3EWIA

Structural analysis of the c-terminal domain of murine cmp-sialic acid synthetase
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
157
structure length
157
Chain Sequence
KEIKLLVCNIDGCLTNGHIYVSGDQKEIISYDVKDAIGISLLKKSGIEVRLISERACSKQTLSALKLDCKTEVSVSDKLATVDEWRKEMGLCWKEVAYLGNEVSDEECLKRVGLSAVPADACSGAQKAVGYICKCSGGRGAIREFAEHIFLLIEKVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acylneuraminate cytidylyltransferase
publication title A C-terminal phosphatase module conserved in vertebrate CMP-sialic acid synthetases provides a tetramerization interface for the physiologically active enzyme.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transferase
total genus 60
structure length 157
sequence length 157
chains with identical sequence B
ec nomenclature ec 2.7.7.43: N-acylneuraminate cytidylyltransferase.
pdb deposition date 2008-10-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 3ewiA00
2FUCA 1L8OA 2WF5A 5A3QA 2EATA 4RETA 1LVHA 3NRJA 3WGUA 2WF9A 2YJ4A 3QUCA 2B8JA 2G09A 5AM5A 3M1YA 4EEKA 3SF0A 4Y2JA 3OCYA 3ZTWA 4I9FA 4J2TA 2HF2A 5AVWA 4PNHA 3IJ5A 4UM5A 3KC2A 3FPSA 1KYTA 2FPSA 5AKXA 3U26A 4HGRA 4QQFA 4XQ0A 3CNHA 3A3YA 4KYTA 3EPRA 2Q4RA 1SWWA 4YGYA 5A3SA 3EF1A 3QU2A 2W4MA 2C8KA 1Y8AA 1Z88A 2YJ6A 2B0CA 3MPOA 4UMVA 1RLOA 2P9JA 3P96A 3FVVA 4UARA 2QLTA 4KX5A 3L1UA 1O03A 3NUQA 5AI5A 3UMBA 1YMQA 4CE6A 2O9JA 2D2VA 1QQ6A 3DV9A 3OTQA 1YDFA 1Z5UA 3UMCA 1K1EA 4HGNA 2MU1A 4NV0A 3NAMA 2ZXEA 3CZ4A 1SWVA 3U13A 5ALXA 4DW8A 2ZBFA 5ALLA 2AUTA 1RPZA 3N5KA 4H1WA 4KNVA 4UU0A 4EZEA 3SLRA 3AR7A 1U02A 3F9RA 1U2SA 3MMZA 3J7TA 4EENA 2ODAA 5AKLA 2HDOA 2WF6A 1EK2A 5ALMA 1SU4A 4Y2VA 3HLTA 4BX0A 2G0AA 2JAOA 3I1YA 5ALGA 1NRWA 3OPXA 2YMPA 3QXGA 2RARA 4UAUA 2NYVA 2HF7A 3QYPA 3IRUA 2B8EA 3L0YA 3S6JA 3ZTYA 3A1CA 3QUBA 4OCZA 4OD0A 5AK5A 1VJRA 4UMEA 3U7EB 3QU5A 4XPZA 4BBJA 1Z4LA 1XVIA 5T41A 2IOHA 5ALUA 2G80A 3WKDA 3WK5A 1Q91A 4L6AA 2YBDA 5AM4A 4F72A 3UMGA 3WKCA 3QGMA 3ONNA 3AR3A 4AP9A 3DAOA 3FM9A 3UM9A 4XE5A 2B1RA 4E88A 3RF6A 3WKBA 2ZBDA 3FGOA 2WHEA 4Y2QA 3NALA 5AW5A 1YJ5A 5AIBA 5AVRA 4EELA 3OCZA 1CR6A 3TLMA 3ZVNA 4OFZA 4DCCA 1Q92A 3W5AA 4BYGA 4UATA 1F5SA 2I6XA 4C4SA 3QU7A 2YMQA 3ESQA 3W5DA 1Z4JA 1RQLA 2C88A 5AW6A 2FPXA 3ZU6A 5ALHA 5ALRA 4BEWA 4I9GA 3ZWDA 1T5TA 1TJ4A 3B9BA 3OCVA 5AHXA 4CF5A 3E84A 3WGVA 1J97A 2G06A 4C4TA 1QYIA 1T5SA 5AIAA 4DWOA 1VJ5A 2GO7A 3K1ZA 1NNLA 4JDPA 1Z5GA 5AKIA 5AM0A 2FUEA 4G9BA 1ZJJA 5AM2A 2I34A 1Z4QA 3ET5A 2IOFK 5AKGA 2FPUA 4Y2YA 2X4DA 3ZVLA 1Z4MA 4HGPA 5AW8A 4YCMA 5AVVA 4MUMA 5AW1A 1Z4IA 3PCTA 4JB3A 5AVXA 4J03A 5ALIA 3U7FB 2QYHA 3NANA 3ZWKA 1TE2A 5ALOA 2I55A 2PR7A 5IT4A 3L7YA 3NIWA 3WKEA 5AI4A 5AI8A 1XP5A 3PGLA 4KN8A 1O08A 1RMQA 2HSZA 2C9MA 5AESA 2WFAA 3SMVA 2VKQA 3L0CA 2DQSA 1YNSA 1CQZA 3U7HB 1L7NA 4BKMA 4Y2UA 1RLTA 3L8EA 1WR8A 4KX3A 1X42A 4YCNA 4ZEWA 4Y3UA 4AS3A 5AM1A 3QU4A 3L8FA 2WF8A 2I54A 3QNMA 1ZS9A 3E81A 3QLEA 3I76A 1T9ZA 4O8CA 2AH5A 2CFSA 4F71A 1RQNA 2BDUA 2IA5A 4G63A 3PDWA 1S8OA 4NWIA 1N9KA 1QQ5A 5ALTA 4NABA 2HEGA 5AW0A 5ALJA 2OBBA 5AK6A 3ZUPA 1L8LA 4NFLA 3N07A 5ALEA 4Y2RA 3AR4A 2P11A 4Y2TA 5ALSA 2JAWA 3BWVA 1EK1A 5AVQA 1Z4NA 3L0BA 5AI0A 2R8XA 5AW9A 2OA0A 5AK3A 4HYTA 2C4NA 2WF7A 4UW9A 4L57A 2GMWA 2WM8A 1ZD3A 3AR8A 1WVIA 2NO5A 3SKXA 5AKEA 3HYCA 3N28A 1L7PA 2OYCA 5IT0A 3WK8A 2PQ0A 1S2OA 2YJ3A 3OCWA 5AW4A 4UU1A 1RKVA 3E8MA 2HHLA 4UM7A 5AI6A 5ALVA 4YIHA 3WK9A 4BNDA 3B8EA 5AW3A 2G1AA 5AVYA 1TJ3A 3U7GA 1RC8A 1RMYA 5ALQA 1U2TA 4UASA 1NF2A 3N1UA 5ALFA 4EX7A 4CF3A 1XPJA 2CN1A 3B9RA 2YY6A 3MN1A 4HAIA 5ALYA 4BX3A 5E0OA 1L6RA 2ZBEA 5AICA 1RMTA 1QQ7A 2YMMA 1L7OA 3M9LA 4ZEXA 3VAYA 3WK7A 5AW7A 3MC1A 3KDPA 4BX2A 4FYPA 3KBBA 1PW5A 1QH9A 3U19A 5ALKA 2RBKA 2C8LA 2CFRA 2HCFA 3NASA 2AMYA 2FEAA 1ZD2P 4BEVA 1L7MA 1U7PA 2YN4A 3QUQA 4CNQA 3ESRA 3KOOA 4YH1A 4NAVA 5AI9A 3ZX5A 5AVUA 5A3RA 5ALDA 1U7OA 5IS2A 2AGVA 4DFDA 1Z4PX 2W11A 4UMDA 4Y2SA 3SHQA 3KD3A 2FPRA 3AR9A 4UAVA 5FP0A 3R9KA 3R09A 2GHQA 1YS9A 5AW2A 1RRCA 5AKYA 2IOFA 1RKQA 1VFPA 3EF0A 4KNWA 2G08A 2OM6A 4BNDB 5AKZA 2JARA 2W43A 1ZOLA 2ZOSA 3DNPA 2B1QA 3DDHA 1MH9A 2FPWA 2I7DA 2RB5A 4OHFA 4XOUA 3ZW7A 2HI0A 2CFTA 4GXTA 4ZEVA 4GIBA 3W5CA 2IYEA 3FPBA 2RAVA 2FDRA 2NO4A 4RESA 2GHTA 3QUTA 3A1EA 3WKAA 3I6BA 3R4CA 3IB6A 5AVTA 4EX6A 3L5KA 3ET4A 4HGQA 3WK6A 1WZCA 1TJ5A 3D6JA 2O2XA 1Z4KA 2R8EA 5ALZA 3GYGA 4YIKA 5ALPA 3FZQA 1J8DA 5AK4A 1WPGA 2GFHA 4QJBA 2HX1A 2HO4A 5AVZA 1FEZA 1ZRMA 4CF4A 1LTQA 4L6CA 2B82A 5AM3A 3KZXA 5AKHA 3WK4A 1ZD5A 4Y2XA 2ZBGA 3L8GA 5JJBA 4YCLA 2PKEA 3AR2A 1AQ6A 1IWOA 2BDEA 3EWIA 3QX7A 1RKUA 4B6JA 3E58A 2Q5EA 4IFTA 2YMLA 4AS2A 3AR5A 2P69A 3A1DA 5AKJA 3QU9A 5ALNA 1Z4OA 2B30A 3BA6A 2JGAA 4C4RA 3RFUA 2EAUA 4IG4A 1N8NA 4HGOA 3L1VA 2G07A 3N8GA 1ZRNA 2MSNA 2YFYA 2R8ZA 4UMFA 2ZG6A 1YV9A 2FI1A 3ZI4A 3L8HA 3AR6A 5AKKA 3ZX4A 1RDFA 2P27A 3ZVMA 4FE3A 2HOQA 4FFDA 1JUDA 2EARA 5AVSA 3OCXA 5ALWA 3PGVA 2R8YA 2I33A 3SKYA 1ZD4A 2BY4A 3I28A 4Y2PA 3OCUA 3ED5A 3W5BA 1RLMA 3SD7A 1TA0A 4MWOA 2JAUA 2YJ5A 2Q4TA
chains in the Genus database with same CATH superfamily
