3EW3B

The 1:2 complex between a nterminal elongated prolactin and the extra cellular domain of the rat prolactin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
203
structure length
203
Chain Sequence
b'MQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prolactin
molecule tags Hormone/hormone receptor
source organism Homo sapiens
publication title Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2.
pubmed doi rcsb
total genus 27
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B01
3TO2A 1T4KB 3DNKA 4J3TA 4LGRB 3UZEA 3KPSD 1QSZA 4PJGB 5LJYH 1EBAA 5D93B 4D2NA 1NBZB 2X9YA 2UY6A 4NZJA 1ACYH 2D7OA 3MV11 2CMRL 4BSVB 5DVMA 1MCPH 1T1WB 3L3IB 5EB9A 2YWYA 3OBAA 3OG4B 5CILH 4KKBC 1XZ0A 2XA8L 3I9GL 3C09B 3LS5H 3WHE0 2AQ1A 2FJGA 3ULSB 1CXKA 3SOBL 1WK0A 3MRFB 1RHHA 5JZ7C 5JNYA 4M61A 1MVUA 3FB6B 5D7IA 3DV6B 3I50H 3O3BA 1KJ3L 2Y06L 4W6XB 4AIXA 4GKOA 5DI8B 5D1ZB 2Z4QA 4B41A 3O4LA 5K33A 4QOKE 1BM3H 5JW3L 5I1EH 4GBXD 5D5MA 4AEHH 2FEDD 4RX4A 5BW7C 4FQXB 4JZJC 2VABB 1P9MC 3MRIB 2VTFA 4CVXA 2W92A 2XV6B 4GMSL 4O2CA 1U3ZA 3VXQB 3QDMB 1LK3L 2VN4A 5DJ0A 5B8CA 3JWOC 1NMCB 4OSUH 1LO5B 3D2UA 1UKSA 2AJSL 2CK0L 1SYSA 3EZ8A 3NIGF 4ZNEE 3BUYA 1FJ1A 4GW5A 2VDQH 3D69B 4HPOH 3NPSB 2X4OB 4FG6C 3KLHC 5BOZG 4XWGL 3ULVF 5FUOH 4LSRL 4UQ2B 4NO0D 3VH8A 3KJ4B 4NQXA 2C4FT 5HY9A 1UM4H 1OTTC 1QBLL 2BNRD 2ZCKH 3ES6B 3O2WH 4JPWH 4NNYB 4AYFA 3SDDC 3RVUD 5TH2B 4PJDF 1ORQB 5FDWB 1F2XK 4HLZG 4LOUC 4WI6A 5KVDH 5HVGB 1RZ8B 1A64A 1R5VA 1ZA6A 3W82A 4F58L 2C1PB 2DJSA 5EORH 1JPTH 2F15A 4LPYA 5C0AA 1IKNA 4JFEA 5CJBA 5D6CA 5FEBA 2CDEA 4GSDL 1DN0A 1S7VA 4LLYB 1T3FA 4CW1A 5EZJB 1G9MH 2QQKH 4PJ9C 3I85A 5E8NB 4PR5B 1RULH 2DTML 4NRZB 1RUAL 4LPXA 4K3JH 4ZOCA 1KELH 4M61B 1V5JA 2FATH 3NCBB 1W72B 5D7JB 4WVRA 3MV8E 1RIHL 2Y6SC 3CFCL 3QDJA 3QUYD 1RHHB 4RNRA 1JZ4A 2WUBH 4PY7A 3WFHA 2FJHB 4M7ZC 4L8CA 3L7EA 4YUEH 2QQNL 1YDPB 1MQ8A 1JHTB 1BOYA 1HYRC 4FMKA 3TZVB 4XB7A 4OZ4A 5IFJA 1I4FB 1E4KC 4GQ9H 4I2XA 2V7NB 4YHPB 2J88H 4J12A 2L0DA 1I9JL 4PBWD 3DVGA 5IMLA 3SE4A 4LRNL 4LVHB 1XCQB 2R2EA 4KH2A 2DIJA 4S10A 3F7YA 3NA4A 3G5XA 3V6ZA 5IHUH 4PBXA 1V3LA 3ZTNH 4ODVH 2X9XA 4PJ8C 1YYML 2DDQL 2WINA 1TPXC 3KG5A 4OFDA 1P7QB 3ARFC 8FABB 5FYKH 3EOAB 1TZIA 3LQAH 4M1CC 1PYWA 4L1HA 1KT2B 4Q0XL 4RX4D 4CU6A 1BQLH 5I9QB 4JZJB 4UDUB 2X40A 2P48B 3V6FB 5F89B 2CIKA 1G6VK 4NT6A 3LKNA 3RVTC 4KKLC 3DX7B 3O6MH 1KJ3H 3VXNB 2WZPD 1LILA 4KXZI 5FECA 3KPOB 4GAJH 3EGSA 5KSBF 3PHQA 4RGNE 4Q0XH 3B9EA 3HE6B 3KPMA 3QDAA 3O45A 3TYFA 4CMMB 2EH8H 3V5HA 5CWSA 3IFOA 3BKMH 3C6SA 4YXLL 2RQ8A 5CJ5A 3OAYH 4P3DA 5DYOA 3B6SA 4YDLC 5EA0H 1PEZA 3AS0A 1OTUC 3BH8B 4IRSD 4JE4B 5C09B 1MF2H 2LTQC 1NKOA 1J8HE 2X2YA 3VRLE 2PW1B 5FA3B 3ZSSA 4F33B 2AJZB 5D6CB 3IDNB 1T3FB 4CW1B 2PN5A 4AT6A 1A14L 1CLCA 1NC2D 1UB5B 2DLIA 4KDWA 4BH7A 4PRAA 1IGYA 5IV2A 5C9JB 3GRWA 5IMOA 2ARJA 2HFGL 2ZSVB 3KXFD 5JIIA 4JZOA 1K2DA 3MV9A 5J13C 1LK2B 3GMOB 3MRJA 3WDHA 5CZVH 1QZ1A 2BNQD 1EHXA 2VJXA 4G7VL 3P3YA 1F4HA 4RAHA 1EO8L 4QO1A 2ADIA 1G7PB 1U8MA 1NBYA 4I3RH 3ZT6A 3VG0L 5EU5A 1T03H 5DHVA 1CDIA 3BQUA 4JFQB 2HKFH 4F8QA 1OHQA 3D18B 4PJFE 1T83A 5C3TA 1NGPH 3CFDB 2G5RA 4F58H 3MRGB 4OZHE 3VJ6A 1NC4D 4D9RD 4IRZH 5T3XE 2KKQA 4BSVA 1WFNA 3ARVA 3KPRB 1I1YA 4JPVL 5IVXB 1RVFH 4P5TD 2E7BA 4Z7QE 3ULUL 2WWKO 1O7VA 1WZKA 1G9EA 1FFNA 1NLDH 4PG2A 2P45B 2KBGA 4IMLB 3ZKNC 4GH7B 5JW5A 5IG7A 4K94C 3V5HB 3SDCD 3ETBF 4TUJA 4EIZC 1NBVL 5IQ9A 1S9KC 3ISWA 2ZUVA 3KR3H 3OPZL 4MAUH 2WAHA 4OCXL 3CVHB 3IB4A 1YN6B 3IRZA 5L2KE 1I8MB 3W5MA 1G6RH 3FOMA 4HV8B 4OIIH 1A3RH 2XKUA 5T33H 4C55A 3FKUS 1T6VN 3QSKB 1BFOB 5E6IB 4QRPE 3NACH 5C2BL 4OM0H 2EE9A 5GQBA 1LP9A 2LTQB 2FCBA 4OCWL 4HKXB 3GMPA 3S98A 4KKLD 3HFMH 3DV4A 1LO3L 3TT1H 1GH7A 2IANE 3CMOH 4MQXD 3BPNC 2CIIB 4M48L 4F7MB 3HNSL 3EYFA 1CL7L 1EEZA 3EJJX 5T3ZE 1TJGL 5L9DH 3C2AH 2VKWA 5DT1L 3VFMB 5IBUG 4UBDD 3QUML 5E2TL 2AJ3B 2GTZB 1Z9OA 4OM1H 4P5MA 1ZLUK 1ZGLA 4EEEA 3GMRA 5E4EC 1XF1A 1IAMA 1YEGH 5B22A 5J0BA 1S5IH 1A47A 4XX1G 3IT8D 4IRJD 3V7AE 4PJEF 1M7IA 2WQRA 2QQLL 4YGVA 1T04B 4KKNA 1P7KB 1IGFL 4YK4C 3C2SA 5CMAB 4Q9QL 4JN2A 2X70B 3GB7B 5BZWA 3RWJA 4ZFGH 5C08B 3ZDXF 2BRQA 3VA6A 1U3JA 5HHPA 3AU1A 1L0YA 3NGBC 1U8LB 3Q1SH 3GMPB 2BDNL 4KDTA 1MAJA 1JYNA 1INDL 5DK3A 4XC3H 5CUSH 1NMBH 1HH9A 4M1GL 1QNZL 5DO2C 3KWWA 4NQSA 4OZGB 4CVZA 4TULH 4ZFOL 4X8JA 1X5YA 4MJ5B 1JI1A 2F58H 1BZ9A 3QZWG 2YXMA 2HT2D 1FPTH 1KENH 3G08B 1AFVH 4OLZL 2F8XC 2HLAB 1SBBA 1TITA 2NXZD 4ODUA 3VWKB 2M26A 4HS8H 2NCMA 2HT3D 1A6WL 3GIZH 3BZDA 1NGXA 3BN9C 1GGBH 4WUUE 5EIIA 2VIRA 5IB2B 5FUZL 2E6QA 4WIQA 3ALWA 1AFVL 4OLZH 3TBTA 2VISA 3CU7A 3BEVB 5IJVA 1CDGA 4MA7L 2R8SL 1CDYA 3R1GH 2XXCB 4Z7WB 4PRBA 3RZCC 1K5NA 4X9FA 5A40E 4CVXB 2FGWH 5ACZB 3RL2B 2MFNA 4OUOA 4B50A 1CDCA 3EGSB 1LQSR 1SEQH 5D71H 1INDH 4LSTH 3FN0L 1GCFA 4GRLC 2IADB 4R26L 1MCQA 5GGQH 1ZWIB 1WBXA 2QHRH 4DKFH 1OAQH 2I9LB 3LKRA 3GMRB 4RFEA 1I1FA 2RBLA 4Q9QH 2MHAA 5ABDE 3PG2A 1MJ8H 1EEUA 2GTWB 3QZWB 1ZANL 3FB6A 3GRWL 4HD9A 1OM3H 2EKSB 3KPPA 4JFED 1G9NH 4P59H 3EFFA 3CZFA 4CU7A 2WANA 3QA3A 3BWAB 4O5LH 1N5YH 4UT6H 2WBJB 3BGMB 1PKQA 5SWQA 