 3WXVH 4LRNL 3VXPA 4AIZB 2HG5A 3NH7L 3V5KA 1LO0H 4EUPA 4MJ4A 1FZMA 5F6IC 5IQ7H 1MH5B 3MXWL 1HZHL 4XGZA 1U8MA 2ADFL 1S5HA 2R23A 1D9KC 3KYOB 2PXYD 5ILTL 1YQ2A 2AABH 2A9NH 2NY2C 4XH2A 1P7HL 3HAEB 4PJAE 4G6KH 4KC3B 3RVWC 5FA4B 2FR4B 1D3CA 4OSUH 3UJIL 5TDNB 2GI7A 4KJWC 1VKXB 4GBXA 3HN3A