3EWNA

Crystal structure of a thij/pfpi family protein from pseudomonas syringae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
242
Chain Sequence
b'SLHPHAMPDMGPDMNKVPWMGDEQIAMLVYPGMTVMDLVGPHCMFGSLMGAKIYIVAKSLDPVTSDAGLAIVPTATFGTCPRDLTVLFAPGGTDGTLAAASDAETLAFMADRGARAKYITSVCSGSLILGAAGLLKGYKATSHWSCRDALAGFGAIPTEARVVRDRNRITGAGVTAGLDFGLSMVAELRDQTYAECAQLMSEYDPDPPFNAGSMKTAPAHVRTAMIELVAEFTKKADALAGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI family protein
publication title Crystal structure of a THiJ/PfpI family protein from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 72
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ewnA00
1GGJA 2NV0A 3UGJA 1S1MA 3KKLA 1GGKA 2D7JA 3D54D 3NORA 1SOAA 2IUFA 2VPIA 1Q2UA 4OIFA 1QVWA 2R1UA 3PQ2A 4P34A 4ENTA 1OX4A 1UCFA 3NOOA 5JZMA 3B36A 1KA9H 3P9QA 2R1TB 1GGEA 3M3PA 4ENSA 4P5PA 4AUNA 3ER6A 4ZDKA 4Y1RA 3CNEA 1OY1A 4UNIA 2YWJA 4B2YA 4PXYA 4ENVA 4ZDJA 4S0ZA 4E5VA 4L8YA 2VRNA 1PDWA 4BTEA 4LRUA 1I1QB 1GG9A 1VHQA 3F5DA 1J42A 2V4UA 3CZ9A 2NV2B 4ENRA 4QYTA 5JZOA 4AJ9A 1Q7RA 3N7TA 1BXRB 4P35A 4RKYA 1IPHA 2AD5A 2ZUWA 3TTUA 2GHRA 3TTTA 2YWDA 4OGGA 1PV2A 3F71A 1CF9A 2ZUVA 1K9VF 3UK7A 3WFZA 1QF7A 3GRAA 1I7QB 4WINA 5SY4A 4UOQA 4ENQA 1OX5A 3TQIA 3PQ4A 4D1YA 1FYEA 2XF2A 3NOVA 1KXJA 2ZUUA 3RHTA 3R75A 3L7NA 3SF8B 3EJ6A 3UMMA 4I46A 4OFWA 1QWSA 4UOZA 2R1VB 2AB0A 4MNTA 1P81A 1QDLB 3CZAA 4L95C 1L9XA 1O1YA 3MGKA 5LIRA 2RK6A 5BV2P 2R1TA 1G2IA 2VDJA 1FY2A 1GPMA 3L3BA 1QVVA 3CY6A 1CS0B 2H2WA 3NOQA 1JDBC 3PQ8A 1JVNA 2GK3A 3BHNA 4L78A 3TTWA 3EFEA 1QVZA 4ADSG 3ZR4B 4B5KA 3L18A 4OGFA 1T3TA 4UZSA 1GPWB 3B3AA 3ZJ5A 1VCNA 2YWCA 2OR3A 1P80A 2FEXA 4HCJA 3P9PA 3R76A 4Y0NA 3PQ3A 4JQSA 3P9RA 2ISSD 3TTXA 3EZGA 4AULA 4P2GA 2YWBA 1OX6A 4QYXA 4Y1EA 3R74A 5SY6A 3VU3A 1T0BA 5E9AA 1ONSA 4E08A 1P5FA 1KEEB 3P9SA 4N0MA 3MIIA 4ENWA 1IZZA 3TTSA 4ENPA 5SY9A 4AUEA 3UJNA 1IZYA 3EN0A 3FIJA 1GGHA 1PE0A 3SOZA 1P7YA 3OT1B 3SF8A 4WXYB 1T36B 3TTVA 2R1VA 4GE0A 4GE3A 1WL8A 4RKWA 3L4EA 4L8WB 1OI4A 4BIMA 1I7SB 1C30B 3OT1A 2WJZB 4XLLA 2ZUSA 4Y1FA 1PDVA 3ZJ4A 3NONA 4OQ4A 1SY7A 3TTYA 1KWGA 2ABWA 3PQ7A 4UCFA 4ENUA 4ZDIA 2A9VA 2W7TA 3FSEA 4P36A 4AUMA 2LXNA 1CE8B 1VCOA 4Y1RB 4Y1GA 3PQ6A 4B40A 4R7GA 2VKTA 5IP5A 2ZUTA 3UOWA 1P7ZA 1VCMA 1KWKA 5SYAA 4B7AA 4GUDA 1A9XB 4K2HA 2VXOA 4ZGGA 1N57A 1M6VB 4LGYA 1GGFA 5K4AA 4MTCA 2RK3A 4L8FA 4I4NA 4L7QA 4OJYA 1U9CA 1C3OB 1R9GA 4N12A 3NVAA 5DFAA 3EWNA 2RK4A 3CYFA 4I2NA 4B31A 3PQ5A 4BFLA 1OX4B 3B38A 4MGHA 3BWEA
chains in the Genus database with same CATH superfamily
4W8GA 3KAPA 2IV2X 4QGFA 4C78A 5IDXA 3V7FA 1FTQA 1QVRA 1T5TA 2Q21A 1IN7A 2AC7A 2PRZA 3IAS6 3FR7A 1LQUA 1CJMA 1GQ2A 3GN1A 1GVHA 3FCOA 2FKAA 4M89A 4LXUA 4CMIA 3BQMB 3RBZA 3FYUB 2JAXA 4KO1S 5HRAA 4W1RA 1A96A 1H8HA 1VE9A 3NX4A 5JBQA 4RTLA 4AYTA 4N03A 2YKGA 1YCFA 4FHFA 2IL1A 2VAPA 3RTBA 4X41A 3G1UA 4RKRA 1SIUA 1TNDA 4TWIA 3VTFA 1TZ2A 3CZ9A 3TJRA 1GPDG 1D1TA 4H7HA 1BG6A 1PAUA 1YVRA 3L01A 2XB9A 3QF4B 4I99A 3H5AA 4ZPXA 3TECE 3A10A 3WLLA 2ICAA 3QKRB 4F60A 2W4IA 3V6LA 1FZTA 4AZ0A 2QW1A 1VE3A 3IOMA 1BDJA 1J0XO 2XYGA 5DOVA 1MKYA 1SVIA 2YW2A 2P1ZA 2Z8XA 3MGCA 1NHGA 1P39A 3OU2A 2Q9CA 3T9FA 1NQXA 1G8YA 1Z0FA 3EODA 4RD2A 5E3IA 1N1GA 1RP1A 2JJYA 3P8ZA 1V95A 3V34A 1Q77A 1U2QA 1RWBA 1SELA 1TM5E 2H1FA 1R0XA 4TRRA 5KNBH 1ZM9A 4QDZA 1ZNYA 3EGDA 3EQ6A 1GTMA 4N6GA 5B6PA 3O9MA 2B94A 1NBME 3CINA 4M53A 2AE2A 1G9SA 4AKEA 4JC0A 4MQ5A 4DJFC 3ABSB 3RS8A 4DVGA 4RIEA 3B1ZA 2O2ZA 3ZEIA 2ODPA 3PQDA 3BXFA 1K0UA 4BTVA 1II8B 4DIDA 1T2AA 1T8RA 2CVZA 4QFBA 4DLSA 1UDWA 4P0QB 1HLFA 2O3JA 3MS7A 4LXTA 1Z5NA 3AEUA 