1ETZA 1MNUL 2X4NB 3SCMA 5ANME 5MEOA 3S5LG 2R4RL 4HIEA 3ZDYF 2PO6B 5HSFA 4UB0H 4ONOA 1E6JL 1G7LA 1JHTA 4XZUA 4FQLH 2D03H 1U36A 4WTZA 4A6YB 2Y25A 5TF0A 4HXBH 4F9PA 3OJ2C 4ODBD 4TOYH 2D9QB 3GRWH 3KLSA 4ZFZA 5ID0A 3IKCA 1I8KA 2BVYA 2IFFH 3IDMA 1BJ1H 4YDIL 2HLFC 2VITB 2BX5A 1VERA 3C5ZD 1ZLWH 1NGXB 2VLLB 1MH5A 1G6RA 5MEPB 5SV3A 2BMKB 1HSBA 1Z6JT 3MGOB 2H1PH 3VJ6B 1FGVL 2OLDA 1TMCB 1ZHBB 3OKKA 1NCCL 2ZUWA 2IQAB 3TN0C 3DXAB 5AYUL 3SDCB 2AEPL 4P2RA 3V5DB 2R2BA 5KS9A 5KVGL 2F53B 1HQ4B 2VXVL 5GGRA 4NDMA 4KMTL 4U0QB 4JKMA 5HGBB 3RHWF 1IAOB 3C5SB 3ARBC 4X99B 5HHVH 2FECL 1YYLL 1FG2A 4ZUWA 4KK8C 4HG4J 1WAAA 2KQMA 3PNWA 3B3IA 3H9HA 3OMZA 4O4YL 5AYQA 1QHOA 3FHQA 2P5WA 5IUSA 1EFQA 3C5ZA 1KENL 4YXKH 5T1KB 3JV0A 4NKQB 4ZFOA 1MCDA 4XP6L 4YBHA 2RFXA 4ELKB 4OZGE 2FJFA 4PTTA 4HLJA 4LSPL 4KTEH 2ZSVA 5T5FL 5L2KA 2CKBB 2VAAB 5DGRA 3DX9B 4PJBE 1M05B 3HB3C 4PGEA 1EEZB 3ZYIA 5CMAA 1NGZA 2DAVA 4R3SB 3CFKB 5EO0B 3MYJB 4PJCF 1MCJA 4WO4C 5GIRA 2HFGH 1PFCA 1MFBL 3M8OH 1ZTXH 1I9RH 3MXWH 3QUXC 4OKVB 3UPRB 1RI8A 3DX7A 3REVA 5BRZE 3SN6N 2JB5H 4XP5L 1UB6A 5IFAL 4HBQA 4ZTOH 3GI8H 5SWZD 1ZGLB 2AP2A 1A7PL 5DVOA 5E95B 2J6EA 4JHAL 3ZKXC 5IR1B 4PJAA 4Y16A 4YDVB 2XRAL 2DM2A 4OLXH 3ZSTA 2AK4A 3QULB 1FFPA 4F7EA 4PRIE 3QUXA 2VXSH 3ARED 5FK9A 1DEDA 2K7QA 2V2WA 3PJSB 3RWHB 3G6JF 3SKJL 3EDJA 4YXLH 2X10A 1KTDA 5GJSH 4FFYL 4MYWB 3S5LA 3S37X 3TN0D 5E6ZA 1FL6A 4KQ3L 2XNAA 2I9TA 2VNCA 4MAYC 3BKCL 4NN6B 2MSPA 4ODSH 1F45A 2CPCA 4OT1H 1V7NL 3ARBD 1UC6A 3DVGB 4U0RB 4M3KB 2FEDC 4JFFE 2F54D 5INDA 3OKDA 5C07D 3MRJB 5TDPB 3U2SB 2H6PB 4NHUB 3FFCB 3WXWH 4WW1A 1T5XB 5CP7B 1A1NB 3E2HB 2V5TA 2NY0B 4PRPB 4XPTH 5JW5B 3C87A 3ULVC 5EOQL 4XMKH 1LDPL 4WFHE 1FZJA 3MMEB 3BQUB 5FV1L 4PGEB 2I07A 1RMFH 5E2JA 2Z91A 3MXVL 5CP3A 1IGTB 3AB0B 5C0BD 4M6OL 4GMTH 3TBYA 4V2CB 1XF5B 1PZ5A 2X05A 4UUJA 4YHIB 1NANI 25C8L 2DQFB 1LDPH 1R6VA 1N7MH 5I1GH 2W0LA 3KPRA 4TQEL 4WW2C 3VW3L 1ZVYA 1RUKL 2WWMC 3RA7L 4KHTH 3H42L 1FYTE 1XCTB 2K9UA 2GW5A 1AY1H 2YZ8A 3ET9F 4ZQKB 2ZOKB 3D85B 3SDDA 3GSWA 1RJLB 2NX5D 2NY4B 5FGCB 1RJZA 1XF2B 3R06A 4TSCL 1AY1L 3IU4L 3EZJB 3K81A 1HKLL 5JORB 4LNRB 4CU8A 2NY1D 5BJTB 3PWPB 4PGBB 3LIZL 4MA8H 4UOW1 3WJLA 3HS0B 1NMAH 5EO9A 3BZFB 3L1OH 5FV2A 5GRYA 4U1HB 5HDOA 5IM7B 3QIUD 1QG3A 4MZ3A 3NAAL 3D6GA 1YQ2A 3C8KA 5CD5D 1JVKA 1ZGLM 2D7MA 2JB6B 4Y8AA 1OL0A 4M02A 3RBSA 5F89A 2E6JA 4OFPA 5I15H 1C08B 2NY2D 1F4WH 5J1AA 1SMAA 1JNLL 1DE4B 3CSPA 3KLDA 1C12B 3UTSD 4ZSOE 3MXWL 3AREB 2ADFL 4UZGA 2GCYB 3UYOD 2DQHH 2VDOH 3IFOB 3VFSA 3MBEC 3BKML 3GBNH 4QHUB 1JWMA 3GHEH 1HZHH 2HH0L 4DGIL 2CXGA 1JNNH 2VLJE 5DHYA 2G5BB 3G5ZA 3IAQA 4Y1AD 5JOEA 1RZJL 3F58H 4ZFFA 3MJ7B 3HUJE 4O51B 1YMMB 2XPGB 1EAPB 4RFOL 4S0SD 4MSWB 3U82B 1JNNL 5GS3A 4MD4A 5JUEL 4BKLB 3GHEL 2YD2A 4RNRB 4P5KB 4JO4H 5D7JD 5FDWA 4N9GB 5HYJA 2HFFB 3MFFA 1MI5B 5BRZA 5HHQA 2ENSA 4EI5A 1RZKL 4XT1C 5JQHC 3D0VB 4GO6B 2P5WB 2NZIA 3MACL 2NY5C 1NC4A 4JHZA 5D9SB 2AGJH 1PY4A 5EPMA 1WWBX 1A8JH 2FHCA 3WSQH 2YC1A 1YMHB 4OIAA 4PRHE 4OGXL 4OLEA 4HKXA 2QQNH 3MRLB 2IPTL 3MUHL 4XCFL 2QADB 2VDPL 4XBEL 5EUOA 2XT1B 2FSEB 3SDDD 1ZSDB 3FONA 4M00A 4TVPE 2JJSC 4YEEA 2BVTA 1KELL 3SPVB 3TV3H 5L0QB 1FZKB 4HFUL 4Q97A 1JTTA 1I3RB 3ALXA 3NA9H 4KVCH 4N5UA 1Y6NR 4OGZA 4Z0XB 5LGHL 3BP4A 5JPNA 3DI3B 1MJUH 3QEQD 5E9DA 1OTSC 5LGKA 2GJ6B 5F97E 1Q1JH 4M8QA 1SVZA 2ZNXA 4RWYL 1ZOXA 1JWUA 3MA7A 3CGTA 2BVPA 4Y4FC 1TIUA 2UZIH 3NABH 5IB1A 2W91A 1D9KC 1ZT7B 4J3VA 1N26A 4QY8A 3N85L 3ZE1E 3UJIH 1CK0H 3JZ7A 5HGAB 4DQOH 4LDOB 1ZT4A 4BZ1H 4F37K 4P23C 3DURA 3MQIA 3AU1B 3KPNB 5CIPA 3GSUB 2W0FA 5MENB 4I0PD 3IRPX 5F7KC 4HXAH 2R4SH 1JP5A 2WK2A 4AJ0A 1U8KA 4XWGH 2A73B 3BH9B 4PGDA 1FL6B 3HAEA 4X98A 4XBPB 5IHBA 3TA3B 2VDQL 4FA8A 1HE7A 1MJ7L 3BPOB 2FD6L 3DO7B 1NCUA 2Z31C 3B4NA 1K8DA 5ETUB 4OB5L 1J1OH 4AEIL 2FDBP 2H1PL 3E3QE 5D7SL 4RAUA 3MLUH 1LK3H 2Q86A 3KPLB 4KAQL 4MNQB 5TE6L 5EH1A 1XGUB 2OTUB 3BT2L 3O2VL 1HHHB 2ZCHH 4RCAA 4YBLC 1NCAL 3GNMH 1NFDA 3TCLB 4Y19E 1FZOB 3O4OC 1IAKA 4JM2F 3DRQB 5I1CH 1MWAH 4XNZC 3GMOA 3WFDH 5HDQL 3O2VH 3Q2CA 1BD2B 4GKNB 2UWEB 3WE6A 1S7RA 5FB8B 4HPYH 2Y36L 1UADC 3LRHA 5K9OB 4X6CB 5BCAA 3EKCA 2YPVL 4EUPG 1HXMA 2N7AA 3GJFK 4LNVA 2E3VA 4WW2B 2VXTH 1JHKL 1MJ7H 2J8UF 5EBMB 5F3BB 4L8DA 1CIUA 4KMQA 5BS0A 5MP6L 4R8WL 4HF5H 3G6JA 3RI5K 4AQOA 3WN5C 4W81A 4XCCL 1F4YL 4LHUD 4BQ8A 4P46B 3RVVD 1AD9A 1S9VB 2BERA 1NGWA 5KTEH 3EIFA 1TJIL 5HPOA 1MIML 3IFPA 5EO9B 4C58B 4I77L 3EJYC 4MVBD 2AVGA 2RCSL 3CFBA 2JF1A 2R2HA 2JKXA 4LRIA 3DLQR 5TE7H 4FQPA 4LLQB 3T2NH 1MLCB 3MJ8B 4X7DC 4YHML 3K0WA 1WTLA 4EDXA 2YHGA 5D7IE 4I9WE 3BSZL 2J1KA 4PRDB 1BFVH 3KYOB 3T4YB 1HIML 3FT3A 4ZMAT 1FG2B 2GJ6E 4ZUWB 5BQ7A 2HKHL 1OWRM 1S9XA 1A4KA 3O4LD 3V7MA 1AR1C 4UOW0 5DQJA 3N1PC 3GHBL 3G5YB 5D71L 1DBJH 1DVFA 4WUUA 4U1MB 2V5YA 4NUJB 4IHOA 4JZNB 4I3SH 4KTDH 1TZHB 5DJDB 5FA4B 4S1RH 4FTVE 4LCWA 4OAWB 3DUHA 4A6YH 1NFKA 3VFTB 5B3NA 3MLWH 4YXKL 2Z31D 2P8PA 3REWB 3UO1H 5HVFB 4PJXF 4Q6IC 4YHZL 2QQLH 2DQCL 2B20A 2CR3A 3QWRD 3QEGH 3EJYD 4DKEL 3CK0L 1OARH 5BVJB 4MJ2A 1Q0XH 1MHEA 3HG1A 1A7QL 3IJYA 4M7LL 2HT3C 2P24B 2AXFB 2B5IB 5E03A 3MFFB 1ZXQA 