3EW3B

The 1:2 complex between a nterminal elongated prolactin and the extra cellular domain of the rat prolactin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
203
structure length
203
Chain Sequence
MQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
total genus 27
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B01
1A47A 1R0AL 1S9VA 4V1DE 3G5VA 2X1PA 4G6JH 4WY7L 4XAWH 1MIMH 1CLZL 5GRVK 3ZKQD 4TUOA 3KPNB 2A83B 2YXFA 1FC2D 4KUCD 1I4FA 1HYSC 3G5YA 1NEUA 2KH2B 3G6AB 3ESUF 4WFED 5IGXH 1P4IL 5D72L 2HMIC 4LRNL 4JO3L 3DYMA 5C0IA 1U8KA 3T2OA 5H2BB 3KYOA 4KHTL 5GGTL 4PRIE 1MCDA 4X6BB 3KAAA 5D72H 2MQ3A 5T1MB 1T7WA 4W4NA 5KZCB 4X4ME 1YMMD 1A1OA 5JMRA 3BH8A 1FV1B 4JLRB 3QI9B 1OD7A 2Y4SA 1NL0H 2L7JA 1LP9A 2X1WL 5F93C 3L3GA 3UTZB 3B2UD 3OBAA 3SDCC 4JFHD 5BCAA 1NGWB 2Y07H 2VITB 2BCKA 4OCSH 3AMLA 2WBJB 3ALWA 4P4KA 1RZJC 4CU7A 3CVHH 4L4VE 2DDQL 5B22A 2QSVA 4F7PA 4PJBB 5JXAL 4M6OH 5JIHA 5D7LD 5GS1B 4DCQB 3MRKB 2SEBA 5FKPB 5DEZA 4OJFH 1EO5A 4HWZB 2FGWL 3FTGB 3G6JA 4P2QE 4LHUA 3QEUB 2FH8A 2Q6WB 4CU8A 3L6FA 5B8CB 3DV4B 1X4YA 4PY7B 2MTPA 4WI5A 1TZHB 4KDVA 15C8H 4NQXA 4WRLA 3R06A 3EFDH 5DF0A 2ZKHH 3TF7C 5GPRA 3NFNB 3I3BA 4N0CC 1JF5A 1F90H 1FE8L 1H9VA 3BQUD 3WFDL 1B6UA 2OK0H 4PLJD 1A4JA 3JTSA 4OCRL 2JK5B 3IU4L 3RPIA 3G08A 3QR2A 3L3OB 3AVEA 5CGYD 4M8VA 3QNYB 4PJFF 3QEHB 3FRPG 1U8LB 4KUCF 1UA6L 3IFLL 3S3PA 4Z7QF 3TC9A 1A14H 3TZVD 5IFHH 1YY9D 3NIDF 1KPRA 2R9HD 2QADB 4M6AA 4NKQB 1KIQA 4JDZB 2FCBA 1J87A 4ODHH 2DYPD 3EYSL 3MLXH 3WIIH 5CEXA 3NIDE 3BJ91 5F72S 5EPMA 1K5NB 1KELL 5KS9F 4L1DA 1XGUB 5KS9B 4ZUWA 3PWJB 2GEEA 2VAAA 5CINL 5TE7H 1CL7I 5FUZH 4UBDC 1W72A 3DARA 4X6DA 4K8RL 5T1DH 4YQXH 3IJYA 1RJZB 3FFDB 4QHNA 2X10A 5EOTA 3OKKB 4B7IA 3UZQA 3D87B 2N4IA 1FCGA 1RIHL 3PNWB 3CCHA 4JJ5A 1BM3H 3HPLA 3I2CL 3RPKA 1GC1C 3WS3B 4IDJH 1NCBL 2HFGL 3BP4A 4YXKH 5DLMH 5D7JD 1G7MA 5EO1B 1A7BA 2CSPA 4X9FA 5JOEA 2WBJA 4PTTB 5E6IA 2DIJA 5IFHL 4NO0B 5JIPA 1FG9C 4BZ2L 3VFTB 2W9DL 5DI8B 4OZHB 2VDPL 1AXTH 3KLAB 5L2KD 5D1XA 3A6OA 4B50A 2EDYA 1GRWA 1VGEH 3LMJL 3VXMD 1C08B 3RWGB 3S36L 2OCFD 2R2BB 4F9PA 1H15A 3GMPA 4G43B 3VE0A 2DQHL 1I75A 3BW9B 4NQCD 1A6ZB 1RK0B 3MNZB 1E6JL 1H3UA 3DBXB 3MROB 4N8CL 1IAIL 1VKXB 2Z92A 3MREB 3WJJA 3P30H 1O7SA 3LEYH 2KZWA 3HNVH 5I17B 1A7QL 1KF9B 2BNRD 3LY6A 1ZANL 3MRMA 2Z91A 3DGCR 4TN9A 5GGQL 1BLNA 5DQJB 1ZT7B 4K3JH 5E2UH 1H8SA 3FL7A 3MV9E 1ULVA 1OGAA 3I50L 3PABA 4HZAA 3DIFA 4KJQD 5HY9A 3GJEB 1RK1B 2AXFA 1F42A 2NX5E 5AWNH 1KXQE 1P4LA 2P8MA 4YHNB 4TUKH 3GMRA 2V2XA 3GJFH 5I1JH 5HHQA 1T7ZA 2CRIA 4MX7B 3DMMC 4X7SH 5T3ZL 1A1OB 1WJ3A 2XA3A 1OSPH 3RHWK 1IBGL 4KVNL 3SE9L 2VE6A 4ETQA 2GIYA 4HKBA 3OPZL 3EKCA 4M48H 4HIXH 4JGJA 4TOYL 1HXYA 1NUNB 5CWSB 5ID1B 4PJHA 4APQA 5JHDE 3MA9L 3U9PL 2WANA 1DCLA 3TNMA 1PDKA 1YEKL 3Q3GA 1G7PB 1F6AA 3LEYL 1QLEL 1JP5A 2AK4B 2H1PH 3VXPB 3LOWA 1G6RH 1YYLH 5I66A 4XXCA 5DK2B 2OZ4H 3PXJA 1OGAD 4ORGB 2XRAH 1KLGB 1WFNA 1MRDL 4M7KL 3DYPA 4WJ5B 4KRPB 1ZVSB 1VERA 4TTDC 4OF7A 5IBUB 3RL1A 3WFBL 4DGVH 3QO0A 5C7XH 5LGHL 3EYOA 2HJLB 1BBDH 1NGZB 2BVQB 4S1DD 1CGVA 3IU3A 3NFSH 1SEBB 2FIRT 2HG5B 5T1KA 4ODSL 3C8KB 5IVXB 2YA1A 4TULH 4Y1AA 3JTTB 1F3JB 4U1GB 4HBCL 3MLYH 4YXHH 1K8DA 4RGMC 2R56L 4QHLB 1AO7D 1T2XA 4UQ2B 4J3UA 1K3IA 1FH5H 4JY4A 1GOFA 5HYQB 1A6WH 1UXSA 3KPOA 2BSTA 4XPBL 3VW3H 4NO5B 1YY8B 2IAMA 1T2QL 2VDKL 2YA2A 4M3JA 1PZ5B 2KQMA 5I73C 4ZS6D 4JDVA 4XVTL 5J6GA 2Z31D 4OIIL 3V52H 1NAKH 1EGJH 4Z7UB 3QUZB 4X5WB 4DK3A 1WWBX 5KSVB 1QR1A 1Q8MA 3SDAB 1U8MA 4KK6D 4PREB 4U1IB 1Q94B 1DBJH 3ES6B 4GLRI 1LMKA 2ADIB 2NX5A 3GSNB 5KW9H 2KZ1B 3EHBD 4O02H 1I1AD 3GNMH 1XCQB 4DGIH 2HFEA 2X4RA 3H9SB 4PJ5E 5HDBF 4OIBA 4PRPD 1U8QA 3C2SA 3LN5B 3FKUS 2YBRB 5KW9L 3QAZB 2IPKA 4D0BB 1G9MH 3KPRA 2X4OA 4XNZB 2AXGA 1TNMA 2VZVA 5BXFB 3OKYA 3OKOA 3T8XB 1QFWL 1D9KB 1T1YA 2DLHA 3EYVB 5FA4B 1CFTB 1N59A 3TA3C 1KB5L 3GMQB 4QRPB 1RJLA 4JRXE 2CK0L 5MEND 4EXPX 1X5FA 3AXLB 2DJUA 3CX2A 5E5RB 1NDMA 2A38A 5A2JH 1ZVSA 1GGCH 4FTVA 1RZIB 2R0LH 4DVRL 1NFDE 2DQGL 4NO3B 2O26U 2EICA 4X7DC 4ZYKB 4PGEA 4L8CB 4ZO7A 4OZIF 4ONFL 3VFPB 4H1LG 4ZFOA 2HLFD 2RQ8A 4HZLA 4JCMA 1LO3H 3CD4A 5ANME 2P4AB 1IFHL 1WSST 2NW2A 3SDXF 4MNQB 1UGNA 2IQ9L 1B0WA 1PYWB 2IH1B 4LVEA 3EHBC 1J1PL 2BNQD 1QHPA 1MJ8L 2B4CL 3GMRB 3QB7C 5I18H 5HBBA 3PL6A 2IMMA 3FQXB 1IGFL 3FCTB 3GJEA 5FA3B 1A7RL 4K3EH 2J5LC 3M1BB 3CCHB 5I18L 5F71A 5HVWA 2CO6B 1M7IA 5FO8A 5BMFL 4G3YL 2YPLE 3WS3A 4JFDB 1LGVA 4FG6C 1H3PH 2EO9A 5AAMA 2XIDA 3ARDA 3I85A 3ZT7A 1NUFA 2VSDA 2YPLB 4JFFB 5I0DA 1Q1JH 5ESQA 5DJZA 1FORL 4HIIB 4M48L 3UCRA 1ZK9A 2FATL 2NY4D 4H8WC 4F57H 4QYOB 4J3XA 1R0AH 4U7SA 1H3XA 4IM8A 1P5UA 3ARUA 3O6LH 1KEML 4LOUD 5ID0A 1OOAA 1BAFH 1OAQH 1CICC 4ZSOA 3FO2B 3NVQA 4YDIL 2NX5B 5D1QB 5J9PA 1TTGA 4IBLT 5KOMC 3NABL 2VB5A 2C3GA 3VRLE 3CSPA 1QBLL 4AM0B 4FZ8H 3GO1H 4P49A 4GRWF 4MJIA 1G9NL 4RGNB 4KTDL 2VIRB 4CAGA 4QRRB 5C0DA 2I5YH 1CR9L 3RRQA 4OLXL 2OTWA 4XC1H 4F15B 5C0FA 2HT3C 4DW2H 1OGAE 1J0JA 1WICA 2IALA 1L7IL 2PW1A 1KFAL 3BZEB 1MHCB 4DUXA 4LPCA 9CGTA 2X9WA 2E6JA 2E8YA 1RIHH 1RUPH 5LVEA 3BWAA 4FQLL 2BOBB 