3QLUA 3VAAA 1F7UA 1Y81A 1Z0JA 3C43A 4P2GA 4O4JB 3WP1B 4Y8VA 1IQ0A 2YRWA 4R2JA 2XODA 2AIRA 3BE6A 2NU7A 1AKTA 4L15A 3DDSA 3ZKWA 1I2AA 2EF1A 2XVAA 5DHQA 1JPNA 3TGLA 2XT9A 1VLQA 2PRKA 4LDZA 3SEQA 5BOSB 2FWBA 2M6LA 2NSLA 2P2YA 2WU4A 1T2NA 4OKSA 4Z9YA 4KX3A 4BIMA 1ZJ4A 2L0XA 3MVEA 2JI6A 1G8JA 4LC1A 3W9UA 4RA6B 2I76A 1GPUA 3OM8A 3RV4A 3B48A 3FTNA 1T9BA 1NULA 2RJNA 2YYYA 4TXJA 1BIFA 2ZB3A 3Q0TA 5HKKA 1LLCA 3IEMA 1OAOA 3GCWA 1NMYA 4PONA 4YT5A 5KBYA 3VTZA 1J2EA 4DUZB 3TSZA 4DLNA 2F4NA 3QVSA 3KQNA 1ZN2A 3KSBC 1CTQA 3FVQA 3HCDA 3ECAA 1R0BA 1WCIA 3BIWA 1CFJA 3FMIA 4P5EA 5CIQA 4DXDA 2VI5A 2OQ2A 3AR2A 3RIMA 2WFLB 4M4SA 1LUAA 1E6KA 4BMOB 2O07A 3R5TA 4LXYA 5ESWA 3SDSA 5KX5A 1ZRHA 2RK3A 3CZRA 3RSCA 3O1JC 3SNKA 3NP7A 3LOPA 3E5MA 3M1YA 3O2QB 1TJNA 5GVRA 3PXBA 1PS9A 3L7JA 2GZAA 3CYFA 3W3ZB 3X43A 2ZSBA 4KMMA 4EHFA 2NO4A 2DHCA 1EGMB 2HUNA 5DRYA 3OBIA 3T52A 1C3OA 5C5DA 4ZARA 4BMCA 3FXAA 3OP4A 1MB2A 2FTKE 3D8NA 3WGNA 4EJMA 1BD4A 5JIBA 3B12A 2OOSA 3BMQA 1UFVA 4ENTA 2B1IA 4FKBA 4DKXA 5HF5A 4AJNA 1EK6A 1Z6GA 5LLSA 4RFLA 3QI7A 3D1LA 3WFJA 1KJIA 3DB2A 4C7OB 3SC6A 3SEFA 1E2LA 2O4CA 4EL5A 2R44A 1N77A 3RADC 5DLPA 1XEAA 4KSCA 4H7EA 2XZLA 2D1TA 1U0HC 1GU7A 4KIFA 2Q3DA 2BRUA 5CVUA 3Q8MA 4NH0A 4CM9D 2V9CA 4TLCA 2A9RA 4HB0A 1NSFA 4TTPA 3GK3A 5C5EA 4CLEA 2DFTA 1SUIA 3L5KA 5JYCA 5ALFA 4LPSA 1I7QB 1I1HA 4LI3X 1UXGA 2IS6A 4Q4HB 1YJAA 3MTDA 4CQJA 1NQAO 1PR3A 5HGXA 4UMFA 2VZ9A 3FPEA 4DCGA 4AP9A 2FA9A 4FEEA 4R51A 2W2OA 2IUTA 5K45A 2ILTA 3F8WA 3RTCA 2FMUA 2FVYA 4RJTA 2DOKA 2KBEA 3QNUA 5LKAA 3KR9A 4R7ZA 2H2AA 4C3ZA 2NG1A 4CKBB 3SE0A 3G1WA 4MV1A 2X1MA 2JH8A 4IFEA 2Y9MB 1ZD1A 2YHUA 3L06A 5MFPA 1Z07A 4V38A 4PZZA 1J1UA 1P18A 1E3TA 1N7HA 5TARA 3ZWQA 3DOJA 3QU7A 2XZTA 4KYUA 4S3MA 5G0VA 4CKXA 3KZXA 4G0UA 1VCNA 1YE3A 3OF3A 5L4NA 2NT3A 3BAZA 1Z25A 3OTGA 4N3CA 5EKXA 2NWQA 1MU0A 2B5OA 2BLLA 2V8BA 4MVCA 1F06A 2GMWA 3IQHX 5DNDA 4Y1EA 2RD2A 5EAIA 1M75A 1RM5A 2H2IA 2YYZA 3LECA 4S1PA 4NQRA 5IJ9B 4JT9A 1PZXA 1KQ3A 4UNQA 4Z3OA 1KZ1A 4LI0A 4KRGA 4JYZA 1Y9EA 1L8QA 3G8BA 1W0JD 4REMA 2VWGA 2AI1A 4X3OA 2JD2A 2OEPA 4XGRA 1UFRA 5SICE 4KITB 1JFLA 2FH5B 3KU4A 4GP6A 1T36B 2QHXA 1CUIA 4EHLA 1Z5ZA 3OJFA 1M2WA 5GJVC 1OLSB 4WD3A 1UDXA 2CL0X 3DP7A 4Z8YA 3VTKA 4DCMA 5B6JA 4NVRA 5A04A 2GAFA 1PZFA 4EG4A 5CFZA 5AVWA 1GKUB 1JP7A 1KR2A 3I01M 3LH5A 4FCVA 5HDBB 2G25A 3LXUX 1I0IA 3O03A 4IDPA 3RYIA 3RRZA 3TOXA 2QI9C 4PRZA 4DABA 1HH4A 2Q3JA 1T5SA 1VIAA 4CT0A 1PS8A 2VK8A 4EX6A 5KU7A 3P7MA 4L9RA 5LQAA 3HADA 1JJIA 4JZYA 4FFBA 4XKJA 2J9RA 3UA4A 3LIIA 4UBJA 2AZXA 4R40A 4HEJA 5FWXB 3ONNA 1V96A 3QPDA 5IAOA 4WXMA 5M5BA 3A9SA 3PEUA 1BDIA 2PMBA 2XMCA 1R0CA 2VWHA 4YRRA 1UBRS 1E7RA 1JG2A 4LV6A 5LQSA 3SQWA 1G3IA 2CUZA 3N2EA 2H85A 6ABPA 1K8YB 2P9CA 4YUZA 4Y7DA 1G5IA 5EWLA 3LX8A 1OC4A 1EK2A 4UTNA 2YBDA 4I1YA 3ROQA 4EENA 4JQOA 4UQOA 3GPBA 1H6AA 5BR7A 1OH5A 3QBJA 3RWBA 1E2MA 2Q29A 2X4DA 2R6DA 4ID9A 4M21A 1Q2UA 4FEAA 3PZBA 2VNAA 1U1GA 3KELA 1Z68A 4FT4A 1ZR2A 1FCJA 3QW2A 5CXQA 1TEXA 2ZRCA 2ZATA 2RG1A 5IFKA 5AUOB 1J21A 3M1AA 1PZEA 2UYGA 3ADOA 1S7GA 3EASA 3G2NA 3E22A 4G6ZA 2LDXA 4OL0A 3U4HA 3UCXA 4EY5A 5K6AA 2CBZA 2ZBUA 1WP4A 5E9JA 1KXZA 4J90A 4Y2UA 4GGPA 4Z0PA 2RAUA 1NF3A 1QH8B 1XHEA 1KAGA 4EYOA 4ENRA 1QIFA 1K63A 1MQSA 2HX1A 1JKXA 3Q15C 4HVAA 8LDHA 4IHJB 1MJGM 1PR0A 4RNDB 16PKA 3IESA 3MWDA 5DIFA 5JJ5A 4FN5A 1V11B 5JQWA 2BHRA 4BE7B 4TS9A 1P2SA 5CH3A 5C1IA 4ZCIA 1CUJA 2GHTA 2PLFA 4KV7A 1YDHA 3SYLA 1LU9A 1Z73A 3FGNA 4MUMA 3C2QA 3IEPA 3QVGB 4RQTA 4WRRA 5EUQB 5AVSA 1FUIA 5AW1A 5HR5A 2QNIA 4NZMA 1NBOA 4HN9A 5KS2A 1DIAA 1O5OA 3PUIA 2EVWX 4GX1A 4OHBA 4UKDA 