4KJPD 2DQCH 1YNKL 2R2HB 4HF5L 5HHOE 4YDJB 2V5RA 5DZOA 4TVSa 3LN5A 4PIRF 2D0HA 4OD1L 1ZVSA 4WGWB 5E2WH 1IEHA 1N6VA 4GKSA 5ERWA 3DUSA 3CXHJ 4L3ED 2WV3A 2ZUQB 1WAAF 1NCBL 4CKVX 1FQ9C 3SQBA 2Q3AA 3SQOL 5JIPA 4F7EB 1C1EL 4J4PC 4NKIH 2CRMA 4UV4H 1PY9A 3HLAB 2KPNA 3PXJA 3QA3B 1JGDB 1R24A 1FO0L 3RPIA 4YIQB 3WYRA 4P2OC 1RUQL 4JO3L 3PNWB 3ULVH 3TIDB 1S7QA 4Y5YB 3O11B 3WUZA 4GLRI 1A6TA 1F6FB 4KK5C 3BT2H 4XP4H 3U30C 1NC4B 3AMLA 3FJTA 4OGYL 3B6SB 4D0CA 4DAGH 4DZ8A 2ED7A 2JK5A 5DRWB 1N3NB 4XRCB 3IXTB 4XXCA 1F4WL 1OGAE 4CUCA 3HR6A 3RBGA 4BUGA 1CGUA 5D1QD 4UB0L 4R90H 4UNUA 4UT9H 4IMLA 1T0MA 5I8EA 5F9OH 5FYJE 2XWJA 4OCLC 2BVQB 1MOEA 2CKBH 3UX9B 4JN1H 4O5LL 1VKXB 5MHSD 1HNGA 1ADQL 4LK4A 3WL9A 3CMOL 3C60C 5E2VL 5EOTA 3WO4C 3EO0A 4Y16C 4JRXB 1VEOA 1PD6A 1CFTA 3V6OA 3LB6C 1AJ7L 2VIRB 3NACL 5IB2A 3M17B 4M93C 5BMFL 2X4TA 1G1CA 3RGVC 4WRLA 3SE9H 3TNMA 5I73C 1TVBA 4V1DA 4KV5E 3ARRA 4LAQH 4YX2L 1OT1A 4Y5YA 5I66A 1UJ3B 3RJQB 2BJMH 5I76A 1K3IA 3AVEA 2RR3A 2EDFA 3GMLA 5I8CA 1B9ZA 1XZ0B 2ZSWB 4F7CB 1SEQL 3BRFA 5F8QC 2N4IA 3SDXF 2YD1A 3WIHA 1V05A 5ESQA 1G7JA 5TPWL 4ZFFB 1NUGA 2YD4A 1AXSA 3PUCA 2VH5H 2A74B 2VDKL 3LEXB 3QXUA 4JR9L 4JQXC 3L5WA 4WU7B 5DJXA 1IT9L 3HAEH 4MXQC 5DA4A 5MI0B 4DVRH 3D48R 2AW2A 3BEWB 3SO5A 3A67L 1QRKA 3IDIB 2HJKB 4JQXA 4JM2B 4XTRD 3DGGB 1YZZA 4A6YA 3VXTA 4PLNC 5J8OA 3EO9H 3RHWK 3K2MC 3L5XL 1BMGA 3RKDD 2CLRA 2J7LA 4WW1B 4M7LT 3C8KB 3DVFA 2UUDK 3TNMB 3GSXB 1HKFA 3FTGA 3MNVB 4MXWL 1U0QA 1D5BA 4P46D 4L4VA 1RD6A 1FZOA 4MWFA 2HWZH 5IEKB 5DRXA 3S34H 5HHVL 4LPTA 1V7MH 1UYWL 4KQ3H 4R4NC 5F6IC 2WINB 5E5RB 3VG9B 4DGIH 5T3XL 2NW2B 5IHZA 1R3KB 3TIEB 2R23B 3QYCA 4K3DH 4HMEA 1MFEL 2V2WB 3PJSA 4Q58C 4EZMA 2BVOB 4G5ZH 2XICA 1G7QA 2FJGB 3S9DB 4HIHB 5JHDA 3EJZC 2E7LA 3WKNA 1U91A 3ZTNL 4DGYH 3RRQA 3QPQD 1I1AC 1KSRA 4GS7C 1X9QA 1J1PH 5I1IL 3FOLB 3O81A 3D0LA 2ZSWA 4G9FE 5KVEL 4YHYB 5C0NC 1XGPB 2YR3A 1HIMH 3GJFB 1WQVT 4PGJA 3RX5A 32C2A 4M6NL 1W2KT 3P4MA 4KZDL 4OZIF 2QR0B 3C2AL 3JV5A 4NC2B 1QEWA 1Z9MA 5EZIL 5LCVH 3UTTA 4XCNB 4AL8H 2DQIH 4W6YB 2LV4A 1IL1A 5KSBB 1D7FA 3FT2A 3SCMD 5INCA 2X70A 3GB7A 4U1SB 3DVNA 5EU6B 1DBMH 1LO3H 2X89A 5TDNB 1KCLA 3HAEB 5D2NB 2CKBA 3T3ME 1TQBB 3AB0C 2CLZA 5F9WC 3JBG7 1MNUH 4UNTA 4LVOB 5B39G 4JB9L 5E9DE 5TGBB 4HFWB 1CR9H 3ZO0A 3BKJL 3BQUC 5C0FB 4R90L 3IVKA 3JTSB 3SJVE 2HVJB 4X9BA 1FNEA 4LQFL 1AQDB 3KR3L 3QXDB 4DGVH 3VA2C 4P3CH 2P24A 3NFPA 4NQTA 1A0QH 3ESUF 3D3VD 1ZANH 1JNLH 2J3SA 2YUWA 1BWWA 3E0GA 1FAKT 1YECL 1MWAL 2AV7B 25C8H 3JUZA 2QSQA 5D6DC 5DRNB 3VGEA 2A6IB 2ZOKA 4LVOC 4R26H 3RWHA 5FUOL 1B0RB 5CSGA 5D7SH 2JCCA 3O9WC 5GGUA 1E27A 1YEEH 2Y23A 4PRIB 1RPQA 4ALAL 5BO1L 3BPNB 4WO4D 1T2QH 3TNNA 3V52H 3TC9A 1UCBL 5IF0B 1JGVH 4OSUL 5IB1B 3RUGA 4YGVB 4OKVA 1J05B 2BVQA 1B88A 4TSCH 3BOVA 5E6IC 5ISZD 1Q72H 1A1OB 1Q8MA 3L3DB 3ZKXB 1KIQB 2EYRA 4UTBH 5IG7B 3FFDB 4G8EB 3VE0B 5ACLA 5C0JB 3IFLL 4NBYB 1MWAA 3ARQA 1I7ZB 1I1AB 1U58A 1ERNA 1A22B 3GSOB 5CP7A 2GK0B 3U46B 4N0FB 4FABL 4EOWH 1LEKA 3P9LB 4A6YL 4LHUG 4W70A 3QP3A 4P23D 4KTDL 1U3HC 5JQ6H 5CGTA 2CGRL 3DJ9A 3B8SA 4JDTH 3HRZB 2WBJA 4IHOB 4NHCL 3KHOA 1LP9B 2AJUL 2DYPA 4LSSH 3S8WA 3ELAT 1J0KA 1GXEA 1XGTB 2JIXB 1TVDA 3TV3L 2Q7YB 5HPMB 1ACYL 3GIVB 4XBGB 4YH6A 4ZFGL 5E6YA 4K9EL 2R0ZH 2DKMA 3CPLA 4I18B 3AUVA 3TM6A 3HI5L 1UH2A 2NY2C 4GW4B 4HUXB 3WLBA 4L8SA 4MNHB 1URLA 3O8XC 3WXWL 4XMPH 3ULVL 1YEKL 4B7IA 3SHSA 1I4FA 4KI1A 1FYTB 1BREA 4U6VH 1ZHNB 5ALCH 1RK0B 3V6BR 2ZG1A 5FYJD 1NEZG 3QXAA 3GSOA 2EIDA 4MX7A 4X9HA 4OCSH 5DJAA 4P57B 3MYJA 4IS6A 2L4OA 3TBVB 1KNOA 1PAMA 3TN0B 4M48H 3ZHKA 1LEGA 4E0RA 1H0DB 1RK1B 4ZODA 2VXQH 2Z8WC 3SOBH 4HX1A 5ICYB 4QRPB 2R1WB 3DYMA 3GBMH 3BUTA 2VXSL 3RWCB 1XR8A 3RPKA 3THMH 5DFWH 5CLTA 1XF3B 1GZQB 1MCSA 4R2GC 1S7TA 3OL2A 1CYGA 2DLHA 4OIIL 3ARPA 1C08A 4HIXH 3GBNL 1ONQA 4DKEH 4JGMA 3CC5A 3RX7A 3NCEB 2APFA 4Y2DC 2BNRE 3PWUB 4X8JB 3DROA 5AG8A 4F2MB 1GIGH 1MY7A 1DANU 2NLJA 5C09D 5E9DB 1BZ9B 3ULUD 4WI2A 1NBVH 4S1RL 3RUGE 1OPGH 4TULL 5BZDB 4ENED 4MD0A 1VFMA 2AEIT 4U31A 4NJ9L 4U3XA 4WWKB 5SWSD 1DBAL 2HTKC 1D6EB 4HCRA 4ZUSB 3LKOB 3BZEA 3ARXA 4I18A 1HSAA 2W1NA 4L4VE 1FSKB 3VWJD 5EOTB 4HIIB 4WHYH 1CK0L 4LSPH 2CGRH 1QYGH 3STBA 1MHHB 3U7WH 3MZTA 1J0HA 4XPHH 5HVHC 3BH9A 5E70A 2BMKA 2W9DL 4M6AA 1T04A 5JXEA 2IADA 3MRCA 1KLGA 2HVKA 4X6DE 2ORBH 4ZNCD 1H5BB 3ZYOA 3U7WL 4HW6A 2H32B 3I6LD 4WEBH 1I3GL 1RK0A 3LEVH 3D39B 4HDIB 4OM1L 4XPAH 4NC1E 3T65B 3MODL 4Z77B 2H2PD 4YAQA 4FZ8H 1AO7B 3G9VA 5F9JA 3T4AA 5I16A 3GSRA 5C07E 5C70A 2ZUQC 5FYLD 4LFHG 1U3HB 1HNFA 2D2OA 4ZUTB 4CMMA 1YMMD 1KTDB 4TNWK 2Z35A 4LCYB 3VWJC 3CIQA 3SGKA 5DMGD 4NRXB 2A6JB 2P8PB 3QDJE 2DMKA 1MCLA 1VFAB 2YD7A 1S8DA 3SCMB 1HQRB 1N8ZB 1N5AA 3U1SH 2OI9C 5D96C 3RZCA 5CZXD 5DFTA 4ZPVB 3LVEA 3OB0K 3L6FA 4PRHA 4L8CB 5SX4I 4PJBA 1QFWL 2LVEA 1X4ZA 1SJXA 3LDBB 5DMKA 2EYSA 1X6LA 8FABA 3BN3B 3DETD 3FN0H 1F90H 4R7DA 5J6GA 4P4RA 4NQDA 3HNTL 3W0WB 1JBJA 1HCFX 1G84A 4DTGH 3CJJA 4OCSL 3Q3GA 5DEFB 2NW3A 4OCRL 1II4E 3BHBB 4FZEH 1KXTB 1OGTA 3DBXA 3E6HB 2P46B 3GMMA 5D7LE 4G6FD 3FQUA 3ULUH 5E00A 5DK2B 3MRKB 4NDMB 2XG4A 2QLVB 1ULVA 2UYLA 3H7BA 