2IGFH 1K8DB 3MRFA 1OTUD 3QDME 5J3HC 1QKZH 5EZIL 3RI5K 3HI6H 3QI9C 3G6AA 5JW4N 2XQBH 4YIQB 3NCYS 5L88L 2X1QA 3LH2H 4OZFA 2EEAA 2IGFL 1JN6A 2R4SL 4PS4H 1WISA 4OJFL 4DKDC 3UTTB 1RUKL 2HYMA 2C1PA 1KIQB 4JDZA 1AKJD 5CMAA 1CS6A 4JFDA 1B0GB 3Q6FB 3KYKH 1CT8A 5IMOB 3V4UH 1SVZA 3MV01 3RWHA 4LIQH 3M1BA 1CLYH 1SBBA 2QQLH 3RVWD 4FTVD 3PDGA 5IVXE 4HT1L 4TSAH 4HIIA 4KVNH 4P5MB 5DJXB 3WLWD 5HYEA 1HHHA 2ZUWA 4NFBA 1JGLL 2X4RB 5D2LB 5J56B 2IH3B 2WMPA 2YPLA 5I30L 3U0WH 1YEEH 3ULVC 4ERSH 3V6OE 5JQ6L 3OKMB 3KDMA 4IRZH 4PTUA 3QHZH 4Z9KB 2E7HA 1UM6L 1WFUA 2FEDC 4MJIB 3UYRH 4GMSL 4D0DB 1PG7X 1JZ4A 5SWQB 4IOFD 4LASH 1ES0B 5ADOL 1UB5A 1O0VA 2VWEC 1I1CA 1NBZA 2IG2L 2J6EA 2NZ9C 1ZXQA 2AJVH 1T2JA 2CDGB 3NA4A 3ARFA 4DVRH 5GS2D 4KZDL 3IDYB 5DD6A 1RULH 3GSVA 4NQDB 3UP1A 1KTRL 1T7VA 3D2UB 1PSKH 3GSUB 5FGBC 5D71L 5KSAB 2G60L 3UROR 4NJAH 1EZVX 4ZDHA 4O58L 4P2RA 2LVCA 4M7LL 1Q9KA 4LIQE 1WWCA 4JPKH 5CZXD 4YIQA 1YECL 1LO2H 1EPFA 1ETZB 3V6BR 4ALAL 4AYFA 4ODXB 5D6CA 5E00A 4H0GA 4NZRL 2PW1B 2BVUA 3IFPA 3FCTA 4ZUVB 2GTWB 1G6VK 1JWMA 3SO3B 1NCCH 3MLRH 4FABL 4P4RA 3T3PE 1MJ7L 4QRUB 4RBPK 1D3CA 4NPYA 4ZFZA 5KAQG 2EH8L 4OBSA 4HIEA 4FOMA 4WENB 4N8CH 4OGXH 2KUTA 1U92A 5F3HB 5FCUH 1R5IB 1OY3B 1EEYB 3BQUC 1TJHL 3R8BB 1YUHA 3EDDA 4Y0GA 4X6FB 3TM6A 3ESVF 1CXFA 4UTAL 1FO0B 4HUWA 5E08H 1GPOL 5E2UL 1VFOA 1XCTB 4PJXB 4D3CH 1BJMA 1E0OB 5DDHA 3ULVH 4KI5D 1DQJA 2APBA 5EC2B 2FSEB 4Q2ZA 1XF5A 2DWEB 5IJVB 4OUOA 2DD8H 3QIWB 3MRDB 3MR9A 3NFSL 2YPVL 3GSQB 5F1SA 5C0BD 2B4CC 1DE4A 5GGVL 5JUEL 4EIZC 4K94C 4RQQB 4JO2L 1YJDH 3OKOB 4WHYH 2ZKHL 2PN5A 1ONQB 5DT1L 3ARXA 4OSUL 3O2WL 1JRHL 3O4LA 5GGVH 3ARTA 2MKLC 4M62H 3GSOB 3WDHA 3VW3L 2R2HB 4Q58C 3V7MA 2FYYA 1MHPH 1K8IA 3UBXG 2ZG1A 4UDTB 5LCVL 5HHOB 2V7NB 1OF2B 2FEEI 3IFOB 1JK8B 4XTRC 2R29H 2BFVL 3SBWA 4KH2A 3GRWL 3U4AA 3CVHL 2IAMD 3MUGA 3ULUD 5BZWB 5DJXA 2BVOB 2R29L 2D4DA 4AIZA 3VXOB 1XR9A 5K9KB 4Z7UA 5ETUB 1Q0YH 1X6LA 4ZPTB 3SOBL 5IBLD 3GNML 4KY1L 5HI4D 4NCC1 4LSTL 1PZ5A 3SKUD 3OKLB 4R4BA 1TETL 3IU4H 1D6EA 1EHXA 3RNKA 1T6VN 5JDJA 3UO1L 1IEAA 1FFOB 2VXSL 4ZAKC 5DS8B 4R0LA 2CDEB 3O2WH 4H1LB 3PWLA 3QDMB 5C6WH 1F58L 1TIUA 2EIZB 3HAEH 1EHLH 1X5JA 1A7PL 4S1SL 2AERT 3INUL 3TT3H 1J11A 3VD3A 3WIIL 2AXGB 4ORZC 1QUNA 5T33H 1G9EA 1A6WL 1F6LL 1A6AA 4HJ0D 4HUMB 3DTXB 2ITCB 4F37F 1PLGH 3IXAB 4X80L 2QEJA 1JWUA 3X13B 1GJIA 4J4PD 1MI5E 3IFLH 2BOCB 1WFOA 1XT5A 3TZVC 2R4RL 3VFMB 1N64L 4K7PY 4R26L 4NNYA 1GZPB 5BV7H 2UUDK 4CL7A 3BIKA 4F7TA 4YZFF 1RI8A 3FONB 3AUVA 4JHAH 2XPGA 3EJZC 1LEKB 2BSED 1CGUA 2NY4C 2ESVB 4HKXB 2C4FU 2KPNA 4FQQB 1NL0L 2D7TL 2EIDA 3SE8L 5J6GB 3ILPA 2X42A 1MJJA 1C16B 1HQ4A 1KIRB 2LVEA 4DKAA 4Y88A 4HZLB 5JORA 1N3NB 1XF4A 1HILB 2EDBA 3QHTC 1X9QA 4XP5L 1I1FA 1NUGA 4L4TD 3H3PH 1ETZA 2XTJC 3WLBA 3BKCH 1FYHB 5C08E 2BRRH 1OARL 1AXIB 3EDKA 4P23B 4QGYA 2FR4A 3U46B 5A16A 3DMMA 2CKNA 3T0ED 5SX5H 3CSGA 3H9SA 2Q76A 2YEZA 1QSFA 2F53E 4Z7WA 2DB8A 2EDTA 2OR7A 1S7RA 5EO9A 4P9ML 5F1IA 3DETC 4NN5C 3NCFB 1KTLA 1WZKA 3C6LB 3QUMB 5T5NG 4LPTA 1WF5A 3ARED 5C0EB 4NUGL 4XWOC 4Y19D 3CDFA 3DOSA 4JRYA 1ZGLB 3BKMH 3OKLA 1DDHA 5D7IF 3ZDXF 3S96B 1BREA 4Z8FL 1BF8A 1J86A 1HOCB 1HIMH 5AAWA 4L8BA 1A21A 1XR9B 2ITDB 3HZVA 3I50H 1W0WB 3BX7C 1I9IL 1J0IA 2CUMA 4ZAKA 2JB6B 3FO0L 4XPFL 4JFZL 3V79C 3QFDB 5AD0A 1G0DA 1MHPL 4NC1C 5IR1A 1DBKL 4WWID 3AS1A 4FQ2H 1FGNL 1C08A 2IH3A 2WK2A 5F70A 5KSBA 5HGDB 2PXYB 4HKJB 4OM0L 5C0DB 4PY7A 4OZGA 1NBYB 4OFYD 1DVFC 4GBXD 1FN4B 4FQ1H 3V6OC 2ED7A 1CFQB 3RGVB 4XNQB 4BFEA 4FP8H 4M43L 3CH1A 2ED9A 4FXKA 4JFPB 4Z95H 4YWGL 3SE3C 3W81A 2CQVA 1T6WA 1DFBL 1KC5H 1PQZA 1QSVA 4FS0A 4G8FB 1L7IH 2CGRL 3MNVA 5GRJL 1LDSA 4P5TB 5CIPA 2BNQB 2IPTL 1C7TA 3K4ZA 4RAVB 3T77B 3S5LA 1VKXA 2BVOA 1NFIA 1U8JA 4X80H 4X6CF 1J0ZA 1K5NA 2DM3A 4MD0A 5E0QA 5DLML 3EOAA 4U1LA 4JFFA 1FL6A 1NCBH 3WXVL 3LKNA 3K3QA 1S7WA 4L8DB 1FV1A 4JLRA 4XPGL 3B8SA 3G5ZA 2BOBA 1BGXH 3EO0A 3S4SG 1YNKH 1NC4D 2OQJB 5LGHH 2EYSB 2B2XH 1GHFH 1D5BA 4M61A 4Z76A 3M45A 2OX5A 5EPMB 5C08A 4AH2B 3NBNA 4CJ0A 4RISH 5DHYB 3WEXB 2VTFA 1CG9B 1IKNA 2VXQL 3HMXL 2HTKD 2I26N 3QDGD 4WU7A 5ICXA 1I1AC 4HUNB 5FB8A 4PJ7F 3U36B 5ALBL 1CZ8H 2OLDA 4KJYB 4G80B 4BQ6A 3W11C 4KK8C 1JZ2A 3TNMB 1YEKH 2ERJB 2HWZL 2NTFA 1H8NA 4M6NH 5TF1L 4Z0BH 2NY0D 2ZSVA 5I75C 3N0PB 4FQJH 4MNGE 3NPSB 3ULVF 5EC1A 3QXVA 1A6AB 4MXQD 4TTDD 4YPGB 2HVKB 1EJOH 1I1AB 4RIRB 3DGGA 5SV4A 5SX5K 5GS0D 4CVZA 5JR1L 2WQRA 1ZGLA 1QRNB 4ELKB 1NMCB 2PCPB 1TJIL 3HC4L 4JVWA 4Y4FD 1AR1D 3DVNA 5LQBH 3GSRA 4U6VH 1PQZB 1C5CH 4TVSa 2EXYD 2AEIT 4BH8A 5HHME 4FQXC 1KCUL 4NIKB 1Q9LA 3AC0A 4OZGE 4GMTH 4XH2B 5C6PB 2YD1A 3ZTNL 5C8JB 3TPKA 1VGKB 3MREA 3ALPA 4HS8H 1SJXA 2CJUL 3X14A 3TO2A 2QR0B 2Y7QA 5IEHB 2OR8A 3P4NB 1MCQA 5GGRA 4R2GD 3VI3F 2CDFA 5GGUB 3GKWH 2J8OA 3PGFL 4AENA 3BGMA 3F65A 2EYTA 3BZFB 2IBZX 2PW2A 3ARDC 4PLKC 4JG0H 4QO1A 1LNUA 3VFUB 2W0FB 3L5WA 3PF2A 1QR1B 2C9AA 3HPJB 4N1EA 1B9ZA 4G7YL 1IBGH 3TYFB 5I1KL 4MNGB 5F7LB 4U1NB 4GS7C 1V8HA 3DVIA 4NWUH 2HT2C 2H3NA 3DSFL 3GHBH 2ZUXA 3VXME 4IOFC 3L5XH 4NHCH 4UZGA 3MJ7B 4U6YB 1ZVHA 5KBNC 1H3WM 2CRYA 4CU6A 5EOCH 5MHSD 