5ICEA 2R60A 2LZ0A 2EATA 1UR5A 2VTKA 2Y9PB 4R8LA 4TTIA 4XDYA 4EO4A 1UPXA 3DYVA 4MWSA 1SVOA 1TAHA 4H3SA 5I7HA 2YWXA 4B6EA 1VL5A 3M3HA 3ZTWA 3ADOA 2JFUA 1U3DA 1GNLA 4KLZA 2WQ7A 4TZ6A 5AVWA 3A9CA 3IJ5A 4GPEA 1U1GA 4F7WA 1RC0A 1T29A 1P0PA 3AY3A 1QHFA 1WCWA 3T3IA 2WSLA 3DFZA 1QRRA 4K5QA 4QQFA 1YS1X 2NVWA 2EKDA 2R84A 4RF3A 4UUPA 2AI1A 2B4AA 1SWWA 2H2IA 2QTTA 3B7WA 5A5VA 4OI0A 5LQKA 1UK6A 1JJBA 4JJGA 3EF1A 4WZ6A 1A71A 4PS1A 4P92A 3HLKA 5ILOA 4R7ZA 5TT1A 1XIVA 4YRTA 3I1JA 4ZRDA 4KRGA 2HMTA 1K3TA 2I4RA 3PKIA 3RH0A 4DS3A 5G3ZA 4F4HA 3IJRA 4B3TB 4P22A 2HNKA 2NXWA 4L15A 4DA0A 4W9RA 4ICIA 4KLCA 2JRLA 4IMIB 4MEAA 3S2GA 1P61B 4WLVA 2PKYX 4IHJA 4Z0HO 4ARSA 4WERA 5CIQA 3TYXA 4CU2A 2NZ2A 4DMFA 4BE9A 3C7DB 2ZRGA 3CUWA 2C2BA 4HGNA 4DLPA 4BC1A 1FNMA 1WXGA 4F12A 3H65A 4DCTA 4FFPA 2FLWA 2IRWA 2Q3EA 2XMZA 1PGJA 3E15A 4WFKA 4C4OA 2H1LA 4KXUA 4M8IA 4E5UA 2XLBA 3WL4A 2GILA 1G59A 4M3NA 4MHOA 2BHRA 1D9XA 3HRIA 4RQBA 1C0KA 2BFOA 4OSEA 3CXRA 4EENA 4C2TA 3VO1A 1P7ZA 1FDIA 2PT7A 4Y1FA 1XMPA 3VYWA 1G5TA 1KI8A 5AJYA 2YW2A 4RH0A 6REQB 1K2VN 3DQZA 1AMUA 3LZCA 5G0WA 2H3EA 5HKKA 4O4JA 5C1IA 4ZVLA 3MBOA 5KYGA 3L7NA 2H4HA 2OK7A 4KIGA 3FLEA 5FPYA 7MHTA 5K09A 2VF7A 4WFQA 2J59A 4H7HA 2R8OA 3QYPA 2YXBA 1JZQA 4ARBA 4L8YA 1MU0A 1RNLA 3W5AA 1U7HA 4XX0B 3STTA 4ZO4A 4CIYA 4D26A 2FA9A 4GOXA 1N2JA 2Z4RA 3B1KA 2C3YA 2PRIA 1XTVA 3NDPA 4OA8A 4M55A 4A15A 3HYTA 1KMHB 4WFIA 1G8JA 3UYLA 1G20E 1Q91A 1TW2A 1UFRA 1YKFA 1SVSA 3OIWA 4TSKA 2FAXA 4H15A 3SHFA 4N41A 2E21A 4K05A 3FNQA 4J2HA 3DDNA 2EIXA 2NAFA 2PXHA 1TRHA 1GFZA 2IXGA 2QRVA 3C3CA 1UEXC 4X8MA 4Z49A 5LNK1 4K26A 4DB2A 4LXTA 4L3WA 5IT9A 4RHYA 1PJ3A 4HH0A 3UQZA 3B60A 4C76A 1VCNA 3DFFA 4IXDA 3AHHA 1JSZA 3VR5A 2LUOA 2PX3A 4WSOA 3R7LA 2BJHA 3HB7A 3SEZA 2OV8A 3O4GA 3W5SA 3ZDFA 1HYGA 4DWVA 4HEA1 3T3OA 4FGSA 4ZVQA 5ER9A 1GILA 4WGGA 4DCCA 4I6EA 4OQPA 3PTAA 2V58A 3N2KA 4K28A 2IYXA 2J4DA 3G5LA 4KKXB 3WO0A 2W37A 2BFAA 3QV2A 1FDRA 2GBIA 1E0KA 3DP7A 4PFQA 1XMOB 2YMQA 2CXRA 4PPFA 3HV0A 3IV6A 2DFPA 1W35A 1NJ2A 1OLOA 2VNSA 2EXXA 3AW8A 1XEAA 3ED1A 1C9DB 3D02A 3IIJA 2Q29A 4J3FA 1S3IA 2R6HA 4ZV9A 3V8EA 3GRRA 1I3CA 5EY5B 1TF5A 1LX7A 1YACA 4R8RA 1DCMA 3ELYA 4M86A 2O2SA 1ZISA 1K7FB 1YDEA 1RHUA 2QN3A 4I4NA 4NOLA 3WAJA 2RHHA 3TUIC 5JCJD 1D6SA 5CT9A 2DBQA 4AMUA 1G4UR 2Z3ZA 4KPEC 3KHTA 2XDWA 4HAVA 1YVRA 4XIJA 1DMSA 1JR4A 1QDEA 2HRBA 3BF7A 3NFYA 4D57A 2IIBA 3AVQA 1N5MA 2J5QA 2PTHA 3CF4A 3DB2A 2RHLA 3CE9A 3DHYA 4ZQFA 5H1YA 2H65A 5AJZA 4AG6A 4CCWA 1KQPA 1EP2B 1SQSA 2I34A 2EFHB 3MQ4A 4X1KA 1W73A 4XXHA 3O74A 4HSGA 4TTRA 5TY0A 5CXUA 4HDQB 1NLUA 2PLWA 4D9IA 2QRNA 2FFJA 4GLBA 1VB3A 3RGGA 3BWXA 4MV9A 4PQGA 1X7XB 4CCAA 1H4VB 3WC4A 3P9KA 2GZHA 4Y6GB 4O2AF 5LZ7A 1IHXA 3C14C 1J06A 2B98A 3NHFA 3PCTA 4FXOA 4DADA 3JD0A 3JZDA 4K6FA 3ZLJA 4J7AA 2O8EA 2P7HA 4BRUA 1I0LA 3HE3A 4JT9A 2GUGA 1DIOB 3A4IA 3Q6IA 1GYRA 1RP1A 4OI4A 1OKKA 2YRXA 5DXAA 2GNOA 3DEFA 3L7YA 4AECA 2CCJA 4J2OA 3GA5A 4MRMB 1E69A 1N9ZA 2OCIA 2ZTMA 4GLJA 1YZLA 4O4LB 4XQGA 2A0UA 3PPVA 4BGEA 3I8SA 5K8LA 2Y93A 3C8UA 3R5KA 4RXTA 1CNMA 3A8TA 5KUTA 4Z8YA 5KTRA 4AO8A 1IZ7A 2RSLA 1MZVA 2WFAA 3P9SA 5CPBA 3RAJA 3BSFA 3SMVA 1GKIA 2EFYA 2ET6A 3BTUA 3UT6A 4CW7A 4L02A 1K86A 4FOLA 4WKBA 4X3PA 3VPCA 3CLSC 3AF5A 3SHVA 2AZDA 3HJBA 3CBGA 4Q7KA 3OX3A 1XQWA 1Q5PA 1J0EA 1OHHD 2C83A 2I3AA 3WWEA 3OBBA 4RZXA 4DZRA 5B1YA 4F8EA 3FMPB 2YKGA 4JP8A 4AYTA 3MWGA 1I3NA 1OSNA 5F76A 1XVVA 2E82A 2IXEA 1YZTA 2DH6A 2HSWA 2KMLA 2JGFA 3C5CA 4HDKA 4JLWA 4RM3A 5FNVB 4DDMA 2ZM5A 2HU2A 2D6FA 3EWSA 1PHPA 1M33A 2FEXA 4YRQA 1YFLA 3QXXA 1F1BA 1X8JA 3FN4A 3OZUA 4HMOA 2X0DA 4IEEA 4HDSA 2NPFA 3ZWVA 3TL3A 1ENYA 2XX3A 1YOVA 4PHTA 2V6BA 4LDJA 1B43A 4M1EA 3HXKA 3MAAC 1ITZA 3CZ9A 2W2PA 1QQ5A 3EVBA 3KKPA 3Q7EA 4FFBA 4YCLA 1AMOA 3ZXSA 2X8JA 5AHOA 4JNCA 1IPEA 4D3XA 2H5IA 4DA6A 4YDQA 3FHOA 1BXGA 5F2OA 4NFLA 2Z0MA 4MVWA 4RAQA 1N4AA 4Q39A 1V4VA 4A3SA 3VR4D 3GRZA 1U28A 4X90A 2JAWA 4Y2TA 4ALIA 3RS7A 4TKLA 3RROA 2VWQA 3EPLA 4AQYB 5AVQA 4OK3A 3GRFA 1GG5A 2JGNA 4GDMA 5JHHB 4IWXA 3E9DA 5GOZA 3RI3A 2C31A 3RVQA 3J80A 3CCFA 4OQLA 5FWYB 1QG6A 1RJGA 1CQIB 1SBTA 4R1LA 4KPGA 1VRWA 2ZBPA 2WF7A 4R0VA 1BAPA 4JB8A 4LNAA 3GPBA 2G04A 2C7BA 2Q6KA 4XGNA 4XWTA 4QT4A 2L82A 5IFKA 2OMKA 1K8ZB 1A69A 1DMRA 2VAWA 4TMFA 3GU3A 2QYSA 4TKUB 3M5CA 1P9WA 2A7QA 4FSHA 2GAFA 1E9FA 4EKYA 2WQ6A 3PQ2A 1HUQA 1MC8A 1WB9A 1C7QA 4JMPA 1ATIA 1XEXA 5D7NA 5CA0A 3IV7A 4MVJD 3PT5A 3QLUA 1U1FA 3BREA 4CRWB 5JI2E 3THSA 5BMVF 5KNBD 3H8VA 3SCZA 2BFWA 3SKVA 3C4JA 2H06A 4H7DA 3TBHA 1GYQA 3QFRA 4B3BA 5U1PA 3NH9A 5FFNA 3FPKA 1QH8B 4FYMA 4YMLA 1U2TA 4XD7D 2XE8A 1GGHA 1CBUA 1NF2A 4AULA 2C00A 2O6HA 3MYRA 5AOAA 3QFTA 3AJ9A 3DULA 5A5DA 4HH1A 5ALYA 2YY6A 3DA8A 4D42A 3S7TA 1E94E 1PO7A 4FFNA 1ENOA 2RJOA 4LG1A 5ILGA 1ZSYA 5FUWA 4G1EB 4YQYA 1HX7A 4Y0VA 4YCJA 2HRCA 4G81A 4QUGA 2PMKA 2M98A 3PDIA 4KXWA 3PYXA 1U7ZA 4KFCA 2CJWB 3GVCA 4TYYA 1JPJA 4JCCA 3ML1A 4GOND 3UKOA 1YU9A 3IQZA 1YHZA 4OA5A 4N5IX 5FPQA 4FEGA 3ZXUB 1CF4A 4AKEA 3PHHA 5G4KB 3IMGA 3AM1A 3SQDA 1RCUA 2GVNA 2Q0XA 3HR8A 2G4VA 3K72B 3LT1A 4TM7A 4TV8A 1GADO 2HCFA 2R6GA 1HNWB 3FWKA 3ZQUA 3UAYA 2W6PA 3ZY4A 3KQNA 1JFVA 2WV7A 3A11A 1M34A 2GDZA 5IC6A 4RC9A 3HDYA 4YC7A 4HQNA 4M0EA 4S2EA 5KKAA 3CTMA 1V47A 5IC5A 1T2FA 1B6GA 4B4DA 2QUIA 