5C2UB 2HVKB 1XEDA 1AQKH 1QFHA 2O5ZH 3MRQB 2BY3A 2QQQA 2XZQL 5A2KH 3VXOB 1R5WB 5GISH 1LO2H 5EZIH 5LCVL 4Y1AB 3SKJH 3T0ED 1WZMA 4FRWA 3U9PH 1F2QA 1NFIB 1N3NA 4DOHB 1I7UA 1UH3A 3RWFA 3QJHB 1WVZA 2DWEA 4O2FA 5GS0C 3GKZA 3TJEL 4AENA 3BP7B 4U3HA 1DBBH 2EDXA 1BQHB 1H8OA 2HRPH 2VL4A 2ZJSH 5F9WB 3VFUB 4Y19A 4LRIC 5JW4M 1EO8H 4G42B 1AHWA 1MLBA 3HMWH 1UENA 3HMXL 2NQCA 1H3VA 1KB5L 4PJIB 3RGVA 1XGPA 5CCKL 1QO3B 4G8GE 3VXRB 1HHHA 4UDTB 4MA8L 5E5UB 4QTIH 3ZDZE 2HT2C 3OKYA 1OTTD 5H37G 2CLVA 1VDGA 2DL2A 2O61B 2EDYA 5EU7E 3HZYA 1DEEB 1S8DB 4HEPG 4KKAC 3QEQE 3WSQL 2VXUH 4NQVA 1N64L 5HHNB 4LOUD 3EYUL 3VFVA 4MCZA 1IBGH 3TN0A 4HS8L 5I6XC 4HHAB 3UJJL 1QOKA 5E2TH 1F42A 2MPAH 2CD0A 4FQIH 1F97A 3OKEA 3ZKQD 3V4UL 1DQLH 3SDYL 5KSAC 3T1FB 4FTVA 4WO4B 4ZUUA 3ROLB 4MNGE 3IJSB 3V52L 3VWJB 3RY5A 4AEEA 4Y8DC 2DQGH 1BZ7A 3BPOC 2EH8L 3JSSA 1DZBA 5AUMA 3MJ9H 1NDMA 2HJLB 3TA3C 4PJHA 1YEIL 2G60L 2AK1L 3UCRA 1O5DT 5DMGC 4L9LC 4AH2B 3C9NB 1P6FA 5GHWH 1X5IA 1B90A 5I75C 4KRLB 3TBSA 1BZQK 4KFZC 4D9QD 1T7YA 3IDIA 4PJ5A 3MGAA 4JANB 5F7NC 5HHME 1J05A 2DWEB 1T80A 4F57H 2BRRH 1YYMH 2DDQH 2HA1A 1OGAA 2FBJH 1T20B 5HGHB 3MC0A 4KJWD 5IHUL 3LKSA 1I9EA 3HC3H 1XR8B 4WU5A 4ZD3H 2EEAA 4F57L 4BFGA 5T5NF 5BV7B 3DURB 1XF4A 4L29A 3T4YA 2VR9A 4HWBA 2GY5A 4U6TA 2B4CL 4CNIA 4PRPA 4IOFD 4GQ9L 4KPHL 4HUVA 2ATKB 3QUMH 4HK0A 4OD2A 3JV6B 1LD9A 5GRZA 4TN9A 4PLJD 4QRTB 3FQWA 2AERT 3SKNA 4HWZB 3OAUL 1IEAA 4QXUL 4BK5A 1EEYB 1UJ3A 2YA0A 5JQ6L 5AD0A 2EYRB 2IBZX 2GJZB 5HYSG 4KJYA 1FVCA 2FZ3B 4KUCF 4FABH 4IRZL 3SKMA 1P7QA 5C08E 1P2CA 1N6QL 1BPVA 2FX9L 3FQNA 4PJIE 3MLXH 1E4XL 3QEQA 5E9DD 2X4UA 1LP9E 4PRIA 2BXZA 2P4AB 4JFEB 1CGVA 1T83C 2CDGB 3B9KC 4R97C 4G8GA 2BVEA 3VXNA 4ISVA 3UTPD 4WW2F 4AG4H 4NJ9H 3VFOA 1OP9A 2Q1EA 2E27L 3WO4B 5FYJL 4AH2A 5IGXL 5CZVL 3VH8G 3OKMA 3DI2B 3HE6C 1YEEL 1NDMB 2P42B 3GMQA 5T3XH 3MV8A 4BFEA 5D1ZD 1KB5H 1M71B 2FH6A 3AY4A 1M6OB 1QP1A 5ADPL 5F7UA 2NNAA 1MAML 4MXQD 4X0KB 5GGQL 3QQ9D 5DD5L 4N0FA 3LPWA 2AGJL 1YC7A 5EIQA 4XMKL 1KEGH 3IVKB 4R96B 1LDSA 4R4BA 2NPLX 4OV6F 1OQXA 1C5BH 1IGYB 3VWKA 2R8SH 1RZKH 2ARJB 3MJGX 5EA0L 5IM7A 1DQLL 3FAWA 4GMSH 5TF1L 2C3HA 3MCG1 2O5ZL 1C16B 3FO9A 4LU5L 4GRWB 3MOBH 4G6FB 4XNYH 2ZKHH 1Q0XL 3HE7A 5JO5B 5L88L 4V1DD 1EO7A 2Y7QB 5IB3B 2EDQA 4ODSL 4K3EL 1MAMH 2DI8A 1PW3A 3KYKL 2UWEA 1CVSC 2ARJQ 3GJEA 32C2B 3AREA 1HZHL 2HH0H 2ESVB 1GOFA 4P4KC 4U7SA 3MV7B 2JCCE 4Z7OE 3GMQB 3KYMB 3D2UD 5TPWH 1BOGA 2BOBA 4E9LA 1KPVA 5ID1A 4AQ1B 1KJ2A 4PP2B 4AG4L 5KSAB 3DROB 1CS6A 3X3FH 3HMWL 1X5GA 3BE1L 3CCHB 4RFNB 4HWUA 5F96H 3WO3B 3OAZH 2Q6WA 4JLRB 2R0ZL 3D1MC 4YQXH 3WKML 4JKWA 4JHAH 5SX5K 1JMZA 1CZ8L 3IGAB 4K2UH 2LAGB 4ZTOL 3FQRA 4WJ5A 4G3YL 3N1FC 4FG6D 3KLHD 4MA3B 5JXED 5FYJU 1CGSH 1UWGL 2DICA 1INEL 5KOMC 5JORA 3ARGB 2R1WA 3MLPA 3T0BA 4GBXB 5D70L 2IAMD 5ENWA 4XMLH 4PUBL 2ED9A 5A43C 2A74A 3VI4F 4I77H 3Q6FB 1NMAL 1RIHH 4C83A 1YQVH 1DANT 1WBXB 1WJ3A 3KYNB 4GRWF 5IMLB 3BXNB 3SEPA 1OAZH 1EHLH 1N4XL 3PXHA 4MQ7A 1G7LB 3I3EA 4WNQA 1CD9B 3HG1E 4Y5XA 3DVIA 1RFDL 2Z8VC 4J7RA 4UINL 5HDBE 2ERJB 5MP6H 3MOBL 2MOVA 3UTTD 4H5SA 1JK8B 5ANMA 4ESKA 5FYKL 2VLJB 4X7EC 4YK4B 3GM8A 5DJDA 4I5BB 5DMIL 1JZ5A 5DS8B 1P4BH 1F90L 3BJLA 4ODVL 2CUMA 5IWLA 4N1EA 4HHAA 3L5XH 3LPFA 3SPVA 3AFLA 2APVA 1D5ZA 5I1GL 4XPHL 2EDRA 4GRWH 4K7FB 1XGYH 1BX2A 3DX6A 3RVXD 4DKFL 2QHRL 3I6LE 4PREA 1GGYA 2NY3B 3T0VA 4MAYB 3QQ4A 2PKDA 4ZO9A 1REIA 3OKDB 1S9YB 2AXGA 5FYKE 3H3BC 4OZHB 1INQA 3QPQC 4MHHI 1KULA 4I48B 1H5BA 2YMXL 4JLRA 3C6SB 4H1LG 1MPAL 5EUOE 1H3TA 1J87A 2P43B 4U1JA 3OF6A 1E28B 1LE5B 1CU4H 1F3JA 5IB5A 1QKZL 2J8HA 3QDJD 2MPAL 1L7TH 3PV6A 5T1MA 3MJ9A 4NPYB 2D0GA 5DJYB 4XBPA 1C5DB 3UJIL 2IC2A 5FYKU 1EZVY 5BS0D 1EZVX 2A73A 3T3PF 4JZJA 4UDUA 2FX9H 1D5MB 1U8HA 4WV1B 1N6QH 1A7BA 5L8JB 1XGRB 4RFNC 3QUXB 2C3WA 3HR5A 3O2DH 3QDMA 3P11H 5C0BE 2H41A 5B8CB 3QDGE 5E6IA 1UZ8B 1HHIB 4LCWD 4LDEB 4GRLD 4QTIL 4HK3N 3O45B 3TYFB 3L9RA 1JNJA 4MJIB 1T7WA 3NCYP 5I1AB 1Q9WA 5C3LD 1LK2A 5D5ME 3RZCD 5DJ2A 3LKPA 4LSRH 4H25B 2E9IA 1EHAA 2EIBA 4L3AA 2UWEF 3MLVH 5B38G 1CTOA 4APQA 2LU3A 5J6GB 1YEKH 1BQHA 1WWAX 4OF3A 2B2XL 5KOVC 1CFNA 2NXZC 1CLYL 1GIGL 2XN9A 5DK0B 2NX5B 1KIRB 5KJRL 2RCSH 5FOJA 3ZE1F 1LO2L 1UWEL 4XP4L 3QCVL 5CEXA 2EE3A 2HFEB 4G3YH 4HEME 4JCLA 3LHPL 4RAVA 1HOCA 4QT5B 4QRRD 3NIDE 1UM5L 5JXAL 2JCCB 3QEQB 3BVNA 5ISZA 4YXHH 2CDEB 5E00B 2WW8A 3S4SA 5I1EL 4ETYA 2UYLB 4UV4L 5GSRA 4OFYA 1C7SA 2RJMA 5DUPH 3ZYJA 4G6JH 3T2OA 4TTDD 3OHXA 5SWSA 2XQYK 5J6HA 5D9SA 1DVFC 2HG5A 4IDLA 3FFCE 3MV7D 3OGOE 4MDIA 4Z7VB 2BNUB 3LRGA 1ACZA 1U8NA 4OD1H 5DRZB 3T0EA 1FVEA 1PYWB 2AEQL 4KRPD 5LAXB 5E94A 9CGTA 3P11L 6CGTA 2IMNA 5KS9F 4Z7NF 2OBGA 3EO9L 4FQIL 2JK5B 4NO3A 5D1QA 2XKSA 1IGMH 4NO2B 3UJJH 4R4FH 3GSWB 3ILQC 3T2QA 2J2ZA 1B0GB 1A7QH 4XNYL 5JXAH 2DQUL 1D3CA 1Q72L 2ZZUT 4AIZA 2R0WH 2X4NA 3QDGA 4X7TB 3BUYB 5KJRH 3P0GB 1KIRA 5ADOL 3UC0H 4ERSH 2BXYA 1U8QA 3A6CH 2YD9A 1KTLA 1RV6X 4HH9A 4JFYA 1HOCB 1FBIH 1HK6A 3EDKA 3MGTB 5GS1C 4RQQA 3C5JA 3N9GH 3O6FB 2NTSP 4RRPA 2PO6C 4XTRC 3VD7A 1KCKA 3PF2A 3VFWB 5FGCE 2DJ4A 3UTZA 1BFSA 3OKEB 3NCJH 4Y4KD 2BHUA 4YDJA 2VERN 