2BDNL 3RTQA 4ELME 4IRJA 2D7QA 4Z76B 1MY5A 3C5ZC 4J3OC 3WJLC 2H9GB 4C56B 1HKFA 5I16A 4JRXD 4Z78A 4ZFGL 3MGTA 3HMWL 4I0KA 1T1ZA 2VQ1B 4N0YL 4R8WH 3QNXA 4NZTL 5E2WH 1P1ZA 2BMKA 4PJ8B 3GMMA 2OJEA 5IMKA 4ZMAT 3V0VB 1I7ZB 1QOKA 3W0WB 3DBXA 2CDEA 4H1LA 3ZTJH 4AK1A 4W6YB 3WD5L 2HFEB 1LD9B 3R1GH 5T3ZD 4HAFA 4KKAD 3SOBH 4NNPL 4HT1H 5EBWB 1N7MH 1DANT 1RFDH 3RGVD 4PJ5A 4CKVX 3S36H 5C0JA 5IW6B 4Y4KB 2I07A 5LAXB 4CMMA 1XEDA 4DVBA 1I3RB 5FECA 1AHWA 3KPRE 2XA8H 4X6EA 1ZSDB 1IC4H 4TVPD 3QXWA 2EE6A 4WFGE 1FAIH 5C0GB 2APWA 3RVTD 4RMVA 3NCYP 4PGDA 4ZFOB 1R3LA 5CP7B 3P4OA 2Q8BH 4NOFA 4N8VB 2VLJD 4UDTA 4JRXA 5F7FA 2CIIA 1H0DB 4M8QB 2F8VA 1GGYA 2VLRB 4O2FA 2XRAL 3IJHB 5GSVB 2AKRB 2RR3A 5FGSA 3PQYD 3QCVL 3QXAA 1A6UL 2RFXA 5CBAB 5EU6E 1EZVY 3PGDA 1UYWL 3T3MF 1F3RB 4UU9A 4XP9H 1TETH 2BNUB 1S7UB 4YDKL 4TQEL 1HQRB 1U95A 2VAAB 5I8KH 5L2KB 1M7IB 2ZUSA 1CIDA 4YHYC 1A1MB 3VH8G 3RNKB 5CEXB 3LQZA 1A6VH 1ADQA 3OZ9L 3ZE0E 2AK1L 1ACZA 2B5IC 4IOSD 3T0EB 2OR9L 4YC2B 2AJXL 4RBPH 1NGQL 4TSCL 5I1GH 3LRSA 1PEWA 4KQ3L 4U1NA 4XNQA 1SJEA 1X5ZA 1ZLUH 4NJAL 3A6CL 4RFNB 5HDQH 5KG9A 4WEMB 2L0DA 3S3SA 3FO9A 4K3DL 1JZ7A 4YFEA 4ZSOB 3KJ6H 5LWYL 4Y1AB 4HGKC 3DX8B 4PJDF 1MJ7H 2NNAA 1UACL 2FYYB 4ZSOE 4P59L 2CR3A 2XZCH 5DZLA 1MCOL 4OV5B 4HS3A 1EXUA 1T7YA 1NANI 1MWAB 2AJVL 5CGMA 4X6EB 5DJYA 4FXLA 3CXDL 1UACH 3DV4A 3L3DB 1RY7B 3B9AA 4ONHA 4L8CA 3I6KA 4GLRH 3ELAT 4BM7A 4Y5VB 1J9CT 4RAUB 3EUUA 4NQDD 1D5ZB 4MXWL 4BQ9A 3OV6A 4YK4B 2A9NH 4MCZA 1QA9B 1OSPL 3GMNA 2G2RA 1KJ2B 3PV6B 3W2DL 5JO5A 5F7EL 5IMLB 1CDGA 1Y6KR 3MGOB 1FFQA 3DXAD 1F4YL 4Q9RL 3GSWB 2Y36H 2HJLA 3K1DA 4E41A 3OF6D 5SX4I 3V6FA 1UQSA 5KJRL 1A1NB 4FFZL 5IVZB 2K7PA 3OR6B 5F7HA 3C5ZD 4V2BA 4LEOA 5ACZA 3U0PB 3QZWG 4RAHA 4WW1A 1HNFA 1XF1A 4PYGA 5F1NA 3OGCA 1A0QL 2J6EH 3HNSH 5CHNA 4NKOA 3BWAB 3I3EA 4BSWA 2NY1B 2NY2C 2J7LA 4XMKH 2QQLL 1FORH 5I1AA 3SGEH 4I4WB 5C09B 5EU6A 1CGYA 2X89A 2AS5M 4M7JH 3LHPH 4LLVA 3TBYB 4P46C 3BPCA 4ZOBA 4FZEH 4WUKH 4XRCB 3MA7B 4PD4J 3T0EC 4PJAE 3VU2A 3D3VA 2FO4B 4ZPVA 4MAYC 5D1QD 3OTTA 5DHYA 5E2TL 1R3KA 4D2NA 1G9ML 1JHLH 3KPMB 1L6ZA 1HHIB 1HXYB 1AD0B 1VFUA 1T21B 1Q0YL 4Z7OF 1KYOK 1LDPH 3MJ9L 2Z92B 5E8NA 5HHVH 5CJXA 2W91A 3I3DA 4KK6C 3X14B 1E4WH 4XCFL 4GRLC 5DYOA 3QJHA 4P23C 2LTQC 3WLBB 4M1DL 1FFRA 2HT4C 3WFDH 5CP7A 3ZDZE 4KTDH 2DQGH 1U8OB 2APXA 4HSQA 5GSRA 4I3GA 5DJAA 4UV7L 3CDGB 3QXTA 4XWOD 3CXHK 3ARFB 3W39B 3FHAA 1K4DB 3PV6A 1JN6B 3GUTB 3ARYA 4GG8A 3MNZA 1YYML 2IFFL 4U3XA 3LPFA 5IWLC 1DBAH 4LGRB 2HT4D 1M6OB 2X4UB 2GTWA 2C7UB 4OCYL 3MXVL 1LEGA 1A9EB 1UZ8A 3DVGB 4P2RE 5JXAH 3QIUA 4KQ4H 1ITBB 3FQTB 1RZGB 2VDRL 4MA3B 3ALXA 2FJFA 5I19L 1NDGB 4LHJB 1A14L 2YOCA 5ADPL 3HS0A 4L4VB 4ZNEA 1KCLA 4WW1B 1L9MA 1JGDA 2W0KA 3QO1A 2H41A 4LEXL 5BQ7A 4OLEA 5GGRB 1B4RA 5KVFL 4YBQC 4KAQL 1H5BA 3B6SB 1KLFA 5I8CB 2GK0B 1KACB 25C8H 4R90H 4ESKA 3BH9A 3T0DA 2E6QA 4PG9A 3O3EA 1UT9A 3H3KA 2ZCKH 5IHUH 4DEPB 3QUXB 2E7BA 1YZZA 2A6IB 5D2NE 5HVFB 3BXNA 1KTDB 4XNYL 4A2MA 2X9YA 1U41A 4GKZA 3NIGE 4LLWB 4R9HA 2FJGB 2KQNA 3TO4C 2EDKA 4BKLB 1J8HB 5DMIH 4DKFL 5E8OA 2F19L 2HH0L 1XF2A 3MUY1 4KKNA 4HUXB 5DQ9A 1GAFH 5DQDL 1H8OA 3FQWB 3GBML 4QRTA 4DQOL 3T65A 4OZHE 4YR6A 5GISL 1NC4B 4XP6H 1M05A 1EUTA 1UJ3A 4NZUH 1YN7B 4G9FE 1FNEA 3GK8L 2XACC 2X44D 4S1QL 1P6FA 3QDGA 4JFDE 3RGVA 3CK0H 3O41A 3RUGF 5D7SL 3LMJH 1Q9WA 5L6YL 1BBJB 4S1QH 4X5WA 1ONQA 3TJEH 1ZHNB 4K3JL 1NQBA 3OR6A 3UJTL 4H26A 4M93C 4ELMF 3GUTA 3H9HA 1DE4B 4YXKL 3G08B 4R26H 4IDJL 4XH2A 5JW4Q 3CFKB 1NGQH 3EYQC 4HXAH 1MAML 4TSCH 5SWZB 5FDWA 1P5VA 5DJAB 1YDPB 5IGXL 1LEGB 3OAZK 4JKPL 4X99A 5JNYA 1H3GA 4DN3L 3CFCH 4WFFD 4HK0A 5FYJU 4QHKI 1YMHA 2GCYB 2IQAA 1H3PL 1TVDA 4RGNC 35C8L 1SBSH 1XGRA 2YSSB 2WUBL 3QJFB 4PJEA 3RKPA 3FT4A 4M8QA 1EX0A 3V4PH 5FHBH 1KJ2H 2JIXD 5CBEA 1AKJB 3NN8B 5FM8A 3V5DB 5K9QI 4E42A 1DSFL 2NLJA 2WUCL 1MSPA 3WS6C 1Q9OB 1X5XA 3S35L 2LV4A 5IB2A 4AQ1B 2VITA 1ED3A 3C6LD 2CDGA 4KWUA 3VMNA 1DBBL 1KB5B 1C5BL 1FNGB 1JPTL 2NY2D 3WBDA 1J05B 4K23L 4ZAKD 1IGML 4UQ3B 4PRAA 4X7EC 5D2NA 1XGQB 5E99L 2W60B 1P7HL 3ROOA 5B3JF 4C54A 4E41E 1OLZA 2HLAA 2O61A 5ICYB 2F74A 3P4MA 3CU1A 3V0VA 1IILE 2VLKD 3QA3A 3ULUH 3FO1A 4X6DF 5HYFA 5KVMC 1EHNA 2WSKA 4OT1L 4X5LA 1JHLL 1MFDH 5EU5B 1KPUA 2Y23A 4LCUA 5F7MC 3BD3A 4PJ9C 1R5WA 4UDUA 3CFKA 3L7FB 4PJBE 2G75A 4EOWH 2BVPB 4ZFGH 3QFJA 5KANI 3RGVC 3P0YL 4X4ZA 1IL1B 3MLSL 1PZUB 1RZKC 1IAOB 4IOIB 3UZVB 2I9TB 2CXGA 3QDJA 5F6IB 3NABH 3LDBB 1BJ8A 4GJTB 3IGAB 2ENYA 2VZ1A 3MBXH 1G7LA 3E0GA 2PR4L 5IEKB 5DRNA 1BECA 4K9EC 5FKAA 1D6EB 3H9YA 4UAOC 4QNPE 3OKDA 3P0VH 5IBLC 2YR3A 3CPLB 2XWBA 5D2LA 3CVIH 4JANA 1P2CB 1NLBL 3MV9A 3S98A 3RWCA 4BFIB 3O9WD 2FX8H 4PJEE 2ADJA 3H9SE 1FH5L 2DQTH 3MRCA 1NAMH 5IUSA 4OZFH 1FHGA 1F8TH 2R0WL 3M07A 5I76A 4YHOH 5I16B 4N5UA 1LK2A 3T1FB 1ZOXA 1FFPA 2UV3A 3CFCL 4Z7NF 3OHXA 1BOYA 2FEDD 5CP3A 2NY6D 1MWAL 4OFKA 2F54A 1LO5B 3GSOA 3O3BA 2XKNB 1NCUA 2DWDB 1MAMH 4ZUSB 2D03H 1JGVL 1E4XL 4OZ4A 5F7DA 1YEGH 5LQBL 5JHDA 4LBEB 1PVHA 2RGSA 4WO4C 2A9NL 4EDWH 2UZXB 3HZYA 3ULSB 2V2TA 1VACA 4PJIA 1WIOA 3ZSSA 4OFYA 2H2SC 3WNNA 1MAJA 2X1XR 