3EW3B

The 1:2 complex between a nterminal elongated prolactin and the extra cellular domain of the rat prolactin receptor
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
203
structure length
203
Chain Sequence
MQSPPGKPEIHKCRSPDKETFTCWWNPGTDGGLPTNYSLTYSKEGEKTTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNQMGSSSSDPLYVDVTYIVEPEPPRNLTLEVKQLKDKKTYLWVKWSPPTITDVKTGWFTMEYEIRLKPEEAEEWEIHFTGHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWSQESSVEM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hormone/hormone receptor
molecule keywords Prolactin
publication title Crystal structure of an affinity-matured prolactin complexed to its dimerized receptor reveals the topology of hormone binding site 2.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 203
sequence length 203
chains with identical sequence C
ec nomenclature
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ew3B01
4DGVL 3CX5J 1T1ZA 5E1AA 4DTGH 2A9MH 1Y6NR 5F7FA 5HHQB 2CGRL 3MRJB 4LASL 4DZ8A 1JPFA 1MCIA 1JPGA 5CJQL 2PO6B 1F3DH 2H8PA 4U1HB 3ZDXF 4NP4H 5J1TC 1L7IH 1T1XB 3PWPA 4ZDHA 2A6KB 3I9GH 3FFDA 3GIVB 4JM2A 3LIZL 3WFDH 3LB6C 2GTWA 2PR4H 3DVIA 3L5WA 1XH3A 4H1LA 3QUMA 4KTYA 2J2ZA 1W72L 3VXUD 4PJXF 2PYED 2A73A 1CZ8L 5C0RL 1EH9A 4UQ3A 2PO6C 3DARA 3KYMA 3CX2A 3HMXA 2AQ2A 4YHKH 1QSEA 2PN5A 3B43A 2DQEH 1KTLA 4OGZA 3FRPA 2ZUTA 3V4PH 3NIFF 1ZS8A 1TMCB 3S35X 4MS8D 5DJCA 1GAFH 2WUCL 3OAUH 4OM0L 5DEFA 3W39A 4RBPK 2HYMA 1KFAH 1O5DT 4Y0GA 1QZ1A 4XAWH 4XPBL 2XPGA 4P4KD 3ZTNL 3TBSA 3L3OA 1CFNA 2AJYL 3ZSSA 3OZ9L 2R8SL 4YWGH 2DMBA 3MYZA 3G5ZA 4GMSL 4PRDA 1C12A 2YUXA 1HIML 2BRQA 4QHNA 2HN7A 3K2UH 3TGXA 5FECA 3RUGF 1ZKAA 4OCWL 3ROOB 1CFQA 3DGGB 4D0BA 4Z0XA 5C08A 5FKAA 2ZNXA 2YK1H 4QRSB 2YBRA 4NQEE 1SBSH 3TCLB 2EIZB 1Q9KB 1VGEL 4DGIL 1P7QA 1ES0B 1G0YR 5B39B 1F42A 2YUZA 5FGBC 3CSYB 4XWGH 3RY6C 1CE1H 3CH8A 5IT2H 5KSBF 3EW3B 1XGUB 3FQTB 5DRWA 4XAKD 3P11L 3BSZH 2HKFH 3IKKA 3QULA 1Z9SA 2IANA 3GBLA 4ODWB 3M17B 4K8RL 3U4BL 4NCC2 2D0FA 1KB5A 1NGPH 1NFIB 4I3RH 3VFWB 3QA3A 4MAYA 3U0WL 1EAPB 5KOVC 2BVOA 5D2NA 3KYOB 2WUBL 5DVOA 4NNYA 5EO0B 2CRYA 4JVWA 4OBRA 5HDBF 2HA1A 3MV8E 1P6FA 4XC1H 5FM8A 3LKRA 3ARFD 4JG1L 1U3YA 3CXHJ 1I8IB 4NC2B 5C0CD 1JI1A 1MFEL 5SWQB 2R1WA 5I19H 4L8BB 4F8QA 3RWJB 4PJ5E 4O02L 1P9MC 1CL7L 4MNGB 5E8NA 3KPRD 1A22B 2GCYB 1I7TB 4LHQB 4OJFL 2DIAA 4KMTH 3LY6A 4LARL 5AWNL 4YZFF 5IWLA 4H26A 2APXA 2XFXB 4G8FA 5DO2C 3WIHL 4WFGE 2W07A 5E2UH 5IK3B 2VLJE 4G6JL 5GS2H 3MNWB 1F6AA 2PW1B 3I50H 3KHOA 4FTVE 2EH8H 1L0YA 4TVPH 3W5MA 1QVOB 3TBVB 5EIVA 3EHBD 1W0WA 2D9QB 2BERA 1EBPA 4M1DH 2VL5A 5ENWB 4QHMA 3WIIH 1CQYA 5I76A 3D3VA 4GG6A 2M1KA 5C0EA 3BIBX 3P4OB 3BEVA 3GI8H 5D72H 1OL0A 3FN0H 5DZOA 5FF6A 2W0FB 4LEXH 5BZWB 3SKJH 3TH4T 1U8HA 5E00A 4HK3J 2O61B 1OAZL 1A4JA 4LHUA 3S6CA 4BM7A 5BQ7B 3LS4H 4JB9L 5JQ6L 1YYMH 4HFUH 4G7YL 1JF1B 1MWAA 1FNSL 4KTEH 5DMYA 4B41A 1RZGA 4O51B 5HYJD 4M4RA 1RURH 1KPUB 1OGTA 4XPAL 3F7QA 1YEHH 3X13A 1U0QA 2PUQT 4ODUA 4JHWH 2CXGA 3PWPE 3R1GL 4AIOA 5GSRA 2HG5A 2AJUL 2NW3A 5MENA 1HHGB 1Q94B 3UEZA 1FH5H 3QXWA 3RVXC 2OL3H 5HHVH 1MJ8H 3ZHKA 5HI3D 5D7IB 4NNPH 3QIBA 2EIEA 4JFXA 3HAEB 4QKXB 3C5SA 3HG1D 4MXWL 5TDNB 4JPVH 3QWQB 1JF6A 4LOUC 2YD2A 5EZJB 4MJIA 3WFEH 2UUDH 4H5SB 4R97B 1S9XB 1FPTH 3O3UN 4MD4B 4OGXH 3QNYA 1QSEE 3HMXH 4OLUL 3TO4D 1WZMA 2APFA 5B3JF 4QOKA 4KY1H 1JZ4A 3ULUC 5ISZD 1GGIL 3PNWB 4JM2C 5JW4Q 1A9EA 4DVRH 3LEVL 3CLEH 5F7NC 2ZUQB 1U8LB 1BFVH 1MJ7H 2BNQB 1YYLH 5IW6B 1TZIA 4QRUB 1MCWM 3B6SB 3IETB 1N5YL 1FORH 4U4BA 1TCMA 2HJFB 5CGYC 3PWNA 3E6HB 4QRQA 4N8VB 4PIRF 1MH5B 2G5BB 5A2LH 1T1WB 5GZOD 5EPMA 3SEPA 4K9EL 4WTWA 2ZCHH 2DDQH 1BJ1H 5C08E 3ULVE 2WWKT 1PAMA 3L9RA 3WKMH 3ULVH 1LEIB 5BS0D 4J1UB 2IG2L 2Z93B 1EZVX 3Q1SH 1ZHBA 4I13B 3CSBA 1YA5A 2ADJB 2VTFA 3DV6B 1G6RL 3VE0B 2CH8A 2JELH 5EULV 3RFZC 1I7ZB 5AYUL 2VLKB 2CIKB 4JFHE 3C5JA 2W0KA 2DQCH 5FFLA 1FNHA 5HY9B 2IAMD 3IAPA 3O4LB 2DIJA 2D3VA 1EZVY 1X5JA 3LKOA 1A2YA 4FQHB 1A7OH 5LJYH 4O2FB 2VMFA 2DQHH 3DECA 2EDWA 1F3JB 4QT5B 4Z7UF 3V5DA 4LGPB 1G1YA 5D2NE 4XP9H 4DUXA 3OB8A 4FFZH 4KVCL 1Q9WA 4F9PC 4JDZB 3QZWG 5GGVL 3ZLQC 4LDLB 4HUVA 1B2WH 1UENA 5EC2A 2EDYA 1ETZB 3C60A 2MPAH 4L3CB 3H0TB 2P49B 4NSKA 1BM3L 5C0NC 5AZ2H 5K9KA 1LO4L 4O2CA 2GYSA 2Y5EA 4RWYH 4RDQG 5JNYA 3CC5A 1GGBH 2HLFC 4OLWL 1URLA 1YECL 5E8DH 4Z5RA 4OKVA 5TE6L 1BX2A 2A6IB 2MQ0A 3QIUA 1DBBL 5AD0B 2PW2B 4JVPA 3E6FA 1P4IL 1NMCB 1IC4H 1KENL 3EFDL 1T22A 5C9JA 4U33A 3MRDB 1HINL 2J1KA 3C2AL 1HYRC 1TIUA 3N9GH 1VFAB 5ID1B 2CIIA 4AENA 1MRDL 3BUYA 5EZLB 1FZKB 3PL6B 5F93C 3L95B 3GMMA 3GMPA 5TF1H 1X3DA 2RJMA 3FT3B 3L7FA 4PRNA 4GG6E 2L7JA 1T7WA 1NMCC 4JFYA 2G75A 3REWA 4H8WH 1R24B 5HI4D 2IBBA 1INEH 1OSZA 4OIAA 2HLAB 1VACB 4IS6A 1V7ML 3MRBA 3G6JF 5EBWA 3O2DA 4GW5B 4APQD 4P2OC 4S10A 5CP3A 5D7SL 2Q6WB 3V6ZB 1DBMH 4HIIA 3W9EA 2EXYD 2B1HL 3IKCA 2E7BA 1I7RB 3QUXA 3VFUA 4IRSD 1QRKA 1YEJH 1MWAH 3NH7H 1MPAL 4X8JA 2AK1L 4RMVA 5D5MF 4PY7B 2BVPA 4IHOB 5C0BD 4Z77B 3P9LB 3ILQC 4XXCC 4DVBB 1LP9A 2XXCB 1NSNH 5IMOA 5DRXA 2ICEA 2VQTA 5MENE 2XQBH 4PJ8D 3IVKB 1NBVL 2B4CC 5L2KB 1C7TA 1QPXA 3D9AH 1SBBA 5TPWH 1TENA 1S7XA 3B9VA 