3NAAH 1JTPA 1DBBL 4WFGD 5DD1H 3BIAX 3CVHH 4FQCH 1BFVL 2XQYG 1YJDH 1RZKC 2G9HA 3I84A 1IGFH 4YNYB 3DWTA 4IM8A 4N9OB 1FHGA 4YIQA 4AY0A 3SDXA 2YA1A 5IK3A 3LPGA 2DLGA 4WNQB 3AM8A 3QXAB 2B0SL 2QHLA 5GISL 1D9KD 1KLFA 3DTXB 5TDOB 3NPZB 5HHXH 4X83A 1YNTA 2C7UB 2OQJA 3ABZA 5EC2B 4XXDA 1O7SA 2PTTA 3PWPA 3VG0H 3QUYC 1T03L 2ITDB 3QH3A 4HZAA 1NAMA 4WENB 3RQ3A 2B4CC 4QNPF 4UT6L 3U36B 4C56B 3FRUB 5DTFB 1KXQE 4YHOL 4MD0B 4MMXC 2HLAA 3QFJB 3LQZA 1N7ML 1UWXK 4LSQL 4LARL 4AL8L 2FYYA 1E4XI 1JZ6A 2IPTH 4XCFH 4XNMA 1KCRH 5I8EB 1EJOH 4ISVB 2BY2A 4X80L 1I7TB 1CGSL 2MQ3A 3VFOB 3BP6A 2YBRA 3QDGB 4CVZB 5IEHA 5CZKA 1T1ZA 2PYEA 4MNQD 4LHQB 1S9YA 2AXGB 5F1IA 4XWOD 1KCUL 4K07A 2HN7B 3U1SL 2XA3A 5JLZB 5IW1A 2PETA 3WFCH 5K9KA 4Y7MA 2VISB 1T0NB 3BYTA 2O26U 3RNKA 3DO7A 3CLFL 5EU3B 2VSDA 3HN3A 5AWNL 2FD6H 2W60A 1MEXL 4JO4L 1YC8A 2BOCB 4PGCB 4BFIA 3I6KA 1MQKH 3HB3D 4QWWD 3DIFB 4ODHH 4Z95L 3STZA 1ZE3C 1BVKB 1IGIL 1YNKH 1NLDL 3ARYA 3NIGE 1JHLL 5CBEB 3X11A 5IMMB 5BS0E 3WEXA 2KUTA 4KC3B 4R0LB 2GT9B 5TQ0L 1MHCA 2IANB 5F7DB 3QISA 4P0DA 1OP5H 1D6VL 2D4FA 2XWTA 3L95A 2BNQE 4RISL 3S36H 3T04D 1MELA 2QL1A 4BH8B 5E8DL 1KCVH 2KH2B 1TTUA 3OJVC 4DZ8B 2P7TA 2ADFH 3UMTA 3LKSB 1DQTA 2JJVA 1ZA3B 1WC7A 4OF5A 3DGCR 4QGYA 2VDRL 4LKXA 4LRNH 5CJXA 2JB5L 4XP5H 2VXUL 1OP3H 4PYHA 1GC1L 3VXPB 1P4LB 5H35A 4NRXA 5IEKA 5T1LB 3GFUA 1T22A 3TZVA 3RP1A 4XVUD 4RAVB 4J4PD 5MEND 3CLEL 1FYHB 4ZUTA 1N5AB 3BMWA 4XPFH 4JVPA 2VDKH 4UV7H 4L3EB 4YJZL 4DK6A 4Q6YA 4UIMB 2WBJD 1BBJA 2A6JA 1Q9KB 3Q5OA 1O0VA 4ZFZB 3F6IA 4I8DA 3LAFA 2R0KH 2WM0A 3KNBB 5L88H 4UIKH 1CE6B 1S7UA 3O3AA 4N8CH 4U33A 5ID0B 4RIRB 1OY3B 5TF1H 1D5ZB 4HIJB 4GS7B 1YA5A 1T0NA 4JO1H 5ICXB 2UUDH 3SKOA 1I3RA 4PJ5E 1KLUB 4PJGF 1FCGA 1BBDH 3KJ6H 1Q0YH 1I9IH 1TNNA 4WWKA 1NH6A 5F3HB 1FFPB 1FZKA 4P2YA 4XNQA 5EC1A 3QIWD 4MNQE 4ALAH 4I9WD 4RGMB 3IDUA 2BP3A 1BQSA 1MCRA 2ADGA 3VFGH 1QFOA 4HIIA 4FQJL 3IS0X 1CGWA 3O6ML 4Y19B 5KAQG 4J6RL 2NNAB 4JQVC 4OZFA 5H2BA 3RVVC 4U1SA 3SGJA 1EK3A 2IBZY 4Z7WE 4U6VL 1MQKL 1ZGLP 4XCNA 4HUUA 1LNUB 3H9SD 4NQSB 1LE5A 1WC7B 12E8H 1HHJA 4ZD3L 3H3PL 4I0CC 2AJSH 2CK0H 5SWZA 4HBCH 4FQ1L 4DVBB 3GMNB 2DIAA 4A2LA 1FV1B 2W9LA 4OF7A 3U0PA 2AK4D 5K9QG 4DZBA 2X42A 1Y18A 3KXFE 3ILPB 2D31A 5I74B 4LAQL 4YX2H 5EFIB 2JJTC 3RWDB 1UZ8A 4S0TD 5C0FA 1VADA 1ONQB 1QSFE 5IESH 1GRWA 4J6RH 3SQOH 1AGCB 3VFNA 3TBTB 3MTRA 3UBXG 5DGQA 1UJTA 3QIBD 4ELMB 1TETH 1SM3L 1PX4A 1WBZA 2WUBL 1H15B 4PJ7F 3U9UA 2EE2A 4IMKA 4I0PC 1ADQH 4MB5A 1E6JH 1PZUB 4EOWL 4P49A 1LHZA 4QXUH 3K2UH 3HZYB 1KYOK 1D6EA 4QYOB 4UU9B 2D0FA 2W0PA 5CSZB 4IRJC 3OKOB 1UJ3C 4KU1A 4HS6B 4HUUB 3I6GA 1INQB 3T0XA 4Z7UA 2YUZA 3GI8L 3N50A 3EYUH 5L2JA 1YY9D 3FO2A 3MZGB 2JTDA 1IARB 3AS2A 1FNSH 4DAGL 1KV3A 5DD6A 3OZ9H 1F3DH 1NEZA 2BRRL 5FXCH 4Y4FA 3KAAA 4PJFF 3VW3H 3DUSB 1QYGL 3I02A 3P4OA 1J0YA 1OAQL 2ICCA 1GC1H 1U58B 3QCTL 4YAQB 2VZ1A 2NY0D 4PRPD 3PL6D 3MXVH 2H6PA 3G9AB 1AO7A 1R5WA 1FVEB 3QI9D 5C0CE 5JMOC 3N9GL 1YEIH 1VPOL 2G60H 5C71A 1NCBH 3F62A 4NC0B 3BJ91 1JK8A 5ANMB 4KK5D 1NUFA 5EBLB 1ZLUH 2FR4A 4XP6H 3FFCA 4LPVA 3PDDA 1M1SA 1BJ1J 3L7FB 2YRPA 4P2QB 3V4UH 3WHE1 1YY9C 5DJ8B 3ILQD 1OF2A 4KJPC 3HC0A 3IXAA 1AQKL 2GSIB 1IC5H 3PWLB 4PP1C 3U4BL 4NO5A 1XIWC 3C6LD 1OARL 4MMZC 2Q7NA 4LLVA 2H3NB 3EAKA 4JB9H 4JJ5B 4XCCH 4JM2A 1BQUA 3ZHDA 2DWDA 4D8PA 3F65A 4FZEL 1OT2A 5DHVB 1DQQB 5I18H 2IQ9L 3KPRE 3C5JB 4JEGB 2ZG2A 3ALPA 4XVSH 4NQCE 4JKPH 2M2DA 4M8VA 4D0DB 1EBPA 1MAKA 1KCSL 2MQ0A 4I3SL 4JR9H 2EO1A 5FOBA 4TNVK 4LEOB 1JGDA 1UKQA 1FE8H 4P2OD 2IANA 3HZKB 4NKMB 5B38A 3MCKA 5J9PB 1JIBA 3HZMB 2V2TB 3RL1B 2JJUA 1ZK9A 2HKHH 4CADB 4MHHG 3QUKB 5ALCL 1CCZA 5F7DA 1M7DB 3LN5B 1TDQA 1GZQA 2VN7A 3QUMA 3QCVH 2F54B 1OB1B 3OB0H 4UI2A 5JIKA 3ARUA 1A6UH 4PBVC 1F6AB 3ZKMC 1FNEB 3ECBA 3BRDA 3QJHA 4JHWH 1QSED 3IAPA 2JB6A 4ELKA 3BDYH 1NSNL 4CDGC 3MLVL 3O9WB 1FL5A 5B3JE 5C7XH 3C8HA 4KWUA 2WWMD 2F8VA 2CKBL 4X7TA 1LGVA 4I0KA 4YHNA 4YHLH 4FZ8L 3LD8C 2I5YL 4AIZB 4OCRH 1TTGA 5F9OL 4UIMA 2FL5B 1I85C 5I2IA 1LMKA 2H9GB 1IAKB 1MCBA 5ESAA 4ZXBB 5HHOA 5A1AA 3DYPA 2OR9H 1NCNA 2WIMA 3DRQA 4L9DA 2B0SH 3EUUA 2HFTA 3MCKB 5DK0A 3QFJE 3NN8B 4TSAL 4OCWH 3VD4A 2X4OA 2G2RA 4UQ2A 1Q9OA 2O5YH 3KPRD 5L8KB 1CLZH 4F7MA 1KT2A 1IKFH 5E4EB 3FQWB 4KVCL 2GUOA 4JPWL 1FO0H 2QEJA 1KB5A 3QT2A 2VLKD 4KI5C 5D1ZC 3PV6B 5T1MB 4D8PB 1T1XB 3MLYL 3QHTC 4I2XB 1NGYA 3T8XB 2FGZA 3RJDA 3BW9B 4CMHB 1MIEL 2FGWL 1NC2A 2GJJA 2F5BL 3PP4L 1HSBB 3VD5A 2VZ3A 3C09C 1IQDB 3DARA 3RWCA 5T3ZL 3PDOB 2MHAB 1CDUA 4C59B 5FUCC 2HP4A 5J7CC 3QEHB 2ICWI 4XNZB 2IALA 2DYPD 3DRTB 4PR5A 4ZS6D 3VWKD 1I3GH 3LEVL 2EO9A 5BW7A 1IKFL 2H2SC 2EKJA 3W9EB 5GS1A 3LKPB 4KKAD 1W72A 5D7JA 3WUWB 1UACH 4NWUL 3U2SA 5JDSA 1OAKH 3TA3D 2IAND 1BVLB 2JIXD 4HJJH 4WU7A 2OMBA 4I0PB 3VXMA 4MJ4A 1ZSDA 1FP5A 2N7BA 5F1IB 3ILPA 3QI9C 1IC4L 3UROR 5C6TL 5T1LA 3BEWA 3I9GH 2EH7L 4WY7L 1HH6B 2VR5A 4DFHA 4HFUH 1TNMA 3VGDA 5SV4A 3F58L 1T7XA 3X13A 5C86A 3H9SE 1NSNH 4IJ3B 4MCZB 5I74C 1ORQA 2ICWJ 1ZHLB 2DQJL 1F8TH 2G2RB 1NBYB 3OKOA 2VLRA 4YHMH 1GGIH 3U0TB 1PKOA 1OM3L 1X7QB 4ETQB 1IAOA 1QHPA 4MWFB 4XAKE 4Z7NE 2B2XH 5E4IA 5E99L 4N8VB 2DQJH 