2D7OA 1MHCA 3SQOL 4Z7VA 2P8PA 4CVXA 3UX9B 1MHEA 5I1GL 3CFDA 1CQYA 1HILA 1HQRA 3MNVB 4NJ9L 2YD9A 4KKLD 2M8XA 1F8TL 5I17A 3P9WB 5M7QA 4R0LC 2CUIA 1MFAL 2B20A 3JV6B 3MMEA 3GBMH 2W65A 3F7VB 4FXKB 3ME0A 3IFNL 3MA9H 4OD1L 1DL7L 4RNRB 4PR5B 4KMLB 1QSEA 3BSZL 4OZHF 1C12B 1UM6H 1S9VB 1FYTE 3ZYZA 4XNUL 4YDJB 5JR1H 1WCQA 4APQC 5FUZL 3W82A 4IRJC 4QOKE 5DTFA 2YRZA 5CWSA 4POYA 5FDYA 1MCBA 2V7NA 3JV4B 3WE6A 3VWJA 5HPOA 1RZJL 3KPSE 3SBWC 1SYSA 4Y8AA 4J6RH 5CUSH 1UH3A 2Z4QA 4FMKA 3IXAA 4QHMA 5EUKA 3RVVD 4N9OB 3F7YB 2QKIA 4JFFE 2Z35A 3SGJC 3R4DA 5HHXL 3LPGA 4HD9A 1N5YH 1N4XL 1D5IH 2EXWD 2HJKB 1QSFD 1K4CB 4LCCA 5F96L 5H94A 2Y06H 1MCSA 3T0EA 1IKFH 3QDGE 1CLCA 4YPGA 2XV6B 5SWZE 2MCPL 4LF3A 4NRYB 3D9AL 2OTPA 1JF1A 4LCWB 1R3KB 1FAIL 3CUPA 4G9DB 3KYNA 4P5KA 5EIQA 1OP3K 4YBHA 3EO9H 2XG5A 1DUZB 2EDOA 2HJFA 3K8KA 1E4JA 5ANMB 2R1YA 1NFDF 3D3VB 1BFOA 5D7LE 2J5LB 2GY5A 2OS7A 2VDRH 1UB6A 5F3BB 4KC3B 1JTTA 3ARSA 1IEHA 4YXLL 3AMKA 3CLEH 1U58B 4ONHB 4WCYH 1UC6A 4DJMA 1J1XH 3HG1D 3P4MB 4BJLA 5HJ3B 4IHOA 2E7MA 2DWDA 4MNQE 4NUJA 5FO7A 1B3JA 4YHIB 2F54E 2H26B 3EOYG 1BIIA 1B88A 3B2UC 3MOAL 3MX0A 3O0RL 2AJ3A 2ZUVA 4EBQL 3FB5A 5F1NB 3HRPA 1MIEL 5J1AB 1KFAH 4TULL 3O3UN 2DKMA 1WVZA 5DQ9B 4RQQA 3N1MC 3H7BB 4J12A 3JUYA 3O4OB 4QRUA 3MFFB 2AK4D 2Z8RA 3C6SB 4H0HB 1JYVA 2UZIH 3SKNA 2VXUL 5C0EA 4ZO9A 1V7MH 4J3WA 4G7VL 4OUUB 1QBMH 1QBLH 1NANH 5JIIA 3O8XD 5I6XB 1I7TB 4F80A 2CLZA 4X9BA 4ODTH 5T1LA 3RIAK 2WW8A 4XC3L 1PFCA 3MBED 3OJMB 5HHNA 1QRND 4HV8B 3Q0HA 5BRZA 1A64A 1LO0H 5DJ0A 2LQRA 4HS6B 5E8DH 2NY5L 4I2XA 3MRPB 1TNNA 1H5BC 2NR6D 3C2AH 1UVQA 4FQCL 3KS0H 3NAAL 3QQ3A 1RAMA 1FNAA 4FZEL 3LIZH 1FFPB 3KPSA 3TA3A 1TQBB 2MQCA 5DR5H 3E8UH 1OARH 2VDNH 1LO2L 2F54B 5BO1L 4CRPA 1U8NB 3ZDXE 3FQNB 4R4FH 4AY0A 4ZPVB 4ELMA 5DA0B 1QYGH 3T1FA 1HEZA 2OXGA 4HF5L 4NRYA 4P0DA 2W0PA 1BD2E 3NCJH 1IGIH 3CNKA 4ZOCA 1U3YA 1IJ9A 5CSZB 3BDYH 1FG2B 3T08A 1TPXB 1IM9D 2YXMA 5TH2A 1M05B 2VLKB 4JN1L 3FB6A 1NC2A 1N0LA 1T89A 1EFXD 4NC0B 5HJ3A 1SEQH 2CDFB 5JXED 5FGCB 4NQXB 3NIFF 4P9HC 1IE5A 4IRSD 2MMXA 5DC9B 2VN7A 2JE8A 2R0WH 3G5YB 2VH5L 1C5CL 1XGUA 5KS9A 5D7JB 4NKDA 3C60D 3WIHL 2JB5L 5D1ZA 3UYOD 3K0WA 2GI7A 5DK0A 4MSWA 2ZOLB 2ZOKA 3QXUA 3P4OB 3QYCA 4KKBC 3VFOB 2VL5A 5EBLA 5IMMA 1K85A 1IRAY 3SE4C 4JQIH 1EBPA 1N3NA 3FQRB 3PABB 1KNOA 4YHYB 1XMWA 4ISVA 3QPQC 4MNGA 4BYHA 2XYCA 5BVPH 4B41A 2X4OB 3QEQA 1OAUL 2IQAB 3STLB 4YE4L 2IMNA 3EJZD 4KUZH 1EFXA 5GS1C 3QNZB 5LKNA 3QXDA 4N1CA 5JOPD 3CH8A 1CICA 2VR4A 4DGIL 5DJ8A 6FABL 2CLVA 4LCYB 5CJOL 1S8DB 2V2WB 2VISA 2HP4A 4X4YB 5JLZB 3B3IB 3RWIB 1G1CA 1Z3GH 2FX9L 3SDCB 4JFFD 3TESA 3E6FA 1MQKH 5HD8C 4ZD3H 4PJ8D 4M3KB 4LHUB 3T0XA 1H15B 3RL2B 5E6IB 2AXHA 1LEKA 2CGRH 5GRJH 3SY0A 1RUPL 4WU7B 3PL6D 3ZT6A 4PJ5B 4R97B 4C56D 4ODTL 4P5MA 3FB8A 2M26A 4WV1A 1UYWH 4RWHA 4LGSB 4D0CB 4QOKB 3FAWA 3FOLB 4JVPA 4O2EA 3SDDA 5HVHC 1T7XA 2X6MA 1DLHB 3HUJE 4L5FH 4QTIL 1CDHA 4O2CB 4P99A 5BJTB 5CD3A 3U9UB 4RAUA 4FXGA 4G6FD 4NQUA 1JYNA 5A16B 3WN5B 1EMTL 4HWBL 1IGYB 3FO1B 1T03H 3R0NA 4PJ8C 1DFBH 1P84J 4G6AC 3L5HA 1BFVH 3RY6C 1XGYH 1QRNA 4EBQH 1CE6B 2VLRA 3X17A 2OK0L 4Y7MA 1UXWA 2F5AH 3KYMA 3RVVC 4EZMA 1JL8A 3SGDH 1KUMA 1KTLB 2V5MA 3GSUA 2J8UB 5DHXB 1TFHA 4FFYH 4IMKA 4N8VA 3Q6FA 5D7KD 1NGYA 3LN4A 4E5XB 4ZUWB 3O6FB 5E03A 1QSFB 5GS3A 4GSDH 4JPIA 4HLJA 3ZE2F 1NAMB 1R5WB 4MQXD 2ZJSL 3DRQB 3IDGA 4LLMA 5F6IC 1SJHB 3VG0H 5I74C 1FVEA 1VEMA 3LKOB 4TRPL 1I85A 5ENWA 5MI0B 5A1AA 3L5JA 4PV8A 5F8RC 5GJSL 2CR6A 2OJZL 3KNBA 4OCMC 1CICB 1CG9A 2PO6C 1UH2A 3S34L 3V5DA 5A2FA 1FRGL 4PGBA 5T5FH 1KGCE 2VH5H 4PRPB 5JLZA 1IAIM 3QQ9D 3PHQA 2NX5D 1YJDC 4MYWB 4NC1E 3QHFH 4HQQH 4FHBD 3HZVB 4YHKH 4RMRA 1AH1A 4OCXL 5FCUL 1MI5D 5C0CB 3TCLB 3H42H 4Z7QE 1E4XI 4N1HB 3KGRA 1W8OA 3THMH 1IM3B 4RWYH 1CDUA 1F4YH 4PRAB 4Q9RH 1ZA3A 2ZSVB 4N90D 3V2AR 3DURA 5DMJB 4JFQB 1FVCA 1YPZE 5CSGA 4PJGE 5LGJA 3H42L 4U6HB 4EI5C 3ARFC 1ODAA 1YEGL 1YEIH 3MUZ1 4Y4FB 1MFCL 1JGVH 2D9CA 1U8HB 1XGTB 3MLSH 5C0BB 3SDAD 4P3CL 1NFKA 4XTRD 3FB8B 1NUDA 2XZZA 3OF6A 4ENEC 1MI5B 1JTOA 4JFPA 5KSBB 1EAPA 3FOLA 1I1AA 4RIRA 2HG5A 5T1KB 5TJWK 2DTSA 4I77H 3BPNB 5DHVB 3OG6B 4NN6B 5KVGL 4ELKA 3HMXA 4MWFA 4AT6B 4CADA 5E9DB 1NLBH 1ZTXH 4X83A 2XG4A 1JNHB 4OGAD 5DUBA 5KAQF 1FL6B 3VMPA 4P2OA 3GEWB 5IHUL 4O5LH 1S78D 3OXRB 4X6BA 3QIBD 4NBXB 2A83A 4ERSL 1AGCA 4KI5C 5F9JA 2R69L 5C08B 1UZ6E 3W39A 7FABL 4K3HA 1F4AA 3TA3B 1MPAL 1UKTA 4WU5A 3SJVB 1D9KC 4I4WA 2J8UA 3EZJB 4LAQL 1FPTH 5FGCE 2JCCB 4JRYD 3S34H 3MLUH 3QZWB 3QUXD 4LSQL 5I8OH 4ZQKA 3B6SA 1DSFH 5ESQB 4YUEL 4U7MA 1LK3L 3U2SA 3FN3A 3HAEB 3P9MA 4Y8DC 1YUHB 4PB0L 2IFFH 43C9A 1RUAL 1I8LC 1XF5B 3H9SD 3OHXB 4HJJL 4LDEB 1B6DA 3CLEL 4P5KB 5F7YC 1CI5A 4OD1H 4PGBB 3TLRA 3DXAE 5CJ8A 2E7LA 3NA9L 3EYFA 1CK0L 1GHFL 1XAUA 3TIEA 4CUCA 5GQBA 4WFHD 1ROWA 1BF2A 3WLWC 4IS6A 3WFHB 3NA9H 3O41B 2GHWB 2C26A 4OCRH 4HWUA 4RFEB 4YHIA 3CDGA 4WHCA 1KEGL 3M17A 2I5YL 5GSRB 3TO4B 4WFGD 4OSUH 5ACZB 3NFNA 4NYLB 5DT1H 3MRNA 1MFDL 4U1GC 4DZBB 1NSNH 1GOHA 2HFFA 4WW2F 5DMKA 2ZUYA 4BA8A 3KLAA 2NXZD 1NGXA 4NUJB 5FO7B 1C5DB 2R2EA 4XP1H 1S9WA 4HW6A 