3N75A 3KZOA 4BKOA 5JSZB 3OQIA 5KJ1A 2XZPA 3JCZA 2O2ZA 1UFKA 4HPXB 1PYGA 3CPJB 4EFNA 4ZT2A 2GCOA 2VVTA 3R9KA 1JDUA 4C0JA 2FF5A 2LWIA 2AMVA 4V0MA 1AHPA 1KFCB 1RU3A 3L7CA 1Z2OX 4FK8A 4N1AA 4W8OA 2ACVA 1GPYA 5AKYA 3DOOA 2CNLA 5BSGA 721PA 4CZ2A 3J81A 2HWUA 1JPNA 2ECPA 2ZT7A 1E99A 4MUIA 1I4OA 4FU0A 2AFIB 1BKDR 1S01A 2MTBA 4KNWA 4GS5A 1XJWA 3AHGA 4TTPA 4Y30A 4BQRA 1A2OA 1MPXA 2Q5HA 3O4FA 1HR0B 1S3FA 3ADKA 1IJKA 2O1EA 2CDRA 4NCXA 3HUEA 2HFKA 4WUVA 3SZGA 2B69A 2GD1O 3EK2A 2XKBA 3T1TA 2DU8A 3D8BA 4Z5XA 3HU3A 3PRHA 3PXDA 1C7JA 1QXSA 1DX9A 5JARA 1SBHA 3QI7A 1Y89A 5CLLA 2DVMA 5WRFA 3VR0A 4W9MC 2XUHA 3JWHA 2HI0A 1RWWA 1YE8A 3MLAA 4ZCPA 1IHPA 3LXMA 5ENVA 2G76A 2C3MA 4PY2A 4EUSA 3MW8A 4O02B 3OEHA 2W4IA 4HZIA 4LHEA 5DW3A 2XAAA 2IYEA 5IU6A 4RVDA 2N1BA 3JD3A 2Z2KA 1J4AA 1YB2A 2OTCA 2Z8YA 3DVSX 4RE5A 4DLWA 2CXXA 3A1FA 5JD5A 1CB7A 2VRNA 1X39A 5KTSA 3LDAA 4EUKA 5A9SB 4MAFA 5IWAB 4MUJA 2KB0A 3HBJA 3PZRA 1IZ0A 2PJDA 4P80A 3SEFA 4BZPA 5LOVA 4ZFNA 4FX5A 1XCPA 4R8SA 3COYA 3KAKA 4O63O 3UCXA 3WIEA 1HWYA 1XNJA 4ANFA 4I81A 5I7FA 2B0JA 2I3BA 1EVQA 5DM70 1DOAA 2YVKA 2FSUA 2HREA 1T1SA 5TSDA 2F8TA 5JYDA 1RVDA 1IM8A 2ORWA 3SQMA 1EAMA 3IDZA 3GYGA 3T3DA 2Z6QA 3CLRD 1XZQA 2BCGY 4QEDA 4LISA 1B14A 2XUPA 2A1UB 1KRWA 1XA4A 1Q50A 3EISA 4URVR 1NONA 3L46A 1L9XA 2H63A 5LKAA 5U9CA 4IHQA 1BMFA 3EC2A 3SY8A 5BY2A 5EC8A 4IIHA 1EHIA 1QVZA 1WCYA 2PSEA 3DD5A 3SXJA 3W6UA 2VOJA 2DPYA 1VSTA 2VXBA 4JSRA 4RHUA 3S1AB 2V54A 4CTJA 1W93A 3KEFA 4JHXA 2JFFA 2C7QA 3OLWA 2CB0A 1GPMA 1H5UA 4OHOA 1NKSA 2W71A 1PQPA 4W82A 1GNSA 4CEIB 1YAJA 4BN5A 3MJVA 4WAUA 3GDOA 5JQGA 3MRXA 2DJ5A 1CDEA 2ZM6B 4N47A 2PKEA 3AB3A 2OB2A 3RGWS 3UWMA 4AROA 5KSPA 1Z6YA 4CLDA 1JRLA 2W6JA 3VDQA 2C61A 1HLPA 3T5MA 1XMSA 1GGNA 3AI1A 2VNJA 5CNKA 3UK1A 1HKHA 4RQAA 2GQ0A 3HXLA 4N18A 2F17A 4M7WA 1QB8A 4Y9DA 2VCEA 3BA6A 3UJHA 2XXAA 2IYRA 1E6MA 1NF8A 2DSTA 2MSEB 1NVGA 3LY8A 4EHFA 4OHXA 4KQKA 3SDSA 4D3DA 2IYYA 4HB2A 2BMVA 1CY6A 1P75A 1DT3A 3WOHA 3CRVA 3NHUA 1LQUA 1U9YA 3HCEA 3NVAA 3EUAA 1EFDN 2G6TA 2QM0A 2AX3A 3U40A 3OF5A 3UMVA 2IP1A 3GEGA 3FBTA 5AKKA 3MAGA 3W8DA 3GP5A 3AK4A 3OEEA 3TOVA 1LPBB 3CQ9A 3GJRA 4CFYA 1SCQA 1X3LA 1XDUA 2DC1A 1JG1A 2JANA 4FFDA 5B57C 4TQAA 1OUMA 3FCAA 3OCXA 4EPTA 3IR6A 2R8YA 1L4BA 3I28A 5ECGC 1S2DA 3GDWA 3P2YA 4MCAA 5FB3A 3N6RA 4U7JA 3VNAA 2HCJB 3MJFA 1E79A 1KEWA 2JCVA 1XK7A 1PFWA 1SM4A 2HAEA 2M2IA 2PH3A 3UB2A 5IJ9A 1MJFA 1EX6A 1KKLA 3FR7A 4EAQA 1JXQA 4D9BA 5HBGA 1Z18A 3JPYA 4GMDA 4Q9NA 3CZ5A 1EPUA 2DUJA 1HKUA 3SF0A 5FOWA 4FDTA 5PNTA 2EKPA 4DVGA 1Q7GA 1GLGA 3ELWA 3LUCA 1SUDA 1BA3A 1WD7A 4OOFA 2RBGA 4URWR 2ZGVA 1ZL2A 2AXPA 4TV9A 5TVKA 2QXTA 3AHJA 3G2HA 4OY3A 3CU5A 3LUKA 5JXHA 4URHA 1CLUA 2YJZA 4PNHA 1OB2A 3FHLA 1G20B 5BV7A 2YHSA 4Z1MD 3R20A 3EVCA 1KAGA 1M1YB 3CNHA 3HKCB 2UZ1A 1I13A 3W6PA 4D92A 5KTTA 1JDBB 3HKDA 4ENRA 3WLFA 3TEJA 3LX5A 1T5BA 4RS3A 1ZBDA 3L0ZA 3RV3A 3C5EA 3ZCSA 1DAIA 1M76A 1MA3A 1CHNA 2JLRA 3K0AB 5C1BA 2QPLA 2PO5A 2XDYA 4MW1A 5H80A 3ZHQA 3OX4A 1OH6A 3C7KA 2YJ6A 5B6PA 2IU4A 1SQ5A 3UFXB 2XDQA 4DCPA 3U16A 1XPRA 1Z83A 3P32A 4NI5A 2C5EA 1FE8A 3GCGA 2VF8A 1RQ7A 2DETA 3D4NA 1NM5C 2AV6A 5IBRA 1N0VC 5TE9A 4WOJA 1J9ZA 1LGYA 2Y4OA 1W2GA 4B85A 1UMCB 5CT5A 4NNJA 4EY3A 4X54A 4R2IA 3JASB 1JMKC 4XVHA 2RCNA 4EUNA 2ZIAA 4US0R 3RBVA 4YO7A 4Q9JA 3TI9A 4KDFA 5EP4A 5F77A 4NCAA 4C03A 2UYGA 3W2EA 2FJPA 3DF7A 3HJUA 3QFCA 3NWBA 5FOQA 5KNCA 1EUDB 1RPZA 1Y8CA 4RFSB 3WNBA 3WG9A 3COZA 2JIZD 4DMCA 4MZDA 1VHTA 3TNFA 1G2OA 5FRDA 1E1YA 1EXWA 2WP8J 5EIHA 4FFMA 1Z15A 5C5DA 4NBKA 1B2RA 3QKRB 4GP7A 4PHCA 2PT5A 2RHJA 3BH7A 3TQIA 4C0SA 2PUFA 1A76A 1OC4A 3U9LA 5AUPB 2WYHA 2EW1A 5BP7A 1PSDA 2I2BA 5COAA 2PRKA 2JAOA 3C4QA 4LWZA 1M5UA 3QXGA 3RFXA 1NE7A 5EWMA 1JT9A 4FR2A 4D4MA 2DLCX 5FWXA 3L0YA 4C20A 3BHNA 3V6LA 3GP8A 4WOKA 1QGDA 1DADA 4HJRA 4XJSA 1KSJA 4C01A 1N6KA 3EUWA 3G13A 2X9QA 4OBWA 4L51A 1FJ2A 1IBRA 4LXHA 4QU5A 3QF7A 4UFOA 3OH8A 1D1PA 1A4UA 2F8LA 4WEOA 3EIUA 3U4QA 3ZV3A 3ESZA 1ZKMA 1KSFX 1A5TA 1NLMA 1B23P 3NBQA 4PG7A 4KODA 1KQOA 4RVUA 1A2QA 2C0QA 2R62A 2WVHA 3O1LA 4X1YA 1DINA 2JDIA 1KETA 3LF2A 3ZQ6A 2A7XA 3IC5A 3WI7A 1G3MA 1GP2A 2CFOA 2MJLA 3H8SA 3UF0A 4PG8A 2C1EA 1PFUA 4KQJA 3WNQA 5CDSA 1H6AA 2JIOA 3P2JA 3DAOA 4MKRA 2ZITA 2TS1A 3HVHA 1XTTA 4R0NA 1U98A 2B1RA 2W8BB 1UINA 1JP7A 1DUIA 3VC2A 1YR3A 5CFOA 3B5JA 1JSXA 3IMFA 5F1OA 2ZBDA 3MJ4A 3FGOA 1F4LA 2ZVDA 3WZMA 3PPYA 1QK4A 4OXNA 3B9QA 3A9WA 4IHJF 5IEBA 5AIBA 3WHLA 2O2JA 3PC8C 1HT0A 2AJCA 4M8LA 4PFKA 3TM4A 4F1WA 4WBNB 1JAIA 3NTVA 2EL9A 1NFFA 3T95A 3ZCPA 4QJIA 3DO5A 4P4SA 5TQ0A 2H1RA 2I6XA 4ZN6A 2WJ4A 1IJFA 4IIJA 3IH5A 3ZHOA 3N2GB 4GLFA 1RQLA 3CCBA 2RIPA 2O07A 4H27A 3JWEA 3SIPA 1E9BA 1TUIA 3A3PA 4G5HA 3CX3A 3CZMA 3KDAA 3Q85A 4RYDA 3WYEA 4TXHA 4OHYA 3NHYA 1JQEA 1PJZA 1D7AA 1PJRA 1ODJA 1TGYA 4MA0A 4WK6A 1DO8A 4K9SA 5ARDA 1IJEA 3U39A 2CLEB 1G6Q1 5ILQA 5K2OA 2HNBA 4O4JF 1Z6AA 2OBLA 2R44A 2DPHA 4M21A 5K3FA 1AA9A 2G06A 4E2ZA 1LDBA 4CV1A 1T5SA 4JY7A 3W3AA 5HTOA 3REQB 3COVA 3NHWA 2YXNA 4YEDA 1XRLA 4P31A 3PK0A 1S3SA 1V41E 1W48A 2JFZA 2ZTUA 1MDFA 3GLTA 1QS0B 4MV0A 1UKEA 4JK3A 1CJMA 1F3OA 1E2IA 2V3VA 1NM5A 2CBGA 2IPAB 5IVDA 3K92A 3N2NA 1F7VA 4LF5B 