3FFTA 2H0AA 4MP6A 1RXYA 2CHEA 4LCJA 5ALSA 4HZIA 2UYQA 2JHFA 2LE0A 1TA0A 4UBKA 3GLGA 2IHNA 4G36A 1LBIA 4DLUA 1NN0A 1Z5UA 2AVNA 2VNHA 1K2WA 2X1HA 3L6EA 1KQPA 2VP9A 3T15A 2PV0A 4OVKA 4FHGA 4QEZA 2OV8A 2YV1A 3RKUA 3ZHZA 1Y8AA 3LUFA 3MLBA 1AA9A 3GPDG 4GMFA 4H1UA 5AVUA 3JVIA 2E5FA 3PFWO 4AJHA 1IBCA 1U7ZA 1IZYA 1VG8A 2NZ8A 3RWMB 4UXJA 1DARA 4Y2JA 1APBA 2O8DA 1PE0A 1GDDA 4WCVA 5ALTA 3SOZA 1H1DA 3BL6A 1P75A 1Z37A 5FLEX 1DO8A 1FTGA 4W9NA 4BNFA 4BFXA 3OIUA 1XV5A 1OH8A 2XWPA 3GEMA 4FIZA 2NYRA 4PSVA 5KQRA 1ZIXA 3ICCA 5KO2A 5B53A 1ID1A 2XBMA 1JQ3A 2R6ZA 2WT8A 1WHSA 2QT1A 3ET4A 4B35A 4D4MA 3FSEA 3Q2OA 1GZ7A 3TEFA 2O06A 2C2YA 1DWQA 4AECA 3KB8A 4XQCA 5KREA 2H18A 2NX2A 4ICIA 4B9EA 2B3DA 5JEDA 2FK7A 3KVRA 3HCFA 3F90A 5A4FS 4A91A 3E9RA 1Z4IA 4LQLA 3RR2A 3RROA 1QLWA 3KYCA 3ROZA 1CRLA 4RPJA 2EOAA 5AI8A 1YAJA 2GYVA 4MQBA 4XD7A 1QOPB 5KQPA 3ORFA 2O5EA 3VNVA 1U2DC 5FBLB 4WN3A 3EXFA 5EHNA 5WRFA 3P4XA 5E4YA 3Q88A 1DC4A 2HMTA 2QTZA 2O8EA 4LC0A 1YK0A 3C15C 1FTNA 4YHBA 3PICA 2R25B 2C3MA 5IC5A 1M1YB 1XDBA 1QDUA 2CBXA 3C3XA 3FNBA 4HTAA 5EMHA 3VUFA 5BY2A 3GO4A 4BNNA 1JIQA 4LVUA 1WZ2A 2DP4E 1X92A 5K7SA 3OFVA 5HRUA 1RBZA 3BJEA 4DSUA 1KYWA 4BECA 1H2XA 5CJ2A 4V1CB 5F7XA 4NBVA 4ZYZA 5BN5B 5FLXA 2ZJFA 1CY2A 3KJHA 5F7OA 4R01A 5JMTA 1A7AA 1Q22A 5FA5A 3OPVA 1X8LA 2R4UA 4AD8A 1C7RA 3OTHA 4YP1A 2C07A 4TLDA 4EPWA 5JPIA 1DBQA 3AERA 2O7SA 3NH9A 4UCWA 3AEZA 3OT5A 4OTZA 3FWNA 3UWPA 1DAFA 3Q72A 3TMYA 1PG5A 4WZBB 4G5QA 3H0EA 2JD1A 5F7JA 4X3CA 1JEQB 1PV2A 3WK9A 3LY8A 4BAGA 4HDKA 3D4BA 3N39C 3NO4A 4QGHA 2DWUA 2YHAA 4TWAA 1A2OA 1AKYA 4DA4A 3FSJX 2YWHA 1PJSA 1R1DA 3OQJA 3WYGA 1QBGA 3N7UA 3QPBA 3D2LA 4I4LA 4Y2HA 2P6UA 4PF1A 5JNRA 5CA1F 4UQLA 4QQKA 4RXTA 4D0NA 3WOHA 5AW8A 5KQSA 2A9OA 3EXHB 4GI1A 1X1AA 1P2FA 3AUKA 2ZAYA 1LB1B 3NVKI 4Q6WA 4M49A 4HDRB 1S96A 2XYQA 1VRCA 2DF8A 3LS2A 4AWAA 2GEUA 3E8MA 2CXQA 3OEHA 4G8DA 4MGIR 1PZGA 3RC3A 5L51A 3AVTA 4B3GA 2VWQA 4MWGA 1GP2A 2GJKA 1YC5A 5JSKA 4YUYA 3TSWA 4BVLA 3H83A 4I55F 4IDNA 2X8BA 1W5EA 1RTKA 1K1EA 1E0AA 4C2TA 1QKKA 3O4VA 3X1YA 1ESZA 1KKLA 4CKCA 5FR2A 3N76A 2ACWA 3P9RA 2BEKA 3ZLUA 4DADA 1VLMA 2IYVA 2JCVA 3U37A 5IANA 4I81A 1A9RA 4OLHA 4DSAA 4ZEWA 1EFPA 4GVLA 1H1LA 4IJMA 1C7ZA 3D6AA 2DPGA 2CDNA 3QXXA 4NBKA 3QNMA 4YN3A 2LIPA 3MD0A 4J7CA 1DRKA 3IMCA 3UJ7A 1E6WA 3O1HB 4JOCA 4RF3A 1ZL0A 2FUNB 1A1VA 4XW2A 3IP7A 3ZWBA 3HBJA 1U4SA 2DG2A 5JAOA 4AMVA 3C6QA 5KSZA 4WDQA 1JMKC 2FR8C 3AJDA 1DBRA 3BEOA 2V6FA 4O2LA 4P7KA 4W82A 4BO7A 4CIDA 1Z0UA 5K8UA 4DR1B 3CZ5A 4FE7A 1A2BA 4DV2B 4HWSA 5TEVA 3WGJA 4CMHA 2P5TB 2L82A 4LHZA 1NSTA 5BUCA 3AR5A 3ICOA 1KEVA 2GA8A 1FSGA 3GNLA 1N6HA 1YZGA 3ZBPA 2HDNB 3FJOA 1ECCA 1XZIA 3CNNA 1YR1A 2K4MA 2R48A 1L4EA 5CXXA 4NQZA 3KT0A 1V5EA 3P9NA 4YRLA 5AUQA 5BSRA 3RYHB 1OPXA 4BNXA 1F2UA 1YASA 3ZUPA 4NNOA 3EMDA 3FLEA 2GCPA 2OXCA 3QK7A 3SBEA 1K3FA 1NW8A 2OYSA 3QA3E 3PE6A 3RRXA 1LDEA 1E99A 1RM0A 4GOOD 3FCSB 1ANKA 2CMHA 2JJ1D 3E8XA 3IXMA 4RC9A 1QJCA 4Q4AA 5AD1A 1XTTA 4KWIA 3B2EA 1NYLA 2EZ4A 4ZQIA 5E4TA 2QTTA 4BJ6A 1OXTA 3TQQA 5JAMA 2FOIA 2R5NA 4X65B 4IZ6A 3BWBA 4KRFA 2D06A 1XROA 1Y1RA 5G0SA 1ODLA 2ANCA 1K7CA 4TTVA 2P9EA 4C0KA 1Z7YA 2HEGA 3GJYA 3FZGA 4WOJA 1BU8A 2ECKA 4B84A 1ORIA 3WADA 3KQPA 4YAOA 1E3JA 3HXLA 3V7YA 3WMXA 3OEEA 3LCCA 1J20A 1GR0A 4BLTA 1AMNA 4UAUA 3NNSA 4ENVA 2FKNA 4QIHA 4D44A 3KHSA 2IRWA 1WG8A 3WRXA 1PJ8A 1P5JA 2PS1A 2GBPA 3VR4A 2HMVA 3FTEA 3OE7D 4U7HA 5KTSA 3FTQA 4WY2A 3SMVA 3D7LA 5IUNC 4RKYA 1ZINA 1SEVA 1H8ED 2PGNA 2WF8A 4LOAA 1NVVQ 4X1YA 3AH8A 1T1SA 3M9XA 4XB2A 4BEWA 2C7OA 2YVKA 1RYHA 4FWBA 1KOFA 4E1VA 4EYEA 3E0QA 3MM4A 2WYWA 3KYBA 3T1YB 