4R8WH 1J1PH 5DLMH 2JB5H 5DQDL 3HE6A 3O45B 1N7MH 3QJFB 4BYHA 1QKZH 3ROLB 1QSZA 5IV2B 2ZCKL 5EORH 1KCUL 4RWHA 1OAKL 3L3HB 4XVUD 4QOKE 2ZUWA 3OAYH 4LSRH 2Q86A 3FQRB 1L0QA 5IM7A 3AROA 3QFJA 5EFIA 5DDHB 2EEAA 3MSPA 1YY8A 4G9DA 4JR9H 1FGNH 3OR7B 2W0PA 3G5YA 4OFYD 4NQXA 5IKCA 1DQLH 1U8NB 5LAXB 4G8IA 3FOMA 4QF1B 2YPLA 1RZ7H 3Q6GH 2WBKA 2NXYB 3LKPA 1MVFA 2FX9H 1BZ9B 4RGOL 1KNOA 3CFKB 3B3IB 1EK3A 5DRZA 5HPMB 3VA6A 1I9JL 1CDIA 1PX3A 2H26A 2NY3D 3C9NB 1VPOL 5GJTL 1MSPA 5BV7B 4ONOA 3V9FA 4OGAD 1OLLA 1A0QL 3JVGA 4Y5YC 4AQOA 5LQBL 1VFMA 3EJJX 4FZEL 5A1AA 4NQUA 4XPHL 2SEBB 5JPMA 4ONHB 3V7MA 4URTB 4YHOL 4CMMB 2NXYC 1DQJA 4YE4L 5JUEL 5I75B 1KJVA 2D0GA 3FONA 2F53B 3QDGB 3I3BA 2AV1A 3GHEH 1I3GL 2NLJB 5EIIB 1I1YB 3VDBA 5HGGS 3IDIB 5M94B 4EDWH 2MCG1 1BD2A 5FB8A 1JRHH 3SE3C 1AC0A 3P30H 3ZE1F 3AREB 4U6YB 3PHQB 3IGAA 5F44A 3MGOA 4NRZA 4V1DB 1E4WL 4L4VA 4P23D 5DMIL 4NZDA 4HUNB 4RFNC 1CDBA 1EMTH 4Q9CA 3GBNL 3NCFB 1D6EA 5I16A 3ARBC 3O11B 2AS5M 1EXUA 3S5LG 1T3FA 3AREC 1KT2B 3HE7A 4DKEL 1YEDA 2JE8A 5INDA 2XTJB 5DJ2B 1B90A 1G7MB 4PLKD 5GRWA 3ZE0F 1P69B 1NDGA 1RUML 3CZJA 5F88B 1Q1JL 2V2WA 2WBJD 2FATL 1QEWB 1U93B 1QP1A 5JZ7C 4N90D 3TWCL 2J88L 3CFCH 3VXNA 2QSCL 1IMHC 2P47B 1MIMH 5I0ZA 1A6AB 4HAGA 3BZ4B 2X40A 3O41A 3FHQA 5KN5A 5IP4A 5IROA 4S2SB 1N6VA 5DJZB 5CINL 5BOPA 1HSAB 3SPVB 4IRJA 5KS9F 5IB5A 1DQQA 2GHWB 2NQCA 2VZVA 5F6HJ 4GMTL 4JO1H 1C5DB 1MLBB 5EWIH 2JLLA 4O9HL 1A47A 1NCUA 4LVHB 4TSAH 4M02A 3QWRA 1T2XA 5EUOA 4WJ5A 4F7MA 3IDGB 5EZOL 4HD9A 3VA2C 4JQXA 1HDMA 3LRSB 5F3HB 3H6JA 1RK0B 5CWSA 5E4EB 1ZWIB 1T2JA 1FN4B 5CD5C 3V79C 1YPZA 5J6HA 1U58A 2QHRH 3BVNA 4JLRB 4M7LH 4ODVH 4PBVC 5DMJB 5JHDB 3BP7B 4LVHC 4TULH 5ERWB 1BOYA 3TESA 3BIKB 3O3AA 4X98A 5GGRA 3QJHA 4KK5C 3CDFA 1QFOA 5GS0C 1MCKA 2YOCA 4WW2B 1LP9E 2VO5A 1VHPA 1CTNA 4W4OC 2ED8A 2AKRA 5I8OL 3SCMB 3P77A 4YDVA 3RGHA 3T2OA 1SYVA 3SKOA 2NTFB 4ZTPL 1EFXB 2R0LL 4GRWB 2OTUB 1BAFH 4P59H 3RPIA 1ZEAL 4G3YH 2WANA 3CVHB 1VDGA 4Z76A 3WUWA 3HC0B 1DLHA 4NC0B 2WM0A 3VWJC 2FYYB 3LD8B 4JJ5A 2HVJB 4MD0B 4LGRB 4CADA 4WW2C 2J8UA 2XOTA 2OX5A 4D8PA 1RJCA 5F8QC 1C1EH 1JGDA 1HN1A 1UACL 2Z4QA 3HPLA 2VLRD 4S11A 5F89A 1X44A 1ZSDA 3BP4A 4HKBA 2W91A 3QFJE 3UJTL 3OG6B 1E4XH 4EVNA 2V9TA 2HFGH 3H9SA 5ECJE 1XZ0A 3LD8C 1WC7B 3V7AE 1BMGA 2YPLE 1DL7L 1F4WH 4HUWA 3MJ8A 1YEFH 1AGFA 3KPPB 3CD4A 3AVEA 3JV6A 3EKCA 1AHWC 1N8ZA 5EA0L 2GJ6D 1B88A 1U95B 4OLVH 3ECBA 3FB5B 1IGJB 5HGDB 4U6TA 3ARWA 4Y4HD 3FOLB 4ISVA 1S7UA 1LWRA 4KV5E 4PP2B 2XKNA 2HMID 2YEZB 4PJGA 2ARJA 4M48H 4JFZL 4DKDC 3UTPD 2OTWA 5JIHA 5C7XH 1FV1B 3QXTA 2HFEA 4Y2DD 5FGCB 4M1GL 3RI5F 4DQOH 1T2QH 1T5WB 1JWSB 5MEPB 4HPOH 1IGYA 5TH2A 3CVIH 4M9PA 1BD2E 4POUB 3MLPA 1KEML 4OSUH 3C2SA 5IMKB 1JF5A 1VB9A 5C2UB 3FFCD 2B39A 2HH0L 1MREH 1RZFH 3SE9H 4PJIB 3JVGC 3DTXB 3JWOL 5DD5H 1JHKH 4L5FL 5SX5H 5BJTA 2HTKD 1IL1B 3PDGA 5C2BL 2WWMD 4F7CB 2VXSH 2IPKA 3N1GC 3SDXF 4CMHB 3DUSA 2A6JA 2IADA 4LPYA 5EN2B 3BI9X 2AI0H 4LCIL 1N6QH 3LOWA 1S7VB 1XF2B 2LV4A 4GRMA 4XRCA 4PB0L 4JKPH 2EDDA 2VXUH 3JTSB 5E5MB 3IDXL 1JMZA 5HD8D 4QWWD 5CBEB 1KJ2B 1VGKB 3RPKA 2R2BA 4CMHC 1AJ7H 1MIEL 2VLMD 5C09A 2C3XA 4R4BB 4XPTH 4QY8B 1FYTE 5DMGC 2D31B 2FWOA 1AH1A 3MV9B 4XNYL 1FDLL 1U8KB 5FCSH 1V7NH 2Y5TB 2J4WH 4LVOC 1P4BH 5BZDA 2EO9A 1DBKL 4G43B 2C1PA 3TBYB 3D0VA 1DFBH 1WGOA 4U6VH 4LPWA 1GIGL 5ANMB 3DGCR 1RZKH 2QQNH 2UWEA 1S7SB 4PJAB 1FSKC 3MNVB 1A3RL 3VXMD 1TQCB 2EO1A 3P0VL 3RU8H 3MGTA 4PRHD 1YPZE 3HMWL 5I8CA 2IALB 4MQXC 3U48A 4R0LA 5T1DH 2YD8A 1FFNA 4XNUL 3DRQB 4PTTA 4I0CC 4OCLC 4OT1L 4OZIA 1FBIH 5DGQA 3HZVB 5JA9A 1I1AD 3LKQB 4G6FD 4OFKA 5DVKA 3BRFA 2NMSA 4M8QB 1FLRH 1FFPA 3GRWA 3A6CL 3FQXB 4KTDH 3UBXB 1JYNA 5A16B 4GW1B 1DE4A 1PGRB 3IAGC 5E9DE 1LGVA 2NY5H 3C5ZC 3VFPB 2ATKA 5BRZD 2E6PA 3BX7C 2K3TA 3RJDA 5JXAL 3DV4B 2Y6SC 3CCHB 3AMKA 4UT7H 4WHTA 1MY7A 1GSMA 3WBDA 2J8UE 2FHBA 3U36A 2LE9A 2YUWA 2ZSWB 4YHPB 4KDTA 4MA8L 1WWAX 3HHRB 1KCKA 4MLSA 5DK0A 4TNVK 5CEXA 1I85A 2D4DA 2YKLH 3E3QE 1CLOH 3GZKA 4L8SA 2VXTH 3TH2T 3GO1H 1G7HB 3MXWL 4X6DF 4OI8A 2E7HA 4I2XA 1XGTB 2IPTL 3L5XL 5GIRB 3RDTB 3H9SE 3B8SA 1FQ9C 1K4CA 4OZGF 4O5LL 3BEWA 4FNLH 4X99A 2UVFA 1YMMD 4PR5A 2P8MB 3WSQL 1A14H 1H8SA 1CTOA 1B9ZA 4HPYL 1I1FB 1I8MB 4FRWA 1KXQE 4Y4FB 5I15L 5I1GH 43CAB 1XCQB 1EEYA 1EHLH 2V5TA 2EDLA 2F5BH 2BNRB 4PJHA 3MXVL 5TQ2L 3RDTC 4HGKC 4XMLL 1QRNB 1X5FA 1CDGA 3QPXH 1OPGL 4KJPC 4M8VA 4PJGE 4U1IB 1YJDH 3SKMA 3TFKD 1U3HD 3C6SA 4YXLL 1G7LB 4FQXB 1YDPB 4ODXB 1S7TB 3VFSB 2YD6A 4Y4FC 4BFBD 1NEZB 4UT9L 2BFVL 3VXTB 3L7EB 3KS0J 1OD7A 3TT3L 2F15A 3KR3L 1AR1C 5FYKU 1GHFL 3PP3H 1V8HA 4ORGB 1QSFD 2D7OA 4OM1H 4FQXC 1E4KC 3UPRA 4W68A 4D0DB 5IGXH 4JG0H 1R5WA 2W59A 4RMSA 4UV4H 4NUJB 1AE6H 3RVWC 4Y5VB 4NM8L 1BQHG 3SQOH 4PJ7A 2WIIB 4GUPA 1U8MA 3I6LE 1UZ8A 2NY1D 3GIZL 5J57B 4ONGH 1UZ6E 4LSQH 4JE4B 1INDH 3QDJB 2ZOLB 3D18A 5ICXB 4LCUA 4ZUUB 2IH3A 1IGFH 3MODH 4JQVC 3QQ9D 3MUY1 2XG4A 5D7LA 1YEIH 1AQDB 1WZ1L 3SGKA 3R0MA 5C09E 4Y5VC 1IQDA 1YEKL 4IIQA 1U8PB 5IJVA 3IF1B 1NC4B 1JV5B 5D7KD 5E6IA 3L5HA 3MRNB 4U1KA 1QYGL 2R2EA 1EJOH 1QR1A 3UTTB 5E4IA 5I66A 4WUUD 2OR9H 2HT4C 4R26L 5T3ZE 1NL0L 3VFVA 5T3ZH 3QIWC 3Q6FB 5DEZA 5T33H 4EUPB 