4XGZA 1U8IB 3VCLB 5IV2B 4ZFFA 5CJ5A 1I9RH 1VPOL 1Z9SA 3C08H 3R0MA 4J4PA 4M7ZB 5CEYB 3JWOC 2B5IB 3G6JF 4ZTPL 1E27A 4LVNC 5EU3B 3MRFB 2YKLL 4ACPA 1OWWA 3I6GA 3MRLA 4HFWA 2F19H 3BN9D 5I8EB 2ICWJ 4Y2DD 3RX5A 1OCWH 4U33A 2ZNWA 1MLCA 4IJ3B 1QA9A 4UINL 3O3EB 3SKNB 5I1JL 4HPYL 1NGWA 5HTSA 4IRSB 3BDYL 4KKCC 1F6FB 1N0XL 5ESVB 4R2GC 3JV4A 3WE6B 4HK3N 5BXFA 3MACL 1OWRM 1MVFA 2D31B 3QZWA 2J8UE 2ZUTA 5KN5B 1RUMH 5EUKB 3DV6A 2XTJB 1JWUB 1YN6A 1HWHB 4OGYL 3WMSA 3MJGX 3EFFA 1G7IB 1RZ8A 1RZFL 1VB9A 1T0NA 4IMLA 1QSFE 1OGTB 1J0YA 2F53A 4PJHF 4Z7WE 3GI8L 4EQ2A 2V2XB 2B1HH 3H3BC 3ETBF 1CDCA 2XZAH 1W8NA 4B53A 2UWEB 4JO3H 1VESA 4WO4B 3QNZA 3MZTA 2MJWA 3BESR 5HHMD 4OQ1A 3LKSA 4D0DA 1WQVT 3WFCL 1DDHB 2WWKO 3V5KA 1JZ8A 3T3PF 5E4IA 3VFMA 3MLZH 3BGFB 3I9GL 4AM0A 2X4PA 3BP4B 1R24B 43C9B 4UIKL 4KPHH 1YY9C 4N68A 4U2YA 3TZVB 1NGPH 1G7HB 5IG7A 2G60H 4QF1A 3H8NA 3RBGA 3UJTH 3EO1B 3HC4H 4TUJB 1OLLA 3CH1B 5INDA 1FZMB 3NZ8B 5BZWA 5BOZG 2GSGB 1FP5A 4JAMB 2ZCKL 4RDQF 1BIHA 3WHE1 1H0DA 5FYJL 2P5WA 3ARRA 5E7FA 1A3QA 2F8XC 4C4KT 4AEFA 2K7QA 3IB4A 4Z0BL 4UNVA 1QYGL 1S9WB 4RFEA 3KHOA 1RSFA 4GUPB 4LASL 2JELL 3QDMA 3I02B 4D9RE 4OZFB 2NY2B 3D85A 1AGBB 2C3VB 1T66D 5DHVH 3RJQB 3WNKA 4YDKH 2R23A 3VFSB 3VXMB 1MRCL 1DEEB 1OTUC 5TE6H 4WGVB 5IQ7H 1ZLVH 3RY6A 1BJ1H 3WCYA 1HEZB 1CFBA 3VFNA 4OZIB 2BSTB 4PTTA 3QIWD 2VUYA 4K2UH 4KDTA 2DQIL 5DRNB 5DVNA 3AREC 5CZVL 3QFJE 3FO2A 4MA1B 4MJ2A 3WNMA 1F45A 1S8DA 5AG9A 5C9KA 2AP2A 3MRLB 3O11A 4Z7VF 2R1XB 4MXVF 3AY4C 4H25B 2FECL 4XWGL 1EFXB 3WXVH 1YMME 3D9AH 5E5MA 4P2YA 2ARWA 2A6KB 2JJWA 2ADFH 1KN2H 4UTBL 1MJUL 3PHOA 1IKNC 2NY0C 2IPKB 4D0BA 1EO7A 4MNHA 5T3XL 2XKNA 3GB7B 5ESAB 4OI9A 2V17H 4XXDB 1DR9A 3WXWL 5FKPA 3ILQD 2YN5A 1IGMH 4MCZB 4D8PA 3F7QA 4YGAB 2EC9T 5IQ9B 2PYED 3O3BB 4MAUL 1CFQA 1T1XB 2VL4A 5IVNA 1JBJA 1AGCB 3AU1A 5D6DC 1A8JH 5IV2A 3CMOH 4HEPG 4MAUH 3VJ6A 2R56H 2CD0A 4AEIH 2JKXA 3BUTA 5JMOC 3HC0B 2VDQH 1OAYH 4N0RA 3QIBA 4PJCB 3KLSA 1JWSB 1VFBA 4F57L 4P2OD 5IEHA 5D5MB 4IIQB 1MCNA 4Z7VE 4YBLC 1KN4L 4P4RB 3IDXH 5ITFB 3VGBA 4F58H 2L7UA 1ADQL 5L2JB 4TNVF 5ENWB 1NGPL 2QR0A 4FG6D 4DAGL 3MV8D 4IRSA 1KBGL 1I85C 1YY8A 2IAMB 4BZYA 3ILQC 3UZEA 2HTLC 1XZ0A 2VUOA 3Q6GL 5GIRB 3PUCA 3ZHKA 2EIBA 5A43C 1S9XB 4U1SA 4P57A 1JGEA 4XVUD 4XMPH 2PO6A 2JJVA 1IM9A 3V4PL 2BJML 1XCTA 4PJXA 5TE4H 4X9IA 1HSBA 3KPPB 3LEXB 5BVJA 5GRUL 3X3FL 3CZFB 3QI9A 4X4MA 5IWLA 4X99B 4JN2B 4UB0L 4MS8C 4G6JL 1LP9F 5ACMA 5K59F 1FYTA 5C3LD 3AS0A 3PHQB 5L8LB 3QIUC 1WWAX 1XCQA 4KDTC 4XC3H 2DN7A 3PE9A 2Z4QB 1NEZG 3B5GA 1VSCA 1I3GL 1A6UH 3KR3H 3AY4A 4NN7B 1DLHA 4PJBA 3VWKB 1QZ1A 2R0LL 3TIDB 1LEIB 2RHEA 2QBWA 3QUZD 4G6FB 4UT9L 1DVFB 3BP5B 3L7FA 4UOJA 2XNAA 4GG6B 3MBXL 2CK0H 4NO0A 3OL2A 2DLFL 3NTCL 4UINH 1WZ1L 1H3TA 1PD6A 5C0JB 2P1YA 3KPNA 5EIIA 4GQ9L 5CS7A 4I77L 4Z0XA 4HUVB 4WI7A 4QKXB 1I8LA 1IAIH 5E24E 2EDQA 2OR9H 2NR6C 2ZUQB 4HWNA 2P8PB 3NZHL 1FNEB 4NM4L 4FQCH 1CE6A 1I9RL 1VPOH 1ZMYA 2BC4A 1JNJA 5L0QC 3TT3L 4XBGA 4KHXH 4PJEF 3VG9C 3BGMB 3K8LA 3MRRB 3WFEH 5ESVA 4JM2F 1FZJA 2R0ZL 4HC1L 5FUCE 1JNLL 3V95A 5MP6H 4XNMB 3MBEC 3R1GL 1A22B 1AI1L 3GKZA 3TBTA 3S3JA 4AMKH 4GS7B 1BVKA 3VJ6B 1TCRB 1AXSA 1S9YA 3GGWB 2DQUH 1M7DA 4Y2DB 1FNHA 3SKJL 3MV8E 2DLIA 2C1PB 1M71B 4HJ0C 3N06B 1DQMH 2CLZB 3MGAA 4NN7C 3ARDB 2IBBA 3CFEA 3PDOB 4NC2B 1AC0A 3UTZA 1FVCB 5L8JB 1LK2B 5IFAL 1UM5H 5E8EB 4KV5F 3UTQB 5I1LB 1KJVA 1N5YL 3L9RB 1QFWI 1F4XH 1U91B 4AL8L 4K07A 1CFSA 1ZS8B 5AYUL 1FJ1B 1LILA 1T5WA 2A77L 4F33B 4U6XA 4XPAL 2F15A 3UJIL 3BJLA 4N9GB 3ZDZF 2I9LA 4L9LB 4I2XE 1M1SA 3U4BH 3DROA 1UJ3B 4EDXB 2IEPA 2ZJSH 4PGEB 3C5JB 4WWKC 5C3TA 3R8QA 2A6DB 4WCYL 3BSZH 2NYYD 1ND0A 5IQ7L 2NY4B 3DHJA 5J12B 4GRLB 1RUKH 1YC7A 1P53A 3ZL4L 3TO2B 3NFPA 1NMCC 2QSCL 2PTTA 4H8WH 2OTUA 4PJFB 4X6CA 4KPHL 4Z6AT 1FPTL 3CDYA 5C0FB 2FIKB 1IAKA 2WIIB 5KVEL 1MI5A 1OW0A 4X5XA 2VZUA 4NSKA 2V5SA 5IK3A 1KLUA 1TTFA 4WUKL 5D1QC 3VI3E 4ODSH 3MRQA 4PJBF 1RJYA 2DMKA 4JGUA 1D5IL 4OIAA 5DJDA 4MDJB 4AG4L 4Y89A 2D0HA 3E3QC 4CDHA 3EOTL 1WBZB 2H8PB 5SWZD 3FB6B 3MGOA 4I0PA 1CE1L 3IRZA 2X70A 1MVUB 4UIMA 1G9NH 1BLNB 3SJVA 4AEHL 5SWZA 4LMQI 3BVNA 2MSPA 4DN4H 5F1KC 4YHOL 1O5DT 3MRJA 1L6XA 3FRUB 3WL9A 1FVDA 4P9MH 3OKEB 2AJSL 4S2SA 3O8XB 4Q97A 5FYKD 3BO8B 1Q94A 3NAAH 5KS9E 1JZ6A 3TN0C 3QEQB 5GJTL 3MV8A 3QUZA 3QUMA 1ZT1B 3QEQE 5IB2B 3GI8H 4FQPA 2HFTA 4JG1H 5MEQB 4P5TC 2FB4H 5IQ9A 1CDYA 1BQHB 1PGRB 4G8GD 4N0FA 5I15L 3CIQA 4ALAH 1H3VA 4JRYE 4Y5VC 4NKMA 4AZ8A 1PY4A 1NJ9A 4YFLF 4OD2B 2JJTA 1A9BB 5LWYH 3PWVB 1YNKL 2HFFB 4NQCE 4YGVA 5DMKB 1ZGLP 1RJLB 3BMVA 1Z0MA 5BS0E 4NRXA 4NM8H 2BVQA 3IDNB 2BVPA 1NDMB 4RMTA 2Z93A 1BHGA 5CEYA 2VDPH 3BPOC 3L3DA 2APTA 3MLZL 1GIGL 2ICCA 4QF1B 4QRPA 3SDYL 4MCYB 4LCUB 1HHIA 2JIXB 3ARDD 4QXTA 4U31A 2BZDA 4L3EA 1JPFA 1DBMH 4UU9B 3G5XA 3FJTA 4HJJH 2PYEB 4LSRL 4L29B 1MFCH 4G8EB 4JPVH 3BQUB 1QQDA 4IRZL 3D0LA 4C55A 4HXBL 3O81A 1KJMA 2WLYA 4Y1AE 1DJSA 4JHZA 1IC1A 5I1HL 3AB0C 5CGTA 4OGZA 1JFQL 3IYLW 2UZYB 1OD9A 3U0PA 4LEOB 4OCNC 3CU7A 1RUQL 4OCWH 4OD3L 1G7LB 4KI1A 3G5ZB 4LFHD 4S1RH 3G9AB 1G7IA 4YX2L 5DMGD 3FO0H 5ERWB 5JTWA 