3FUUA 4FXPA 1DKOA 1MO4A 3RE1A 4PSKA 3ZQJA 3K6KA 3JYLA 4WFQA 4BKQA 4DCNA 5FWAA 4RTRA 1JAIA 4RA9A 3JR7A 4KYIB 3ZU6A 3QWHA 3O8QA 2O59A 5ALRA 2RFLA 2HRRA 3H1EA 1WW8A 3HCWA 3T9CA 2B4RO 2GILA 2R00C 3BWDD 3F74A 1SPBS 2BFAA 1NZJA 2WHPA 5D8DA 3G9XA 3MJHA 1LF5A 3EQ9A 3KQOA 4DSTA 4O4LB 3KRTA 1NG9A 2GWRA 1EMDA 3HEAA 3IBGA 1C81A 4EABA 1QZZA 2FN8A 5BT9A 3VZRA 1UUFA 3W1VA 3DO5A 3TNJA 5B5SA 4D7AA 5FL7A 2CFOA 1E9BA 3AEYA 3W5VA 4JWTA 1W4BA 2WTAA 3IHLA 5LDDC 2HSDA 2AG5A 2O2CA 1Y4AE 1PCXA 1TIBA 5LNK1 2ATIA 1SC4A 2VTBA 1S3GA 1DRUA 3P26A 4MUAA 4Y9RA 4D5EA 2BDUA 2OFPA 3KV3O 1W5AA 4MA0A 1C3LA 5CTAA 3A9RA 1YB7A 1X19A 4UE3S 5BWOA 4TOIA 4GWLA 3TQOA 3QJ5A 5IC4A 4P1ZA 4E32A 3JQDA 1XN1A 2XYPA 3ZGVA 3ZI0A 2DECA 4AF8A 1UKVY 3NC0C 3DEFA 3TNDA 4LYFA 1KZYC 4MMZB 4G2TA 1C1DA 3QYJA 3D8SA 4WLOA 1QMPA 1KJ9A 2RC6A 1AF7A 3MTGA 1GLNA 2N1MA 2O0JA 4TRJA 2D1QA 1F9AA 1SVNA 3WLRA 1XQVA 4PTZA 3GHYA 1M5RA 4Z7JA 1MX5A 1E8NA 2GJAA 1J22A 3IPLA 4X24A 4CTOA 3T8YA 3OQVA 3THRA 3D8HA 4OQFA 3IIKA 4LPKA 3W77A 1TZCA 5HM6A 1P5RA 3R3XA 4X8HA 4ZYTA 5KTMA 2J0UA 2ZCUA 1DU4A 2PL5A 3R6LA 4LNAA 4PYKA 1T5DX 3COVA 1M0SA 3RANA 1KBOA 4B33A 3P2EA 1IDOA 4J07A 4URVR 1H5QA 2WW8A 2PRSA 2TMGA 4ZOQI 4Y2XA 2F00A 1U3CA 3FWKA 2C5FA 2R7LA 3PCXA 1SG9A 1W29A 3FVWA 3NM4A 1GTJ1 2W11A 2VDOB 4MPPA 5ABPA 4CCWA 2OK8A 3PC2A 4RF5A 4RIIA 5K8TA 1E9EA 2A1TR 1AUQA 1L5FA 2WE8A 5C8VA 3R7NA 4TTJA 1U1EA 3CKYA 3DB1A 4FW9A 4GICA 3M3DA 1JHXA 4KR9A 4BMZA 2BGGA 1CYDA 2JHPA 4ZO8A 4D9EA 5BN4A 2EIHA 3JD4A 3KUKA 4J94A 1M2NA 4OJTA 4PAWA 5LKRA 1BGVA 4JUIA 2EU8A 4E5SA 4BKRA 3H6HA 2HQSA 2IX9A 3LDGA 2Y66A 3Q85A 2R62A 4R84A 1ZD8A 4WINA 5A02A 3IBFA 4RQUA 3DTTA 5E6RA 2J3EA 4EHHA 4L0DA 4S1NA 2FWRA 1G5QA 4UD6A 5CNIA 3BE5A 4INOA 3UMYA 4N8DA 2EKPA 2W70A 2PKXA 2R1VB 2X9GA 4PM4A 5IN5A 4CBVA 4ETIA 1EAMA 4GWKA 3WGZA 4QODA 4WZZA 4D81A 4MUBA 4J0CA 4BO0A 4PAGA 5HUHA 1RPJA 2YNMD 4QTZA 2G5CA 4EI9A 2DLCX 3TD2A 4EFMA 2JAOA 2DGDA 3RFTA 2ZIGA 3UC9A 5KOHA 1W49A 2Z2IA 3U80A 3ZIDA 5HUQA 2HNKA 1ML3A 3L6RA 4LS3A 3ANSA 3RW9A 5CM8B 3NHWA 1LQ2A 3A9TA 3ESRA 3EC2A 5EIOA 3ZBTA 4AJKA 1JB9A 3X1MA 3C1TA 3B13B 4R8KA 4OB6A 1DJLA 2VP5A 2OESA 3I2GA 3UJHA 4MRAA 4DMHA 1TT7A 5K3EA 5I9SA 3LBIA 5JAPA 4UMEA 4MGYR 2M6KA 3U5TA 4W9MC 4XVRA 3DPIA 3BC1A 1WULS 3ANXA 3RRNA 4RLFA 1Z2EA 1EDOA 2DWPA 4G24A 4KQCA 4OYHA 4IF4A 2ZPUA 3EN0A 4GIBA 4JP2A 4EPVA 4Z54A 1DG9A 1FMFA 4PU0A 1P91A 2EW2A 2R97A 2MSLA 2QPLA 3DLTA 2W4QA 4EPXA 3GN2A 4TWZA 5K99A 2H29A 3PRYA 1RC0A 2CSUA 4Z4CA 1XPOA 4WK2B 4OI0A 5KJ6A 9MHTA 2XVYA 3WYNA 1D5WA 1PK8A 3UJDA 4BWFB 2GTPA 2I1WA 1IVYA 1HFWA 4MP3A 2B25A 1X3LA 4RK7A 4RV9A 3JCZA 5ITWA 5IYZF 2YXBA 1D2MA 4M60A 4E6EA 5JWOA 3LDAA 2GDZA 4Y2QA 4CL2A 1PJAA 4FGSA 4A5SA 1DX6A 4XCQA 2JGKA 4RD6A 4EG6A 2WUVA 3CR8A 5H7XA 2ZBGA 4ZCTA 1N0UA 1WPXA 3M34A 4URYR 1DFGA 3CE6A 3COSA 1GAEO 5JDIC 1MRZA 3JYHA 4DRXA 1KO5A 2XQJA 4LYAA 3URKA 1Z7EA 4DTIA 3H7IA 3MK31 1Z62A 4P3KA 1DFHA 3KE9A 2VF4X 3NGMA 3OZEA 5H83A 1WPQA 1WSAA 4JEMA 2ESRA 4PC7A 3RU3A 2GI4A 3UM9A 3ZDXB 1BQ3A 1XI2A 3VO9A 3DV2A 4JH0A 3U44B 3EWAA 2W6ID 1KI6B 4O5AA 4AJEA 3U4MA 2QQGA 1ZNXA 4QNNA 3LT4A 4BPRA 2EBHX 2ZS7A 4ECEA 4YRIA 1VIDA 1E3DA 1RW4A 1M33A 4W7HA 4AY2A 4DDMA 3TLCA 1JQDA 1LBQA 2HK8A 3NIFB 4C4ZA 2CZCA 1LY1A 2D4AA 2NO5A 2EX0A 1BO6A 3PF8A 1ZMRA 4WKCA 2PNFA 1X7HA 3GARA 1N2CB 3G7SA 3PUJA 3DGFC 3HBFA 4EMTA 2TECE 4M1QA 4AIIA 2G3YA 2X42A 3FYHA 2GCOA 3VYVA 5GP1A 3MCWA 3OZSA 1XTUA 2VK2A 4KKXB 4DB2A 2QLNA 3UH0A 4JGGA 3RO7A 3ZXXA 4GLLA 4AF6A 1HNXB 1NOJA 2P9QA 4IH4A 1NTRA 3TTTA 4C6TA 2A0YA 2SHKA 3EF3A 4KK3A 4AROA 2JDID 1P6UA 2XEDA 3TUIC 1XEWY 4BX0A 4HUTA 4HZUA 1HTTA 