1HDCA 1E9VA 3K4QA 3V4ZA 2JRCA 4BDSA 3GRKA 1E2DA 1BHO1 1N6IA 2IX9A 3LD9A 3T52A 2WIAA 2YW9A 5CIWA 3VU9A 1LBTA 4TZ0A 4PYRA 5JNLA 1BNCA 2GAAA 1LBQA 1UWCA 3B13B 5LKRA 5T64A 1J7JA 1I7NA 1SUFA 2YYZA 3S29A 2O20A 3HR7A 1QGUB 2RGUA 1M1NA 2H7VA 3B1FA 4M7PA 3I39X 2DQKA 3WLOA 5JTUA 4XQEA 1WZNA 2JI6A 1NLFA 1VMAA 2RG1A 3A70A 3CW8X 2REQA 3JVIA 5COQA 2I55A 4FOPA 2B5VA 3ANYB 2HA2A 1WV1A 3IDFA 3JWIA 2FR1A 5CGQB 5D5PA 3BZUA 4JEUA 4GHWA 1Q7EA 3B1XA 2Z3WA 4H77A 5CR9A 1U9ZA 5CB0A 3A1TA 1JJFA 1WXWA 2TMGA 5LQDA 4M54A 3HK2A 5E0KB 1FX1A 3TXXA 2PYZA 3F96A 3MGBA 1L6IA 2Q3DA 3IKMB 4AUMA 1BWRA 4N0QA 3T7AA 1OX4A 4B76A 2UDPA 3A3OA 1XDZA 3UUFA 3OURA 5B7GA 3T9DA 1WZUA 3VC7A 4Q16A 1K88A 1XL0A 1U1CA 1W87A 3WL6A 4EHAA 1GG8A 2YNMD 5TS2A 4NESA 3A0RB 1PTJA 1T9DA 2A1TR 3H5NA 4GR9A 4KGZA 1ULSA 4CTOA 5IZCA 5JISA 3ABRB 4W5NA 1J0XO 2GI4A 3L0IB 1V5WA 2DHDA 3PQFA 1CSEE 3FKSA 3TZLA 4C1NA 4CIBA 1WMDA 3EVZA 1GTG1 3T0IA 4B2PA 5JDCA 4HXYA 3CUVA 1RSZA 4FNMA 4UDXX 4BFXA 3EDRA 2IA5A 2XWSA 4X71A 5DHRA 3Q3IA 5G4LA 4EATA 4N7MA 2I2CA 2OCKA 3TSWA 4DCJA 3M6MD 4M76B 5BYKA 3TTUA 5C3MA 2O8FB 3DZIA 1P4HA 5BO5A 4UCQA 2JJ1A 5FTMA 2C82A 2VBCA 4GBGA 3EZ2A 4M9XA 2OFFA 3SNHA 2VL7A 3OM8A 4UBMA 3AESA 3T9AA 3WOVA 4DIKA 4P4NA 4DMGA 3G6WA 4DMMA 2FP4B 1J2YA 4GEGA 1ZK4A 1GL3A 1DARA 3ANNA 3OLVA 4KYIB 3TDKA 4MW0A 3UV6A 4HWSA 3SS9X 5A5FA 5MFZA 5EIBD 4JJIA 4QFDA 4UEOA 3OJWA 1DBPA 1ISRA 3DOEA 3WO1A 3BTVA 1ABFA 3ZWQA 1SCNE 2GXSA 4RQTA 1PQUA 2NMVA 2A0FA 1ZG3A 2GEVA 3LHIA 3GPCA 3BZBA 3VPAA 3QVTA 4FGKA 5TXGA 4M1QA 3DO8A 1NASA 1ISMA 1LJUA 1Q0PA 2VWHA 2XH8A 3D6FA 4N82A 4E08A 4NATA 5CB4B 1WVIA 4IOMA 4Z0NA 4ZU3A 1X9HA 1ZBQA 2AQKA 3I8XA 4JZYA 1F8FA 1QF7A 4D9MA 4ZT3A 4UBKA 4V38A 2O06A 3B36A 2VK2A 1KERA 3WWDA 1QONA 3X43A 4BO4A 3I5UA 3LKVA 3SYNA 3M4YA 4C89A 5DOZA 4ENQA 1YS6A 4MVJM 2O8CA 4XM1A 4Q1EA 4F21A 3PC2A 2P68A 3CSUA 3TKYA 3AY7A 3K1JA 2AZ4A 2YHIA 3B89A 4PGMA 5HSGA 4JL6A 2NZVG 1E7RA 1TIKA 4IGEA 5K51A 5JY6A 2XV1A 2ACEA 2BR3A 3T8YA 1QIGA 3WK9A 4YRSA 3FOZA 4N48A 4DMRA 5AW3A 1QHHB 1CUIA 1VIVA 2IU3A 3R9XB 3P97A 3PJDA 4RSMA 2ZTHA 5GZ3A 2ZAGA 4RZ2A 3V55A 4Z2YA 4XJXA 4BX3A 2Q3CA 3PNLA 4MW9A 4MQEA 3BMXA 4DBLC 4AKHA 2ZB7A 3THYA 3L7IA 4QDXA 3C3BA 5CK4A 3A27A 5IBQA 5K99A 1XROA 1BCSA 3G6KA 1NDQA 3M9LA 4ZEXA 4ESVA 1WHTA 2EJVA 2PLRA 2FE1A 3DE4X 3HZRA 5HTKA 4R68A 4JB2A 1NF3A 4HNVA 2HTEA 3PX7A 3B52X 5DNEA 4REQB 1U0JA 2OBMA 3M6FA 5DF1A 3C0KA 1NVDA 3U19A 4S04A 4LC1A 4DT1A 4BWYA 3RS3A 1NXXA 1NZDA 2DHCA 1T9CA 2UAGA 4RSGA 3W2HA 2DTEA 2V1XA 3JD1A 5F3RA 5U4QA 3A3NA 1DEKA 1SCUA 2VYFA 2HK9A 4I66A 1GYPA 1Z36A 3QELB 4C9BA 3BXPA 3PI6A 4P3XA 1Q1ZA 2VAPA 1US8A 4IVNA 5IJWA 1FZTA 2IHZA 3ZGYA 3JTMA 4NJOA 4ZAYA 3SHQA 4BC0A 4CMIA 1QP7A 4S2UA 3C1UA 4MV7A 3NDIA 1BMTA 3D5EA 4QQKA 3SJAA 3DFKA 3CJRA 3U44A 2WD9A 3C74A 4WLOA 5E6RB 4IKPA 3O1HB 3WRXA 1XTKA 4B84A 5JMPA 4OX9Y 1ZCZA 5C80A 2ONZA 1MEOA 3HCWA 1TCBA 4WNAB 3DVRX 1UXHA 1Z0KA 3IQWA 4L5AA 2JBAB 4O1HA 3DZJA 4BVLA 2JARA 1PG2A 1T9GR 1Q77A 1T5OA 2EF0A 2B1GA 3PFIA 4FYYA 1WZEA 1C1DA 3PX2A 3R4VA 5CA0F 2FLKA 4ARIA 2FZ4A 2B1QA 4MYHA 4REOA 1AS0A 3F6YA 3H75A 3QG1A 3AUKA 3DQPA 3R77A 4JEMA 3AFHA 4NMWA 3LQKA 4BO2A 4L4YA 4HQFA 4OREX 5DCYA 1PGPA 5F4ZA 1SIWA 1DXYA 4NULA 1TVMA 5FUYA 4AF6A 1XDDA 3IVMA 3TSAA 2AG1A 4R2WA 2Y1XA 5IDVA 3FWNA 4YUXA 1U0GA 3QTTA 4PF1A 4PLWA 1THGA 3S0JA 3UOAB 2KM1A 1N92A 1ODLA 4RESA 4EHDA 4PVDA 4EB0A 4OXYA 3KLOA 4J49A 2GK3A 1UXOA 4DA7A 2W93A 2WFMA 2OV3A 3GI1A 2BRUA 5EE3A 2RI0A 4QFBA 5DLPA 5K0NA 5JNWA 2A84A 3WMGA 1UZUA 5KU1A 4GVPA 4HNSA 3FIUA 4YASA 3IKLA 1CHDA 4KXXA 4ES6A 1GR1A 1X7WA 1N25A 4P4LA 4R3NA 4R83A 2C2YA 4RUKA 5F12A 3FGZA 2HT6A 4X0EA 5F98A 2IYPA 5ESXA 3LSTA 2OO5A 4KIUA 4OKNA 4TV8F 3VAAA 3FYUA 1G5IA 4B3JA 4D1YA 1OBHA 4NJMB 3PI7A 1RYDA 2G5PA 5L4NA 3VSEA 4KHZA 5AK4A 2WDZA 2ZRQA 2X2EA 3KSDO 5KNDD 2XADA 3GLGA 3W5IA 3W2IA 4DNXA 2G5TA 2ZI7A 1V16B 4F6RA 5BN1A 2BM9A 1XKQA 5K6TA 1EFAA 4BQEA 2DMRA 5K0GA 3GAMA 3S81A 4ZU6X 2OHVA 3DTVD 3KQUA 1D04A 3R7FA 2QIOA 2QM8A 4COOA 2VYND 4D5GA 4CM1A 3KCQA 1ZD5A 4RVNA 2EQBA 4MB0A 1OFGA 4H3HB 4OQ4A 1L4EA 3HBLA 4WDQA 3WGMA 5D3MB 3U31A 3GLSA 4CETA 1U94A 3LA6A 2GJKA 2WA2A 3OX1A 1PD0A 3AJRA 2HYDA 5EZYB 3DTVB 5LMZA 4DGSA 1ZLXA 1UMBA 1V7PC 3AR2A 3MIIA 3PNYA 3G0BA 3TB6A 5JV5A 4DV4B 3VSAA 1ZMBA 4Q21A 1PT7A 2QD2A 4TTQA 3E5NA 3AUSA 2ZCUA 4ENSA 4EJ2A 2P2CA 4JQCA 3W7BA 3U61B 2ZJYA 2VJNA 1B73A 3KVOA 3M4NA 3CLTC 3I2FA 3RFUA 3VI4B 4YAUA 2E4UA 1HYEA 2CNOA 4JP2A 3W8FA 2OAQ1 3M70A 1Z7YA 2BBTA 3LQYA 4H6XA 1IZ9A 4HWPA 3QOWA 3WLAA 5HKKD 4U2EA 1H8HD 4K9RA 4YBRA 3ZI4A 4MPDA 3PU6A 1MAWA 2P27A 3JQ8B 1JHMA 1I33A 4K88A 3I9MA 4Z4HA 3V7WA 1PSZA 3ICPA 1AUQA 1D5CA 1R18A 5LOVF 2VRCD 4LJRA 3KS9A 3SKYA 3VKGA 2XDAA 2CLHB 3FETA 1BE1A 2YJGA 1DFHA 2X0KA 4WXHA 2OYRA 3RC7A 1R2QA 2REXB 2XVXA 4MWOA 3MMPA 5HZHA 1P9LA 4GOMD 1NBHA 1U3UA 4MYRA 4N65A 3LZDA 4RD1A 1V3TA 5IJAA 2VBGA 1SVUA 3ESBA 2FRDC 3GLQA 3T99A 4BNZA 1LVHA 2JEOA 3TQSA 3I58A 1O96B 4BJ5A 2V98A 1TKAA 1TU0A 4MW4A 4MQMA 1U7XA 2R5FA 1ARZA 1UT6A 3ORQA 2G9NA 1V7QA 2ZU6A 3RIMA 5B6IA 4JJFA 1J8QA 1E2UA 1L3IA 2YZGA 1M2VB 2CLDX 2I8LA 3ZN2A 3RQIA 3FPSA 4AJKA 1NF9A 2C2XA 4ETMA 1PUIA 2GBPA 3V8RA 2HO5A 2CLLB 1HA3A 