5AUMB 1CD8A 5DJZA 1CZ8H 5DK2A 5KVEH 3MACH 3V4VL 3BW9A 1YPZF 3RY6A 5I1IH 3JXAA 2EDJA 3T08A 2VZTA 3OJDA 5L0QC 3BP7A 2BNQA 2PO6D 4ZOAA 4KGJA 3SJVD 3SDCC 5LBSH 4G5ZL 5ITFA 4OCNC 2VXQL 5JPNB 3PIQA 4K3DL 3RWFB 5FGSA 5J3HC 5JUEH 4HCRL 5L7XL 2K1MA 4OI7A 2DD8L 1HI6B 5C6PB 2VSCA 5I18L 4FTVD 4LLYA 4NWUH 3OKLA 4UOJA 2XZZA 3C60D 4Y0GA 5C92A 3NCCB 1F11A 1YYLH 3T0EC 3RGVB 3QUZC 1E6OL 4HS3B 4M93B 4N0UE 3EOTH 1CU4L 2GJ6D 1SY6H 4OZFB 2ZUTA 4I4WB 1FPTL 1X7QA 1DQJA 2VUYA 1BLNB 2PW2A 2J5LB 2YN5A 3OWEA 2XACC 4GQPH 1JE6A 3ZT5A 3L3IA 2EC9T 4OB5H 2DRUA 2WIIA 3HI5H 4LPUA 5BO1H 5F1KC 4GT7A 4NWTL 3PWJB 2IF7A 3KS0J 3O9WD 2Y1VA 3EDEA 2MTPA 4Z5RB 1SEBB 3RWGB 4EN3A 1HH6A 2J88L 4I3GA 4EQ2A 3MLTB 4LLVB 5CD3B 3QXDA 4XPGL 4XVTL 3D9AL 2DWDB 1P53A 3WIFB 4HDIA 1T0PB 2Q7YA 4LMQI 5GS2D 5HPMA 5IOPB 2AQ2A 4Z7VA 3TWCH 2KZ1B 1TFHA 4XPTL 4HC1L 3VGHA 3U6RA 2AJ3A 2F53E 2GTZA 3P2TA 3UTOA 1A0QL 1RZIB 4X6FA 3UDWC 4ZNEA 2YD5A 5KN5B 1HKLH 4K9EC 3P4NB 5HD8D 3TVMB 2V2TA 2RHEA 3F12A 3IJHA 5E7BA 1OD7A 4KJQC 5KANG 2DQDL 4ZO8A 5EZLB 1IC1A 3L3KA 1IVLA 3X14A 4ZXBC 4H1LB 5F8RC 1F11B 3MLRL 2WNGA 1M7XA 3QDMD 4OLVL 2H2PC 1F4YH 4R0LC 4WU5B 4OZGA 4LHUA 2VLRD 3GSVB 2HTKD 4OV5B 3SY0A 3CXHK 4GRLB 2NXYC 4X7SL 2HAZA 1CDBA 1N4XH 3S35X 3NOIA 3RA7H 3P4OB 3FT3B 1T2QL 4QHKJ 3ULSA 1S7XB 3PWJA 2VXTL 1YEFH 1EVTC 5GJSL 3DXAD 1QRNA 4PUBH 4F37F 2YPVH 4ODUB 1SM3H 3FONB 3DO3A 4JGUA 2C3GA 3REWA 4WDIA 2JJSA 1KB5B 2PYEE 1UM4L 2K7PA 2ZCKL 2Z8RA 3CFBB 4LSVH 3L3GB 4J8RA 1J0JA 1TZHA 5GZND 1J5OH 3LZFL 1IAIH 1QQDA 1A7PH 1EJ6A 2UV3A 3CDYA 1ZVSB 1SJEB 3FQNB 2X4TB 1J1PL 1PBYA 4QXGL 3QIBA 1AR1D 2R1XA 5ELIA 3P40A 4LHJB 2ZUYA 4DFIA 2H3NA 1DN0B 4U3CA 1RUQH 4G80B 4GAJL 1BM3L 5JW3H 5GGSA 4MD4B 3QCUL 5GGSY 4BKLA 5KVFL 1R0AL 1D5XB 5GGVY 4K3EH 2P8LA 5GHWL 5HGDA 4HT1H 3UBXB 2EECA 3CFDA 1KF9B 5IK3B 2XKNB 5BV7L 4FQJH 2HWZL 3K7UA 3RWEA 3WJJC 1XH3A 4K8RC 4KVNH 2HT4D 4PJAB 1WEJL 4OZHA 3S3JA 2G5BA 2UZIL 3G5ZB 5F7WC 2NY0C 4XAWL 4KK9D 1BIIB 4H0HB 4E42A 1Q94B 1CXIA 2QR0A 3BN9D 3WHXB 3IXTA 2ITDA 1A6TB 3VDCA 5HXMA 3G6JE 2NXYD 1PKQE 3CX2A 3L3KB 3X14B 4E41E 2C7UA 3A67H 5I17B 3K46A 4U1GB 3QIWA 1NUNB 5HHNA 1ETZB 4GKNA 5K59F 1QVOA 3QO0B 2HTLC 2XZAH 1MFBH 3HLAA 3M8OL 4OCMC 4K55A 1HHIA 2F54E 5MEQA 2UWEE 5KSVB 5CBAB 3J7HA 4UQ3B 3LIZH 1XF3A 4NO2A 3W11C 1JGEB 3IETB 2ZOLB 1FNSL 2B7DT 4WGVB 3MRHA 3B9AA 3O0RH 3WN5A 4N90E 1A14H 3LEYL 4OTXH 2QQKL 3CAFA 5LGJB 2OR7A 5EU4B 2LABA 4KTEL 4YFDB 4P2RD 3HE6A 2Z92B 4KHXL 5BMFH 2BVPB 2R56L 5C07B 4WUKL 1QRND 1WUNT 1G0DA 3VU2A 5DYOB 4H88H 3H42H 2X4QB 1KPUB 1FFOA 2CKNA 4RQQB 3OXSA 4PJHE 2ZNWA 1OAUH 4QF1B 3MNWA 3BMVA 3JVGC 3OKMB 1AXIB 4QRRE 2EDNA 3BYYA 4OZIA 4HUWA 1TETL 2YUVA 5IFHL 1NBZA 1UGNA 1XMWA 1EEQA 3OGCB 1ZHBA 1HEZB 2BY1A 3HI1B 5DQJB 1JCKA 4I1NB 4MGXA 1U3HD 4Y5VB 3PWPE 4N0CC 1D9KB 1PDKA 5TJWK 4OJFH 3QJFA 5KSUA 4BH8A 2AJZA 1FGVH 2IALB 1EEYA 4HPYL 4PJCA 1G7PA 1VSCA 1UT9A 1UXWA 2X4PA 1S3KL 3GK8L 4G6AC 1UA6L 4KJYB 2ESVE 1X44A 1CDJA 2EIZB 3V4PL 3QB7C 4H5SB 1VEPA 1A7OH 3SE9L 4LLWB 5T1KA 4MLIA 3WS6A 2MJWA 4MXVE 4LIQH 4Q9BA 1HQRA 5EO0A 3SKOB 2FO4A 5FYLH 5DRNA 35C8H 5EBGA 5JHDB 1OGAB 4HXBL 3SDAD 3G6JB 5ICZA 5TFSL 5FO9B 1SYSB 3H0TB 4PJDE 5FM5M 2JLLA 5DD0H 1MJJB 1VGKB 2APTA 2DMBA 1A6AB 2XN9B 2HJFA 3QQ9C 3IS1X 1X4XA 1F6LL 4K23H 4GRLA 4MJ6A 5FUZH 5C0EB 5J1AB 3FFCD 5DMKB 1D5IL 1GGBL 3PGCA 5A16B 2RFXB 1L9MA 5F7MC 1D5BB 2NY6B 4JFDA 5ITBH 1I8MA 1MI5E 4WI7A 43C9A 1RZGA 1HXYA 4Z78A 4D9LH 5E8OA 5DFVC 4PPTA 2Q86B 4U1IB 4YHKH 5GS2H 1FFOB 3S37L 3T1FA 3EHBD 4PJ7A 2P5WE 3PABA 4LQ1A 1BVKA 4KI5D 4ONGH 3DRTA 5E8PA 2WSKA 2QKIB 4FQCL 2ID5A 1BEYL 4X98B 3AXLA 1C5DA 3UAJD 2NY1C 4F9LA 2ICES 2PTTB 1ZLVK 3KXFB 4PFEA 2W38A 3N06B 4WV1A 3CH1B 3ZYZA 4Z7QF 4HKZB 4PG9A 5IIEB 3FQXA 5D8JL 3RIAF 4E41B 3WUWG 3MBEB 1WV7T 1CI5A 2EIEA 3U4EA 5A2FA 4KJWC 5K9JH 1KTKE 3UC0L 3IDNA 1YDPA 2X1WL 5C0ND 3FZUC 3VXRA 2F8OA 4Z76B 2ADJB 3HA0A 1OP3K 1E0OB 4AEHL 5C0AE 1YY8B 2BSSA 4OT1L 1HSAB 3UTZB 3OKLB 4OZFH 1NCTA 3CSGA 1CXFA 4UMGA 5I1KL 3HCVB 1KN4H 2GQHA 4WJ5B 3ZE2F 5HHPB 5L7XH 3VGBA 5AYUH 2EXYC 4BK4A 5E24E 3LQAL 4ZQKA 2K3TA 3RWIB 3MRNA 5C08A 2XKNA 1K8IB 1OP5K 4M1GH 2Z0BA 1PZ5B 3ARGC 3RI5F 1DR9A 3P9MA 2HJFB 4RMRA 1FFQA 1KG0B 4JFDB 4S2SA 3S96B 4IIQB 3V6FA 2EDTA 4PB9L 4RMSA 3FO2B 5FYKD 5C1MB 4Q74A 1RZJH 1M7IB 5C0CD 2KDGA 2X4UB 4KKCC 2SEBB 3MMEA 4PJ9D 4PJXE 2ARWA 3ARWA 3UYPA 1B6UA 4ZUUB 3ROLA 1MCWW 1OAYL 5D5MB 4HGWB 3TH3T 4L4JA 2R15A 4LLUB 5JDSB 1PQZB 4QHLB 3CSBA 3WCYA 4I5BA 1BF2A 1U92B 4LARH 4O00A 4APQC 4NN7B 3FL7A 4J2XA 4NKDB 5KTEL 2NLJB 4X6DB 1JPFA 5J11B 5BOPA 5F71A 5I19L 5FUCE 1BD2E 1IM3B 5I0DA 1QSEB 5GRJL 2NXYB 2CQVA 4NHCH 2CJUH 3U4EB 2ATPB 2NTFB 4JDTL 3ZDXE 2X1PA 3K80A 3L6FB 2B1HH 3ZKSD 3LB6D 5MEQB 3HG1D 3IYLW 2VDNL 4QHUA 5CJQL 1C5CL 2KL6A 1EDQA 4JKKA 1CGYA 4JY5L 3K1DA 3DSFH 4OF6A 2NX5A 5JXEC 1JZ8A 3RNKB 4K8RH 4LKCB 1H3XA 4KI5E 2IH1A 4QOKB 4OM0L 2DIBA 4PJHF 1TVHB 2F74B 1I1FB 2HMID 5DJAB 4X6BB 3SE4C 4Y2OA 2R1YB 2WQ8A 4MD5A 4GXVH 5CGYC 5D72H 5GRUL 5CFHA 3OHXB 4WWKD 1U2HA 5SWSB 3MLUL 5GIRB 3O6FC 2VLKB 1ZLVH 1A4JB 4Q9CA 4YO0A 3SGDI 5IP4A 3FO0H 5GGSB 3H7BB 1WWCA 