3AFHA 4JGIA 3R5XA 4L4UA 2XLBA 5K9ZA 4YRSA 1BDHA 2PGXA 1A71A 3VH1A 4EL0A 1KXJA 1PUIA 4B6GA 1V5WA 4LY6A 2HJ9A 1W0KD 1RRKA 2E85A 2GNPA 4II3A 5FBZA 3TO5A 2OCBA 4EJ0A 4M1MA 4ZQGA 5EJEA 4W99A 4IIBA 3W5BA 2VDPB 2RI1A 2XUDA 3SZUA 4II7A 1OWNA 3FG9A 3KVNA 5KHOC 1DPFA 3EPRA 2RBKA 1K6MA 1Y33E 1USKA 3KYDA 5L3SB 1L7AA 2C5LA 3OC6A 4P3PA 2XMGA 3ZS8A 5AESA 4KQXA 3OVMA 5HQTA 3K5WA 1DX4A 3T99A 1Y1KE 1RXEA 3P97A 1L4FA 5ESDA 2YYSA 1CG6A 3QJYA 5F2NA 5JH7B 2CBGA 2OR3A 4EY8A 3R9XA 1NW3A 4YRZA 4C87A 3AJ9A 6PFKA 5BQXA 2W2QA 3S5UA 1YAHA 1GUAA 3JAWA 4A1FA 2GM5A 2RKOA 1Y1QA 3G0OA 4KDEA 3WYCA 2AOWA 4M8SA 3G0IA 4UFPA 5F9FA 1N4AA 4RY8A 4U8GA 1NA5A 2AKYA 1GNQA 2DCUA 2Q5JA 4R9VA 4DUGD 5BYAA 1E2NA 4F92B 4KXFB 2OXIA 1E3QA 4U2EA 3ESZA 3EIQA 4QOIA 6GPBA 3DD1A 3DDOA 5GVSA 4CM4B 4YRPA 5DNCA 1Z08A 5DCLA 4HPJB 4TWRA 2GRJA 5LNK6 2GVZC 4UVGA 4QM7A 1CVIA 2DQ4A 1DJMA 2Q5CA 4Z9AA 3GAFA 2GOYA 3PENA 4LEIA 2A3RA 3AFOA 1KWGA 3K94A 1YDEA 3F7MA 4R9NA 3MERA 1RWXA 3U4QA 1M83A 4AUMA 3ZNPA 1U8EA 4DCTA 2DVMA 5U4QA 4G0OA 3GFPA 4G0ZA 3S1AA 2VBFA 1U3GA 3IV6A 4WZAA 5LUAA 2WUDA 5FOQA 3RRBA 2W2PA 4G5OA 3AF2A 4H6VA 4OB8A 4X63A 3ILYA 5LA6F 3SSMA 3IUEA 1DADA 2Y76A 5E6SB 4ZT5A 5AP9A 4YUXA 1Y63A 4JR2A 3HWX1 1QH1B 1COWD 2Z2ZA 3BJZA 4RVUA 4HB4A 4FOTA 1J2TA 4IEIA 1IHYA 1LBHA 1V8BA 5AVKA 5F21A 1JR3E 3KTOA 3PXEA 2QA5A 4IJVA 1TMOA 5EXXA 2BC9A 3CV3A 4NONA 5BWLA 3IVRA 4BNDA 4NESA 3NJRA 2O0HA 5JC8A 1IG3A 1W0JA 4Q5IA 4CF7A 3SWWA 3D43A 2BKEA 3L7MA 4JYPA 2R11A 2RHBA 4L0CA 3UWMA 4URFA 5BPHA 2OO3A 4B73A 5A5EA 2WUEA 4XPZA 1U2PA 1RCFA 4AXBA 1EX6A 1EFRA 3AF0A 4B2YA 4ND1A 1FQWA 2C2XA 1O6ZA 1W36D 3M4XA 5FPKA 3H11B 4OJNA 5DBHX 5KTOA 4FFSA 2YJZA 1TQ2A 1ZM2A 2AJCA 1MPTA 1UDBA 3KHTA 4J7UA 1XJCA 4A8JC 4K9KA 2GT1A 3ZWXA 1JG6A 2ID8A 2QAIA 4PPNA 1KVRA 1MEEA 2XAAA 4PRYA 4TMZA 4JASB 2NP7A 3H5WA 1U2SA 1B2RA 2YWDA 1DQPA 1BHJA 3LF1A 5DWVA 5IXSA 1J70A 1ZRMA 1LBEA 3AOEC 4MVYA 2C2BA 3L9XA 4BC0A 4DJDC 1DL5A 4FKMA 1BCSA 4Z3KA 4JYMA 2A35A 1GA1A 3YASA 4B4VA 2BZGA 2D3WA 2I33A 3MQ4A 5C7OO 1NBEA 3C8UA 4Z0TA 5IZCA 3IC5A 3GJ4A 2G0AA 3P9IA 4PS0A 3AETA 3NHBA 3QEAZ 4CKEA 2Y4NA 4CCSA 4MPRA 4ZZ3A 4X94A 4MV0A 4P4SB 1QQ6A 3ZY5A 1YR2A 3KR1A 4BFWA 2NOAA 2C9CA 4X6XA 1GT91 1MPXA 2XADA 1QHNA 3HFRA 3SR3A 1R10A 1DG1G 5IF9A 1G0NA 3ZCPA 5HMMA 2YMMA 1VYHA 3BCRA 1O6CA 3LQKA 1ECBA 2F9LA 4XQGA 4H7KA 1B0UA 1A76A 3JWHA 4PSAA 2W6MA 3I73A 2IBTA 3CN9A 5K2OA 1YFKA 4EEXA 3JSXA 1O4WA 4OMFG 3ZWYA 4HCJA 2EDAA 4MLCA 4F85A 5DBFA 1E1CB 3MG9A 1O58A 3WQHA 3BGWA 4GR5A 1IQUA 1N36B 5CIYA 3RGGA 2HWXA 2V58A 4M9CA 5KTNA 3CJQA 2CGEA 2R6FA 1YVEI 3RS7A 4M1EA 4PQEA 4N7RA 2F8SA 3LI2A 1Z9BA 1V8DA 1I14A 2COEA 3AF1A 3TDKA 3ZGLA 2B7LA 2WY2D 4XQ0A 1JAXA 3WY9A 1RCUA 4X8OA 3LQ4A 1BX1A 3RSSA 1LTQA 1GXSB 1WU7A 3W1EA 2VQ3A 2AJDA 4AZVA 1CR0A 2BFPA 3JWIA 1X9IA 1MOZA 1VIYA 2AWOA 4NPHA 5IULC 3OQ1A 4JLJA 3O38A 1EP1B 3RRFA 4OJKA 3ROXA 2JAQA 5CNKA 4L4RA 2OV3A 1UOPA 2ZXEA 3FLMA 3IVXA 4FE3A 4GOXA 3ZJ4A 3MQ2A 2RHHA 4Y2SA 3MTQA 2JEZA 1ULZA 5DM70 1JYEA 2FPSA 2VHWA 3PXDA 3LXMA 1XRRA 5J2UF 2QV7A 5TF4A 1R9NA 1TYDE 4GOLD 4K5QA 2JBAB 1V71A 3E9QA 4BWGA 3ZY2A 4P7BA 3GCGA 4WK6A 4YRMA 2HQOA 3GLHA 3N6VA 3FF1A 4ZOCA 1F48A 4DCUA 2YIDA 1UC4B 3IE2A 2O2XA 2J1LA 2AFHB 4RKQA 1M2OB 6REQB 3IMFA 3PQCA 1QYRA 5COAA 1CUWA 2FPWA 4UZEA 4KG7A 4RETA 3OQNA 1MCZA 4R1OA 4YASA 2W2VA 1KDPA 1OHHD 3E3MA 2YN2A 3VO2A 1ZSYA 4R2HA 4YX9A 4V3BA 1HE4A 3UBMA 4D5GA 3QTBA 1JIXA 4NU0A 2ZE8A 1NX9A 4CL8A 4Q4JA 5DSZA 5DLQC 1TU4A 3IDZA 5EIFA 4RV4A 1L4LA 3QF7A 3F1LA 3JV7A 2Y68A 5LSAA 1KI3A 1CR2A 4KODA 4IGFA 2PZGA 1Z34A 3E7PA 2DFVA 2Z56A 4RWEA 1YZVA 4LYYA 4JITA 4QYMA 