4ZICA 5JYCA 2E4ZA 3H5VA 4Z51A 5KDOA 3LUGA 5F9MA 2Q4RA 2DUWA 2FZWA 3BK1A 3LTNC 1CS0A 5DI3B 1IXRC 2C3UA 3BFPA 4GBED 4LVOA 2W4MA 1WCIB 3O94A 4G1VA 1BFKA 1LLCA 4G9GA 2PRSA 4GQBA 3MWFA 3CVXA 1Z33A 3ICVA 3EVFA 3BC1A 2HRQA 5E7IA 5K3DA 2LNDA 1B3RA 2H52A 3LLVA 4H60A 4NBWA 4XLZA 1YA4A 3OKAA 4I4LA 5C3UA 4O5AA 5C8DA 1WIWA 1D9ZA 3QENA 3VC1A 4RHXA 2QV7A 2FK7A 4NMXB 1AQLA 1E7QA 1TZJA 2R25B 1O03A 3HDHA 1DLIA 4Z2AA 2JG3A 2ZWMA 4AU1A 1P19A 3INTA 1IIBA 2VTEA 3D0OA 3WGIA 3EZNA 1IMOA 4FFRA 3IX7A 4FGWA 1YUMA 5SZHB 4UQLA 3RTBA 3D59A 1GKKA 1K1EA 2ODTX 2XNDD 1NYLA 2XQGA 3U3RA 4M9RA 2WYUA 2AFVA 2X1LA 2Z58A 3SR4A 1JPVA 2D4HA 2E4YA 2IE0A 1YVDA 5I5EA 1HXHA 1X1CA 1HDXA 3AFNA 4RJ2A 4DW8A 4EWLA 2D06A 2ZDGA 4ZQHA 3TOSA 3GARA 1C9KA 1M2OA 1NVTA 4Z4EA 3SLRA 1Z5NA 3MJDA 4DDTA 4POAA 3F9RA 1N36B 3C6XA 2BJVA 3PVZA 4E0BA 1P5HA 1YZHA 5BMOA 1X7YB 1FXWF 4Y9SA 3AVOA 1U1DA 4ADSG 2I1VB 3IE2A 3BDIA 1OBFO 5T3YA 3LY7A 5BWMA 5BUZA 2UVPA 1T9BA 1MOPA 1ZQ9A 4KIWA 4WCFB 3RYFB 2J9YB 3OPYA 2QZ4A 3TMYA 1X87A 3U4DA 1IAQA 4Y2VA 1ZN8A 3TX6A 3IAM6 5KWSA 1LSJA 2H1FA 2YMPA 1BA2A 1M75A 3U7QB 3TEMA 1FW6A 2IK8A 4TV9F 2OQRA 4YJHA 3S6JA 3U7JA 2QTRA 3LPAA 4AZ3A 2NXCA 1YK1A 1PD1A 1VYHA 4HNAA 2ZDHA 4LDRA 1XD2A 4JBHA 4KIJA 4RA9A 1TM7E 2DJIA 4U3JB 1NP3A 2OD2A 2G4CA 3GCZA 1NQOA 4MTLA 1ZESA 1NHWA 1P7YA 1UFVA 2H0AA 4BJ1A 1XVIA 2B1IA 1I7SB 3SP1A 3CM0A 3KVVA 3QIVA 3UJ3X 1C7ZA 2XKAA 1N3YA 4N5MA 5LQRA 3GLIB 3UATA 4F56A 5JJCA 4DSOA 1ZHOA 2I7TA 1EVJA 3ND8A 3VAZA 3L4BC 2YVAA 3G7UA 2FEOA 3O83A 2RHDA 1F0NA 2IH5A 4EVRA 3CH6A 4ZO6A 1Y37A 2QJRA 4KWEA 5FAKA 1X38A 3GVHA 4C7OB 3WNVA 4Q4AA 1V37A 2O6LA 3LCJA 2W6ZA 4ML3A 4DMKA 4R51A 4YV1A 3EZYA 1IM2A 3UAWA 4FEYA 1K9SA 1TKCA 5DSXA 3MTBA 3HADA 3L6OO 3N8IA 4G5GA 4F5EA 4QAQA 3GB9A 1RAFA 4F8JA 3RS8A 1OU4A 2H2HA 1M1ZA 3HWRA 2FVXA 1JSCA 1XX6A 1ZMRA 1L4LA 3IELA 2PZAA 1QV6A 2GK6A 4QPJC 4ER3A 3FNEA 4X85A 4XDZA 4DUZB 1I4WA 4R31A 1Z35A 2H9IA 3L6DA 3ZY5A 2FFRA 2CWWA 2IZ0A 1O95D 2H5JA 1Z4JA 4BBZA 3NHMA 1RAHA 2EJWA 4WY5A 5KQPA 3MCAA 1OD6A 1EB9A 3RYCA 1PEKE 3DAPA 1G42A 3OQJA 5ALRA 3P0JA 1Y42X 4XUGB 2DPMA 1P3Y1 1U11A 1WU8A 1Y8QB 4RJIA 3GUUA 4RV5A 4YLGA 4O3MA 1GZHB 4LXUA 3O21A 3N2LA 1QGYA 2X4GA 3D81A 3WXMA 4PCAA 2ZSBA 2FEMA 2VJPA 1O2DA 2Y1WA 4II7A 4QUAA 1EM8A 2FCRA 5DLEA 2Q0QA 1Y48E 4NZPA 4R2KA 2VJBA 3QVUA 1DBRA 1H1DA 4IJUA 4PYKA 5CXXA 5EZSA 4Z7JA 3GZNA 5AIAA 1Q3KA 4YGXB 1ZM9A 3M1AA 5HHTA 1YJXA 1TFUA 1X14A 3GLKA 2DFTA 2V59A 4IEFB 1Z5GA 2CD7A 3DYIA 3NC1C 2VA9A 4KAAA 4RMJA 1KYQA 4ZVVA 5DX0A 3ET5A 4G1CA 1N2HA 2O7VA 3HP7A 3Q11A 4Q1VA 2PGXA 1VSUA 5DN9A 1KE1A 1LK5A 3DE6X 1IDOA 1J5EB 3I2YX 4B2IA 2YWEA 1QGAA 4C5CA 3V4SA 1OXUA 2OHHA 3R0JA 3RV4A 3PL1A 1VDZA 5BV2P 1Z0UA 5DHPA 1NI3A 3RRYA 3BCRA 4GPTA 1HYBA 3LY9A 2QRMA 3DMNA 2Q46A 4EG5A 4HFJA 3MTEA 4LY6A 4E30A 4OHPA 2XTMA 2PCLA 4BFVA 4HDNB 1CXZA 2AT1A 1F2UA 2AJBA 4C4PA 2IZ5A 1C30A 5JYEA 1TVKA 2OCGA 2QTBA 1YB7A 4B33A 1FF9A 3FDXA 2QMUA 3D2AA 2UU9B 4CWAA 2Y76A 3TNYA 3U2QA 3TUJC 3OOYA 3DDCA 4LSWA 4ZHSA 2BMAA 1QV7A 1NVBA 3TLYA 1VMEA 3ZD6A 3NTUA 3SEAA 1O08A 1UXJA 4HFRA 2NAPA 5I45A 2OP0A 3SOZA 2CLCX 2WTEA 5JFGA 5CTJA 4CMEC 2C0PA 5K6AC 1T6ZA 4RE6A 1I2CA 2IQ5A 4LDZA 4TT8A 5DYYA 4IIJF 2VUIB 4EYEA 5LQCA 2XE7A 1ML4A 3PHIA 5KCZA 2ONKA 3TGPA 1EE1A 3GT3A 3ILXA 3N0RA 3PDIB 3AZQA 3FTQA 2D1TA 2J3IA 1T26A 3UC9A 4GOLD 4AJ9A 4WA7A 5GVRA 3QVJA 2KI5A 1FXUA 3AHCA 4IXWA 1EWTA 1P2GA 4JBYA 1N9GA 2NZYA 1CCWA 2VPTA 5KMGA 2E2WA 3QVGA 1YQQA 1C0LA 2HHJA 5IP5A 5IPFA 3EOAI 3KTAB 4O8CA 3A6JA 4R40A 5F73A 4C7MA 4WKPA 4PC1A 2XBMA 2VP0A 3PDWA 3KQYA 3R5SA 2NACA 3SIRA 2J3LA 4XR4A 3V7YA 3VI3B 3AMVA 2EJUA 3HSSA 1LUAA 4CM7A 3IIEA 1AX9A 2P75A 2GCIA 3MNFA 5CH8A 1P0FA 3WGGA 3WV5A 2CFCA 1HTBA 1GTVA 2VDOB 1L8LA 2W0SA 1GL7A 4ZODA 2G6BA 1VLJA 4PSKA 3G0GA 3AR4A 4K0KB 1Q0HA 3F1KA 2NZ8A 4YHHB 1VP3A 1OLUA 3RVDA 4HYYA 5D51S 1JKJA 3MINA 4J9VA 5DGTA 3WJ2A 2BE9A 3FDZA 1ES9A 4E32A 8MHTA 4ZJUA 1ILEA 5I4CA 2PUTA 2FZVA 2XRFA 4EMSA 4YJDA 5DI9A 1W96A 4L28A 1RIFA 2F00A 4GSLA 4CNBA 1U81A 2Q2WA 4E03A 5IAGA 2FZLA 5JSUA 4EYGA 1OAKA 3DPUA 3ZHYA 4OJQA 2FPIB 4A10A 3QPVA 4KAFA 1YGPA 3N0XA 2WNSA 1IN6A 2OY0A 4CV3A 3WJAA 2NUAA 3TX2A 3WFZA 2IS6A 2G8LA 2WIJA 3I45A 5AJUA 4FC6A 4RF5A 4DEYA 3NYQA 4ZZ0A 2F8SA 1VL6A 4UU1A 3DFMA 2IH4A 3UHPA 4UM7A 1XZNA 1MOQA 1DAGA 3AJEA 5IKEA 3IE1A 2AWNA 4JXXA 1H6CA 4YP6A 4ER6A 5K0CA 1LBHA 1V95A 1DJOA 1TJ3A 1KH3A 2FPMA 2NG1A 1N2BA 3P7MA 3I5AA 3N8KA 1NVAA 3OJXA 4GX0A 4PG5A 3TRKA 3FVWA 4IOJA 4Z7OB 1YRAA 4AIIA 6PFKA 1P44A 3H2ZA 3O92A 1X80B 1TYBE 2I3ZA 3AZOA 3KU4A 3OJEA 3EFOA 2INGX 2TYSB 4MB6A 5AJVB 2BP7A 5DTQA 4Z9XA 5FORA 3WB1A 5K3CA 4Z6KA 5JPCA 5JH7F 1I4DD 3TD2A 3KM0A 3G0CA 2I6QA 7REQB 4ZC1A 3L04A 4P38A 3HWWA 4JQYA 5CU7A 5H70A 3SZUA 4QOHA 2P3QA 4LYFA 1K9VF 4G8CA 3GLUA 2QORA 1CZLA 1E4OA 4YAOA 2UZ3A 5FADA 3V1TC 1IG0A 1B76A 2EG5A 1N5IA 3D9QX 3QBDA 1R10A 5E1DA 1ZD9A 2A9KA 3DWGA 3FMVA 4K8OA 4KE7A 5IBPA 1EFTA 2LCFA 4AUNA 3GQBB 4O33A 5AUOB 4JI8B 3NONA 1O8BA 4HYQA 1G66A 4PYQA 1JHXA 2AEJA 5ALKA 4BVAA 2GJAA 1ECPA 1CZUA 4MWBA 1KP3A 1G2IA 1EINA 1MVOA 2DBVO 1J0BA 1MV5A 2XUOA 3LUAA 2W6JD 3FGPA 4QJ4A 2BL4A 1KPIA 5FPPA 4Q3AA 3UMJA 3E2MA 4R8MA 2EGGA 4O4HB 1PZGA 3B3FA 