4FQLL 4D9LH 3O3DB 3TC9A 5I1IL 3VFGL 1WFNA 3CZFA 4LLDB 1ADQA 5F3BB 3TJHD 4DZBA 5DUMH 3QXDA 4RZCA 5D6CA 3MBEA 1DR9A 2UWEE 3DXAA 1LK3H 4QHUA 1U8IB 1K3ZA 1A6ZA 4WO4A 4GRLD 3WHE1 4AL8H 2JJTA 4G8EA 5GGRY 3SE8L 1TVBA 1NBYA 2Y1VA 3WDJA 4F7EB 4KK8D 3SGDH 2J6EA 3IJYB 2XWJB 5F1IA 5H2BB 1AP2A 4EN3A 2NY0C 3CK0H 1LO3H 2BY1A 4OZHB 3RIAF 3T2NH 3TN0A 3WMSA 4LBEA 4ODSH 5IEKA 2BSRB 4ZS7L 1C7SA 4HULB 3H9ZA 2Z31A 3GSQA 2MHAA 3L5JA 4OZIE 1OSPL 5EOCL 3O6ML 3B9KA 4BH7A 1AXTL 4OZFB 3HZKB 2PCPA 1FE8H 4LKCB 3DMMC 1ZLWK 2EDNA 3P9MA 4NKIH 4YX2L 1F11B 3GRWH 1RFDH 3HZMB 3MV11 4KKBC 1FVEB 5IFAL 4R0LC 3TNNA 3S96A 3CLFL 2ZG1A 3MACL 3TPUA 1UM6H 3UBXI 4OTXH 4OV5A 1WVZA 4ZPTB 1I8LA 3LB6D 4UNTA 2A83B 3RWGB 4AT6B 5DD0H 1X5XA 4HS6B 1I3RA 2PO6D 4U0RB 5T5FH 1OF2A 3O0RL 2IPUK 2UZXB 3D39A 4LLUA 4I2XE 1X4XA 1R5IA 2XN9E 4PFEA 2H41A 2YXFA 5DS8A 2B2XL 5T3XL 1S7WB 5DD6A 1A7RH 4JHZA 5I1LA 5L6YH 4JRXE 1JMXA 4JDTH 2ZP0T 2FR4B 3RGVB 4RSVA 4HWBA 4MA7H 4UQ2B 1CG9A 4U0RC 3FRUB 4UBDD 4TQEH 4Y19B 4ERSH 4ONFL 3OKLA 3D1MC 1QA9B 2VZ1A 4PJHE 1FO0A 3OXSA 5FYKL 3MLTA 4RGMC 4POYA 3WL9B 3T8XB 1D5MB 1QBLL 1RJZB 3RUGA 2X09A 1S5HB 5TDPA 3DIFB 4U2ZA 4H20H 1J0YA 2AJ3A 4YDJA 4NO0D 1CGSL 2VQUA 4EBQL 4UT6H 1NGQH 4XBGA 1E6OH 3VFRB 4JO3L 4X9BA 4P5TC 2Z35B 1NCWH 2W60A 2FL5B 4S1RH 4ZFFB 3IFNH 5GGTA 4KPHL 5KSBA 3SO3C 2FECI 2PTTA 5MP6L 3W2DH 5FK9B 1T03H 2DQFA 3P4MB 5I8EA 5T1MA 3G6DH 5J9PA 4B53A 3U9UB 4QRTA 3QQ3B 4NRXB 1MCHA 4NN5B 4P9HC 1J8HA 4M6NL 3QNXA 3QUKB 4JFDB 1U8OA 4PJ7E 4U7KA 2CMRH 5E99H 4NQEB 4PGBB 4J8RA 2DQJL 3QQNA 2FHFA 3BPCB 4K3GA 1MOEA 4YBLB 4KJQC 1U6AL 5D7LE 2YSSA 1W72A 4UI2A 1NDMB 2OSLB 3CDYA 5FUCC 5JW3H 3BH8B 4CN4A 2H6PA 1JPSH 3RWDB 1K5NA 5IHZA 2UV3A 5DRNB 1JN6B 1ZOXA 3KPNB 1LE5B 3WHXA 3H7BA 1S5IH 4J3WA 4RX4A 1U92B 5DQ9B 3IU4L 1QTYT 2VIRA 4R96B 5EZIL 1Z9LA 1ZANL 2ILLA 3ALPA 3MV8B 4FQPA 5EOQH 4ZMAT 5E94A 2ERJB 4N1HB 1AD0B 1RZJH 3GBML 1ADQH 4PYGA 1KCRL 3Q2CA 1QQDA 3IAQA 5KAQG 2H45A 3C09C 2GIYA 5FUOL 3F65A 2P5WA 4PJ5B 1A1NA 2DWEA 3O3EB 3O8XB 5DK2B 1XGPA 3ARPA 5GISH 3TA3B 2IBGA 4YHNB 5AAMA 2P24B 2VDPH 3DYMA 4I0KA 4Z7WE 5DJ6B 1PZUB 2OP4H 2CJUL 5DC9B 2FECL 1XR8B 2J6EH 5F7LB 1F3DJ 2NR6C 4D3CH 4WW1A 2ERJC 3I6GA 2VLJB 3OAYK 1Y18A 3BKJH 1E4JA 1NMAH 4FTVB 4BSVA 4LLVA 4Q2ZB 3O8XC 3ZL4L 5IMLA 4MA3A 2C26A 3TA3C 3L6FB 3WCYA 4K94H 3V6OA 4WO4C 1ORSB 3KYNA 1OAYL 5DEGA 5FO8A 2Y7QA 5SX4I 5I1DB 4ZUVB 4LNVA 1IM9D 5ESVB 1H3GA 3HN3A 3S35L 5FUZL 4EN3C 3SGEH 1S7RA 4O58L 4JZNB 1J1XL 1JVKA 3UC0L 4HC1L 1W8OA 3I6KA 4YAQA 2COQA 4P2RA 1CFVH 1QD0A 2ARJQ 3RWEB 1T21A 3CDGB 4M61A 2D9CA 4XB7A 5HXMA 2W9EL 4OUUB 3CFJA 1H0DB 3RWIA 4N0FB 1HYSD 2ATPB 3IDNB 1JBJA 2YRZA 3IFOB 2R0WH 3B5GA 4UUJA 2A38A 3MRQA 5FA4A 2BMKA 2YPKA 1WK0A 3D39E 3TZVC 1DBJH 2GTZA 4P0DA 5IB1B 1ZHNA 2HT3C 2VJXA 3ULUD 2GT9B 4D0CA 1GJIA 3PF2A 3TIDB 1DN0A 4OF0A 1N59A 2GJZA 1SJEB 1ZHLB 3FTGB 3BAEH 2YPVH 4XP6L 5FYJD 2DQDL 4JGUA 5E2JA 3WIHA 5D7JB 4DKFL 3FFDB 5CGMA 2OL3B 4HWBH 3L3JA 3BQUB 3PE9A 4XVTH 4HFWB 4XMPL 5CGYD 2X4OB 1LO2H 1UT9A 3PUCA 4KAQH 3VFNB 12E8L 1FIEA 3F7PC 4H0GA 1C8PA 2A73B 1NFDA 1UJ3B 3ES6B 2R4RL 4UQ3B 5T1KA 2NYYC 3KYMB 2GK0A 4AY0A 4YR6B 1TZHA 3VGAB 5FEBA 1PQZB 2DJ4A 3L3IB 5K93A 3ZDZE 4X0KA 2ZCLL 1JNHB 1KTLB 1ZLVK 1H15A 4MJ5B 3O6FA 1XAUA 2BNQD 2FJFB 1TQBB 1ZS8B 3D69A 3NFPA 3AAZA 4W6XB 3RWHB 4QXUL 3QUYA 3O81A 3EZJB 3T09A 4HMEA 4PRPA 1DQTA 1UJ3C 3QZWA 2BK8A 2HKHH 3GFUA 2MJWA 4NQCA 3QXVA 5LGJB 3VGAC 5F1KC 4DGVH 4DJMA 5FHBL 4X80L 1OARL 1JHTA 4G9FB 5DJAB 4R7DA 2CGRH 4KI1A 2DQIL 3ARDA 4LASH 4QHNB 3EFFA 1J8HE 3DUUA 5CJQH 1FLTX 5C08B 2FEDC 3LEXA 1QFWM 4YGVA 2P7TB 4IOFC 3VXSA 1DUZA 4JFFA 3BXNA 2VLKD 3NN8A 3DVNA 3KVQA 4OF8A 3RZCA 4ZFZB 1JGEA 1RIVL 3W0WB 3LIZH 4Y7MA 3O4LD 4TSCL 5ACZB 3HZYB 3UAJD 5HI5D 2BVQB 5GRVK 3AGVA 2OJZL 1W72H 3EUUA 1CZ8H 5C0RH 4PGDA 1D5BA 4ZODA 3UTQA 5C07A 3C6LA 4W6WB 4L8DB 3F7VA 2CDFB 4MAYB 1LHZA 1HK6A 1CVSC 1QPPA 2BVOB 1CD9B 5DGRA 1A9BA 1UKTA 2WUCH 5JLZA 4OM0H 5DQJA 4XWOC 3PGDB 4Z7NE 3LKRB 1S9YB 1WBZA 4U1GB 5I2IB 1AIFB 4XPBH 1I9RL 3ZTNH 2R1WB 1ED3B 3KYKL 2P5WE 4KQ4L 2AJYH 4KDWA 3OZ9H 3EOYG 1F3RB 2CR6A 4XZUA 5FYJU 2R8SH 4GMSH 5JMOC 1HIMH 1JNNL 2DLGA 5FDWB 3BZEA 1NCAL 3LQZB 4OCWH 5I8KL 3BUTA 4G8FB 3O6KL 4DCQA 4PV9A 3HUJA 4YHIA 3SDDB 4BZ2L 2KPNA 3PL6D 1OVZA 1VGEH 4DGIH 4GSDL 1G6RA 2ZWLT 1PLGL 3ZKQD 3K4ZA 3V6OE 4CNIB 3P11H 2WV3A 1T6WA 4HF5L 1HQRA 5FKPB 3H9HB 3ILQD 3KLAA 4K8RH 3U4BH 4PJBF 1MFDL 2V7NB 2B0SL 3S36X 2VL5B 1CIDA 3BO8A 4OD2B 3VRIA 3U0WH 3WFHB 1CLYL 1NLDL 2X70A 3BPNB 3MMEB 2AK4B 2DWDB 5IG7A 4J3VA 3BEVB 2WSKA 5E08L 5EO1A 4OZ4B 2WUBH 4C83A 3AM8C 4F7TA 2CRIA 5FF6B 3TBWA 4GKZB 3T0EC 2G60L 4FFVC 1J86A 3VXOA 1IRAY 2X9XA 4JG1H 3EOBA 1A4JB 3SOBL 1MFEH 3NPZB 4WHYG 4ELMA 5GGUA 1MWAB 4DAGL 4O02H 1CL7H 1H9VA 3BPNC 5F9JB 4JDVA 5HHNA 4PJEF 5ALBL 1UH2A 3X13B 2QV2A 5F96L 5L2KD 4ODUB 4OJFH 4LARH 1FFRA 3VXRE 5AWNH 1JI2A 1BJ1J 2VB5A 2VXQL 1ZLSL 2HG5B 1FZOA 5CJXA 2NW3B 4Z7VF 3FT2A 5MENB 3WIHH 4B50A 2E9WA 3J7HA 4G6JH 1KLGA 2Q3AA 3MPCA 2Z0BA 4P4KA 3QIBB 3ESVF 1IAKB 3QEHA 5IJKA 1NFDE 1CN4A 1NC2B 2EDJA 3MFGB 5FOBA 5MERB 3WJJC 3H3BC 1IKFL 4RFEA 1FJ1B 2HVKA 4QOKB 4BUHA 1B0GB 3TM6A 5IW1A 1ZTXL 2NXYD 