5KJEA 1NQVA 1SHZA 3EG5A 5HTKA 4Q7QA 2CXOA 1KJNA 3ACDA 3MHPA 4JZKA 3V2GA 1VLLA 4YBRA 4GRAA 1K27A 4OGKA 2CUKA 4LTDA 1RXUA 1P60A 4DGQA 5C5IA 1XJWA 1UXKA 4DBLC 1EE1A 1Q16A 1VLZA 2WVAA 3C6ZA 4YRNA 2DR0A 1OI3A 2GTIA 2QROA 3AJRA 3TPCA 5IKPA 3GRAA 3R3VA 2HDHA 3AR4A 3EMBA 4LKRA 4ZMRA 5FUQA 4JNCA 3P9KA 4RF2A 4N0EA 2OQVA 1Q74A 4NPCA 5JPDA 5JR3A 5I9BA 1V6AA 2HWYA 1SHUX 1XEXB 4GOJA 3EEOA 2G6BA 1MHPA 3BMCB 4BY9E 4CLOB 3V8NA 3B1WA 4ZU1X 4CT5A 5JSQA 1XVLA 1ZR4A 2WIBA 3IAHA 1XAGA 3T7CA 3RC1A 4NZNA 4LRXA 2Z8YM 5KOIA 2O0LA 1G8MA 2WJGA 4J0IA 4V0ME 3TINA 2IYPA 5DTIA 5FXMA 1Q44A 1JDBB 4M9XA 3TTWA 2F3SA 3R09A 5HIKA 4OOEA 1JS1X 1QAQA 3QFFA 2C04A 4JEIA 2VXYA 2XIJA 4KO8A 1C0LA 2XVMA 3DZBA 4D80A 4P7JA 1JQEA 2ZE7A 3UAVA 4EJSA 2CDBA 4BNTA 1HOTA 3IXQA 4PLWA 5LP6B 4LXGA 1UP7A 3HYNA 2XW6A 3HVRA 1ABBA 2YWRA 4J9UE 3GUUA 4YJHB 4YO8A 5FPPA 3U7IA 2FCAA 2B69A 3FMVA 4B34A 5E7QA 1YBAA 1IY8A 3UXEA 3R6DA 4O4HF 1PI3A 4ZVPA 3TSAA 2WSSD 4HDNB 3SP1A 3WWOA 2DTXA 2HAEA 3IUYA 4YDQA 1VBFA 1WOYA 1DIGA 3L2OB 3WLNA 5L9AA 1KI4A 5GJCA 1QG2A 1MOSA 2P5UA 3WSTA 5JPCA 3CTPA 4HNSA 3KIPA 1HGXA 1X38A 4DLXA 2OFOA 3ZN2A 1I3MA 4ZHQA 1OFVA 5EJ9A 5DN9A 1LZKA 3AYZB 5J4VA 2WKQA 3RC7A 2I66A 4KQ9A 3MAAC 1L2TA 5G2OA 2FQXA 1U90A 4WDRA 5BMOA 1UM9B 3LSTA 3BQNB 3D0QA 4KDFA 2VXOA 3HKEA 4F4CA 5ALWA 2GASA 2Q0SA 3OX1A 3L7LA 4JBWA 4JKYA 4KLAA 1U0LA 4KQHA 5AT1A 2IU4A 2Z09A 4M36A 2J4FA 1FU8A 4MV8A 4R2KA 3X1WA 1MAAA 4WHMA 1BVRA 4EVSA 2QPAA 5AK5A 5BT8A 4GECA 2C83A 1JECA 4DLAA 1NMZA 4NMLA 3KTFA 4BV8A 4RAQA 1WCYA 1WMDA 4CEIB 3EISA 1FA9A 1AUXA 1Y6ZA 2PQ0A 4UTPA 4LGCA 4JB8A 4UUPA 3UTDA 4KBFA 1FUYB 1IJFA 2JLSA 1CXZA 3CURA 3GG9A 4IX9A 4L2IA 4C43A 3VNBA 3MJFA 4GU5A 3ZHRA 2PU7A 1C30A 2XCLA 3I45A 1XXLA 2R6JA 1V8OA 3IIJA 5EP4A 3M33A 4RD4A 3GLSA 3EVBA 2FYTA 2Z9BA 6YASA 3ZNNA 3VH2A 2HGSA 2JI4A 3QE3A 1HTBA 1KS9A 4PXYA 4DLWA 1LSOA 2AV6A 2V9PA 2VAXA 1E5QA 2VHEA 1DKUA 2Q1YA 3W8EA 3I4LA 3WZ2A 3RYIB 3WC4A 1NJ2A 3L7BA 5EPOA 2C4NA 1I1QB 5F3RA 5ES4B 1T5HX 2AOTA 3G8CA 1J42A 4HX9A 4RUKA 1F3OA 4MP8A 5CJJA 3TLBA 2FPPB 3UOAB 4O3MA 4GPEA 5BSKA 3PDCA 4KPGA 4RVGA 1GUBA 2IP1A 3JQ8B 3W8NA 3WV4A 5I5GA 1N5KA 4YCCA 2NZUG 1HSOA 3PR3A 1IUOA 3HZHA 1E4YA 4JJ8A 2D2FA 2H48A 2MYUA 2VT2A 3NBZC 4JBNA 3C1AA 3F3KA 3H05A 1VHLA 2FOLA 4A26A 4BATA 4K6HA 4PWZA 2RG7A 1KMQA 4NZYA 2FZLA 3AJ8A 2YHIB 2VJCA 5IBPA 1MC5A 1C3XA 2BGKA 2J32A 4FHEA 3JD1A 1EDEA 1ZY2A 5SV2A 4Q3CA 2EV9A 4Y18A 2ZBVA 2AN4A 4N7JA 2Y1GA 4FHDA 1LDNA 4XR4A 1WMAA 2P3QA 3HCAA 5BR1A 1G5RA 2GK3A 4BQSA 2A84A 5REQA 2Q8NA 1Q15A 2RGCA 2F48A 3AHEA 3DOCA 5FTMA 1ZJWA 1N8TA 5EE1A 1FPMA 1RI3A 1UAYA 2BPOA 4KI7A 4PCAA 4PBTA 3S68A 2P41A 3A25A 3H16A 4CIAA 3NIDB 3UMFA 1OUMA 4IXWA 2CE2X 1E5LA 2IP2A 3QJGA 4MQFA 3UMSA 1W2GA 1F8FA 3W2FA 1ZBQA 3I23A 3R5HA 3N8NA 5E9AA 4HI0E 5A6SB 5AW5A 3ZNOA 4NYMR 1P5FA 3P9SA 4F9EA 1FPQA 5B2EA 2V0CA 1ZG3A 4EJ2A 3OZXA 4AUEA 3A9UA 3OE7A 4IIJA 5JVDF 2VL7A 4GOMD 1RAAA 3C3MA 4M6WB 1Y9DA 221PA 4XJTA 4G85A 1H8EA 4DE5A 5TIIA 4EIWA 2REQA 1IUNA 2C77A 4I50B 4MUJA 1Y5LA 4LOIA 3UWDA 4DC0A 1D4AA 4E1BA 2OQRA 1A8UA 4BZWA 5BOVA 3ZQ4A 4DIUA 3OLZA 2HSJA 3U0BA 3HK2A 2ATCA 2JCXA 1P0QA 2BMEA 1B6GA 2JCGA 4DJAA 4J0JA 2XA2A 4DWWA 1WKBA 4GSKA 1JE1A 1ZU4A 3RM3A 4FFVA 4G07A 4E31A 2PIAA 4D97A 3OUUA 2FB9A 1JSLA 2VYQA 2O05A 2PT6A 3KSUA 3G9TA 3M5CA 3V1YA 3CNQS 4CIWA 4AI6A 1A69A 1FFCA 1KI8A 4HJRA 2WVGA 3SC3A 2NXNA 3T5GA 1FFBA 5JSZA 3CEJA 1EG7A 2FSIA 2R8EA 3NV9A 3VVLA 2X0EA 5T64A 2ZQYA 3VZPA 4X45A 1SZJG 4N5LA 1CIVA 3EPLA 4PG8A 5BUQA 3DBLA 1GTZA 4BMSA 2EGUA 4COKA 3NDBB 4H4CA 2QW8A 3GF4A 3DULA 3QXGA 3X1KA 1XQWA 5G1NA 5LIPA 4ZOAA 4F3KA 2PWPA 