3VR5H 4P7GA 4CMEA 4Y2SA 4I4CA 3KXIA 3KJIA 1FBNA 1SVNA 1UWLA 4KRYA 4LQLA 5KQGA 1GPWB 3ISJA 1FRZA 2WHPA 3AERA 5FP0A 1WXEA 2FX2A 1N6NA 2QMHA 3F9IA 5JSKA 1HL3A 2CHVA 3MILA 1YS9A 4CGYA 1A5AB 5BR1A 3I4CA 3G7SA 3BGOS 4RK7A 2BT4A 2WM3A 7YASA 4FGUA 4JGIA 5J4KA 1LD3A 2QUKA 3EDOA 3O84A 2FHPA 3I9V1 1MQAA 4NNPA 3EQ2A 3PE6A 1U04A 2ZBRA 4EBFA 1WV0A 1W59A 3M3DA 5L6MB 1CEQA 2GERA 2QVGA 4GI1A 2ZOSA 1EHCA 1N6PA 1DTEA 1SA0A 2J0EA 2ZLBA 1K89A 3I9OA 4NRDA 1T4CB 4ZWNA 2OBXA 3DJYA 1L5HA 2FX3A 3BH6A 1Z47A 3DPIA 1C1XA 1JX6A 2OG2A 3OA0A 4E11A 2C5GA 4JCOA 5HZGA 1MO4A 4JUCA 4N6NA 1IFXA 5DEIA 3QBVA 5I01A 1YCDA 4UBNA 3QVOA 4GXQA 4AF7A 3Q8WA 1CRWG 4IO0A 3I09A 3SNKA 3DMDA 4WGFA 4JBGA 1UBRS 5J5AA 4LPKA 3RNLA 4A1OA 4MEBA 3IEIA 4BQNA 4DNFA 5CBPA 3OE7D 1AB5A 3MGAA 1ZN2A 2XJ4A 2VSYA 4YCCA 3ENVA 4Q05A 2G9UA 2JCXA 3S8YA 3WKAA 3JS5A 1HQDA 5IJ9B 1RXYA 8LDHA 1R12A 4DRYA 2AYZA 1JEOA 3R5XA 4PR3A 1AGPA 1ZCBA 3ET4A 4B44A 4MXDA 5CW1A 3QFHA 2IOYA 1J99A 4OHKA 1JEYB 1NBMA 3AIIA 2H4ZA 3G1TA 3NBMA 4WINA 3R0QA 1K6JA 5DP2A 4HTFB 5C4GB 2O5CA 2GEBA 3DXFA 2E3JA 4MV3A 1D8TA 2X0RA 1M0EA 1U80A 4QHTA 2DWPA 1O4WA 1PHRA 1TEXA 4TMZA 2O2XA 2R8EA 2HA4A 3MTDA 5ALZA 2WKPA 4PZLA 4YIKA 4OHVA 1SUPA 3RJMA 3DEYX 2FHSA 5A0VA 1Y3HA 3MHPA 4Y6OA 2W7TA 4K6KA 1HE2A 2P2LA 1A9PA 2X15A 4QFCA 5A7HA 2RG7A 3MT8A 4DLKA 4E6EA 2J0VA 4MCIA 4QELA 2CL7X 2PYIA 3V8NA 5BV1A 5IKPA 2OUKA 1L2TA 3D4OA 4ND7A 1L5VA 5AM3A 4QXAA 3IPXA 4LJ4A 7GPBA 4KQEA 2JCSA 4DR3B 3GY0A 4FOTA 4DLSA 1P1FA 3LH5A 4HQ0A 2Q3FA 2DWCA 3EG5A 4TUYB 3UA4A 4OTZA 3R9WA 1G41A 1PR1A 1QGZA 4M88A 4CM6A 1IUNA 1PWXA 3RU3A 1WF6A 3THWA 2GYWA 2OFOA 3MS7A 1X7ZB 4YCAA 5H4HA 5TF0A 3U7IA 4DR7B 1QCDA 1LS1A 2J3HA 2A86A 4L4ZA 1VJDA 5JLJA 3W9SA 1HYHA 1KZ6A 1QO0A 5T4HA 2A6PA 1K06A 2GHIA 5L53A 2Z6VA 4S3MA 2XCQA 4XA8A 2FUG6 2BUBA 5FOVA 5JDIA 3QBEA 3IUSA 4YNBA 4RGVA 3HKBB 5ELMA 4DV0B 3B8HA 3H6KA 4K3VA 2IH2A 2AD1A 4L2IA 1ORVA 1YKSA 2I65A 3U4HA 5C7OO 1HFKA 1FRQA 4HGOA 1JQ3A 3EGIA 3P0IA 1EGMB 4M0KA 4OGKA 2D1QA 2JI8A 4BB9A 2CVFA 2WINI 4H4CA 2YFQA 4PSAA 2Z4TA 1ML3A 3D6NB 4QUEA 3JQGA 2FW1A 2GJ4A 4GPBA 5DLYA 3JYPA 5I5GA 3TQQA 1YKGA 5EXSA 3WLMA 1AE1A 1LS6A 1O7JA 2JGJA 1VG8A 1ZJZA 3OJOA 3IO3A 4WX2B 5IC4A 3ZJUA 1V43A 4XWOA 5KQRA 3ZYCA 3BRQA 1W4CA 3C8MA 1OH8A 3MWLA 1N0HA 4PTLA 1N57A 2WPDA 4FFSA 5ALWA 4IHAA 1IRIA 1H42A 3IE0A 3L0SA 5JMOA 4Y2PA 2GZAA 1VFNA 4H4DA 3VR6A 2I3DA 2OPBA 4OHRA 4XFDA 3W5BA 1DC3A 3NVMB 3L1IA 4II3A 2AN5A 3IAHA 2ZJAA 1M7GA 4K9MA 1PIWA 2G36A 2HPZA 4E5PA 4WZBA 5SICE 4ZI3A 1RM0A 3TNLA 1OTHA 1E2BA 3CH7A 2HA0A 2LXNA 4LQ4A 4RY9A 4ZPXA 2R2GA 2JDID 1KU6A 4P9NA 1EKXA 3EBLA 4RMHA 1DTWA 2WJPA 1U8EA 2DCUA 2ZSEA 3BL8A 3LNCA 3LYUA 1N6RA 1O58A 1U5CA 1T43A 1ULTA 1ZIPA 3F5FA 1QH0A 3L79A 4BIIA 2FOLA 4HNGA 3ZHRA 4TKVA 1VGQA 4I9FA 3HJNA 1H2HA 2VP5A 4J2TA 4BNNA 2VRBA 5EMJA 1P2SA 1EVEA 3VKVA 3U6BA 3I6MA 3PC6A 3TLJA 1KRXA 1AHIA 1WABA 2HK7A 3C6BA 2Q2OA 2XTAA 2IDJA 3VR3A 1D1TA 3FPFA 5BVGA 3I01M 5G1OA 3C3JA 1DCTA 3A9UA 4BCDA 4JUIA 3BHIA 3KHKA 1DC6A 1IXSB 3IESA 4B0PA 3ZWPA 2QOEA 1EUCA 5T4EA 1G8AA 2P0AA 1NVWQ 4NZOA 4YJGA 3PIIA 4G4IA 3UHOA 5CDYA 5FOUA 1SHLA 4CMBA 1YT5A 4OH1A 3G59A 4MVYA 3MBIA 1A1VA 4KDRA 3C6YA 1PI3A 5E3HA 4KX5A 3EGEA 1NVUQ 1YR7A 2JW5A 5TDHA 2FDXA 1CUBA 4M9QA 1KAEA 5AI5A 1Q14A 1RZRA 2R8BA 1NG1A 1II8A 4MLCA 2HMUA 3RG8A 1QKJA 1GRRA 1V3UA 2PX4A 4NX2A 1EDDA 2WHQA 4D80A 5CFLA 1FFYA 4IDGA 3ZJ4A 4LZOA 2OZPA 4MCHA 5JECA 4L9SA 3RSZA 2NU8A 5ALXA 3ZHVA 3FMIA 3GJ8A 1JILA 1QQTA 3PHCA 4OJKA 4DMUB 5IXYA 4GAEA 4IZIA 4KNVA 4QYIA 3ZGXA 5JJ5A 1K27A 3GCWA 2AI2A 3TCKA 1TX4B 3ZCXA 5KBYA 1ZJ6A 3BGIA 1USKA 4D41A 1UBMS 4XDHA 3RB8A 4QFMA 4LRXA 4UQPA 2X2OA 4HB0A 2I8CA 1RWPA 2IBMA 2SKCA 3KQSA 1BCRA 2CXTA 3MGCA 4LAFA 4PIPA 1PE0A 2ONCA 4LJYA 4Q24A 4B3DA 2VDPB 2ZU0C 4FBLA 1SKYB 3E3AA 1I1NA 5DSZA 4RVFA 5HFNA 1SXJA 1CIPA 4U4AA 4NFSA 1KJIA 1SQ6A 1JT2A 2RJNA 3LYHA 4JA2A 2QRHA 3WL5A 2XUJA 3THRA 1WXFA 2VP6A 4IOLA 1JALA 3A6HA 3UJ7A 3EX7C 3IP9A 2OGZA 1V8DA 1J23A 2PR2A 1SBYA 5IJ0A 4L5CA 2D2XA 5TQVA 4J07A 4KAJA 3IEXA 2F43A 4RWZA 4R7GA 5CNIA 2MINB 3IUQA 1QYCA 4U9IS 4G1MB 2YIJA 3WKDA 3H1TA 4N0EA 2BMDA 3WK5A 4EA8A 4ZTBA 4DJFC 3P0EA 4OB7A 5F78A 2D1SA 1TMYA 3N70A 3DBIA 3CT4A 4J3JA 4UZEA 4E46A 2WT8A 4P08A 1HM5A 4PCLA 5IABA 1JEQB 2B7CA 4EUFA 1XTRA 3RANA 1GPBA 3WB2A 3C1TA 2RKOA 4AAYA 5GJVC 3BIXA 4DM4A 2RJ3A 4W5QA 5F3WB 4W6ZA 5BNWA 1WZ2A 2NQTA 2Z5GA 4ZI7F 1ADYA 1G2PA 1XE3A 1SEPA 1L4GA 2QMQA 1XXLA 3M6XA 4C4YA 1FYEA 3GW8A 4RK4A 3WE7A 5HQ3A 3JQ6A 1E64A 3LM8A 3MGGA 3FKSD 3KQHA 4W5TA 3OT4A 3ZVNA 2ZBVA 1C4OA 1YZKA 3EDMA 3ILVA 4IY1A 4OFWA 3RDPA 1FS6A 1JQKA 2XB8A 2FPGA 3QLVC 3H6HA 1ZM3A 3T5CA 1EXDA 3ESQA 1XU7A 1BWQA 3GFGA 1J9EA 1GUZA 1ZVMA 3A9SA 3LY5A 1CQWA 1KDRA 3CLKA 3DV0B 3NEAA 1Y7IA 4Q82A 1J2RA 3QFFA 1UDBA 2YVQA 2BZ0A 3KXPA 3W6NA 5AW6A 2OB1A 4Z8XA 3WSVA 1U0RA 1YRBA 4O4IB 3EXHC 2VYQA 3IPLA 3GLHA 3IODA 1T5TA 1C9EA 2XF2A 3TTVA 4CIVA 5P8WA 3FX2A 4J16C 4LFAB 3QY0A 4OMFG 2HQ1A 2XCIA 4RNCA 5IK2A 4ETIA 3P9YA 3A6PC 3EWNA 5G0TA 5IF3A 4ED9A 3BKXA 3D4IA 3GBVA 2M6LA 1I32A 5KSWB 3CISA 1ZUWA 1XZ8A 4FJ2A 1SGWA 3OQ6A 1SUIA 1K5HA 2PKCA 4HUTA 3LHFA 1UC8A 2WHRA 2WWHA 3D7MA 3GX1A 4PLPA 5C5EA 5FTNA 1CF2O 