4JPIA 3MRPA 3OKYA 4PRPE 2DF3A 2I07B 4EKXA 4NQCE 2P48B 1NGXB 2CUIA 1R3KA 3IRPX 1OAZH 4QRQB 5JQ6H 4JB9H 4HWUA 4MZ3A 2XACC 4G7YH 4MMZC 5CZXC 5JW4R 2EDOA 3KDMB 1FNSH 1HILB 1DSFL 3I3DA 3T3PE 8CGTA 2ZJSL 1A3QA 1FNGA 4XPAH 2G5RA 2F53D 4ZO7A 4MB4A 2N1KA 3QDGD 3DVGA 5DMKA 5CJ8A 1EHAA 1QNZL 4JFFE 1FHGA 3R1GH 1ZHBB 3U6RB 1KEGL 2AJUH 4PUBL 5DSCB 3ARED 5CSBA 1KC5L 3WDHA 3ARFA 3ZT5A 3K81A 4V1DD 1JJUA 5C0CA 5A43C 1N5AA 4X5WB 5E0QA 4MXWH 1WZKA 2BSSA 1DP0A 1FYHB 4PJDA 4ZTOL 2VDNL 5JZ7D 3KPRA 1V5JA 4OLUH 3BP5A 1KIPA 1F6FB 5ADOL 3MO1A 2IFGA 3T4AA 3N06B 5FYJL 3V0WL 3ARZA 3QUML 1GGIH 1A8JH 1L4IA 4AH2B 1M71A 2XTJD 3LEVH 4LRNL 4PJCA 1DQML 2R29L 4KH2A 2H32A 4YHML 3ZDYE 4MXQC 3GB7B 1N5YH 3C60B 4BKLA 2X4SB 4NSKB 5A2IH 4HKJB 1I8KA 1DUYA 4ORZC 5D96B 4IEFB 3MTRA 4LK4A 1H8OA 2W9LA 5HVHB 4K9EH 4PJFF 5EU4A 1BX2B 1A6UL 1NCDL 4ZFOB 3HUJE 4QTIL 2IG2H 3VGHA 2KUTA 5C71A 1XF1A 5GSVB 4NZJA 1KTDB 1H5BA 1UGNA 3TLRA 1T22B 3G6JB 5C9JB 5F97E 4PREB 1G6RH 3BZFA 4K3JL 4X7CC 5BW7A 5AYUH 1EVUA 2CIIB 5C0JA 4WI4A 3ARSA 5FIEA 5GS0D 2GKIA 4YGAB 3U4AA 5BMFL 3GMMB 2BJML 5HYJA 2I25N 5I17A 2R1YA 4P5MA 1Z3GL 5D1QB 3PJSB 4F58L 4LSVL 3MLWL 1FIGL 4XX1G 3QG6A 5C0DA 4JFYB 5JHDD 4KVCH 3DX9A 3NCYS 5GGVH 5J13B 3UX9B 3HG1A 1KB5L 4JHBA 3A6BL 5HGAB 3QWOA 4HIIB 3W9EB 3QUXB 3VFUB 4ELME 4YDKL 2RGSA 3SCMD 4HIJB 4JKMA 2CXKA 1BM3H 1ZT1B 4F33B 5I18L 3TO4A 2QSQA 1LO4H 2V6HA 1EFXD 4UAOC 1GRWA 5KSUA 2F58L 4E9LA 5JPNB 5ISZA 2X4TB 5JHLL 1K8IA 1D5XA 4XXDB 3LKNA 5DRXB 5JW4N 4OLWH 1YECH 5DHVA 4YXKL 4DN4L 3OB0K 4PG9B 1TFHA 5TE6H 5FHAL 3MLZL 5IIEB 2DN7A 1DBBH 3OL2A 4UOJA 4NO2B 5B4MD 1P4IH 1LNUA 3REVB 4NHUB 1KENH 3EFDH 1BIHA 3ABZA 3WXVL 1HINH 2EIBA 3C2AH 4HKXA 4WENB 4G8GB 5L8KB 2E3VA 4Y5XA 1MRDH 1VCAA 5CJBA 3ULSA 1TLKA 4MS8C 4UDTA 1FFOA 1E28A 4H1LG 5BS0A 2FJGB 3LKSA 5GJSL 4X4XB 1FNLA 1YY8B 2X4UB 3VW3L 3BOVA 2X4NA 4EQ2A 4LNRA 4GAYB 1BJ8A 4FG6C 5IVXF 5IKCB 4LU5L 3VFOA 2CD0A 3F5WA 1V7MH 4G8IB 3QO0A 2YPLB 3D85A 1BVKB 4N9OB 5A2FA 3IJHA 4XAKE 1H3UA 5D7SH 1XGQA 2B1HH 5L2JA 3K2MC 2IAMA 4NQVA 1MPAH 3LN4A 3T1FA 5IBLD 2AK1H 3FO2A 32C2A 4K7FA 3ZTJG 5DA0B 2YWZA 1SYSB 4Q0XL 4AM0A 3BYTA 2B4CL 5D8JL 4KGJA 2J8OA 3PGCA 5DJ8A 1NBVH 1II4E 3SDCA 4PGCA 2EZ0D 4N68A 5EU6B 3LN9A 1WCBA 3VRLE 3ZKNC 4I9WD 1QSVA 4Z7OE 4CVXA 5CMAB 3VMNA 4JGJA 1BD2B 5DQDH 2VOTA 4PJDE 1NANI 2XNAA 3IGAB 4X6BB 4QHKI 3KPRE 2D2OA 1D5ZB 3MGOB 1JRHI 3A0OA 2IPUG 1C08A 4U0QB 2ZCKH 1KCUH 2AP2A 1OAKH 3HPJA 5K9QG 1Y0LA 5HHOA 3ARGA 4KQ3L 4MYWB 2EC9U 4IOSD 3IB4A 5DMGD 3AXLB 4JM4L 3ARFC 4PJCE 4XH2B 5SWZE 3CFBA 1T3FB 5EO9B 3DX7B 4MLIA 4XBPB 2Y36L 4RNRB 5INDB 4C4KO 3R8BB 3K8KA 1NDGB 1RD6A 4X5XB 5CCKL 4RGOH 3UTZB 1K4DB 4LKXB 3EGSB 2AV7A 4M6OL 1NCBL 3MV9D 4P46B 1I9JH 5GJTH 1VPOH 3CNKA 3VXNB 5J6GA 4P99A 4NQDB 1BGXL 3RWCA 5L8JB 1A0QH 3R8QA 1AC6A 3O3BB 4MJ2A 5LQBH 1HI6A 4JEGB 4FZEH 2VR4A 3SDAB 4XPHH 1FYTB 2Z8WC 4YXHL 5LXGL 4MQXD 4YHOH 4PS4L 4QXTB 4YE4H 5JUEH 4APQA 1T0MB 4IRJB 3QH3A 3HI1A 3EHBC 1B0WA 4RGNE 1JZ7A 2BOCA 4LCCB 1I3GH 3B2VL 1P7KB 2OYPA 3BN3B 4XVSL 1A6TB 4GQ9L 1J8KA 2K9UA 1P7HL 1UJTA 5HYJE 5GGVY 5GZND 5C0BA 4AJ0A 2HFFA 3MRFB 4IM8A 4OIBA 4PRBA 1E4WH 4F7MB 1TTUA 5DMIH 5ACLA 2X44D 3B5HA 3C8KA 1AKJB 2IWGA 1H5BC 2MKWA 1Q72L 3GBNH 1FG2A 3D2UB 4NM4L 2Y6SD 4DOHB 4JKWA 1GGUA 5ACMA 3Q3GB 4J4PD 4LIQL 2OLDA 3TV3L 3U7WL 3KYAA 3N1FC 4DKEH 3GI9L 5JO5A 3INUL 3RY4A 4X98B 1RZKC 1LMKA 3BRDA 2L7UA 4IOIA 1RUMH 4JFOB 1Q1JH 5FO7A 5GS3A 1RPQA 2FATH 2MTPA 4X6DA 3TWCH 2J88H 2QSCH 1Q8MA 5IB4B 4KHTL 4LHUG 4YDVB 3S4SA 3SKOB 5H35B 5DHVH 3MV7E 1Z9MA 5IHUL 1S78D 4F3FB 3IFLL 3HC4L 3OR6B 3DO7A 1P84J 5E9DB 1DANT 4M6ML 3LSOA 4XPFL 1NUGA 5CINH 5DJDB 3SDYL 3TO4C 1XT5A 4GMTH 3RDTD 4Q7DA 4ODBD 1IGIL 4O9HH 2LTQC 2ZG2A 3OSKA 2Z4QB 1ZT7A 1BWMA 4KJPD 3S37L 5IUSA 2OQJB 4U1SA 1ZSDB 1DEEB 4NC1C 1AXSA 4R7NB 5BS0E 2R69L 5EZOH 3GNML 5AG8A 4QTHA 4FXLA 2N4IA 3H9SB 1K8DA 4ODHL 4V2CB 2FHCA 1E4XI 4GW4A 4XT1C 5HJ3A 2FBOJ 2BNRD 1QRND 1A6WL 1J18A 4KUCD 1VENA 2DL2A 3VJ6B 1JL8A 5GZOC 1N8ZB 4KFZC 2CQVA 1RHHA 4HT1L 1R3HA 4FQXD 5GRVL 3IJSA 4ISVB 5E03A 4KJYA 1KBGL 2DLTA 4KI5D 3GMLB 4GG8B 3O2DL 4PJGB 1WAAF 2ZSVA 5I8OH 2ZPKL 3I75B 4HWEL 4X6EB 3RVWD 5DXWA 4HS8L 4ZTPH 2P4AB 4D94A 2R0LH 3QEGL 1ZEAH 5E7BA 1KIQA 3DRTA 4F7PB 1LQSR 3T2QA 1IGYB 1NAMB 1ND0A 2IAMC 2WINA 4RBPH 1CGUA 3UDWA 2FGWL 1MCNA 8FABA 2FJHB 1T1YA 1RJYB 4PY8J 1EHXA 4G80A 4ZSOB 5HHOE 5SWSA 1UACH 2W1NA 2JB6A 5FGSA 4GH7B 3VG9B 1F00I 3UJTH 2XWTB 3VFMA 5B8CB 2EE6A 3DUSB 3MLYL 3QDJD 2C7UA 1L0XA 3WJLC 4EDXA 4LFHD 2DQGL 3VI4E 3LCYA 1DL7H 4NQSA 1SVZA 2XXMB 4JVUA 1IGTB 4R2GB 4XRCB 1ZMYA 5CEZD 2VDML 4LVNC 1MHEA 5EA0H 3VG9C 3WUZA 3BGMA 4GOSA 1NC4D 2PNDA 2X5PA 4ZOCA 1ACZA 5KW9L 1O7VA 3SKUD 4RAUA 5C0AB 3TCXA 3UTTD 3CFIC 5K9OA 4ZOEA 1AR2A 2DJUA 3IFPB 4Y8DC 4JFZH 3VWKA 1CDCA 4TN9A 5IVNA 1CGVA 1J0KA 2DLHA 4NN7B 5IVZA 2DTSA 5E70A 3QCVL 4M1GH 3T3ME 4YPGA 4LF3A 4HKZB 4R4FL 2HWZL 3NA9L 2C1PB 2PXYA 1HHIA 3GMQB 1KEMH 4XCFL 1KG0B 2R2HB 3MCLL 1GVIA 3CMOL 5TFSL 3OKOA 5C0BE 2HH0H 3CU1A 4WTXA 3JWOH 2OMNA 4YHYC 2X89A 5HI4C 5EUKB 4L5FH 3DURA 2FIKA 1UEYA 1NGWB 4CDHA 5C2BH 3BGFB 5D71L 1X6LA 3B83A 3R06A 1T04B 4HV8B 1K2DA 1KXTB 2W38A 4QNPF 1MAJA 