4Y4KC 3IDJB 4WFFD 1P5VA 5L2KD 4GMTL 2XNAB 2YPLD 5EC2A 4PLKC 4NIKB 1MY5A 3G04A 3IU3B 1RMFL 4K8RD 2PNDA 3N85H 2NY6D 1KTRL 2MQCA 4X4YB 1HILB 4P9ML 4FXLA 2YD6A 5IFJB 4IRJB 3VXQA 2VOTA 3ARFA 3MA9L 4P2CG 5C0GB 1P4BL 4LQFH 5KAQF 2EYSB 1HHGA 3PL6B 1QO3A 4JG1L 4Y1AE 1J18A 4RMWA 3QAZC 4R96A 2J4WL 5DVLA 3TT3L 2ZCLH 3JUYA 1DVFB 5ESAB 3NZ8A 5F44A 2V2XB 1V7NH 1MCHA 1CBVH 2VDMH 1L4IA 2A2QT 5HDLA 4ZDHB 1OOAA 3JV4A 3S35L 1UXSA 3TBYB 2J8UB 5GSVA 3ZE0F 4P48A 4URTB 3GUTB 1XGRA 3GO1L 1A6AA 4Z0XA 1OTUD 3ARZA 1S7TB 2BNRA 2VDLL 1LO4H 3DV4B 1A2YA 4YZFE 3C60A 5E8EA 4PYGA 1SQ2N 1IQWL 4ORGA 1ZA6B 1KJ2L 1HQ4A 4N0YH 5GGRB 1GVIA 3MUGA 4Q9RH 2MCPL 3TVMA 1LE9A 3CVIL 2YKLH 1EERB 1S5IL 2YN3A 2PCPB 1FCCA 3PP3K 4IJ3C 1QD0A 2GT9A 2V9RA 5IFAH 4CN6A 3PHQB 1T2XA 2BFVH 3BD4A 2DKUA 4C83B 2R9HD 5DT1H 3VDAA 3QIUC 4RMQA 3D25A 3OR7A 4BSWA 5TDNA 4RAUB 4JREC 3D5OF 4LLAA 4LEXH 3QI9B 3WLBB 1G7HB 2OTWB 1V3JA 2EYTA 1MHHA 1RY7B 3QEUA 1J7VR 2NY3D 1F3RB 4JANA 2D7QA 5DJ0B 5LG1A 1T20A 5HGHA 1BQHG 1A9BB 4K7PL 3A6BH 4M9PA 1DSFH 2VZOA 3GBLA 4FXGA 1AIFB 4RZCA 4JRYE 4MXWH 2E7MA 5I71C 5AZ2L 5GS0L 1K2DB 4RGND 4NM8H 5DEGA 3SO3B 3U0WL 5IVXF 4ZAKB 3U7YL 4MAUL 2APWA 2BCKA 4NO0A 4XB8A 5BS0B 2VZVA 5J1SC 4JFQA 1QLEL 3REVB 3QFDA 5FAAA 4ONFH 3RVTD 5DR5L 4L5FL 2OK0H 3HC4L 5FO8B 1X3DA 4QHMB 3FMGH 3C6LA 2Z92A 1S7RB 5FB8A 3T77B 1NMBL 1E4KA 5IMKB 4JPIB 4M6OH 2NY3C 3Q1SL 5C0RH 4TPRL 3IDYB 4H1LA 4L4TD 5EIIB 5ADPH 1KGCE 3DX9A 3EO0B 3QHZH 4XXDB 3ARDA 4Z7UF 5D2LB 5KVGH 2A6DB 4NQDD 1GOHA 3RUGB 5I9QC 3EYQD 1NGWB 3L3HB 5EZJA 5C0BB 1UQSB 5TE4L 5ESVB 4EN3C 3X3GL 1JV5B 1ED3B 4P3CL 3OR6A 3WIHL 2E7CA 3MNZB 4NBXB 2CIKB 1RULL 2DTMH 4S2SB 3S96A 1G7MA 1R3JA 4GKZB 2BC4A 1U8HB 3VFUA 4HZLA 4CJ1A 1RZJC 5ICZB 1R3IL 1G9ML 4HUNB 1IZKA 3KDMA 4JFDD 2GSGA 4GSDH 3OR7B 1QSFA 3BKJH 1MCNA 3MRBA 3U0PB 1J9CT 4O2FB 1RFDH 3N1GC 1QBAA 4HGWA 1TJGH 5GRWA 4TOYL 5J11C 5E2VH 1U8PB 1VFOA 1ZAGA 5D2LF 2HYMA 4PTUB 5D70H 2X09A 4MNGA 3K3QA 4JFZH 1KIPB 3LS5L 4ZG1A 5FYLE 2P5EE 3O6LL 4G8FB 1MHPH 3VXTB 4BH7B 2YC1B 1DUYB 3IKKA 4LLMB 1OLLA 3BP4B 4WFGE 3NBNA 5T1KD 1ZKAA 4UT9L 2ZUUA 4FQXA 4TUOA 3UZVB 3UBXI 5GRVK 2UZXB 4P59L 1MHPL 5ICXA 3ZZ1A 1ZTXL 2G75B 4FQ1H 4OGYH 4X5WB 5L2KB 1YY8A 3P0YL 1K6QH 4JPIA 3VXRD 1MFEH 2WP3T 3MNWB 4OQTH 4QHMA 3DMMD 1K3ZA 1AGFA 4P3DB 4QRSA 3M1BB 2VLKA 3MYZA 4ZPVA 1QR1A 3LKQA 3QIBC 3KPSA 4ODXA 4QEGA 3QUYB 4XC1L 1FC1A 5IF0A 2MMXA 2VLRB 3QQ3A 2EDDA 2AK1H 2IPKB 4PV9B 4XGZB 4RDQG 1PG7X 4G43B 5IW3A 4Z78B 5DLMH 3C08L 1T66D 1WCBA 3MV01 4P3WA 3CFJA 2VC2H 1I9IL 4TVPL 4MA3A 2FECI 4ZAKD 2AXJA 1UEYA 4D0CB 4M9OA 3SDYH 4NCDA 1HHKB 2Q8BL 4GG8B 3WXVH 2F53A 1DE4A 5HVHB 2XRAH 4OLXL 3UYRL 4HKBA 3HPJB 5DEZA 3FB7A 2CMRH 4P23A 2I26N 3QXTA 1A6WH 3HMXA 4P2OA 5E5MA 4C4KT 3QNZB 1XIWA 1A7NH 1JNHB 1H3PL 5KW9H 2A9ML 3P9MB 3W81A 4K3HA 2XTJB 5D5MF 5FGRA 4QRTA 2X89D 1MREH 3RVWD 2F58L 4JO2H 3L7FA 2VUOA 3FRUA 5DTFA 2ITCB 1JPGB 2PR4H 2AKRB 5JMRA 2VH5L 1CQYA 2X4QA 4QRSB 3U4AA 4JQIH 4FQQA 5AZEL 3B9DA 3NIFE 1K5NB 1AKJA 3SKMB 1SVCP 1UG9A 2BDNH 3DUUB 3B9VA 2HFFA 2FX7H 1RURH 5DMYA 4ORGB 1FG9C 6FABL 5A2IH 4B7LA 3QWQB 5BV7H 1U8QB 3A6BL 1JN6B 4YDIH 1YJDC 4OBRA 1DQDL 2FNBA 3BZEB 5TE7L 3T2NL 5EDXA 1YNLH 1LD9B 3TJHD 5DD6B 4PJEA 5DJXB 2CLVB 1A5FH 3QUMB 2Y5TA 3T8XA 5B38B 5F70A 1JGLL 4FP8L 1S9WB 3VXSB 3QUKA 1JWMB 2BSRA 1OAXH 2XYCA 4JN1L 5JW4R 2DS4A 2EDOA 5EWIH 4X0KA 2V7HA 5IMMA 1DL7H 3G6AB 1BIIA 5ILTH 4KPHH 2VXVH 3MV8B 3RTQD 3TYGH 2C1OB 4TTGA 1XH3B 4NQCD 2FLRT 4MDJA 1Z5LA 2QSTA 3RWJB 1MCOL 1NGQL 5M94B 3O6LH 3OX8A 3O8XB 4ELMA 1AKJB 3KLAB 4OZGF 4G8GB 4Z0BH 1CGTA 5DC4B 3W2DL 1VFBA 3FZUD 4YDKL 5CHNA 1LO4L 3D3VB 1SYVA 1A3RL 3IDJA 43CAA 1NFDF 3DMMC 5HHMB 4EDWL 4KV5F 3U7AA 3OTTA 1Z9LA 5E1HB 3ARFD 2VABA 4EI6A 2XFXA 1VA9A 3BEVA 3FRPA 1JWSB 4M5ZL 5IJVB 1A3QA 4KZEL 3OPZH 4OCXH 4P5MB 1CD1B 3S3PA 5C0DB 3T77A 5KSAA 1SMOA 4Y4HB 4DVBA 5F93C 4PREB 1U3YA 1RJYA 4X5XA 5E1AA 3DGGA 1JPGA 2EZ0C 1FNHA 1J12A 3I3BA 2DQGL 3F7RA 1I7RA 2A1WL 2IGFL 2DJUA 3W11D 5GZOD 1FIGL 4H20H 3C6LB 2J6EL 5LGJA 4IOSD 1FL3B 1WT5A 3TA3A 5HI4D 5CAYB 5C6WH 5CJOH 4X7FC 2AXHA 4WEUD 4QT5A 4G6AD 4U6HB 2NR6D 4DQOL 1ZHNA 1JMXA 3BISA 4WEBL 5IBUB 2Q87A 3WFEL 1U91B 3UTSA 3F5WA 2ZG3A 2Q6WB 3VFPB 5E7FA 1JPTL 2EKSA 3KPPB 3KPLA 3WDIA 3GMMB 4GAYA 2E5EA 1KLUA 3S4SG 1B2WL 4U1LA 3PP3H 3EFFB 4MB3A 1U93A 2R23A 3MV7A 3G04B 3IU3A 4CMHC 4X8XA 1U8NB 2FIRT 1Z3GL 3LKRB 4RFEB 4BSWB 1LVEA 2PYFB 1DBJL 3NA9L 1MCKA 3PDGA 1G7HA 5DC0A 5ENWB 3GHBH 3OB8A 1JWSA 1DLFL 3KPNA 1XGQA 2XWTB 3B2VH 2ZJSL 1L0QA 4XP9L 4N0CD 4B0MM 3O3DA 4GUPA 4XCEA 5BXFB 2H9GA 3G5VB 1BBJB 4G7VH 5FF6A 4U7KA 3O41B 5HHOB 2CO7B 4KROC 1XR9A 3FQRB 5D7IF 4YR6A 1OPGL 4LLMA 4OLYH 5TGBA 3A6CL 5BVPL 1RIUH 4D0BB 1FDLH 4H0IA 3BO8B 5IKCA 3MBED 4OI8A 4HCRH 1C5CH 3MRNB 3D18A 3TFKD 5DWUH 4NYLB 3WS3B 1AH1A 2F74A 4HIXL 2DB8A 4U05A 4LVHC 3MUJA 2W59A 2OJZH 2H26A 3T0WA 1SEBA 4XNXH 3HUJF 2PTVA 3QIBB 1M7DA 1P4IH 2FB4L 4RRPG 4JVWA 4M7ZB 4PG2C 2NX5E 1H9VA 2Q8AH 1JHKH 4EVNA 4OLWH 1Z9SA 3V6OE 4MAYA 4GBXC 5D7JC 1HH9B 4MQTB 2BVUA 1KUMA 1DBKH 4RFOH 2QTEA 4X5LA 5I66B 3LKQB 3IDGB 4OGAD 3P4NA 1N59A 5IJKC 1H8SA 4P5TA 