1U4NA 1NHGA 2YINC 2O1SA 3ESXA 3LQQA 1WVGA 4OB8A 3GPDG 4W8HA 1E59A 1DQZA 4IUYA 1DTSA 1O94D 1A7KA 2IPOA 4ILKA 2X4DA 2CDCA 3QBTA 4LRTB 2H1HA 3NM4A 4ND8B 1ZIOA 2OV2A 3V1UA 2ZUFA 1GITA 2WC1A 3EFHA 1H2BA 1Y3FE 4D4KA 5BSHA 1K7CA 3SQXA 1ZYUA 4CM5A 4FYJA 4BQPA 4Q9HA 3TK1A 5ITZA 3UK0A 2RGEA 5JEEA 1WKCA 5LA6B 1LVUA 4RDXA 1LNQA 1AKVA 5TQ2B 4MR8B 4HBGA 2R6R1 2LIVA 1XJ5A 2JGDB 3VKWA 4FYXA 3ZJYA 3AEQA 3ZLUA 2OC4A 5IT4A 5JR3A 3QK7A 4BV3A 2QL9A 2AC7A 2G9ZA 2IYZA 4C78A 5K8CA 1W0KD 2IVZA 4FMCB 3Q8KA 2AKEA 4C87A 3M33A 2C9ZA 5LP6B 4MUXA 4C6RA 1L5KA 1E1MA 5TT0A 3ZU5A 1Y6ZA 3I9JA 4KR6A 1USVA 5FYQA 3PPXA 3V8BA 2HRDA 3JQQA 4LJSA 2D7CA 4QYTA 1H94A 2Y2VA 1XVUA 3ZGLA 3DB1A 2HIAA 4ROTA 4D3SA 4EUEA 4UAGA 4V1CA 4N6OA 3THYB 1GA6A 3A1NA 1RFGE 1Z5PA 4KPUB 4GI2A 1CUYA 5BN3A 3L3BA 2MSKA 3PKJA 4MVJP 4Q9IA 1LF0A 2ZZKA 1N3IA 4JROA 1E2EA 2QM7A 5GJBA 4QDTA 1XNRB 1QG2A 4U6SA 1JNYA 3V7UA 4YT8A 5FWNA 5B2FA 3RVSA 3EUFA 1ZGAA 4DT1B 2WR8A 3I0NA 5CX1A 1VHJA 4F3RA 2O8NA 1X2EA 3E81A 2C42A 4TL6A 3MWDA 3PA8A 1S89A 2AF3C 1XRPA 4DLBA 6NULA 3SK0A 4DV5B 1U2EA 2JD2A 1NW4A 4QYXA 3X2EA 4RTSA 3R3JA 1KK2A 4W5JA 1NOIA 2PSFA 2VCYA 3ANLA 4P6VF 3A1WA 2CFIA 4FW8A 3PR3A 1FSZA 4RDHA 4S0ZA 4KU4A 4N5LA 1VPLA 5AK0A 3ZCVA 2GBLA 4Z4IA 2PEYA 3KR1A 4PU0A 4Q4JA 4UD2A 3RKUA 3IDSA 2YN0A 2KLBA 2AFHE 4BJ3A 3LHDA 3UICA 3OHSX 3RYIB 1GL6A 1D0VA 1NAIA 1NUTA 3DO6A 4HY3A 1GM5A 2X19A 1WAMA 4FB5A 5A71A 2R00C 1JWAB 3GJ5A 3NJ8A 5IKXA 4MS1B 1Z4NA 3AGPA 5LNK6 1POXA 2WILA 3HJCA 3P2IA 5EMMA 4N8DA 5TPZA 4CTMA 4ARCA 3HJRA 3LL4A 2AQ8A 2VN8A 2VK8A 3AU9A 1TJNA 1LDYA 2ARKA 3K0CA 4NENA 5EQDA 1NL3A 1Y4UA 2CLFB 5B7NA 1XQ6A 5KNCH 3UPTA 3COJA 1NW3A 3EXHA 4UPVA 1ZGHA 4BMYA 1F20A 1MBZA 4GU5A 4HEA6 1JYFA 1ZHFA 4RZSA 1P7PA 4YRFA 5I8PA 1SC1A 1GO2A 1P9RA 4MI3A 4NP6A 4AZSA 4JLBA 3ZV4A 3K0FB 3T7EA 5TJHA 3TLKA 4P8RA 4F3TA 1V11A 1CC1S 4LN1A 3LXXA 1QV9A 1EJ2A 4L73A 4FYWA 1JF8A 3B3GA 1EFVB 3GCDA 4H7EA 2BZSA 4C05A 5CUQA 5DHTA 1WOMA 3ZLVA 3TD6A 4R1OA 2AL7A 2J07A 2J67A 9LDTA 1FBTA 4LK2A 3O9MA 2QTVB 1C8BA 4DCSA 3PIDA 1NN5A 4N9QA 1ZOOA 2AYYA 3E7FA 3T9FA 4E94A 3G8AA 3MF4A 1RJWA 3DD1A 3H1AA 1M72A 2PGLA 3EEFA 5KYTA 2BFEB 2XQKA 5E4YA 2JLWA 1H0HA 4CQMA 2WJHA 3TD9A 1WZIA 1T3SA 4EJSC 5C53B 3L92A 3U49A 3KDPA 1X7GA 2RGDA 4LDQA 3IAXA 3VOTA 2JI7A 1EWYA 2X14A 3C8ZA 3AX6A 3QJGA 1OAOA 4I9HA 1KIAA 1NTOA 4OM8A 4ARVA 3NHLA 4O2AB 2DKOA 4AO6A 3OY7A 1E2HA 2X7HA 3QMPA 4F6RB 5KWIA 1C9YA 1I5EA 4EG8A 3BGSA 4M38A 3NASA 2YYYA 3ZZ0A 4EW3A 1VA4A 3HA2A 3PXUA 3C3AA 2DB3A 3HSKA 3IUBA 3ESRA 3RUEA 4LZZA 4QGBA 3TR5A 1SHUX 3WYNA 4BEBA 4WQMA 2J3MA 3EZ6A 3VU1A 1E8MA 1OH7A 3WXBA 3T4EA 4P82A 5FV4A 3C3WA 3P20A 2IEDA 4JLMA 2FR8A 3FWPA 3E9YA 4DXDA 2Y3IA 4KLNA 4TTJA 4RFLA 3KFLA 3SC4A 3D1LA 4R1NA 1YMUA 3GPIA 4DOMA 1BHQ1 1VLVA 2IHTA 3HO8A 4IINA 4JITA 3SJCA 4B3MB 1D6NA 1KAHA 2O2CA 1UKBA 3K9CA 3KJHA 2WTAA 3VTKA 4A4DA 4F11A 5K5EA 2UUCB 5CJPA 4PAOA 1GGVA 5DHSA 5LZ8A 1RXVA 2GYVA 2Q0SA 3MTIA 2AHOA 3OZCA 5CG1A 1A9OA 2J9GA 3VZDA 1TZBA 5BWBA 1NYTA 5B7PA 1JJ7A 1SXIA 4KFUA 4G97A 4XIGS 5K0ZA 4GDFA 1BHSA 2RHWA 3DWFA 3V4OA 1G5FA 1BMDA 3SZOA 1VHLA 3ETDA 4LIPD 3F9CA 2JZOA 1THTA 3AEXA 5EHGA 1ZK1A 3ZJVA 2FKNA 5FCDA 2VP9A 3V2UA 1JS1X 4ENVA 3L7BA 3I32A 2GEJA 2CFTA 2MT9A 5BUSA 1RWQA 1QUEA 1V1MA 5EJIA 4BNVA 3QKSA 3W3AH 5HUQA 4EO7A 3BK2A 1KEKA 3CLUD 1DAMA 4CL0A 1HRKA 4I9UA 4MQ5A 1FVOA 3GT4A 3LRXA 5HF9A 3RVNA 2NO4A 4O0LA 2VSXA 5KSYA 3NTQA 4FT2A 3MTGA 3HB0A 3SXPA 4RH3A 1E58A 1UZLA 2P9ZA 2PY6A 1CETA 2YV2A 4JVSB 4ZOLA 1VE6A 3LL7A 3T7SA 3TTWA 1U2ZA 2LKCA 4ZIRA 1ZY2A 5JHGB 3WMRA 1G3RA 2V8OA 4Z4CA 3ZY3A 3ZY6A 1SD1A 2DWQA 1M9NA 3D6UA 1L7RA 2ZXUA 3ETLA 3L8DA 4B1FA 3AVUA 3ZWBA 1T3TA 3IQHX 2X8LA 3CO0S 3KPYA 1DAKA 1XU9A 2O23A 5DMXA 3HGTA 3VNBA 1AF4A 2ECFA 4G85A 4HJXA 3QEAZ 3KYJB 4Z53A 2FY8A 4BMZA 3ZY2A 1LPMA 2R97A 4E4RA 1WXHA 1ZNZA 3PS9A 5CM9C 4OKSA 5D1NA 2O8VA 4M8KA 4CL8A 4QLBA 1GD1O 1P1IA 2CE7A 3HB9A 1F6WA 1M83A 3KZXA 1QPGA 1RBYA 2VYVA 4WXPA 3R74A 5THXA 3NNSA 9ABPA 3HACA 1KEEA 2NUTB 3WGJA 4DF3A 3GG2A 3BTOA 4HBZA 1L8QA 1TUGA 1JE1A 5EIOA 5EZ6B 3VO9A 1G5QA 4OUKX 2FPPB 4AN4A 2XA9A 4X45A 2WHXA 2QLFA 4N0MA 4L85A 4QDZA 4MKHA 5JJBA 1QDUA 3B6MA 2FSIA 3SLGA 5HEKA 3T35A 1NPTO 4R81A 1JIKA 2A78A 4IFTA 2YMLA 2QI9C 1D4ZA 4IJ5A 3RBZA 1CZRA 4URFA 1A04A 3EEBA 1QRUA 3O4JA 3QU9A 3AG5A 3T0GA 4Q3BA 1ZWKA 1BX0A 1MEEA 2NU6A 2XSZA 1HT2E 3D3EA 4NR0A 2A9OA 3O8DA 3DNMA 2FZGA 4Y1GA 3SYKA 2ZTLA 3ECSA 1I94B 3B1ZA 3ETCA 2DCMA 5LWQA 4K3UA 1DO2A 2JGEA 2YZ7A 5BWNA 1TADA 1ZRNA 4M49A 2VI5A 1UP6A 2R8ZA 3HA5A 3MWEA 2EFJA 4HR7A 4BVFA 3IALA 4ZQBA 1OFTA 4B4VA 1A5ZA 2P0EA 3MOIA 2O0KA 3TR0A 3H2IA 3FYDA 8AT1A 1SKAA 2P9QA 3DFIA 3RVLA 1VC2A 2J6CA 1F2TA 4OL9A 1XMIA 1P2DA 4PS0A 4M1MA 3TVTA 1G19A 2ZUCA 3K05A 4GM4A 4ZOAA 3DVAB 2LE0A 5H68A 2R5WA 3PQEA 1QUFA 4F7DA 5EKUA 1G8KA 4JYMA 3S2EA 4EGJA 1N2OA 1ODTC 4QC2A 3AEKA 2IHUA 3OO0A 2NT4A 5EWLA 3JR3A 4FUQA 2ZQ5A 4C7JA 1K68A 5B58C 1ORTA 3D0KA 3IP1A 3KE9A 1Q0ZA 1T13A 2D2EA 4OP2A 4PAWA 4RGQA 3ZZNA 3N0TA 4L5IA 1EWRA 3UAOA 1R88A 5B37A 1ZXLA 3ANXA 4CLXA 3K09C 4PC6A 4D9KA 3DDSA 1OU0A 5FR2A 5K05A 3TXAA 1M7HA 4EITA 3SVLA 2PUAA 3CH5A 1DXOA 5G53C 1COWA 2QD5A 4N7RA 1FDWA 2O3UA 1G21A 4BMSA 2HF2A 