3EW5A

Structure of the tetragonal crystal form of x (adrp) domain from fcov
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
168
structure length
168
Chain Sequence
DLILPFYKAGKVSFYQGDLDVLINFLEPDVLVNAANGDLRHVGGVARAIDVFTGGKLTKRSKEYLKSSKAIAPGNAVLFENVLEHLSVLNAVGPRNGDSRVEGKLCNVYKAIAKCDGKILTPLISVGIFKVKLEVSLQCLLKTVTDRDLNVFVYTDQERVTIENFFNG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the X (ADRP) domain of nsp3 from feline coronavirus
pubmed doi rcsb
source organism Feline infectious peritonitis virus
molecule tags Rna binding protein
molecule keywords macro domain of Non-structural protein 3
total genus 48
structure length 168
sequence length 168
chains with identical sequence B, C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ew5A00
4R7MA 2EEEA 3GPGA 4J5SA 4ESSA 4GUAA 2DX6A 1LAMA 5FSVA 2LGRA 3ETIA 4J5RA 2BFRA 3KR5A 4J4ZA 3EWPA 2AFCA 3KQZA 1VHUA 4R6TA 5HIHA 4ZX8A 3IJ3A 3Q71A 4R76A 4D86A 4TU0A 4ZY1A 3Q6ZA 2FAVA 2EWBA 3H8FA 1HJZA 3KZWA 4ZY2A 4ETKA 4ETJA 3H8EA 3EJFA 4ZY0A 3EW5A 3IIFA 5CBMA 4K0CA 3EJGA 3KQXA 2BFQA 5CB3A 4ABLA 3EWQA 5AILA 1ZR3A 3SIJA 2VRIA 4X2TA 1SPVA 5FSZA 3EKEA 5FSYA 5E3BA 3V2BA 3H8GA 2X47A 2XD7A 3V45A 3GQEA 1BPNA 1ZR5A 3IIDA 3PEIA 3GPQA 1YD9A 3EWRA 4JVVA 2FXKA 4KSIA 4KYBA 2ACFA 5D8NA 4IQYA 5FSUA 1BLLE 1BPMA 3GPOA 3JRUA 2J9AA 4J5QA 1TXZA 1NJRA 4UMLA 3SIIA 3GQOA 3EWOA 3JZTA 1LANA 2L8RA 4ZX9A 3SIGA 4JGKA 5FSXA 3VFQA 3SIHA 4JCAA 3T8WA 3KR4A 4ABKA 4GVVA 2FG1A 1TY8A 5HOLA 4GVWA 4ZYQA 1LAPA 1LCPA 4ZI6A 5CMSA 5DUSA 5CB5A 4K3NA 1GYTA 4JLLA
chains in the Genus database with same CATH superfamily
4R7MA 2EEEA 3GPGA 4J5SA 4ESSA 2JZEA 4GUAA 2KQVA 2DX6A 1LAMA 5FSVA 2JZDA 2LGRA 3ETIA 4J5RA 2BFRA 3KR5A 4J4ZA 3EWPA 2AFCA 3KQZA 1VHUA 4R6TA 5HIHA 4ZX8A 3IJ3A 3Q71A 4R76A 4D86A 4TU0A 4ZY1A 3Q6ZA 2FAVA 2EWBA 3H8FA 1HJZA 3KZWA 4ZY2A 2JZFA 4ETKA 4ETJA 3H8EA 3EJFA 4ZY0A 3EW5A 3IIFA 5CBMA 4K0CA 3EJGA 3KQXA 2BFQA 5CB3A 4ABLA 3EWQA 5AILA 1ZR3A 3SIJA 2VRIA 4X2TA 1SPVA 2RNKA 5FSZA 3EKEA 5FSYA 5E3BA 3V2BA 3H8GA 2X47A 2XD7A 3V45A 3GQEA 1BPNA 1ZR5A 3IIDA 3PEIA 3GPQA 1YD9A 3EWRA 4JVVA 2FXKA 4KSIA 4KYBA 2ACFA 5D8NA 4IQYA 5FSUA 1BLLE 1BPMA 3GPOA 3JRUA 2J9AA 4J5QA 1TXZA 1NJRA 4UMLA 2W2GA 2WCTA 3SIIA 3GQOA 3EWOA 3JZTA 1LANA 2L8RA 4ZX9A 3SIGA 4JGKA 5FSXA 3VFQA 3SIHA 4JCAA 3T8WA 3KR4A 4ABKA 4GVVA 2FG1A 1TY8A 5HOLA 4GVWA 4ZYQA 1LAPA 1LCPA 4ZI6A 5CMSA 5DUSA 5CB5A 4K3NA 1GYTA 4JLLA