5D1ZD 4LLMB 3VFVB 4LAQH 5ISZB 4U6XB 3STLA 5J12C 4U3CA 2VLRE 3S88H 1DQQA 4BSVA 4L5FL 2OL3H 1CLYL 4YX2H 5FM5M 1KV3A 2XKUA 5B38B 3FOMB 1KJVB 1MHHB 4XCNA 5B39A 4LDLB 5I73B 3BZ4B 4LLVB 3OSKA 3BT2L 2YA0A 4HUUB 1NMBH 2MWCA 4JHBA 2Q7YB 1IC4L 3Q5OA 3UTPD 3HB3C 2CKBL 1QLRB 1KLGA 3IJSB 3LZFL 3MLPA 5ETUA 1AI1H 1RQ5A 4RX4D 2XZQH 2P24B 1X5GA 3L6FB 4MHHI 3LKSB 5JW3L 1VDGA 3EYSH 2EE3A 3MLXL 3RU8L 1Z3GL 5I8CA 4PRNA 1FO0A 3MRGB 1GVIA 1HH6B 3MRKA 2QQKL 3KLHD 3HE6A 4JM2D 4IRSC 1TJGH 4OM0H 2BNRA 5JW5B 4P4KB 1YPZA 4IJ3C 4UT6L 3K7UA 1WEJL 5IMLA 5DHVA 5LXGL 2DJ4A 5HDLA 4NM8L 2P44B 3NTCH 4QTHA 4DW2L 3VFPA 1NCDL 3C87A 2C1OB 3DETD 4LVNB 2UYLA 3G9VA 5DFWH 2OZ4A 5SX4H 3EZ8A 1G7MB 5EO1A 3IDMB 4HIJB 4QTIH 4LKXB 1KG0B 1JWMB 5CEZD 5IW1A 4MZ3A 5DUBB 5A2IH 5AG8A 4OLUH 5DI8A 1UCBH 2GAZA 3GSQA 3NGBB 1NFDA 4GAFB 5C0RH 4F37K 5E9DA 1T80A 1D5BB 4HF5H 2WP3O 5DFTA 1BIIB 1NGYB 1NC4A 1RURH 3NIFE 1JNHA 5EG6C 1WAAF 3BD5A 3C09C 4HC1A 3TBWA 3W11D 1IVLA 1CFNB 3HI1A 1JF6A 3B83A 4J3SA 4NQSA 3E8UL 2ZUUA 4ODWB 2Z35B 2RFXB 5CBAA 3F12B 1AY1H 3MROA 5F8QC 1ZLWH 3HZMA 3DMMB 1BZQK 1VHPA 3IJYB 4QXUH 1TVHB 3HAEG 2BNUA 3DJ9A 1QFUL 1BZ7B 4CNIB 4HV8A 1UENA 3BPLC 1BQHA 2Z91B 1A7PH 3VXNB 1CZ8L 2NXYB 1S9XA 4PP1C 4U1SB 4Q6IC 1EHLL 2H3NB 5IB5B 4QY8A 1S5HB 4LNVA 4X6CE 4D0CA 4PG9B 1P7QA 3QUML 1CQKA 3OPZH 4NNXA 3QPXL 2FSEA 4PFEA 1WBYA 2PTTB 4Q2ZB 3UO1H 4CVWA 1M7DB 3A6CH 3JBG7 4Y2DA 2YD5A 1BP3B 2FB4L 2CKBA 5EZOH 4E0RB 5I1EL 5D7SH 1IAKB 5IW6A 3OKMA 5BO1H 4GRWH 1UWXK 4FQXB 5EH1A 2XQYG 2XFXB 4Q74A 2WWMC 4YJZL 4TSBH 2GW5A 2R2BA 3BN3B 3WKNA 1KT2A 4OF3A 4PB9L 4X7CC 1PX4A 1P4IH 3CVHA 3IFNH 2AJ3B 4WFHE 3SKOA 2BOCA 4HKBB 2R2HA 5C1MB 5IMKB 3T65B 1EO8L 4L8BB 3ARWA 4NQTA 3ZKMC 4EN3D 5T1KD 3VXTA 4QHKJ 3O6FA 1CU4H 3LKRB 1L0YA 3W9EB 2OI9C 1HHJB 3KXFD 4NZJA 1CTNA 4W70A 4R7NA 1R3JA 3BP5A 5AZ2H 3ARVA 4EDWL 1E6JH 4HKZA 4LLQA 4ZUUB 1HKLH 5JW4R 4DOHE 4Q9CA 3QRGL 5FM4A 1U95B 3K74B 4LHUD 3U4BL 4RWYL 2FIKA 4HK0B 3A0OA 2MOVA 2Z8SA 3FB7B 3SGKC 4ODXA 2ATPA 3MRRA 2FR4B 1V3LA 1QSED 3LZFH 4RX4A 4XWGH 4UT6H 1KGCD 4JZJC 5T3ZE 3MJ9H 4I3RL 2OP4L 1PG7H 5TDNB 5ADPH 2GYSA 1FIGL 1SY6H 2CIKA 1XIWC 1UKSA 4BSJA 2HLFC 5D96B 4XHJD 1I3VA 3UDWC 4LOUC 4O9HL 2OMBA 3ZYIA 2WWMD 5ID1A 2P5WD 5FEBA 3STZB 1E28B 1JRHI 3KPRD 1JCKA 3VFGL 1KJ2L 5K9JH 5H2BA 1Q72H 5IM7B 2JF1A 4EUPG 3RWEA 1K9TA 4DUWA 1KC5L 3K2UH 4OZGF 3D6GA 3U82B 5IB5A 1XGQA 1QPXA 4FFWC 5KSAC 3ULUL 4XPBH 4QRPE 1XH3A 1WBYB 4FFVC 5E5UB 1BZ7A 1MFAH 2Q87A 4KTYA 4CNIA 1SVCP 5C2BL 4ZUTB 1DLFL 4K9EH 1HXMB 4KROC 1J5OL 1N4XH 4L8SC 3MLYL 4YXHL 5LGKA 2OP4H 4GBXC 1DVFD 4XPGH 2HN7B 4YZFE 3CGTA 1T83A 4Y2DC 2H2SD 3VWKD 5DUPH 4JZNB 1BOGB 1V7NL 2XT1B 2F53D 4RDQG 4RGNE 3DX6B 4GRWE 3JXAA 4XPHH 4M1CC 3MOAH 3ARGB 3TH4T 2VXTL 1XF3B 2VZTA 4PBXA 5ICYA 1EH9A 3RKDD 1CBVL 5FDWB 4HKZB 1G0XA 5C9JA 2VOTA 2BVTA 3BAEH 4Z8FH 3J8F7 5E2VH 3TBWB 4XX1E 5DJ6B 3TFKD 5DURD 2DQCH 3HFML 1II4E 4FP8L 4M43H 4W6XB 4Y5VA 3RIFF 1FBIH 4P3WA 1I8MA 1KYOJ 1HYRC 1OP3H 3L3IB 4XGZB 3QEHA 3GJFB 3SKMB 2D7PA 3DLQR 1P84K 5D7JA 2B1HL 1ZHKA 1ACYL 4QRRD 3D39D 4PV9B 4CN4A 1A4JB 1P4BH 1UM4L 4PRBA 5DVKA 2DLTA 4G8GA 5ADOH 2FGWH 2N56A 3WYRA 2VMFA 2NLJB 3RP1A 5E1HB 5GJTH 3BGFC 3GFUA 3EOAB 4U1LB 1B4JH 1KBGH 5TDNA 1N8ZB 4U1IA 3P4NA 3QIUB 4JGMA 3IF1B 2OQJA 1AGFB 3O2VH 3M8OH 4F33A 2ATPB 1HH6A 3KJ4B 43CAB 2Q1EA 2XY2A 2YD7A 4NUGH 4KGJA 1WZLA 4KAQH 2J88H 3FRUA 2BY2A 4OCXH 1CDIA 2A9ML 1AGBA 1EJOL 5D71H 1YEDB 2CLRB 5EUOB 5IF0B 4TSAL 3V8CA 1WTLA 4XAKD 2RCSL 1KTKE 3LIZL 1ZANH 1JHKL 1INDH 3C08L 3T4YB 4ETYA 2IAMC 3VA6A 3ZYOA 4JFQA 5B38G 3IKCB 4WO4A 5GGTH 5B39B 4CJ1A 4NJ9H 1QFWM 4CVZB 4PRID 4WEUD 3LN9A 2GSIA 3QJHB 1UWGL 3BKCL 4MDJA 2R1XA 1O7VA 5DMIL 5EZLB 1BD2B 3GI9H 4MA7H 2GT9A 3NZ8A 4MMXC 3HE7C 5CGYC 5I1IL 1FSKC 3VXSD 2DTML 1QFHA 3MV7D 3CSYB 5HI5D 1CFNA 1J1OL 1D6VL 2EH7H 1YMMA 3AS3A 4ODBD 4KQ3H 5J13C 3BISA 3LVEA 1ORQA 2H2PD 3L3KB 3VDBA 3RWFA 3L3IA 4RNRA 3PWUB 1AGDA 4Y5XA 5D7LA 4JPIB 1N64H 1DTUA 3RVWC 4QXTB 1U8PA 3QEGL 1L0QA 1RZKL 5D1XD 3IFOA 5C9JB 5EU7E 5JDSA 5MENE 4XCEB 2P5EB 2WINA 3WD5H 2XWTB 4MNQA 3JWOL 2V5TA 1MCIA 4I0PB 3PIQA 5FYKU 4Z18A 2YBRA 3MO1A 1A3RH 1WFTA 3SGJA 4M4PA 1L0XA 5EO9B 3S5LG 3P9LB 1G0YR 3D25A 2W38A 5E4EC 2DL9A 4JY5H 5TE7L 1T1WB 3JUZA 3HMXH 1JHTA 2G5BA 2GJ6D 3LHPL 4LF3B 2YK1L 4Z7UE 1AQDA 3FZUD 4R90L 4PJ5D 3I6LE 4ZUTA 2P47B 2FHFA 1JGEB 5FO9B 3BYTA 3QUYB 1GGUA 5DS8A 2UZIL 2DQEH 1KENH 3H6JA 2BSSA 1I9IH 3TN0B 4MD5A 2DLEA 4JZNA 4Q9QH 5IB1A 3W9EA 2EDHA 5CJXC 1A6TA 1R3IL 2CXKA 3N85H 3GRWH 5BRZE 1LDPL 4WW2A 1F3DH 1P7QB 4CDGC 1MRFH 3F7PC 3UTSD 1WWWX 5JW5A 5EBWA 1I9JH 4PJXE 3OX8B 3DX8A 5CZXC 1G84A 2AQ1A 2VDLH 2HT2D 3LQMA 2VKXA 3JV6A 3FQWA 4QRTB 4Z95L 4YWGH 1JRHH 1AO7E 4NZUL 4YHML 1INEH 4GW5B 4LPWA 3IU3B 4GG6A 2DM7A 4UV7H 4ZFOL 5D70L 5DVOA 4G8EA 1U0QA 1EEZB 4MB4A 5FOBB 5KOVC 3X12B 4G9FA 4RSVA 4C83B 1QLEH 3UPRB 2CMRH 3D18B 2ADFL 3T2PA 4I0CC 4M1GL 3FT4B 3KPOB 1MHHA 1RUML 4XCNB 3Q5TA 3WO3B 4OUUA 2WBWB 4Z7WB 1CCZA 4MSWB 1IEBB 3EDFA 1NFDB 5C07D 2QKIB 5SWSD 3S4SB 5DEFA 4P23A 5ISZA 4GRWB 5I71B 5IHBA 3FN0H 3GBNL 3PJSA 4I13B 2BX5A 5H94B 