1KPRA 4YDLB 4IRSC 3D0LB 4HUXA 4BFGA 4JANA 4LCIH 3DBXA 1FFNB 4N0UA 1JK8A 1EBAA 2APVA 4NKDA 1KCLA 4IJ3B 1A02N 4PB0H 3LDBB 1CLZL 3F8UB 1U2HA 3IDXH 2BCKB 3BGFC 3L3GA 3M1BA 2PYFA 2LAAA 3SGJC 4PJ8C 2AJVL 1FFPB 5CKGA 1GGTA 1MIEH 2YMXL 4CGTA 1D9KB 1TPXC 4Z18A 1GZQA 1P2CA 5C0IB 3V8OA 2FLRT 3P4LA 1DE4B 2R23B 1IZKA 4MX7A 1ZGLA 2VUYA 1A6VL 4XNYH 1CXKA 4JFPA 1FDLH 3FQNA 1ZGLP 4IJ3C 3NIGE 3LDBC 1CU4L 4HMDA 1DBKH 4KUZL 4HX1A 1CD1A 1UWEL 4XVUC 4NRYB 3FB6A 2GJ6A 1NCCL 4TRPL 1F4XL 4Z9KB 3T65B 5DK0B 4QO1A 1GIGH 4Y4HA 1RK1A 4L8SB 4FA8A 4BSWA 3IRZA 1FZMB 4U1LA 2VC2L 3FL7A 2XN9B 1OQXA 3RGVD 1A3RH 3BEWB 4FQCL 4Y19D 2MNUA 3P0VH 3MFFA 4JRXB 2LABA 2BOBB 3HMWH 2FZ3B 2FB4L 4JFQA 5L9DL 1XF3B 3EDEA 3G5VB 3ZT7A 2PKDA 2NY3C 1EEYB 3FFCA 4XNUH 3TVMB 1FL6B 1OAXL 4OT1H 4PJHB 4F37F 5M95B 4LPCA 3B9AA 5EU7E 2CLRA 3N1PC 2ZUVA 3C6SB 3VGFA 2VQ1A 4RQQA 3KWWA 3A6CH 3MNZB 1NJ9B 5TE7L 3T0DA 4F15B 1U8JA 4WWID 1OCWL 4NFDA 2XA8L 3TP4A 4ZNCD 5JXAH 5E2WL 2D7TL 3U30B 5C0GA 1CICD 4G5ZL 5KG9B 3BGAA 4D9QE 1MHHA 1N64L 1MELA 4KJQD 4P23C 4RMUA 4MA8H 3S3PA 3QDME 4J6RL 4N90E 3TYGL 5SWSE 4JFDD 4BUGA 4WWKB 1D5IL 3MZGB 3MXWH 3D25B 4MWFA 1D7FA 4NQED 3TF7C 2JJUA 2IPTH 3L5XH 1WT5A 4O5LH 6FABL 4PJ7B 4GUPB 3MRHA 3WSQH 4BQ8A 2ORBL 3H2WA 3ZSTA 4OCYL 2G9HA 3OMZA 4HPYH 4P3WA 3RA7L 3T0WA 1F2XK 2WBJC 3WS6C 5I15H 4EOWL 3SJVE 4M6AA 4WWKC 4LCUB 3TJEL 1MNUL 1IGML 4EEEA 5J11C 4P2YA 4ZYKB 1DDHB 4XNZB 5J56B 3MXVH 1F45A 5TQ2H 4XMLH 1HHJA 3RNKA 3BESR 1C5CL 1Q38A 1OPGH 3NTCL 1QLFA 4IIQB 4YXLH 2APTA 1XR9B 5E6IB 3RNQA 2NR6D 3MV8D 4PRHA 2EH7L 4BFIA 2CO7B 3GSUA 2R2EB 2WZPD 4ZNEA 1QR1B 3QUZB 4UT9H 2BFVH 3B5TA 4PGJA 2QL1A 3U46A 3MLXL 3VFVB 3C08L 4XNZC 4PJ5D 3TT3H 2JJSA 3KR3H 2CLVA 3O8XD 1GHFH 4O2EB 3TA3D 2VZ3A 4HGWB 1I1AA 3CZFB 4WFHE 3D48R 1PKQB 2OM5A 5CZVL 3LS5L 3QXDB 4RZCB 3MBEB 2NX5B 2AABL 4FXGB 1OHQA 4NBZB 2ICWA 4QHUB 2GITA 1SM3L 1T83A 4WFGD 4WGVB 2VLJD 4OCNC 5GS2D 3QUZC 1OT1A 5ICYB 1TVBB 1NBYB 2AAVA 1U42A 3EDFA 4NN6C 1A7BA 4Z7WB 1IARB 3GMOA 2H3NA 4TTDD 5I9QB 4FTVD 4FABL 4TVPD 5BRZA 4HG4J 4HEPG 5DI8A 4NM8H 3SGDI 3TN0B 3EYUL 1HZHL 1RZJC 3HFML 4MCZA 4N0UE 3GIZH 3QQ4B 2VDOL 2MHAB 2BVYA 2MCPL 1JZ5A 2P43B 3JTTA 5C6WH 1YC8A 2H2SC 4HIHA 5MEOA 3VI3E 4LLMB 1T20A 3B9KB 4BH7B 1WZ1H 2PCPB 3NBNA 2QQQA 3PWLB 4NUGL 1YEKH 1TETL 5CBAB 1YMMA 5D9SB 3S96B 1QHPA 3TNNB 5DC4B 1R3JA 5TGBB 2Q8AL 1QYGH 2OCFD 4J3TA 1QO3A 1X5HA 4YDIL 4R26H 1HWGB 1NL0H 2FDBP 1Q9OA 4Q6IA 4O4YL 1TVHB 4XNQA 4FQLH 4MJ6B 4PP1D 2NYYD 5I1IH 4LLWB 3VFGH 3UJJL 4X4ZA 2UYLA 3JWDC 1UKQA 1UXWB 1DN2A 4NZUL 2ITCA 3G08B 1MCDA 4LLUB 4NZTL 2P5EB 4WV1B 1R5IB 1U3HA 3T0BA 1A4KB 4HH9A 5D7JD 1NCNA 4M3JA 3BQUD 4KRMB 1SEQL 3SE8H 3U82B 3NAAL 4NIKB 4JJHA 5IEHB 1RVFL 3F58L 3GUTB 3OKKA 1VKXB 3BH9A 5KVEL 3JZ7A 3FFCE 4ZS7H 3V0VB 1QSFA 1FCGA 1N0XL 4UDUB 3STZA 1UKSA 3OXSB 4ETQA 5IESL 4QRPB 3VRJA 1OSPH 5EOCH 1M6OA 1TCRA 4J12A 1QLRB 2VZSA 4KI5F 4MQSB 3O6MH 1AXTH 1X5YA 5GPRA 1AXIB 4Y2DC 5ITFA 3CJJA 4YX2H 1IKNC 5TDPB 1PZ5A 3TYFA 2AJ3B 3RJQB 4NO3A 4QCIA 5EDXA 4HC1A 3VFTA 5IFAH 2WP3O 3IXAB 3CLFH 2DBLL 3OKEA 2JCCF 3MACH 1KUMA 1G7JA 5EU5A 4XBGB 3AC0A 5JOFA 4G9FD 3EJZD 2Q20A 3K8MA 3ZHLA 3S9DB 1NEZG 2PTTB 5BVJA 4PG2A 2AGJL 2HTKC 3FB7B 2CKBA 2WWMC 2NNAB 5C08D 3O0RH 2DQFB 3ULVD 2VLME 3KHQA 3MRKA 5T1MB 3OKMA 5CIPA 5T3XE 3QNXB 2B2XH 5C6PB 3GSVA 4LPVA 4RIRB 5T3XH 3W0WD 3QCTL 1L7TL 3GHBL 4YLQT 4HIXL 3THML 1SMAA 3RL2A 3WLWD 4XWOD 1IE5A 1LEKA 1Q0XL 1G7QA 4J8RB 5L0QC 3I3EA 1WISA 2OMBA 4JZJA 5HD8C 3IU3A 4HDIB 1LEGA 4QWWC 4X6FA 4ONFH 2ZKHL 1BOGB 4GAGL 4KZDL 4MAYD 4XCEA 1KSRA 5FYKE 3K74B 5FYKH 1K5NB 3MYJA 4DK6A 5EU3B 4HZLB 1TZGL 4UIMA 1QBLH 1HOCB 4PRHE 2E6QA 2C9AA 5T5NF 3KPQA 5AUMB 4ZNEE 2R0KL 3P4NB 3QHFL 1W8NA 2DI9A 3U2SA 3KPSE 2X2YA 1CGSH 5K59F 4EBQH 2EDKA 3FQUA 3WFCL 3QRGL 3BE1L 4BQBA 1UQSB 4JO3H 3I2CL 2GSGA 3EO0A 1QQDB 5E1HB 4KPHH 2ZOKB 5MP6H 2P5WB 2DWEB 4P9HL 4OZHF 2EKSA 4PJBA 1T66D 1OAUL 4QYOB 2FO4A 1IC7L 4U1JB 3SDDD 1EFQA 3GSRB 1LE9B 4K55A 4M6NH 4XMKL 5J1AB 3ALXA 2VABA 2IQAB 1SY6A 5JQHC 1T7ZA 3MRJA 1MFNA 4FFVD 2DICA 2DQJH 4KKCD 5BXFB 1MF2L 5BOZG 4ZUTB 3WN5B 1LD9B 4L4TE 4POZD 3DHMA 1KJMB 2PO6A 1WTLA 1UADC 4X7DC 1U6AH 3IDMA 5GS1B 1H8NA 2W0LA 3KYNB 2X1WL 5DEGB 1CXIA 4DWHA 1T1XA 5FO8B 2Y7QB 2AK4D 2A6KA 2VKXA 4TPRL 3GIVA 1RUAL 4FQ1L 5FYLD 1J0IA 3SGEI 2F5AL 3CDCA 3IU4H 3WN5C 5EZIH 3X11A 1T21B 1VADB 2JF1A 4M61B 3X12B 1ZANH 3CFJB 1QUNA 3IYLW 2X42A 4C56B 4D2NA 3MJ6A 2ZZUT 4LLYB 4K8RC 4WHCA 4UUJB 5FA4B 2B5IB 3GBMH 5CJOL 1KCRH 2BXYA 2VWEC 1JFQL 5IQ9B 2GTZB 2E8YA 5FUOH 1ZHNB 1XCTA 5MEND 2GJJA 1DN0B 1MAKA 4ODTL 2X9WA 4XCCL 3EYFB 2Z92B 2VSCA 3RX5A 2CJUH 3QIBD 1S7QA 4WUKL 3PXJA 3VXRB 2VERN 4P2QE 43C9B 1A1OA 4K7PX 5KSVB 1IEAB 1NC2D 2F9BT 2CLZB 3RY6A 3L3JB 2B5IC 4WEBL 1QSFE 2AEIT 4DKAA 4JY6A 5DFVD 3ROOA 4QOKD 3DGGA 3TFKC 1U3HC 3ZL4H 1NFDB 5CZXD 5T1KB 3RTQB 1NPUA 3MRGB 1TZHB 1OAYH 3EYOB 4G42B 4QRSA 3TBTB 3B4NA 4M3KB 4K7PY 3TCLA 3V4VL 1PY4A 1H15B 2DL9A 3O6FB 1Q9KA 3FB8B 1NGYB 3S35H 5FUZH 4O58H 3D69B 4GKSB 1J1XH 3AAZB 5B39A 3UC0H 4HC1H 3CSYA 1BQUA 3NZ8B 5GRXG 1XGUA 3FQTA 5KTEL 2AXJA 4XPGL 1MFCL 1MRFL 4ODWA 4PRPB 3M17A 5M7QA 4LHJB 3FZUD 2W9EH 3RTQC 1G9MC 2HRPL 