chains in the Genus database with same CATH topology
4R7MA 2EEEA 3GPGA 4J5SA 4ESSA 4GUAA 2DX6A 1LAMA 5FSVA 2LGRA 3ETIA 4J5RA 2BFRA 3KR5A 4J4ZA 3EWPA 2AFCA 3KQZA 1VHUA 4R6TA 5HIHA 4ZX8A 3IJ3A 3Q71A 4R76A 4D86A 4TU0A 4ZY1A 3Q6ZA 2FAVA 2EWBA 3H8FA 1HJZA 3KZWA 4ZY2A 4ETKA 4ETJA 3H8EA 3EJFA 4ZY0A 3EW5A 3IIFA 5CBMA 4K0CA 3EJGA 3KQXA 2BFQA 5CB3A 4ABLA 3EWQA 5AILA 1ZR3A 3SIJA 2VRIA 4X2TA 1SPVA 5FSZA 3EKEA 5FSYA 5E3BA 3V2BA 3H8GA 2X47A 2XD7A 3V45A 3GQEA 1BPNA 1ZR5A 3IIDA 3PEIA 3GPQA 1YD9A 3EWRA 4JVVA 2FXKA 4KSIA 4KYBA 2ACFA 5D8NA 4IQYA 5FSUA 1BLLE 1BPMA 3GPOA 3JRUA 2J9AA 4J5QA 1TXZA 1NJRA 4UMLA 3SIIA 3GQOA 3EWOA 3JZTA 1LANA 2L8RA 4ZX9A 3SIGA 4JGKA 5FSXA 3VFQA 3SIHA 4JCAA 3T8WA 3KR4A 4ABKA 4GVVA 2FG1A 1TY8A 5HOLA 4GVWA 4ZYQA 1LAPA 1LCPA 4ZI6A 5CMSA 5DUSA 5CB5A 4K3NA 1GYTA 4JLLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7M A;  2EEE A;  3GPG A;  4J5S A;  4ESS A;  4GUA A;  2DX6 A;  1LAM A;  5FSV A;  2LGR A;  3ETI A;  4J5R A;  2BFR A;  3KR5 A;  4J4Z A;  3EWP A;  2AFC A;  3KQZ A;  1VHU A;  4R6T A;  5HIH A;  4ZX8 A;  3IJ3 A;  3Q71 A;  4R76 A;  4D86 A;  4TU0 A;  4ZY1 A;  3Q6Z A;  2FAV A;  2EWB A;  3H8F A;  1HJZ A;  3KZW A;  4ZY2 A;  4ETK A;  4ETJ A;  3H8E A;  3EJF A;  4ZY0 A;  3EW5 A;  3IIF A;  5CBM A;  4K0C A;  3EJG A;  3KQX A;  2BFQ A;  5CB3 A;  4ABL A;  3EWQ A;  5AIL A;  1ZR3 A;  3SIJ A;  2VRI A;  4X2T A;  1SPV A;  5FSZ A;  3EKE A;  5FSY A;  5E3B A;  3V2B A;  3H8G A;  2X47 A;  2XD7 A;  3V45 A;  3GQE A;  1BPN A;  1ZR5 A;  3IID A;  3PEI A;  3GPQ A;  1YD9 A;  3EWR A;  4JVV A;  2FXK A;  4KSI A;  4KYB A;  2ACF A;  5D8N A;  4IQY A;  5FSU A;  1BLL E;  1BPM A;  3GPO A;  3JRU A;  2J9A A;  4J5Q A;  1TXZ A;  1NJR A;  4UML A;  3SII A;  3GQO A;  3EWO A;  3JZT A;  1LAN A;  2L8R A;  4ZX9 A;  3SIG A;  4JGK A;  5FSX A;  3VFQ A;  3SIH A;  4JCA A;  3T8W A;  3KR4 A;  4ABK A;  4GVV A;  2FG1 A;  1TY8 A;  5HOL A;  4GVW A;  4ZYQ A;  1LAP A;  1LCP A;  4ZI6 A;  5CMS A;  5DUS A;  5CB5 A;  4K3N A;  1GYT A;  4JLL A; 
#chains in the Genus database with same CATH topology