3R6WA 3E7DA 4BDTA 4LF4B 4TN5A 2R751 1E32A 1ELOA 2C2ZA 1HZZC 1RAGA 1URPA 2HMYB 4R2HA 4B3HA 3B6KA 3OZIA 1P62B 1YZNA 2CK3A 1RWOA 2Q2QA 4KE8A 4ON9A 2I1QA 1M74A 4XQ0A 1GCIA 2PPVA 5LZ5A 1FUYB 2DWOA 4WLEA 3JY6A 1WEKA 2QPTA 3CYFA 4L4RA 4NJEA 4YDRA 3VUEA 3VA7A 2EDAA 1CRQA 3G17A 1PFYA 3NDBB 5A3SA 1J21A 4EW1A 5ENDA 1ZINA 1AKEA 2MMGA 3B3JA 3GN2A 4OU4A 1G8SA 4C0BA 1GHTA 1TM1E 2IPMA 2H4XA 3JQFA 1L4KA 3MQ2A 1XCJA 1LZKA 1YRYE 1ZI8A 2Q5CA 2VHYA 4MRRA 4X92A 4ZJZA 2X2FA 4IILA 4YACA 4JSTA 2M1XA 4J43A 2EEZA 3ADCA 3P96A 2YWJA 2G63A 2QW8A 2ZJ7A 4IQFA 2V7GA 4M37A 1MAAA 3RVMA 3L4KA 2OHOA 3WLKX 1ZN9A 3MK31 4EHIA 3HGMA 1P1HA 3GGPA 4J0JA 1DQRA 2G5CA 4PYOA 2D7JA 3T7RA 3QW4B 2Q8PA 1WMFA 4DLZA 3FSJX 4TT3A 4Q12A 4ER7A 2NZXA 5K1ZA 1CUAA 4GG1A 4EH1A 1TGVA 1P5JA 1OLXB 1LA2A 4NV0A 1KY2A 4NBLA 2ZXEA 4U8GA 5THQA 1MABB 1BWSA 3RVBA 2ZIXB 4PIMA 2D8AA 3H9BA 4YMHA 3T5TA 3ENWA 2PN1A 4MRSA 4QBTA 2GRJA 4F91B 2ICAA 1Z5ZA 1T5HX 4UEQA 1KWGA 3INGA 4BZZA 3KQKA 1NFQA 2V7UA 4HRXA 1CE8B 5KYWA 4Q9DA 4FN4A 2NXNA 4MMYB 1E0AA 1AKWA 5DX8A 4I55A 4A8HA 2A5DA 3C1AA 4XYLA 2F1OA 3H9EO 2I6UA 2XRMA 2IBSA 2NYAA 3FRIA 3L4SO 2QB5A 4PEVA 4BVBA 5IVHA 2FWNA 1UDRA 4QDOA 2IEIA 3C6QA 3I1YA 3LC2O 3LHSA 1XNQB 5I7SA 3A2LA 2Q5OA 1G3IA 3K6KA 1JMVA 5I48A 1V1JA 4IDBA 3ABZA 3F5QA 3F4KA 4QJ5A 5ADVA 2XYGA 4NZ9A 4B80A 4G0QA 2PUGA 3HJAA 4X64B 1ZU4A 2W98A 1KJWA 3B51X 4ZVTA 2Z98A 3U4AA 4LSMA 3VGJA 3IXQA 4CVNA 5BUQA 5LSAA 5FBQB 1O54A 2B21A 4BMXA 2RE8A 4M83A 5T41A 3FHJA 5FTLA 4QUIA 1DRWA 2G7MC 3WISA 3OG9A 3ND7A 1YGYA 3KZ1E 1BJRE 4I5GA 3HPQA 4MP8A 1IPFA 3NV9A 1PF7E 1A98A 2ANBA 2C4HA 2YWRA 4QDJA 1IN7A 2WKSA 4K6OA 4Z9FA 1UT5A 1CVLA 3RU2A 3N86A 3S4YA 2W58A 3CSDA 3OZVA 3FM9A 4P34A 3GA7A 3M0EA 4JDUA 4U7WA 4AYXA 2IW3A 4QUHA 2A88A 3CNOA 3E0QA 4TGLA 5GONB 5BT9A 2C77A 4LJLA 3N53A 2EL7A 1QE5A 3BORA 3KOMA 4G5SA 4MK4A 3WKBA 4IIDA 5BYJA 4RJLA 2PUCA 1JFTA 4H7IA 5L51A 1GAEO 1RYNA 2MSDB 4U2CA 4WBXC 4ALJA 1Y3CE 1NMYA 2GN0A 2A5LA 2ZRIA 4IUDS 4YK7A 1BVUA 3U3XA 4UAJA 2XCTB 1ESNA 5KVCA 4UJ5A 3PZBA 4HWTA 2LR0A 1UQUA 2RGYA 2WD7A 2QGFA 5HYVA 2G5GX 2VBFA 3ZBQA 4HAOA 1J8VA 5FWYA 5HR5A 5CVJA 4FIDA 1KEPA 2PWBA 2BAGA 4MCJA 2FEKA 4G0XA 1A2BA 4GGOA 1ZUNB 5F2EA 3DKKA 3DMPA 3QVGB 3BE4A 5C34B 1NDUA 1YS4A 4XD2A 2CVPA 3WWCA 1DGQA 3OM1A 3HQ4O 4Y1RA 1U3WA 4OBEA 4ZVMA 5I9IA 1TJ4A 4BO7A 1J24A 1M34E 3G2IA 3VR2A 3IUYA 4QOIA 2E1PA 5DT2A 1V7CA 1NMQA 1XWWA 3DZCA 3Q7SA 2EQAA 1R37A 4QTXA 4ALLA 3NYWA 1B16A 3EA5A 4ECEA 1EK0A 1GQOA 3KL2A 1JR3E 3EQZA 3CIFA 4ALMA 1SUWA 3GCXA 1VBKA 3QX8A 2DF8A 4V0ME 2Q5JA 4JDPA 3T7JA 2EX0A 2OM2A 4DTCA 5KQLA 3FJ1A 1YFZA 1XAJA 1O6GA 4P3KA 4BLRA 5BWLA 4KYUA 1DWOA 2IUEA 2GWHA 2F9MA 3MINB 2UZ0A 5A7FA 2QF7A 3UTCA 1IUOA 3BFKA 1GQ2A 1NBIA 3VPXA 4BFUA 1R0RE 1Q74A 5AKGA 3VYUB 3RQSA 2CCGA 2FRXA 2IFTA 3SSAA 2CLSA 3TLZA 3UO8B 1VE9A 4AG5A 1PT9A 3ZVLA 4OO3A 3EBPA 1EJ0A 2JH8A 2QZZA 2PWYA 2VHXA 3KB1A 1KXZA 3WZ2A 4GQAA 1W1IA 4RCVA 1B8NA 2IUSA 3BSYA 3JQAD 3K8OE 5EQJB 3AM4A 5LYJA 1SOMA 3SFZA 3BRCA 2QTNA 3HCBA 3K5WA 3NANA 3YASA 3ZWKA 3B3QA 3V5NA 3TSZA 2G72A 3HGQA 4A0HA 2B6NA 2J9FA 3H7AA 3U9TA 4AWBA 4MWEA 3WLLA 3KQPA 1EB8A 3EA0A 1FW8A 2ZXFA 3I64A 3HB4X 3JQAB 1J8YF 1XFAA 2QR5A 3HCFA 3PC7A 2W2LA 1QHEA 1TK9A 3H1EA 1A4XA 4BN0A 2FMTA 1UKZA 1PVDA 3ZDDA 5BSEA 4HLDA 4E2YA 3OPYI 4V39A 1EBBA 3JATB 1EIWA 4CI9A 2YXLA 3IBSA 1I4TD 2DQSA 5HS4A 3L7JA 4GC5A 4M46A 1G8FA 4UUNA 3WRVA 3JALB 4CCYA 3ICOA 5GINE 5KEIA 1DVRA 2BGLA 5JAMA 2JFVA 3IHTA 3V2GA 1QJCA 4KX3A 4M2LA 1ULUA 3QVVA 1IBCA 1ECCA 3CZPA 4HLNA 3WY9A 5ES4B 3HCOA 3FZYA 1I4EB 4N9WA 2L69A 4ZKDA 1MO5A 2V45A 4MMXB 2I54A 4OLFA 1WB4A 10MHA 1ISPA 4MPPA 4EEZA 3HCCA 3VX3A 5IYZA 4JQOA 4KE6A 1PR0A 1H23A 2P2NA 2PO7A 3PV0A 3RIEA 1RTTA 4A0GA 2GO1A 3O2NA 4QU0A 2ZE7A 2WG2A 3M9XA 3CNLA 4JT4A 1MTZA 2Y0CA 4KO8A 1UMDA 1ZJ5A 4A03A 4ATNA 1T8UA 1X7DA 2O1WA 2MSLA 3X1MA 1S9DA 2F4NA 1MW9X 3V3KA 1FFDA 5DNVA 4DM3A 2L0XA 4OQQA 4RGBA 1XLWA 4UHBA 5IF9A 3OOHA 3IKTA 2FSFA 1Q84A 4Z99A 3P4UA 2H8GA 3E1GA 2EP5A 1AUPA 3WHPA 5C4IA 1W88A 1PGQA 1T6XA 4Y2RA 1GTRA 3LW8A 1P3DA 4EK9A 5F9HA 3FMFA 3ZVRA 3G0DA 1NZFA 3M6LA 1EUZA 3RFVA 2DYKA 4GYYA 1AXGA 2WYIA 1DWPA 4KP7A 1NJSA 2D62A 3EXFB 4L16A 4B6PA 4I7EA 3SXUA 2C7VA 1WNFA 1XRSB 5GM2A 2C4NA 1WVMA 1GU1A 1Y8RB 2J48A 2GMWA 2ZRDA 4RPIA 1MGPA 4C7BA 4EKDA 1G6OA 1ECJA 3ZWXA 3VSBA 5KOYA 4YAGA 3H4MA 4PSUA 1B93A 1SBQA 3F4BA 2V0NA 4OVKA 4IWYA 2Q7DA 4FI3C 3VHQA 4KN9S 1XQ1A 3TJZA 3GNQA 4ZA2A 1PJCA 1X6VA 2W5UA 5FF9A 4GMKA 3VHXA 4CEHB 1PNQA 3EAGA 4W8GA 1RKVA 2ZRHA 3ZHTA 2GWRA 4W5OA 1P0QA 2NM0A 2WE8A 4ZYZA 2L42A 4DUYB 1U8AA 3NCHA 2P6PA 1U7UA 1LDEA 2VHCA 1F14A 5C32A 2VPPA 4KRFA 2PVPA 1PS9A 2IYNA 4LZAA 4TVBA 3BD7A 2MCFA 3PD1A 3M4XA 1ZXXA 3BWYA 3C3XA 4RZHA 4RTNA 2VJDA 1DDOA 1U8XX 3GJTA 4K9KA 1KI1A 2QMZA 2QNIA 3A37A 2QAGA 2YBEA 3I2JA 3IQXA 4W1QA 5AICA 4YRJA 3E9EA 3DCNA 2K4MA 3ELUA 3UAXA 1MC5A 4MQFB 3UG6A 4F2PA 1OV4A 2IYTA 4ITVA 2ZUEA 3ISVA 5CCXA 2HPAA 3DH0A 3HUFA 3P26A 5G02A 4WZAE 1U8UA 3O3NB 3O5AA 4EA6A 4LTNA 2APJA 4JD5A 2KHZA 4G2NA 1QH9A 4H7PA 2PUDA 5JSHA 1E9SA 2B5OA 5F9FA 1OW3B 1QCYA 4IJVA 4NYJQ 1XK6A 3M6AA 1AK1A 2FEAA 1RI1A 4YH1A 2R8PA 4N76A 2TSYB 4AK9A 2Y27A 5L6LB 4YX9A 2AVDA 4RPGA