4MD4B 4XMPL 3V7AE 2D03L 1T1WA 2XWTA 4YH6A 3N9GL 5BZDB 1NC2D 5E5MB 4TUKL 1LVEA 4ZTOH 1MUJA 5GSVA 5IEKA 2EC8A 4Z5RA 2VLRD 3MLWL 4LKCA 4WHTA 5HI3D 2V9TA 2I9TA 5JPNB 4UB0H 4XCEA 2DBLL 1R3HB 4X0KB 4P5TD 3GIVB 1W0WA 2FBJL 1U58A 1RZFH 4KZDH 3OR7B 1ES0A 4KQ4L 1OM3H 4EOWL 2V9QA 5A3ID 1DEEA 1CLZH 1ERNA 4JZJA 1GZPA 3SDDD 2C1OA 2A6JB 4PTUB 1GGBL 3UPAA 1OHQA 2EYRB 1YN7A 3UDWA 1AC6A 4WFFE 1YPZB 5CJBA 4GAJL 5EU5A 1A4KB 3GSXB 1U3HD 3LPWA 3CFIC 3HC0A 25C8L 3LEVL 2QJDA 2D7TH 1VGEL 3MBEB 4LLUB 4KKBD 4NKIH 3UXFA 2ATKB 1B0RA 3S36X 5KSBE 5EBGA 4QXGH 2V2TB 1LO5A 1RULL 1IFHH 3O6FC 3H0TB 4HPOH 3U9UA 2ZUQC 1CICD 4DCQA 5EIIB 4ZS6C 2ESVE 2HFGH 3RDTC 2BXYA 4EJ1C 5T1LB 3TO4A 4QXGL 5EU6D 3DVNB 1RIVL 4XP1L 4OFVA 2ICWI 2HH0H 4FN0A 4S0TD 2B1AH 2AABH 4M03A 5D6DA 4JB9H 1QO3B 3HC3H 1MRFL 2G9HA 3HUJA 5FAAA 2W65B 3F7VA 1KB5H 4J3TA 1A3LL 4YEEA 5DJ6A 3ISWA 4MQSB 3QCUL 5LBSH 4J8RB 3MUHL 2IADB 1CXEA 3QIBC 2FWOA 3RWCB 1UADC 3MYJA 2JK5A 4JO2H 3KHQA 5E00B 2F53B 1X4XA 3QIBB 4LLAA 2Y5EA 2V5YA 1MPAH 4KUZL 4G6AD 3SJVE 1FLTX 3VWJD 1U9KA 5KN5A 3KPSD 3B8YA 3OGCB 3QI9D 5CKAA 1UWEL 3QDJE 4LK4A 3QT2A 2X41A 4KK9C 4I1NB 2KKQA 4UQ3A 5IFAH 3I6LD 3Q2CA 4NPYB 4KJWD 4OTXL 4LPVA 4ZUSA 2GY7B 1G7QB 4JQIL 5F6HI 4UNUA 2O5YL 4NDMB 2Y36L 3MGTB 4YUEH 5FA4A 1BQHG 3GMOA 5D2LE 4LLWA 4Q9BA 1WTGT 4U6TA 1DQLL 3RZCC 4JHWL 5HYJA 5DD6B 4MDIA 4BFGA 4D9QD 4HFUH 4JO1L 5ILTL 2E6PA 4LLQB 5M94B 1NMAL 1ZT1A 4XZUA 3KPLB 4JFXB 1KEGH 2OTUB 4H5SB 4W68A 4Y4HC 1I1YB 5ACLA 1BMGA 3OB8A 5E56A 1KCSH 4D94A 1X5LA 4WI2A 1FIEA 4IMKC 2ED8A 4BH7B 4W81A 5BS0A 4K3GA 3QISA 5HGAA 2FJHA 3TCXA 4L8SB 2DI7A 2P45B 1QBAA 2I24N 4UIMB 1PG7W 2VLLA 1Q9WB 2FHCA 4K8RD 3DRQA 1VGKA 4Y16B 1IAOA 4IOIA 3G5XB 3H7BA 1I3RA 1M6OA 4F7TB 1WBZA 5T1LD 1V3JA 2P49B 1SM3H 1OQOA 3S35H 1BZ9A 5C09D 5ELIA 4RFOL 1M7XA 2DBJA 3O8XA 5T5NF 4GG8B 3LKQB 2DMCA 4LQ1A 3UJJL 1Z6JT 3MSPA 5E2WL 3RJDA 5JZ7D 3N85L 1ZEAL 3VXQB 4DQOH 5ITBL 5GGSA 1W2KT 3DUUB 2OJZH 4OKVA 4PGCA 4U05A 5DMYA 4JO4H 2X4QB 3IAGC 5I71C 3MODH 1MFNA 1MLBB 2VZSA 1LO3L 4MGXA 1MFEL 1OSZB 5TE4L 3ZTNH 1IM9B 1NJ9B 2H9GA 1QG3A 1RHHA 1JNNL 4KRMB 3EJYC 2A6IA 3P30L 5E8OB 3SDDB 3EGSB 3T09A 4WUUD 3QHZL 4NCDA 1N59B 4R4BB 1DBAL 2ZG2A 3LB6D 3BH9B 4MDIB 2FH6A 4R4ND 1T0MB 2Z31B 4LCCB 5FF6A 3WHE0 1FO0H 1KB9J 3N9GH 3F5WA 1RV6X 3O9WA 4I9WD 3G04A 1MEXH 1N5AB 4QRRA 3TP4A 5J1TC 2FZ3B 5MI0C 3W2DH 1T3FB 4J23A 1J1PH 4HWBA 3PWPB 1PX3A 3OMZA 1V7NH 3WV0A 4NCC2 2VIRA 2LE9A 2VR9A 4LIQL 1XF4B 3FO9B 1A02N 3DI2B 5FYJE 1AE6L 2C7UA 3I84A 1Y6NR 4L3CA 4IIQA 1AJ7H 4XB8A 1Q0XL 2X70B 1XF2B 3HTLX 5EOQL 2WZPD 4FQQA 3D0LB 4MWFB 1CL7H 4QRSB 2ZPKL 4ZXBB 2E3VA 2BXZA 1PKQB 1OAKH 5F88B 1NSNL 3ET9F 4OLVH 3PWNA 1GCFA 1GGIH 5E1AB 2J2ZA 1IGJB 3WN5C 1ZA6A 4PJGB 1WITA 4U1JB 5TDOB 1S7RB 2BC4B 3VFWB 1F4WL 1Y18A 3K2UL 1FZOB 3W5MA 3PP4H 3VGHA 3C6LA 2VWEE 3WXWH 2Y06L 3MRBA 2A74A 4Q6IB 3ROLB 4D3CL 2W0LA 5C86A 1BGXL 2IC2A 1LWRA 3GGWA 5ERWA 1KTDA 5FO8B 1N6QL 2ZOLA 2WBKA 2FRGP 4QEGA 4I0PC 4O51A 1RZJH 4NQCA 2NY1D 5E9DE 2JCCA 1EVTC 2ID5A 4WFEE 1T22A 5INCB 5HGHB 3O3AB 4J4PC 4M9OA 5I2IA 5DJZB 1FZKA 1PAMA 4ODUB 1JUFB 2R15A 2PTUA 2VISB 5KSAD 4U1KB 2D4FA 2EYSA 4M62L 4XCYB 2XTLA 4WGWB 5F7KC 1CF8H 3QG6A 3VA2C 1BWWA 2EH8H 5FHBL 3V4VL 1KEMH 2R4SH 3DV6B 5HHPA 3V0WH 3BI9X 3PGFH 5LBSL 1TQCB 2B2XL 2E27L 3C8DA 1CIUA 2ESVA 4L3EE 1F3DJ 1A6TB 3QUYA 2ZSWB 3FQNA 4LQFL 4L3AA 3HC3L 1U42A 1NLDL 1UWGH 4OQTH 2EDLA 4G6KH 5EN2A 2OZ4L 1QLFB 4HHAB 3W0WD 5HI4C 5HI3C 3HA0A 4IMLB 3SPVA 5I1CH 2E7CA 1BD2A 1R3JB 2JCCF 1C5DA 2R2EB 1XFPA 1P69B 2YHGA 3WSQH 2OL3A 12E8L 1U8OA 4KVCL 1KSRA 4ZDHB 1RFDL 3TPUB 3QH3B 5D7JC 3H2WA 1ZT4B 4HIXL 4LBEA 2EO1A 2RCSH 4DZBA 5E2VL 1KCRH 1BBDL 3MRNB 2OSLA 3PWVA 3MQIA 5EORL 4KVCH 2AKRA 4RMWA 4UILH 3WSQL 2MKWA 2X1OA 2K1MA 1CGSL 5C08D 1MLCB 1KLUB 5EFIA 2MNUA 1OAZH 5B3NA 3VFRB 1G7HA 1MH5B 5FYKE 4WNQA 3BP7B 4HUUA 4NO2A 2MCG1 4JDVB 5CLWA 3VD9A 1G6RB 4KHTH 2XXMB 3WNOA 1S5IL 2XZAL 3QFJD 3ZYJA 5KSVA 2W9LA 5EU6B 3ZLQC 2RB8A 5HYJE 3D85B 4JANB 1AGEB 3VXPA 3OXSA 5KZCD 1U8QB 5D4QA 3EFFB 3RWJB 3HE7D 1TENA 3QPXH 5F3HA 1TJIH 2ICEB 4M61B 3VXNA 4K8RH 2I25N 4GO6B 3VI4E 2EXYC 5BZDA 4HDIA 2AXJA 2J88L 2X5PA 4HMEA 3IT8D 3HR5A 2AI0L 2DQHH 3CSBA 5FHAH 2JCCE 4ZXBC 1JVKA 4M6NL 5F7EH 5TF1H 5DSCA 4FFYL 4BZ1L 4X9HA 3FQUB 4RGND 1X3DA 1ZHLB 1D9KD 1J8HA 2A0LC 5GRXG 3BRGC 4UI2A 2W9DH 3O3DB 4BZ2H 4GKZB 4M6MH 4HUWB 1HCFX 4K94L 1UXWB 5I6XC 4R7NB 4NHUA 4UMGA 3MZGB 5EU4B 2A6JA 1J1XL 4GRLA 1DN0A 4LSDA 1NCNA 1YEHH 5HHPB 3FONA 3X3GH 1FL3B 1IGJA 2XZCL 4OKDA 3VE0B 4H20L 5J89A 5DVMA 3T3ME 5L8KB 1ZLSH 3U48A 1YJDL 4LVOB 4NNYB 2DQCL 3HFMH 4HK3J 3WDIA 4XT1C 3VXQA 1NCTA 4POZD 1XGYL 1HQ4B 1KIRA 3EOBA 1MAKA 2GFBB 5JPMB 2P8LB 4XPTL 4BK4A 4G43A 3UAJD 5FYLE 2MCPH 4PREA 3RI5F 5CHNB 5KVDH 2X4NA 1AXTL 1IQWL 4W6WB 3HE6D 3VI4F 4F7EB 1CLOL 1QRNE 5FB8B 1TJGL 5IROA 1G6RA 1JPFB 1WZMA 4OQTL 3GO1L 4O9HH 4GAGL 5DUMH 4PR5A 3DIFB 4MAYA 3HHRB 4Q9QL 3F6LA 1CLOH 4Y4FC 5ECJE 1F02I 4Z77A 4YXLH 4EI5B 4JR9H 2QADC 1AFVH 2PTVA 4TQEH 3T0BA 4OLYH 1LK3H 4PRHA 3FFCE 3TCLA 5C0CA 3UTSA 3BT2H 3TYFA 3F7YA 3MRPA 3RHWF 4M7LT 5IT2L 1Q1JL 