2FLBT 2ZUYA 1G7IB 1P9MA 4WNQB 1ZHKB 1JHTB 5F21B 1YNTA 1A7PL 3KYOA 5INCB 4TNVF 3IXTA 5EO0A 1ZA6B 7CGTA 5E95B 5F7HA 2QSTA 2LU4A 1L6ZA 3GGWA 3LEXB 2BC4B 1I8IA 4J3XA 4YGVB 3K46A 1DUZB 4JFFB 4XP6H 1ZVSB 3NN8B 1T5XA 2AEPL 5JORA 2DQDH 3RWJA 3DVNB 4MDIB 4LSTL 4DKFH 3QQ9C 1JNLL 2M8XA 2GCYA 1I7TA 4XMPH 5F1NA 2YN5A 12E8H 2XFXA 5D70L 3STLB 1NKRA 4PGDB 1FAIL 2R4RH 3S36L 1N3NB 1J0ZA 4X4YB 2RIKA 4A2LA 5JMRA 2DKSA 2ZCLH 2VISA 1A64A 2F74B 2PW1A 1RUKL 4CAGA 4JREB 1SJXA 5GGSB 1FO0L 2QTEA 3C60D 4JZJC 4QXUH 1A9BB 3LVEA 1QVOA 3LQMA 5SX4H 4LRIC 3TBVA 2IFFL 2VAJA 3TJHC 2NZIA 3FKUS 4QHLA 1UXSB 4FQQB 4YNYB 3FAXA 1OB1A 4MNHB 1Y6MR 5ENWA 5FHBH 4X80H 3W9DB 2X4QB 1BFOB 4GRLC 1OARH 4MMXC 1IFHL 3WDIA 4XZUB 3P4OA 4KRPB 2OI9B 4JREC 4WHYH 2M2DA 4JFEA 2DQIH 4L9LB 2W0FA 4E41B 1CR9L 5FCUL 4LSDA 1C16B 5GGTL 3MRLA 3CAFA 3QHZL 2ICES 1WITA 5BQ7A 4PTUB 1NUFA 3MREB 4AEFA 4O51A 1RIVH 5D1QD 2EYTA 4KRPC 2OI9C 4TSCH 2BXZA 1R3IL 4CN6A 2XZZA 4Z7QE 1NEUA 4L9LC 2OJZH 2FCBA 3KLAB 5HYSG 1Q94A 2NY4B 1EO8L 2C3GA 4MA1B 4PJEB 3BO8B 4LCYA 5D7IA 3HAEA 4F2MB 2X70B 5TDNA 4EJ1C 5IG7B 5EZJA 4H5SA 4Z7VB 3QUXD 4AMKL 4M1CC 1S9XA 1XF5B 1OW0C 4MD4A 3TBWB 4M7ZB 5HHPA 2D7PA 3VXOB 4LDOB 3JXAA 1HE7A 2YHGA 2IH1B 1I9RH 3HI6L 4ELMB 5GGUB 2NY4C 3PNWA 4X6CE 2BRRL 4NOBA 3KYKH 1E0OB 4KQ4H 1VFBA 1RQ5A 3PQYE 4OD3L 3K1KC 5T1LB 4JDVB 3MJ7A 5HHNB 4KRNA 1U8LA 2BNQA 1CL7I 1JNNH 3UTSA 1GH7A 5IW6A 1NCAH 3B6SA 3KPMB 4TUOB 4UBDC 5I8KH 3NACL 4NO0B 2HJFA 4FG6D 3O6KH 3FT2B 3V5HB 1TXKA 3WNNA 1BZQK 4G8GD 1MH5A 1FL5B 1K6QL 1KLGB 2G5BA 4BZ2H 3A67L 1T1WA 4QRRB 3QEHB 1BFTA 4GSDH 1PLGH 1KB9J 3GJFK 3FN3A 1TTGA 3EJYC 1XIWB 4J1UA 4JPWL 1JGUL 2N7BA 4HF5H 3HB3D 1F90L 1FGVL 2HVKB 1MFDH 1A3LL 3OXRB 2B0SH 3DV6A 3WEXA 3VE0A 4F9PA 4HCRL 2YPLD 4CW1B 1I7ZA 1CLYH 1NLDH 4AEHL 2VLKA 5A3ID 1DLFL 5E08H 1YUHB 1H3PL 5KVMC 3ZKND 5HY9A 4YFLI 3O4LA 5IOPB 5E5UB 5CHNB 3S5LB 1XIWC 4FQHA 4YIQB 2G60H 4UTBL 5ESQB 1F3JA 3SOBH 3LZFL 3GJEA 3ULVF 3O2VL 2OXGA 4UV7L 3OGCB 4JDZA 4DAGH 2BZDA 4CVUA 3QBTB 1FNGB 3RBSA 1KULA 5ALBH 5FYLL 5EU6D 5F96H 1ZA3A 2KDGA 1CFBA 5DMKB 4AEIL 3LPWA 4HK0B 4MHHI 2VXQH 1ONQB 4RISL 1ZLSH 1BD2D 4L3CA 3H0TA 3S98A 5HGHB 3U7AA 3VCLB 1IAII 4GJTB 2YWYA 5K9JL 3B2UD 1B3JA 4H25B 2KL6A 5JOPD 4OFIA 3ZE2E 4MNQB 4PJDB 3WHE0 1OP3H 2YD1A 2A6IA 1WV7T 4YBHA 1ZK9A 1X6NA 4KKAC 4PV8A 4ENED 5AD0A 3BP5B 1KIPB 5F9AC 2BY3A 1IKFH 3MO1B 4Y16B 3T4AB 2YR3A 4LEOB 4K3HA 4XX1E 4PJFB 1UWGL 3MRDA 1ZTXH 1M71B 1WFTA 1OP5K 3RVTD 1KYOK 5EZLA 4P2OA 1FZKA 3RZWA 3L95A 1VERA 2ZUXA 5I74B 5SWZB 4BH8B 4P46D 3FT3A 4ZD3L 4NQDD 5HDOA 1CLCA 1FVCB 4Y16C 4JRWA 1R24A 4XXCA 3SDAD 4JFEE 5F7DB 2R9HD 1FYTD 3QXAB 2HLAA 1VACA 1IM9B 1HWHB 2XKUA 1DSFH 3PHOB 3ZT6A 4KMLB 2ZJSH 2CDGA 5EU4B 4IRJD 3T0XA 1JUFA 5CSZA 2FSEB 3V6ZA 1QFUL 4ZPVB 1YEGL 1I7RA 1QNZH 4BQCA 1KEGH 4LP4A 4PUBH 3OQ3B 5DC0A 1PSKL 1KC5H 5D1ZB 1WQVT 4IHOA 4Z77A 3P9LA 5FXCH 3G5XB 4DVBA 4RGNB 1KXVC 5DT1L 2C1OB 3NCJL 3L3DB 5C0JB 3BDXA 2RAMA 3QNZB 5IR1B 4GG6F 1J87A 1NH6A 4C54A 1UH4A 3PABA 4ZTOH 1IAIL 3ULUE 1AKJD 2VDNH 4XP5L 3IVKA 3D2UD 5L2KA 5D7IE 4UU9A 3FQWA 1OTTC 3QG6B 4KRLB 5ADOH 3GK8L 5FYJE 4H1LH 2YD9A 5EBLB 1IC1A 5FYJH 3V0WH 3QUMH 1HYSC 3DX9B 3O45A 1I7UA 2ZG3A 2XZAL 4LRNH 1IC5L 4OF5A 5IV2A 4JQIL 1DQMH 2R29H 4JY4A 3L3HA 1JWMB 3HI5L 4YHMH 3QWOB 2I24N 3FT4A 5GQBA 5E2TL 4FQIL 1GC1C 3FQRA 5DDHA 3LV3B 4Q58C 4Y5YA 1JZ3A 5ESAA 2BNQE 4OGYL 1T4KB 3HNVL 3UTSE 5KSUB 5E9DD 3ZKXB 1U8NA 5LAXA 1K8IB 2WIMA 1ZLWH 4R97C 3ZTJH 2OXHA 5I1JL 5IFJB 3MV7B 5ILTL 5FO9B 1R3LA 1A6UH 1SEBB 1BZ9A 1NCDH 3KJ6L 3CFKA 4QTIH 5IVXB 5HPMA 1Z0NA 1RZIB 1Q9LB 3C9NA 1KLUB 3SE3A 4KJWD 5GRUL 4OLEA 1AGDB 1NGZA 2FEEI 2ZUQC 4K3JH 4PJ9B 1IM3B 5B21A 2SEBA 3ZKXC 4ZFOL 5C6TL 3H9SD 4WI6A 4ONHA 3H3PL 4AEEA 4CMMA 5BMFH 4YO0A 2BJMH 4NCDA 1Z3GH 2F53A 4F58H 4LSVH 3MLWH 4U1MA 4DGYL 1FIGH 3QDGA 1T0NA 2ICCA 4YHZL 3ARBA 2NLJA 5EIIA 2VLKE 3IDIA 3MRIA 4N8CL 3AREA 4U6YA 3PHQA 4A6YL 5DYOB 3DVFA 2IANE 5JIPA 1E6JL 4PJ9C 1RIUL 3QO0B 2VSDA 1A1MB 1ZT4A 2OR7A 4CVZB 1KB5H 3A6BH 1A5FL 4ZUSB 1H3XA 3ZKMD 4LCWA 3HTLX 4TUJA 4YDKH 4D9RE 4HUUB 5I18H 3FO2B 32C2B 3QAZB 2NY6B 1MJJA 2A6DB 2F58H 1KT2A 2NXZB 5JHLH 2A77L 2D0HA 1G7MA 3PGCB 4YXKH 4DN4H 2Y06L 3S97C 2E7LC 5DJ8B 3J8F7 5FHAH 3UAJC 5HI5C 3MLZH 4ZG1A 5J12B 3SDCB 1LVEA 1QEWA 1A6PA 1HH9A 1RUPL 3DSFL 4MHHG 3QO1B 3WIFA 3QAZC 3LRGA 3WXVH 2NY6C 3TNMB 4OQTA 3H8NA 3OKNA 1UYWL 3BZ4A 1CFTA 3E0GA 3N50A 4X9HA 4JHAL 3PDDA 5HHOB 2K7PA 3ARGB 4CRPA 1HSAA 5ETUB 5J12C 2FEEL 3T4YB 2NZ9C 2F54B 2NW2A 1VESA 1YNKL 4R2GD 5GJSH 1PX4A 1C5DA 1MLBA 5F7EL 4HQQL 3VW3H 4MCYA 4XGZB 3CFBB 2DM2A 2VDKL 3TT1L 3JBG7 2QR0B 5EC1A 4LU5H 1KCVL 2IMMA 2C3WA 5H94A 25C8L 3T04D 3D3VE 5C0AD 5F3HA 4AIZB 4I8DA 3OPZL 4W4OA 1ZWIA 5J6GB 1FN4A 4RFOL 1JTPA 1LO5A 5JHDA 1HI6B 4Q0XH 1Z5LA 3R4DA 3PL6C 5ERWA 2B4CH 3BIKA 5D8JH 3MBXL 3VWJA 2FD6L 2H1PL 3RKPA 2GQHA 35C8L 4WW2A 5DTFB 2BOCB 5FA3B 5ELIA 1MCWW 5A2KH 5E8PB 1FL3B 3U1SL 3MLRL 1EFXA 2LAGB 4TYUA 5L2KE 2HFFB 4PBXA 3HC0A 5ID0A 1KJ3L 1YY9D 4BA8A 4NO5B 4KQ3H 1S9WB 2FYYA 4OI9A 2HVJA 3C8KB 3UXFA 4MJIE 4JM4H 1FG2B 5HYQB 2JIXB 3S88L 3KAAA 2XV6B 4BZ1L 3OAZK 2V5RA 3S8WA 1MI5A 3STBA 4U6HB 2NY7L 2Y36H 1AHWA 5AG9A 