 4R7M A;  2EEE A;  3GPG A;  4J5S A;  4ESS A;  2JZE A;  4GUA A;  2KQV A;  2DX6 A;  1LAM A;  5FSV A;  2JZD A;  2LGR A;  3ETI A;  4J5R A;  2BFR A;  3KR5 A;  4J4Z A;  3EWP A;  2AFC A;  3KQZ A;  1VHU A;  4R6T A;  5HIH A;  4ZX8 A;  3IJ3 A;  3Q71 A;  4R76 A;  4D86 A;  4TU0 A;  4ZY1 A;  3Q6Z A;  2FAV A;  2EWB A;  3H8F A;  1HJZ A;  3KZW A;  4ZY2 A;  2JZF A;  4ETK A;  4ETJ A;  3H8E A;  3EJF A;  4ZY0 A;  3EW5 A;  3IIF A;  5CBM A;  4K0C A;  3EJG A;  3KQX A;  2BFQ A;  5CB3 A;  4ABL A;  3EWQ A;  5AIL A;  1ZR3 A;  3SIJ A;  2VRI A;  4X2T A;  1SPV A;  2RNK A;  5FSZ A;  3EKE A;  5FSY A;  5E3B A;  3V2B A;  3H8G A;  2X47 A;  2XD7 A;  3V45 A;  3GQE A;  1BPN A;  1ZR5 A;  3IID A;  3PEI A;  3GPQ A;  1YD9 A;  3EWR A;  4JVV A;  2FXK A;  4KSI A;  4KYB A;  2ACF A;  5D8N A;  4IQY A;  5FSU A;  1BLL E;  1BPM A;  3GPO A;  3JRU A;  2J9A A;  4J5Q A;  1TXZ A;  1NJR A;  4UML A;  2W2G A;  2WCT A;  3SII A;  3GQO A;  3EWO A;  3JZT A;  1LAN A;  2L8R A;  4ZX9 A;  3SIG A;  4JGK A;  5FSX A;  3VFQ A;  3SIH A;  4JCA A;  3T8W A;  3KR4 A;  4ABK A;  4GVV A;  2FG1 A;  1TY8 A;  5HOL A;  4GVW A;  4ZYQ A;  1LAP A;  1LCP A;  4ZI6 A;  5CMS A;  5DUS A;  5CB5 A;  4K3N A;  1GYT A;  4JLL A; 
#chains in the Genus database with same CATH homology
 4R7M A;  2EEE A;  3GPG A;  4J5S A;  4ESS A;  4GUA A;  2DX6 A;  1LAM A;  5FSV A;  2LGR A;  3ETI A;  4J5R A;  2BFR A;  3KR5 A;  4J4Z A;  3EWP A;  2AFC A;  3KQZ A;  1VHU A;  4R6T A;  5HIH A;  4ZX8 A;  3IJ3 A;  3Q71 A;  4R76 A;  4D86 A;  4TU0 A;  4ZY1 A;  3Q6Z A;  2FAV A;  2EWB A;  3H8F A;  1HJZ A;  3KZW A;  4ZY2 A;  4ETK A;  4ETJ A;  3H8E A;  3EJF A;  4ZY0 A;  3EW5 A;  3IIF A;  5CBM A;  4K0C A;  3EJG A;  3KQX A;  2BFQ A;  5CB3 A;  4ABL A;  3EWQ A;  5AIL A;  1ZR3 A;  3SIJ A;  2VRI A;  4X2T A;  1SPV A;  5FSZ A;  3EKE A;  5FSY A;  5E3B A;  3V2B A;  3H8G A;  2X47 A;  2XD7 A;  3V45 A;  3GQE A;  1BPN A;  1ZR5 A;  3IID A;  3PEI A;  3GPQ A;  1YD9 A;  3EWR A;  4JVV A;  2FXK A;  4KSI A;  4KYB A;  2ACF A;  5D8N A;  4IQY A;  5FSU A;  1BLL E;  1BPM A;  3GPO A;  3JRU A;  2J9A A;  4J5Q A;  1TXZ A;  1NJR A;  4UML A;  3SII A;  3GQO A;  3EWO A;  3JZT A;  1LAN A;  2L8R A;  4ZX9 A;  3SIG A;  4JGK A;  5FSX A;  3VFQ A;  3SIH A;  4JCA A;  3T8W A;  3KR4 A;  4ABK A;  4GVV A;  2FG1 A;  1TY8 A;  5HOL A;  4GVW A;  4ZYQ A;  1LAP A;  1LCP A;  4ZI6 A;  5CMS A;  5DUS A;  5CB5 A;  4K3N A;  1GYT A;  4JLL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...