4O51A 5HDQH 2VZSA 3SKUD 4HS6A 2OMNA 1CN4A 3LH2L 3FQXB 4XHJD 4F7PA 2NR6C 4BM7A 5FGBA 1HILA 4J3SA 2XTLA 4D3CL 5FA3A 3INUH 2VLJD 2APXA 2W65A 4CBPA 1FFNB 1KN2L 1V3KA 4DCQA 1ZS8A 3R4DA 1MI5A 5BRZB 4P5TC 1BP3B 3DUUA 4AEIH 5HHQB 5DSCA 2B1AL 3BH8A 1OCWL 3VXMB 4POYA 4DEPC 4MB4A 3QDME 5C0BA 4X6CF 3GGWB 1YEGL 4H8WC 4WHCA 5CJXC 1I9JH 1ED3A 4JY6B 1OAKL 1CFVH 1W72L 1FNLA 2YBRB 1BLNA 2PW2B 3VFTA 1N0XH 1Y18B 3ARGD 3E1F1 3EYFB 4YUEL 3MO1B 3HNSH 1T7VA 4PD4J 4J1UB 3QDHA 5H8DA 4M7JL 4XPBH 1IGCL 3ES6A 3WNKA 1B3JA 4OIBA 1NKRA 4HUXA 3U0TA 2NYYD 1AXTH 2V17H 4TYUA 4KY1L 4HIHA 4R7NB 1S7QB 1BD2D 4R9HA 3VRJA 4EXKA 2BSSB 2Z93A 1Q1JL 1Q9LA 5D7LB 4KK6C 2GTWA 4OF8A 3RWGA 1DUZA 4EN3B 5CD3A 3PHSA 3CPLB 4BJLA 3WV0A 3RPIB 1TQCC 3DXAA 4WWID 4NNPL 2OSLB 2BSTA 1TTFA 4EIGB 4HIEB 4LBEB 5C0CA 4JRYD 1VACB 4MLSA 2H32H 3PHOA 1EIBA 4NFCA 5MI0C 3T0DA 3O6KL 5F7FA 4NNXA 1GJIA 5ESVA 5FDYA 3V8OA 3WEXB 3W9EA 1X5LA 4KI5F 5GS1B 1UCBH 1YEJL 4Z7UB 5JDJA 2YWZA 4BZYA 4L8BB 2X1OA 4X6DA 2APBA 5MERA 3O4LB 4P46A 1EGJA 4LNRA 2IJ0C 4TSAH 2D9CA 5E94B 4E42B 4B5EA 3FAXA 2G75A 5C09A 1J8HD 4WCYH 3W5NA 2L7UA 4OGXH 2CK2A 2BNUA 1AGEA 2DI7A 3QUZB 4HX1B 5ICYA 2MNUA 4Y4HA 1RVFL 3BD3A 2ZPKL 4U6XA 1D5IH 4PJ7B 3RY4A 4IDJL 2OJEB 3OXRB 3THML 5AAWA 4PRNA 4AM0A 4NFDA 1A1NA 4EI5C 1RUPL 1YUHB 4YFLI 4UILL 5JLZA 1A7RH 4ENEC 3C60B 4HGKC 1MFDL 3ECBB 3B83A 4UDTA 1A6VH 4JVUA 5TFSH 2OSLA 2Y6SD 1Y0LA 2P44B 1G7JB 4WUUB 5D6DA 1T1YA 4W4OC 1EV2E 1FVCB 5D1XB 3OG6B 3EYSH 1HINH 4JRXA 3D39D 4ZXBA 2OP4L 5BV7C 5EBWB 4R0LA 4XMLL 4M43L 2EDKA 3DTXA 3NIFF 2DBLL 1U41A 3MLZL 2GITB 1LEIB 1INEH 3AAZB 3PWUA 4ODXB 1WGOA 1HCVA 2DKSA 4YWGL 5I76B 4N9GA 2ENYA 2VQ1A 4KZDH 5F6HI 3HNVL 1UM6L 3QO1B 2EDWA 5D2NE 1WZLA 5TDOA 4UUJB 4U1KA 4JCMA 4W4NA 5A3ID 4ZFOB 1P84J 4YZFF 1BJMA 3MV8D 4PV8A 3LRSA 4FQHA 1OSPH 3T2PA 3GSVA 4JFXA 1S5HA 3U46A 1I9RL 5I17A 1CT8A 4JFOB 4Q2ZB 3L3OA 1J0ZA 3DV6A 3O3BB 4F15C 1QA9B 4UTAL 1P7KA 3MV9D 3QG6A 5CINL 2EDLA 4OLUL 2F54A 2UVFA 3UP1A 5K9JL 4K3JL 2DLTA 4YR6B 3EDDA 3P77B 3VXUA 1I1CA 1TXKA 4EN3D 1T1WA 3IFLH 3MUZ1 5I6XB 4PB0H 2Y72A 2J12B 4GUPB 4JG0H 4O58L 2FX7L 1B0WA 1N8ZA 3O0RL 1G7QB 5HY9B 5HJ3A 5IT2L 5EZOL 5FCUH 3QH3B 3WJLC 5HYQA 4U49A 4L8SB 4MNHA 3R0MA 1MSPA 1Z3GH 4HC1A 1C5BL 1KEML 4XP1L 3T3MF 4DUXA 3NZHH 1VB9A 4X6DF 2CIIA 4M6MH 5EU4A 3KPSE 4WHYG 1IM9B 5CLWA 4JFEE 4LP5A 5DS8A 4UT7H 1P2CB 1UCTA 4JFXB 3ROOA 2XZCL 3WFEH 1A7NL 1J10A 4CN4A 1OQOA 3OXSB 3B2UD 1N2RA 4POZC 4ORZC 3PWPD 2DBJA 3VXSA 2VQ1B 3TLRA 2HT4C 1FRGL 5GJTL 3MBXH 4Z8FL 3TCXA 1R5IB 2OL3B 2X9WA 2H2SD 1YPZA 4DK3A 5D2NA 2R1YA 4EI5D 1UH4A 4OI9A 5D1QC 1RJYB 2W60B 2DQEH 2IAMA 2P5EA 1I3VA 1CT8B 2A6KA 1CR9L 1UVQB 1FAIL 5K9QI 3LD8B 4LIQL 3P73A 3GSNL 2BCKB 3SE3A 4E5XA 5D2NC 1WZ1H 3ZKND 4MS8D 1RZ8A 2GIYA 1DBML 1KTLB 4HH9B 3H9YA 1X5HA 5BZDA 3LS4H 1K6QL 3IJHB 4PJ7E 4GW1A 4BA8A 1YN7B 5EZLA 1JJUA 4TUKL 2R4RH 2A0LC 4Y5XC 1FRGH 4RGNC 4F80A 4KUCD 3KHQA 4M6NH 2YZ1A 3L9RB 1N2RB 1RQ5A 3LZFH 4HPOL 3BKYH 3NFPB 2A83A 4NQDB 5HTSA 3V0AC 3TVMD 3RU8H 1IRAY 5D2LE 1TZIB 1HXMB 4OD3L 5EWIL 1EXUB 1DQQA 4TSBL 2VQUA 5FO7A 4PJDA 4P2RE 2EDBA 4NGHH 3H9SB 1MJ8L 5JHLH 4PJBF 5CWSB 4YDVA 2EC8A 3FRPG 1NAMH 3QQNA 1DVFD 2X4RB 1A5FL 3KJ6L 2V5SA 3J8F7 1UYWH 4X4XA 5BRZD 4PY8J 1DEEA 1GPOL 1V7ML 4H26B 3I50L 4M8QB 3KYMA 5E8EB 3CU1A 4OLVH 3GMLB 4JG0L 4O58H 3QIWB 4EQ3A 1YEHL 2DQEL 1H5BC 4TRPL 3QFJA 2E8ZA 1IILE 1FORL 1OB1A 5F88B 1BAFH 1PG7L 4G6KL 4MNQA 4GRMA 4G7YL 2R29H 3X3GH 1HDMB 3FN9A 1JZ2A 1CTNA 3EFDH 2W0FB 4J4PA 5MENA 7CGTA 1G9MC 1W0WB 2I60L 3CX5K 4O02H 4NZUH 5FHBL 5D1XD 2LU4A 2BNQB 2X5PA 3BIBX 3D9AH 3KPTA 5C0AD 5F7HA 4MJIA 5J12C 4L3CA 1KBGL 1JL8A 1KIPA 3MLWL 2O61A 4NZUL 3RVWC 4DW2H 1RU9H 4POZD 1FYTA 4LP4A 2PW1A 2IMMA 4G6KH 1KJMB 1ORSB 3U7YH 4QYOA 4M7KH 3W9DB 3BX7C 2OP4H 3FO1A 2AV1B 4ZS7H 5TQ0H 3ULUE 1SJEA 1ZWIA 4R2GB 3K1KC 1V8HA 4XI5D 4FQ2L 5EUOB 1JF5A 1WF5A 3FCTB 4HUVB 5E8OB 3GJFH 2ESVD 5FM5O 1AGCA 3HPLB 3M1BA 4CRPA 1A3LH 1Z0NA 4Y16B 1SBSH 4UTAH 2V9QA 1MEXH 1QACA 2D03L 3X17A 4FNLH 3QQ4B 2AABL 4PJCB 1T21A 2YXFA 5T3XD 1S9XB 3VCLB 3TGXA 3TPKA 2W9EH 4HAGA 1X5XA 4AIOA 1T7ZA 3E3QC 4PJ5B 5CIPH 2F19L 2WBWB 5F88A 5GGTH 4N90D 4PRPE 5L9DL 2WLZA 2IG2H 5D7IB 4A2MA 2DL9A 4LLQA 3NMEA 3S6CA 1HWHB 4PLKD 3MRPB 2ATPA 3F12B 1R3JB 4GKZA 4EBQL 1ZEAH 1C16A 1P1ZA 1A1OA 4X80H 5KSBE 4D0BA 4HUWB 4M1DH 5SX5H 4LASL 4DN3H 3TFKC 4NC1C 2R2CA 1VEMA 5INDB 2X6MA 4G6MH 1FLRH 3WFHB 1TJHH 4F3FB 1S7SB 3QXWA 4F8TA 4DKAA 5LXGH 1CFTB 3S88L 1CBVL 2X1QA 4R7NA 1ND0A 3VRJB 3FT4A 1ZHLA 5JW4N 2CRYA 4PJXB 3DYOA 1DUZB 4LGSB 1JF1A 3WD5L 5D1XA 1A4JA 4NM4L 4KK8D 3U83A 1GAFL 1EMTH 4MSWA 3SE8H 2NMSA 5M95B 2VRAA 4MA7H 3VDBA 1ZLWK 2FX8L 1KGCD 4N8VA 4P2RB 2JELL 3V5DA 2XN9D 4YO0B 5D2LA 3CVHL 5FM8A 3TPUA 2FIKA 2OXGA 3QHZL 3C5ZC 5DD1L 3CCHA 3NABL 3RTQB 3N1MC 4G9DB 2ORBL 3PQYA 3QEGL 2C3XA 3G5YA 3VI4E 3WFBL 4YHZH 1RSFA 1FL5B 2IBBA 5JR1H 1L9NA 3PIQB 1FVDB 3E8UH 3HI6L 4GW5B 1J8HA 5JTWA 2R9HC 1QLEH 4JFFD 4ODTL 1JRHL 2DI9A 4H0GA 4WW2A 1WBYA 1KNOB 4GXVL 1F6AA 5GRXG 1NCDL 1MFCL 1QFWM 5CIPB 2R0WL 1AE6L 2V7HB 4KUZH 4YPJA 3QWRA 4U1GC 2AJYL 3QHFL 1ADQA 4QRPA 1BJ8A 2DQUH