2BY4A 3DE5X 3FRIA 4PIPA 5I48A 2XD4A 5K2MA 3O75A 3PQ2A 1L7OA 3SXUB 1MGPA 3TR0A 2HK6A 1CK4A 3G9ZA 1AQNA 1ECLA 4F0JA 2LIVA 3U3RA 5EE3A 2DKFA 3K1ZA 2PPLA 1P8AA 5EA2A 3TIVA 4D82A 3F9CA 3LT1A 4DQDA 4ENSA 2IOHA 2ZIAA 2PX4A 4KEAA 1NFFA 4NI5A 3CVUA 4JSTA 4BMYA 1XUOA 3DMRA 5HFJA 3TBFA 2BLNA 1I1NA 3OA0A 2IW3A 2QR2A 1NI5A 4HUQB 2ZRKA 5G4KA 3WYAA 2BFEA 3CRQA 3NETA 5DMXA 3NFRA 1V41E 3OQPA 2GN6A 3LD9A 4WUVA 2GZSA 3N7TA 1SCNE 4Q3DA 1VRVA 2I8AA 2QIOA 2IYUA 4RSGA 3VU8A 3ZV6A 5IVPA 2J5KA 2NVBA 4B6QA 2ZYWX 3L0BA 2BOVA 3LNTA 2Q1XA 2XNSA 1ZONA 3L6UA 1B0PA 2MINA 1QYCA 3EMKA 3SU8A 5K0LA 2CKDA 3FUVA 5B1DA 1WKCA 3KZKA 5IEBA 3RS2A 3VR4H 3NHSA 1VXRA 4HLNA 1WD5A 4P83A 4AIRA 4V3CA 5I01A 3DKKA 3EWSA 1M1NB 1V4NA 3Q6IA 4LZPA 5EZ5A 4MVJF 3SZOA 4KK4A 4J43A 3LY7A 2UDPA 3I6IA 4WWHA 5FUWA 3UYKA 1Z3IX 1RBYA 4GAEA 1EWRA 1QFMA 1LRLA 2RGUA 3FRHA 2JIOA 3QZUA 3OCJA 1NZDA 2ZRGA 5JQGF 5LQCA 5DVZA 3E84A 5GONF 4TYWA 2COKA 5F52A 3ZHVA 1ISMA 4IJKA 4QTXA 5B4VA 4MVJE 4X44A 4BGIA 1IZ8A 2OV6A 4BQIA 2RIPA 4DMKA 3DXFA 3Q87B 1HFEL 3GFVA 4TN5A 4Y0VA 3PQ3A 4CMAA 2VSFA 4GP9A 4Z9XA 2YDYA 3HB0A 3N2GA 2YWBA 1L3BA 4Q1CA 5CRIA 3TOZA 1QKIA 1FFEA 4OHOA 2HGZA 1SBIA 4GLOA 5DP1A 1WF6A 3UN1A 2VTKA 4OQLA 3UV3A 4HQRA 3DVAA 3EG9A 3KFVA 4TYNA 4QU0A 5HZKA 4R0VA 1C7FA 4BX3A 1IN1A 3U3MA 5IM5A 1PSDA 5J47A 3ITNA 4Z0HO 1XVUA 5AWFC 2VK4A 2X0RA 1VPWA 3MYRA 1NNEA 3LVQE 1NVDA 4GEKA 3MJRA 4JBLA 3C3CA 4ZVTA 3SD7A 5AW7A 1JG1A 1GL7A 2EBUA 5EKUA 3T3NA 1SY7A 4PN3A 4ROTA 2SBTA 1Q0PA 2UXDB 4E33A 3BH7A 5TQ2B 2QTBA 4PZLA 1WX1A 1ZK4A 3LZ6A 3B78A 2X9QA 4Z8XA 1E2DA 2YNMA 3DCIA 2PGLA 3AY0A 1SHLA 3IEUA 2CNOA 3EDMA 1AVTA 4MGKR 1EDDA 4HFMA 5K8JB 3JQPA 5IT9A 2XBLA 2VYVD 4G84A 1D2AA 3PWZA 2VF8A 3C98A 3GQVA 4MUIA 5JROA 3NBMA 5EKDA 2Z3WA 3OICA 4RD3A 5TVKA 3T3EA 5JSHA 3UPUA 3ORHA 1ZXXA 1QF9A 3GGGA 1D0IA 4AKGA 3W78A 1PX0A 4C4YA 3LQQA 2H16A 5U9CA 4R8MA 1TM7E 4KQ1A 1X7GA 3N2NA 3O4JA 3RLFA 2RH5A 4OIFA 3SVLA 3M6FA 1KH1A 1ULAA 2G9QA 2JZCA 3H9BA 2PJRA 2GPNA 3IPXA 3LPMA 3PLNA 4EZBA 2YV4A 1NY6A 1WXGA 2EQAA 2IYNA 4TQAA 5A7FA 4J3FA 1G21A 3A3OA 2DUJA 3FPSA 4NOLA 5E1DA 2UU9B 3SIXA 1P7PA 2P6MA 3BGOS 3P0JA 3LUKA 1MAUA 4H0FA 4PX9A 3A27A 1FNDA 4Z3DA 2QSJA 3CKLA 1CR1A 3FLAA 1JIIA 2WK1A 2ZYTX 4DEVA 4F3NA 2HF8A 3KXLA 5JZOA 3MTEA 1OVMA 2EW1A 1U0GA 1VMIA 3HCCA 4LHWA 4PC2A 1QG4A 3MEQA 1K3TA 1G8PA 4IIHA 1RXWA 4LJRA 2B8TA 1T9KA 3R7SA 3REFA 1M1XB 2G0NA 1TB4A 1Q3HA 1R4NB 2D5AA 4RIGA 1EUYA 4F2PA 4JJGA 1GRVA 2ZOSA 4O8CA 1UP6A 5ALOA 3RJ5A 1XGKA 1FYEA 5DEOA 2DHDA 3UMMA 1ENZA 1NF8A 1UR5A 3K1AA 1CRZA 1Y0BA 1ZEMA 2BFFB 2BSAA 2EKBA 3L4BA 4PFQA 5CA0F 3ED5A 5FULA 4H3KB 3RS0A 1AMUA 4WBNB 1SKUA 2O14A 2W6IA 2H17A 4JI8B 2NU9B 1IM2A 3HN6A 4X7RA 5COBA 1QS0A 3AB8A 3VU9A 5LYJF 4W5NA 1GL9B 4ZI2A 5LYYA 1GNPA 1M2GA 3GUZA 3JVEA 1QHEA 2QLTA 1A5AB 1QUFA 3IOCA 3KJQA 5EP1A 3U60B 3FYDA 1DWUA 5GGYA 1IEQA 3K4PA 3OE1A 1F8UA 4B9AA 1BXGB 1SBNE 4LWPA 5KYXA 1FNCA 2WTUA 5EZYF 4F71A 4WE3A 2NUAA 4LNUA 1PNVA 1BW9A 4KC0A 4EFLA 4AJOA 2J85A 3VYSB 3A9WA 2I3DA 4M88A 5CVTA 4KPYA 1AH2A 3R23A 4TKVB 4RELA 2H4FA 4ARZB 4B7UA 1I13A 1X2BA 4ZV9A 2IYFA 3M49A 4LZAA 4PPYA 5EWJA 2IPXA 4XWKA 2VDLB 2R6CA 3DOEA 5EWJB 1E0JA 1MHTA 2AQIA 2BZ1A 1Z39A 3N5KA 1Q57A 3GDOA 4NABA 1SXJB 3V8QA 3IT0A 4H0NA 4OQEA 3KAJA 1W0KA 4PO3X 2ACVA 2X6TA 1G1AA 3N3AC 1EK1A 1P2UA 3NCHA 4HPWA 2UZ4A 4BV2A 5H3LA 1Z12A 3WRXC 4BB6A 4P4UA 4DF3A 2KLBA 3Q40A 2WA1A 4NNPA 4B3TB 4GDFA 1I5RA 2G1UA 5AKEA 5FBWB 5K0TA 5ED4A 3GFQA 3SS9X 2A86A 4OXXA 4N9QA 4NYJR 1MOQA 1J0DA 4BGDA 5CB4B 1YL6A 1Y7HA 2UUBB 1X6VA 1J7KA 2V0GA 4DQKA 2JJ2D 1YB1A 1BRMA 4TL7A 1N75A 4DWVA 5ITVA 1E3SA 1RHJA 