1LP9F 4G6AD 3AS3A 3JWOC 1K85A 2WWKO 4IOIB 1G9NC 1X7QB 5CCKH 1D9KD 3MUGB 5L7XL 2CK0L 5FO7B 2F8OA 4M6OH 3LN5A 1NCBH 1IGCL 3WD5L 3NFNB 5FM4A 4S1SL 2AJZA 5DUPL 4HLZG 1BGXH 4CU8A 2HJKB 3BKYL 1I9IL 2ADFL 4NKOA 4YXHH 5GRJL 5LXGH 2Y25A 4EI5B 3FB5A 4AYFA 2EXWD 3LSOB 1IGJA 4NKMB 4PS4H 5HGDA 1RJLB 2QADB 4HJJL 4XNMA 4PP2A 2YEZA 3B2VH 3OV6A 1QFPA 1EEZB 2VDRL 2XN9D 4XVSH 4GQ9H 3SY0B 1BPVA 1FV1A 1HXYA 3MOAL 4WU5B 1WLHA 2F53E 1BIIA 4PRAB 1AXSB 5ICZA 4JRXD 1JWSA 4DUWA 4WU7B 1YC7A 4MQ7B 2RFXB 4X7FC 5GHWL 4L29B 2C3VA 1NANH 1F5WA 2KZWA 2QADC 3HKFA 4LSPL 5IMKA 3RVUD 1LK2A 4JPKL 1Q72H 5HJ3B 3TVMD 5BV7C 3OHXB 4NM4H 4PJIA 5MI0B 3ARQA 1OWRM 1BQHB 4LIQE 3PWUB 3LHPL 4JY5L 4LIQH 1W0YT 3TV3H 3U7WH 4RAHA 1BZ7A 2VLLB 5SV4A 4KV5F 3GI9H 4N5UA 4P3DB 1IL1A 4LCWE 3INUH 5I75C 4F7CA 1R3HB 3EDKA 5HSFA 1J12A 4KJYB 5EN2A 3UYRL 3DPBA 4E0RB 3GSNL 3O9WB 2DLEA 1S7VA 2ZSVB 1ITBB 1HH6B 1XF2A 1RU9L 4W4NA 4KHTH 2DAVA 3EAKA 1B0RB 4JO4L 3GSWB 1ZLVH 4S1QL 5DVLA 4OCMC 4HZAA 5AZEL 5IHUH 3SBWA 3IFLH 2A74A 3HC4H 3JTSA 3DRTB 5E5MA 1HKFA 4M6MH 3U0TA 3M07A 1ND0B 4XPFH 4G6KL 1KJ2A 4WWKD 4HJGA 2MOVA 1U91B 8FABB 3SDYH 4QY8A 5KSAB 2D31A 3QDMB 3O9WC 1IGIH 1MJUL 1OGAB 5SWSB 2HTLC 3SE4C 1UH3A 1WBXA 5D1XB 3S37H 3NZHL 3GKWL 2XTJC 4ZO8A 2Y5TA 3OX8B 5DF0A 2DM3A 2R69H 3DLQR 4MDJB 3GNMH 3VFMB 5KANI 4JAMB 3TBYA 2XRAL 4ODHH 3S34L 3O4OB 1JPTL 5ANMA 1I3UA 4P9ML 1EEUA 2ITDB 4R6UA 2X10A 2PTVA 2ZUUA 1A6WH 2YD7A 4BSJA 1S7SA 4PJAA 3SJVB 3CFDB 5D1XC 5DVMA 4M93B 3BGMB 4B7IA 4HT1H 2EE9A 5CP7A 4P5KB 5E6ID 4U05A 4RA3A 3WS3B 2FX8L 2IALA 4E42A 1KBGH 1W0VA 4YEFA 4RAUB 5H37G 3O4OC 3QUZD 4XHJD 3SN6N 4S0TD 3O2DH 1CVRA 2HP4A 4K07A 3BPOB 3C5ZA 5CP3H 3FMGL 5F6IB 2ZPKH 3VWKB 3DRQA 4HWEH 4N0RA 4HS8H 3VXPB 4ZAKB 3BN9D 3HZVA 3LKQA 5DUBB 4YPGB 3QEGH 4M93C 1IVLA 1SJHB 3MBED 2NX5D 4ZFGL 2IEPA 5HGBB 1B4JL 1HHIB 3CX5K 2IGFL 3UZQA 2H2SD 5E4EC 2FGWH 3FQXA 5A16A 4GRWE 4GW1A 2V2XB 1PYWA 3VXQB 3TIEA 3V5KB 5DHYB 3WV0A 3CSPA 1YPZF 1NAML 2BY2A 3MA7B 3DV4A 3CCHA 2FIKB 2YA0A 3TN0D 4ZAKC 5KVGL 4Z0BL 2ZSWA 3R06B 4GBXB 4DEPB 2Z31D 1K2DB 3KNBA 4M7JL 4ZQKB 2V7HB 2O5YL 2X1OA 3MLYH 1MI5E 2BSTB 2GK2A 3MUHL 5D2LA 5FM5M 4HUXB 3SCMC 3B9KD 3IDYB 4CU7A 3DBXB 4N0UB 2DQGH 4I18B 1XGTA 5I1AB 3RDTA 5GIRA 3BMVA 3DX6B 2VDMH 1HNGA 1HSBB 2P8MA 3OGOE 4GBXC 4DEPC 5KW9H 1I1FA 1I8MA 4Y4FA 5B4MC 1DBAL 2QKIB 1EO5A 5DJYB 2DD8L 2J8UF 1XCQA 1L9NA 4F9LA 4I18C 3QCVH 3ETBF 2O5XL 3C8HA 4R4FH 2HWZH 3D39D 3NA9H 2P5ED 5LGHL 4U1IA 3FB6B 1G7LA 4PRIA 4XCFH 4FQXA 1E4KA 1YDPA 3MCLH 4OAWB 1RK1B 3CMOH 5TFSH 1CK0L 4NNXA 2AEWA 1NEZA 2DYPB 3VXTA 2OTPA 4NKQB 3G04A 3GSXB 3L7EA 2BDNL 1GXEA 5D71H 2AXGB 4ORGA 4PJIE 4I9WE 2P8PB 2LQRA 2CO6B 2P8LA 2AJXL 4QRPD 1MUJB 1GPOL 4L4VE 4ELKB 4NPYB 4D0DA 2X41A 3HNSL 1S3KL 2W92A 4JQVA 5IBLC 4PJGF 3EYQD 3NOIA 3B9EA 3S37X 5HBBA 3QG7L 3MRMA 4M62L 4NUJA 2I9TB 2J12B 1CLZH 3OJMB 2VDQL 3DX8A 4Y5VA 2X05A 2HJLB 3ARVA 3O2WL 5IW3A 5TDOA 2AJVH 1X9QA 5C92A 4NJ9L 2EZ0C 4YPJA 2YMXH 4N0CD 5HHME 2W65A 4L8CA 2ZOLA 3D6GA 1AGCB 4KVNL 1A6VH 4I1NB 1WCQA 1AQDA 1QBML 3QIWA 4XCYA 5EOTB 1HXMB 1CBVL 3LQAC 3CXHK 3RAJL 1CU4H 3OJ2C 1J05B 4KUZH 1UWEH 1U8PA 4TRPH 1NCCH 2P45B 1F4XH 3IF1A 3U4EB 1JV5A 3MRNA 1MLCA 2YUVA 3QR2A 4OI7A 4Z6AT 1INQB 2IQ9L 3KS0H 2VC2H 4MXVE 5F9OL 3UTTA 3SBWC 1YN7B 4IMKC 5EBGA 2QQKL 3Q6FA 1NBQA 1UZ6F 4FQCH 3QISA 4EUPA 3O3DA 4XNXL 3MRHB 5F3BA 4UB0L 4WY7L 3KJ4B 1VEPA 2I9LA 3K80A 5KANG 2DMCA 4HIEA 5HVFB 2FB4H 4PJAE 5EUOE 5L9DH 1U8IA 1AGBB 1XF4B 2RR3A 3U7YL 2AQ3A 1TJIL 4I48A 1IBGL 1VEMA 1OAXH 4F7EA 3DMMA 5DD3L 3IJYA 4FZ8L 2XWJA 4C58B 1HHJB 2ED7A 2P46B 3RNKB 2EICA 4OZHA 3QI9B 2Q7YB 4HBCL 4AG4L 3MUJA 2E5EA 4ZO6A 2BSRA 1JCKA 5LCVL 4WI5A 4OLXL 2Y07L 1V3JA 4BFIB 5TE7H 5CD3B 1OCWH 2XA8H 2EC8A 3KPSB 3CUPA 5DZNA 3FO9A 5E2WH 2D7TH 2P5WD 1TQCC 5GZNC 2UWEF 4LKCA 4G5ZH 3RVVD 2Q76B 1N64H 3QI9C 2GY5A 3ZYZA 2DMKA 4J6RH 3TYGH 3V95A 1D5IH 2FNBA 4ZPTA 2H9GB 2A83A 2DQUL 3RWGA 3X3FL 3PV6A 2RCSL 4J4PC 4HS6A 4P3CL 4OZIF 4Y4KB 5DI8B 6FABH 2BHZA 3GMRB 5D2LE 4NT6A 3V52L 3PWJB 2ORBH 4NFCA 4I77L 4MCZB 1AD9B 4FQ2L 4OCYH 1EJ6A 2A1WL 2EDBA 2D03L 2BVEA 3RA7H 2Z9TA 4DN3L 5CEYB 4EOWH 4K8RD 4OCRL 1T80A 4L4TB 3TJEH 1MNUH 1IGMH 3BIAX 4XP4L 1S7WA 2WNGA 4ZXBB 2GFBA 1Q0YL 3VGEA 1S78C 2FR4A 1C5CH 5J4MA 1H3VA 4Y4KC 3RGVA 3NTCH 4UQ2A 4Y19A 1MCQA 1UVQB 1QA9A 2GEEA 2EH7H 4C56D 1R3JB 2VRAA 3K3QA 4P5TA 5IMMB 3LAFA 5E8OB 4C59B 3WL9A 3MLXH 3K7UA 4ZXBC 3S4SG 5J0BA 3C08H 3T8XA 1Q9OB 4PRIE 1MCRA 1D5MA 1QFWI 1MVUA 4XNQB 4HUKB 4LQFL 1S5HA 2ADIB 2JJVA 4P57B 3PIQB 3MQIA 1LDPL 5DA4A 5CZVH 3LS5H 5EBMB 4MD5B 2FO1A 3VXRD 2AABH 3HNTL 5EG6C 1SM3H 4HH9B 3VFRA 4F9LC 1F4YL 4I0PB 1FG9C 4Z78A 4ZFFA 1OP3K 1P4LB 4FABH 4PJHF 4F80A 3BKCL 2JCCB 4N1CA 4P2QB 4WDIA 5FK9A 4YHLL 5KVFL 3OB0H 1PY9A 3EYUH 3RBGA 1HZHH 3HFMH 3P4MA 5T1KD 3RTQD 2QQLL 3VD7A 2VDOH 3KXFB 4KI5C 1AFVL 2MCPH 3QQ3A 2Q7NA 4NRXA 1U41A 2CUHA 3O6FD 3QUKA 5I30L 4JFDA 2GSIB 4C57C 2ADGB 1TCRB 5KOMC 3NABL 5ITFB 3NPSB 2J8HA 1F02I 4MGXA 3G9AB 3BPCA 4NUGH 4P4RB 4PRPD 2V2TB 1TETH 3H3KA 2X9YA 1AO7A 3OKEB 1RSFA 4KWUA 1UCTA 2VE6B 2Q8AH 4YFEA 1NDMA 1IEBA 4FHBD 3FN9A 4U6XA 3BH8A 4AK1A 3EYSL 3WNLA 4YDIH 3JWDL 5DRNA 1B4RA 1JN6A 