1HKLL 4XPFH 5K9JL 3B4NA 4MX7A 3HAEA 3P9MB 3VFGH 1CL7L 5E8NB 4N0CD 5CJQH 1BQUA 2VN4A 1XH3B 5JHLL 5C0AA 3T2NL 1CGTA 1QLFA 4WHYG 3WIHH 5IKCB 1X5KA 1HIML 4IRJB 1HXMA 4XXDA 4F7CB 4LCIH 3GB7A 4RMSA 4XC1L 3WIFB 1IGFH 3QUKB 5FECB 1N2RB 3O2DL 3PP4L 3U0TB 1J7VR 4D9RD 1INQB 3LQAL 2VZOA 1ZA6B 4PJGA 5DVLA 3MOBL 1X6NA 4IEFB 4L3ED 2QQQA 1JYWA 3EYFB 2R0KL 4M4RA 3QA3B 4DVBB 1EVUA 2RIKA 5CAYB 3MOBH 3O9WB 3LQAH 5EFIB 2W0FA 2NW3A 4AJ0A 3JWDH 4ONFH 1OVZA 3PDDA 1UZ8B 3DVGA 4JEGB 15C8L 3C5ZA 2ENSA 2X4SB 4OFPA 2F5BL 1MELA 4IHOB 4G8IA 4HLZH 1YC8A 5FGBA 1HZHH 2HA1A 2HWZH 2GJZA 2HKHH 4BQCA 1U3HA 3IDJB 1YDPA 4M6ML 3HZKB 4O2FB 2F5BH 4PJAF 2VXVH 3GMLA 3RNQA 2W92A 3UTTA 1MCOH 1S7XB 4Y4KC 1ITCA 4JO1H 2VLMD 1IGIL 4RGOH 1FFOA 3UC0H 1B0GA 2NY5H 1BZ9B 3FOMA 5AEAA 3ARFD 1T4KB 2X09A 2BY0A 5J6HA 4AEHH 5E6IC 3VFVA 1AGFA 5T3XE 4EN3B 4P2QB 2Z9TA 4HQQL 4MNQD 5DR5L 3P73B 3MV7B 3OAZH 5F89A 3VXSB 1SHMA 3CPLA 4U7KA 3RX8A 4IDLA 3P0YH 3HRZB 3RVUD 1EFQA 4WI9A 4EI5A 3SDXB 3B3IA 3RWIA 5D2NB 4U3HA 4LRNH 2YD2A 2H2PC 3V5HB 2W60A 1P4BL 3VFTA 5IB1B 5EU7C 1JFQH 4HGMA 3TIDA 3FT3B 1MIML 4OB5L 5GZOC 3RVXC 1JI2A 2MHAA 3RDTA 4Y16A 3DXAA 2WIMA 3KPLA 2XNAB 4GBXB 4JFXA 5CINH 3TV3L 2BCKB 2VJXA 2GUOA 2FGZA 1FNLA 3SCMB 5DJCB 3KPTA 3ARZA 4R4NC 1E27B 3C60C 2YUZA 3VXUE 1FDLL 1NBZB 5I0ZA 4PJIB 2ZOKB 5CMAB 3WHXA 4KXZI 4J3VA 1MCPH 4P2RB 3FMGH 2CKBH 4L4TE 3PWNB 4NKDB 2DLGA 2DQEL 1FYTD 2HRPH 2B0SL 1JMZA 4AQOA 3GRWA 4RAVA 3T77A 5GGSY 3LD8B 1YMHB 4FNLL 2V5RA 3DUSA 1MREH 2EYTB 4OLWL 3FQRA 4GMSH 4JDTH 2YD4A 1AO7A 3AM8C 3O6LL 3ECBA 5HPMB 5IIEA 1WC7B 4Y4KD 3QCUH 4IRJD 4GG6E 4JRYB 1QVOA 3T0WA 1DQLH 1ORSB 5EBMA 1J8HE 1CD8A 1FNFA 1HDMA 4CW1A 2VKWA 2H32H 2E9IA 4OGAC 3ULUF 5C71A 4AH2A 3JWOH 1D5MA 3LCYA 1SYSB 5ISZE 2E8ZA 1EUUA 1JK8A 4QWWC 4LSUL 5E8EA 2YRLA 3UTQA 1MH5A 5I1LA 3MJ6A 1DBBH 1HOCA 5I1AB 2BRRL 4KKLC 1AD9A 4P2OC 4GW4B 4KJQC 4UTAH 5F89B 5D9SA 3VXSA 4NQCB 2D31A 1RHHB 1OQXA 3VXUB 2X4TB 4K3EL 2Y07L 2RJMA 1SY6L 5J6HB 5K9OB 3EO1A 2AAVA 4X6DB 4LP4A 2QL1A 4UV4L 5IVXF 4QYOA 4DGVL 5CD3B 4H25A 3P40A 4FZ8L 1NGZA 1RUQH 4G7YH 1D9KA 1J8HD 1R24A 4Y2OA 2R0ZH 3JWNC 2NW3B 2L4OA 1QFPA 2CLRA 4G9DA 4HHAA 5D1ZB 3GI9L 4MA7L 4P5TA 3TVMC 4C58B 3ZKND 3ULUC 2FJGA 2PYEE 1BFSA 4UIKH 3LKPA 4WV1B 3EFDL 5TFSL 4TVPL 5A2LH 4M93B 1S7TB 5FYJD 2GJZB 1OTSC 2EDXA 3TPUA 2DD8L 4Y5YB 1SEQL 5TFSH 2VDMH 2YN3A 2F58H 3SQOH 1SYVB 2PNDA 4Z7UF 2X4SA 3HE7A 1JHKH 1X7QB 3IETB 3RPIB 2FBJH 4WDIB 3MODL 1LHZA 3CFJA 4YK4C 3EYUH 3AFLA 3FFCA 3UYRL 5GZOD 3LN4B 2PW2B 2NXYC 1NAML 4L29A 2XPGB 3ZDYF 4UV4H 3FN9A 1FAKT 1I3GH 3KYMB 4TSBL 5DEFB 3MV9D 2B39A 4XP6L 1FVEB 5GZNC 4U2ZA 3RWFB 5AWNL 3C6SA 3MNWB 4JFEB 4YEFA 5MEPA 4UNTA 3KXFE 3OKEA 1UZ6F 3RY4A 3RWHB 5DRZA 3VD7A 1QSEE 5E94B 2WM0A 1HE7A 3QUMH 2ZZUT 4F9LA 5GRUH 4V1DB 3KXFB 4P57B 1I7RB 1MFEH 2GTZA 5AUMA 3B5TA 2F58L 3VXOA 5J11B 3RTQD 3HNVL 1DBJL 4QOKA 1S7SA 1T22B 4OCYH 1T1YB 3EYVA 4PJ7E 3VRIA 1W72B 3LS5H 5K9OA 2VSCA 4WTWA 1IEAB 2NY6B 1TCMA 3L95B 4F3FA 1F58H 4KK5D 3U7WH 1OAZL 4HX1B 1ZGLM 3V6ZB 1NMAH 4JRWA 4P2QD 3P11L 1CD0A 2P5ED 3KVQA 5FUOL 1T04B 2B0SH 2IBZY 2QSCH 5E6YA 4F2MB 5HSFA 3ORJA 1CE1H 1F00I 1ZA3B 2J8HA 4LSPH 3W5NA 1C16A 1FNSL 1F6AB 3CLFL 3U7YL 3BIKB 5E6ZA 5HD8D 5DA4A 2OTWB 3GIZL 3KYKL 4WW2C 4MCYA 3O0RH 1LEIA 4CMMB 1HHGA 3CFJB 4OV5A 1ORQB 3HI5L 3TYGH 1IT9H 1MCFA 1G7JB 1X5IA 1U2HA 5DWUH 3VFRA 5JHLH 2YK1H 5JHDD 2AV7B 1IQDB 4LU5L 3VXRE 5HVGB 3P4LA 1V05A 5DK0B 4OI7A 1GC1L 3BFOA 3QXAB 4PP2A 1X5HA 3U46A 3GJFA 3IDIB 3SKMA 3VXRB 3O45A 4YHZL 4LMQE 4R2GB 4LFHG 3P77B 2EEBA 3KPPA 4JDTL 1YEDA 5IF0A 1S7VB 2BNQA 3IXTA 1JPST 1R3IH 4E42B 1U8PB 2XOTA 4YNYA 4DGYH 3AB0B 4MXQC 5EBLB 4N8VG 4KY1H 3UAJC 3VRLF 3AREA 43CAA 3L5XL 3IS1X 1PG7L 2Q20A 3GHBL 3OJDB 3QJFA 5LGJB 3HNSL 5B38A 4HBCH 5J0BA 2X4TA 4V2CB 4Y19B 1JF1B 2EIEA 1CGWA 3L1OH 2R39A 3EDEA 2DM4A 3UYPA 4M7ZC 5E2TH 4GW4A 4NZRH 1U3HC 2WAHA 4POUB 4U49A 3QWRA 2HMID 5DJ2A 4CBPA 2ILLA 1NCAL 2P7TB 1I9EA 3BKML 4NT6B 3N1QC 3VXUA 5GGSB 4U1HA 1MJ8H 2B4CH 1QRKA 2VE6B 3SHSA 4ETQB 3WNPA 2V2WA 1GC1H 3QDJD 4ZAKB 4X98B 2AEQL 1C7SA 3GMMB 2VXVL 3TJHD 4HG4K 3SGEI 1QBBA 1QTYT 4J7RA 1BVZA 3F5WB 2IAND 3DO7B 1A7OH 1KXVC 3K80A 5F7WC 3C8KA 1I1YA 5D7LB 4N0UA 1BVLA 2Q86B 1EO8H 4JO4L 2JLLA 4IS6B 3WFHA 2YPVH 4WTZA 3EYOB 4PG2A 4K71B 4XP4L 3JWDL 4KROB 4QCIA 5EULV 2Q8AH 1NCWH 2A1WL 1ZT7A 3D1MC 5FF6B 1WCBB 1DQJB 5TGBB 5HGAB 1T0PB 5BS0B 1AXSB 3F6IA 4MLIA 4TNWF 4I3SH 1J0HA 5JA9A 3JWDC 1F3JA 5GS0C 1ZLWK 3MLWH 4G9FB 4UDUB 3PGDB 4RZCA 3LS4L 1LE9A 1U8JB 4ZFFB 5F7DB 1HNGA 3U30C 1U8IA 1FLRH 4YDIH 3NACH 3TBTB 1S7UA 1OP5K 4JE4B 1BAFL 1OAQL 2AI0H 5CIPB 4DKEL 3B9EA 1IL1A 1TXKA 2FBOJ 5IBTH 3TH3T 3FT2B 4G42B 1FFNA 5HHOA 5B21A 2NXZB 1XIWB 1HHHB 2LAGB 4MJ5B 2IG2H 1PLGL 5HGHA 5INCA 3HR6A 1U8KB 3LV3B 2E9WA 2DF3A 1LP9E 1P7QD 1T4KA 1CFSB 1ZS8A 3L3HA 3U4EB 3DHMA 2VLME 4XRCA 3HNTL 3LKOA 4LCWE 4XNYH 4ZFZB 5GS0L 4YC2C 3QUKA 4L4VA 3HCVA 3WL9B 3WEXA 2WWKT 3MV9B 3F7RA 3VRJB 2UUDH 4Z5RB 5FO9A 3MLTA 1FLRL 3VWKA 3QIUD 3UBXB 5EZIH 4P2QA 3U0WL 4PLOB 5IP4A 1YECH 2Y5TA 4FNLH 4GAGH 4HX1A 5HYSG 4DAGH 3DGGB 1NEZB 2HVKA