3KPNA 1LE5A 4O4YH 4Q9QL 4NDMA 4H0IA 3UJJH 1U92A 4PJ7F 5DQ9A 4NZUH 3UTTE 3OKMB 4NZTH 5LKNA 1KGCE 2RHEA 3X14A 4JFFD 2WW8A 1QFWL 5ITBL 1T89C 3GSVB 4EZMA 2VR5A 3L3KB 1SEQH 3CPLB 1AD0A 4WFED 3MX0A 3NAAH 1G0XA 1LEKB 1FC2D 1G7QB 1RVFH 3F58H 1S9VB 5KVEH 3O8XA 1I1CA 5DK2A 4X6FB 3E2HB 3TA3A 4YHNA 3LEYL 5DJ6A 1N0XH 4XCEB 3ZMRA 5IESH 5LVEA 3BKML 2AEQL 3BWAA 3PP4L 5CILL 1GZPA 1G7PB 4L3EB 5IHLB 1HHKB 4UIMB 5HYSA 4LMQE 4YQXL 3RIFF 4Q2ZA 3FCTA 2DBLH 1FNEB 2X4PB 1ORSA 5MHSE 4KRPD 4ZUVA 4JZNA 3TZVA 4E41D 4AZ8A 2DRUA 3QRFM 1BVLA 4Z7WF 3P73A 1J9CT 2MQ3A 2AGJH 4OLYL 1OD9A 3UO1L 2EKSB 3BHBB 3UJIL 2A0LC 5I1EL 4WI7A 3CDGA 3P0GB 4QEGA 4N0FA 4K7PL 2ATPA 3IDNA 1MQKL 1YMHB 1MHCA 2VABB 3IFOA 4M1CD 3QCTH 1L7TH 3GHBH 3G6AA 3VGBA 4HIXH 3THMH 4PJXA 3VD4A 4ZOBA 5C8JB 1KPVB 5LBSL 1Q0XH 5IF0B 5IB1A 1I4FB 3PGFL 3WXWL 2GT9A 5C0FB 5CKAA 3TIDA 2NY4D 2ZKHH 3IDMB 4GAGH 1SJEA 1ZHLA 3BT2L 3OKDA 4KZDH 3FTGA 3MJ9L 3DJ9A 3QEQA 1ORQB 3BP6B 1WBYA 5D7JA 3WE6B 4Y19E 2OL3A 5TE4L 3CXDL 1KLFA 2BHUA 3BQUA 1TZGH 4HFWA 2X4OA 4NZRL 2X7LB 1B6DA 3VFNA 1PKOA 2R0KH 1UJ3A 3QHFH 3ES6A 3X11B 3WFCH 3QRGH 4YR6A 1PQZA 3BE1H 2E7MA 3L3IA 1P1ZB 5T1LD 1JNHA 4NWTL 3I2CH 4WFFE 3GDBA 4MJ5A 5KJRL 1EIBA 3MR9A 3EJYD 2FJFA 3NIDE 1OLZA 3RGVC 3RWHA 1M7DA 4K23L 4X6CB 3HR5B 1S8DB 4Y1AA 4P9HH 3C8DA 1XCTB 3PQYB 4ZS6D 1BEYL 4LPUA 3DHJA 5L88L 3ILPA 1OAUH 1MY5A 1IC7H 5F7YC 2G2RB 4WTZG 4HWZB 1S7QB 4QRRD 5LGJA 2EDEA 5F71A 4XMKH 1EVTC 3L5IA 3ORJA 1A1OB 4N9GB 4LLQB 2E6JA 2OJEB 1KELL 4G9FA 5DJAA 1CICB 1XIWD 1UB6B 5DR5L 1TVDA 3ZDZF 5FUCE 1MF2H 4JY6B 4YUEL 3HC3L 4JFDE 7FABL 5C70A 1ZAGA 4X7SL 2P7TA 2XY2A 5BVPL 1NLBL 2VH5L 3EDDA 1IT9L 4TPRH 4X9GA 4ZFZA 3RL1B 1RUAH 3W0WA 4FQ1H 5AEAA 1OP9A 4I3SL 4QGTA 1AO7E 5ACZA 1CICC 3HZYA 2BVQA 3UPAA 2F5AH 2I27N 3HS0B 1CDJA 5JW5A 2DLIA 1KIRB 4NN5C 5DJ0B 3KPOB 4KKNA 4L8DA 2CDFA 4W81A 5CJOH 1YNTB 2CUMA 4KKAD 1JFQH 3IXTB 1DTUA 4CJ0A 2DIBA 1TDQA 5TF0A 4YBLC 3PGDA 3I85A 4XCCH 1S9YA 4ODTH 1OAQL 3GGWB 5I2IA 1MCBA 1AY1L 3HLAB 5H8DA 1AIFA 5LWYL 4WUKH 3VH8G 1ED3A 2ZNWA 4GFTB 4EI6B 5JORB 1T5XB 1PJ9A 1T7VA 1CE6B 4MNQD 3DXAE 4PLJD 3KG5A 5ALCL 4MB3A 4WEBH 2XY1A 5F1NB 5HHXL 5FDWA 4TSBL 3LQZA 2O5ZL 1HQ4B 2XZCL 4Y16D 3QPQD 1OTUD 5B38G 2X4RA 2ZUSA 5MEQB 3SDDA 2VISB 4ZUWB 1AQKL 3SKNA 3V4VH 4PGEA 2R4SL 4TVPE 2HT2C 5SWZD 4Z7NF 3JV4B 3P0YL 3AM8A 4HCRA 1DVFB 4HS3B 1G9ML 4CNIA 3T0EA 5KTEH 4XPGH 1N0LA 3CFEB 1MFCH 5FKPA 1MRFH 3H9HA 4QHLB 3IS1X 3RHWF 2YC1A 3EZ8A 1N2RB 1MCLA 4N8PA 2V7NA 4KXZH 1OB1B 2B1AL 2HRPH 4OD2A 3ZDXE 3RKDC 3WFHA 3MMEA 2AK4A 2DWDA 4J3UA 1A7PH 4OZ4A 4JFEB 4TTDC 2C3HA 2ESVA 1F8TL 1R5VA 4Q97A 1OTTD 1DVFC 5E8EB 3IDJA 1X5LA 4GKZA 5D6DC 5D1ZD 3MRLB 1RIHL 1T1ZB 5E1AB 4RGND 4PJXE 2CKBL 4HUMB 4ESKA 4JRYA 2AEPH 4J3SA 3S3SA 4LSTH 4UTAL 5F9JA 4DZ8B 1JNLH 1JPFB 2EYTB 4R3SA 1JZ2A 1JPGB 3NIFE 2H8PB 3WJJA 3QEQE 5J1SC 5D70H 1FAIH 3PWPB 3S36H 4ZDHB 3VGDA 2BHYA 1MRCL 1KN2L 4JM2B 4LCYB 3MJGX 1MCOL 2GTWB 1M05A 5CLWA 1J1OL 1RUKH 3L5WB 1IAKA 2VL4A 1XH3B 4H1LB 3AS2A 3QUMB 3HA0A 1PEWA 1NC2A 1FO0H 3ZZ1A 5HHPB 4PP1C 2IFFH 4NJAL 5MERA 1QSEB 3RUGE 1FJ1A 3VMOA 1B0GA 5D7JC 3ZYIA 4Y1AE 1JWUA 3BQUC 5DJCB 1VFBB 1IFHH 5HYIA 3SQBA 3MV7D 3MJ7B 5JA8B 4MSWA 1A7NL 2I07A 5DEFB 3W39B 3UTSB 3BW9A 1NGXA 1CR9H 5FCUH 2XPGB 3TBSB 2A9NL 3L3OB 5GGTH 5KSBE 3QHZH 1NFDF 4UOW0 4X4MA 1CFNB 4G9FE 4I5BA 4PJ9D 4JKLA 3KDMA 1PEZA 3G5ZB 1TQBC 4PRDB 1HILA 2NY2B 1C12B 4HBQA 5IBUG 1MCPL 1TNNA 2HN7B 5FECB 1CFQB 3NGBB 1CFSA 4D0BB 1R3IH 4Z7UA 4Z0XB 4M03A 5FKAB 4KZEL 3I02A 4YFLF 3U6RA 2YBRB 1SY6L 5DSCA 5HDBE 3W0WE 1EO8H 3WEXB 1P7QB 4HSQA 4X5WA 3D85D 3QFDA 3EJZC 4PLNC 2DOCA 2NY2C 4CU6A 5DRWB 3F62A 4AMKH 2XTLA 3NGBC 3QULB 2IANB 4CL7A 1K9TA 4LL9A 3ULVC 2C4XA 1KB5B 3T08A 3T3PF 2NY6D 4YZFE 1NMBL 4WI3A 3QA3B 3GJEB 4RDQF 2NXZD 3HI6H 2BRRH 5D2NB 3IDUA 4AH2A 2RBLA 4NNYB 4OD3H 3E8UL 3RWFA 3WLWC 3SDCD 2NZ9D 1ZA3B 2PF6A 3W82A 3GB7A 4HXBL 3NACH 3F7RA 3F12A 2X4SA 4R4ND 5IBTL 4HKJA 4MAYC 3KGRA 3QEUA 5E8NB 1K6QH 1HHHA 3A67H 5D2NC 5FOJA 2GUOA 5HHOD 4NOFA 3ARGD 4FN0A 4H26B 4XI5D 2F54D 4ZFOA 5E6YA 4U1GC 4JPWH 5KZCB 4KK9D 4PV8B 4HHAA 1JGUH 1MAML 5GSVA 1F90H 1FGVH 1KTDA 1A3LH 2LFGA 1F6AB 3ARYA 3G6JA 4OD1L 4PREA 3ZDYF 4HCRH 1ACYL 4XC3L 4P49A 3S3JA 3T0EE 4AEHH 4P2OB 1DLFH 1J11A 3JWNC 1W0WB 1H3PH 4A6YA 1UCBL 5IWLC 4OCXL 5D1QA 5D5MA 3PJSA 3MLUL 4HLJA 1U9KA 1WUNT 4UTBH 1T66C 4QHMB 5I76B 2AK4E 3SDDC 3D3VB 4GG6B 3LZFH 4P2RE 1KTRL 3O2VH 5C0EB 1ULVA 2ESVE 2JK5A 4UV7H 3HUJF 2AJSL 3T0VA 3U9PL 5FYLE 2CDGB 1EGJL 1JUFB 5CSZB 1U8HB 5FYLH 5HGAA 5E00B 4F37K 1WIPA 3WKNA 5C1MB 3ET9F 4KKCC 4AEIH 4LHUB 3VXUA 4JRYE 2PYEA 4XBEL 4RISH 4POZC 3VGGA 1BQLL 4HIJA 4BFEA 3GM0A 1EHNA 1RAMA 1ZT1A 3V0AC 4F33A 1RZGB 5K9JH 5B3JE 4H8WC 3BISA 1OGTB 5JPNA 2X4TA 5DJXA 2DBJA 4XTRD 4XXDA 1OWWA 3PABB 5GSRB 3DROA 4PG9A 1JYXA 1NUNB 5IIEA 1UM4L 2JIXD 4NO2A 4UU9B 3FQWB 3REVA 4NHUA 1TTFA 4JFXB 4DFIA 3C5SB 1UWGH 1WSST 3DETC 4MJIB 4ELMF 1I7UB 2Z91A 4G8GA 2CKNA 2Y23A 5JIIA 3QNYB 5GRZA 4JY4B 3WNKA 3FT4B 5BO1L 4ZD3H 3RX8A 1A7QL 2FJGA 1MFBL 2Y4SA 4TNWK 1A9EB 4X4XA 4GO6B 2X4UA 4Y5YB 3QIBC 4GAYA 5ESAB 3AU1A 4G7VL 4EI5D 1BLNA 1TZIB 2QADD 1BVKA 4X4ME 1R3LB 3W81A 1QFUH 3PWNB