1H3EA 3HSYA 1QV7A 3OZGA 3FKQA 1CUAA 2VF5X 1L3IA 5FRDA 1M0EA 2I8CA 2C3YA 2VP4A 5FHRA 5LBUA 5E0OA 3EGCA 2A94A 1CUVA 1GUFA 1IHPA 1SCUA 2DUWA 3ETGA 3ZEAA 4DUGA 4F5WA 1GPAA 4NH4A 2ZULA 1UOEA 3AM5A 2RKWA 4UM7A 1K06A 1TOAA 1RVV1 4UDYX 3NTRA 3ER6A 5HYVA 1E96A 2BUAA 4L4XA 1RMTA 4M0FA 4NEHB 4HXYA 1L5NA 5C1DA 4O4HA 5JJIA 3EC1A 5J2TA 4UBOA 1M8FA 4FCWA 2I6QA 3IT1A 5KVQA 3BHJA 3PNOA 4H1VA 4JJ6A 4EGQA 1R12A 3HP1A 3ODPA 5LCXA 5CLFA 1ZIDA 3BCSA 3G6KA 2P0AA 1QMGA 1E0SA 4GPBA 4QFMA 1X8XA 1F12A 4HY3A 3QKIA 2WB2A 2EF0A 4ITUA 1QF7A 4J29A 4DZTA 3FAKA 2JHCA 3MPOA 4CJXA 2Z5FA 1G0OA 4I4TF 4Z2YA 3MJEA 1VDZA 3OC0A 4JD5A 4RF4A 2WG1A 2WNHA 1XTQA 1VB3A 1COWA 2G1JA 2QYTA 4J0HA 1WR8A 4FOLA 4RPIA 1FYWA 3N53A 3SYTA 3W5HA 4IV5A 5A3QA 2O0KA 3G23A 2D74A 4XIJA 2AF3C 2I2XB 2R1TA 2VPPA 1GPMA 2DX7A 1I4WA 4LX8A 1TE2A 4PZDA 3T3OA 4Q3OA 4GFDA 2AUNA 4YAFA 1GUDA 2E55A 2R9VA 2YOFA 4D9BA 3VA7A 3O1IC 5H1YA 3RYFB 2Z83A 3TZLA 2B9VA 3PEVA 1OE0A 2QTMA 4AO7A 5AICA 1VYUA 5L3VA 1F6DA 2ON6A 1K66A 1FZQA 3SQMA 5CDSA 3ESXA 4L08A 2IGBA 2DJ5A 2YQZA 3SS7X 1Z6YA 4BP9A 1W75A 2XZPA 2EG5A 4TL9A 4OBXA 4WKBA 1U6IA 5LDGA 4DPMA 4EW3A 5EUMA 2HRCA 2FWPA 4YQZA 1BX0A 3LP6A 1TYAE 1E4EA 4MS3A 1RHMA 4QBGB 4Q9LA 4OLAA 1GFZA 1V3VA 4II2A 4Z6KA 3T1TA 3HFGA 2GYUA 1C7EA 3DXYA 4JEUA 5FPYA 1MN6A 3K20A 1W85B 4P3OA 2KS6A 3D4OA 1D1SA 1XRPA 2GYYA 2YW9A 1S3IA 3DUWA 4IDCA 1KS2A 5ERXA 1I80A 3PVZA 1M7BA 3O93A 5K0EA 4LV8B 4J75A 2R1ZA 2CY0A 2ZJZA 4OIMA 2HQRA 4R8RA 3TGPA 3BF7A 3EZFA 1JYFA 4F3TA 3OG9A 1NPTO 1VSTA 5JCJD 4MKXA 1JTVA 5TX7A 3T3DA 2QN6A 1MC4A 3HKDA 1BWQA 1XTVA 5EIWA 3FD8A 1L4UA 4BWVA 2ZRBA 2P79A 3H19A 1C0KA 3P71T 1NMSA 1ICIA 2FGJA 4BU1A 3RCBA 3U3KA 2JVJA 3K70B 3H75A 4MCJA 3WHIA 4AJ4A 4L8FA 4C7BA 3G79A 4H1WA 1HYHA 1U9CA 4LOJA 4G0XA 1IMJA 2XH8A 1VB5A 2P4EA 4L5IA 5FJJA 3KJIA 4G0NA 1OIWA 1V9CA 2G7ZA 4WX2B 2C3UA 4KR7A 4HVTA 3BD8A 2JKZA 4CQLA 3EJ6A 1LQTA 1MW9X 2AG0A 3L02A 3SSNA 3C5VA 3HWWA 4YMSA 4LFAB 5HCNA 1ILEA 3ASVA 2P40A 4K81B 5HQ3A 4DNQA 4HQNA 2A5GA 1E8MA 2QTVB 3UZUA 1XVTA 1LZLA 4URXR 1JMVA 2W4MA 1T2DA 6AT1A 1GGNA 1HL3A 4HSEA 2HHCA 3QWIA 4W5WA 3LFUA 4UNIA 3TR6A 3H97A 4MOWA 5KVCA 3HBNA 5J23A 2CDAA 3LQRA 4AZ3A 2ILVA 1GHTA 1TK2A 2EX1A 3DKIA 3SXJA 2IA5A 2QTGA 3MZ0A 3KCQA 1PG2A 821PA 1ITZA 1XMIA 4MV3A 1GQQA 2JRCA 1HYQA 4GKKB 4LJKA 5DNVA 3T1QA 4BNWA 4DDWA 1MABB 1VSVA 2X9NA 3K3PA 1YFJA 5HS6A 1YJXA 1N5DA 3TW8A 5IJZA 1NJ1A 3OWOA 4K9MA 3WQQA 3W4IA 1DIHA 2F90A 2AFHE 4CCYB 1ZFNA 3L79A 4RMGA 1XJ0A 2BH9A 2R8RA 3OCUA 3N75A 4FMPA 2Y4OA 2Q4TA 3INRA 4O2BF 1P81A 3QUCA 2PZJA 2Q1WA 2GAIA 3CZAA 1T9CA 5ILGA 4EYQA 5INTA 4G1UC 4JDUA 5AVQA 2QKYA 1OHHA 3IGFA 4A5OA 3HA2A 4DLRA 3VBCA 2C7PA 2H0QA 4OB7A 4NAHA 1ISIA 2NAPA 4CR8A 1FFXA 5E0KB 3B9QA 2Z08A 4GZMA 1NLMA 2DY0A 3WO1A 5K05A 3UWSA 5I7EA 5JAHA 4MRMA 3AUTA 4M86A 4UNNA 5DMHA 4HMOA 3P9PA 2J0EA 5CYGA 3RU7A 3S55A 4JMPA 5LWHA 4ARSA 1IWPB 1QE5A 1UC9A 1OA1A 4W7IA 4MYCA 4YI5A 1BX3A 4YJGB 2DBZA 3G2JA 4CUZA 2FSVC 1MX9A 5CX4A 4U9IS 1GPKA 2OORA 1ZUWA 1BJRE 1E0DA 2O8VA 3QPAA 4QICA 1KEUA 3WDMA 1X7YA 1E62A 4Z9FA 3VYRB 5J5VA 4ZYVA 4XDGA 1JRLA 4OLBA 1B43A 1Z7BA 1B74A 4K9QA 1H9CA 3KCNA 3OPXA 3KFXA 1DEHA 1X80A 4H6XA 4BNUA 3U40A 2CFCA 3DMDA 4OXRA 5TLSA 2ZIZA 3H5IA 3TE6A 2F2TA 4QZVA 3KUUA 3PUHA 5ALMA 2J3JA 4PQFA 3T9AA 5EIBD 1Y3FE 2M2IA 4NE9A 2OHFA 2FETA 3NIBA 2MDTA 4OUDB 2ADOA 4NBWA 3T0GA 3TLYA 2Z5VA 3H65A 1NW9B 3FDXA 1Z7WA 3ID6C 1TA9A 2FPIA 2H59A 3DMYA 3H6GA 4JI6B 4PHHA 4BO4A 4DAOA 3QBEA 2HBYA 4KLZA 4NCHA 2IZZA 3NJ4A 1SVUA 4WLEA 1TUIA 2ZVPX 4LZWA 4CLRA 2X8JA 3BEDA 3MRVA 4MVJA 2IPMA 2QNRA 3Q5GA 2G17A 4UEKA 1VMDA 4J4BA 5K3CA 3HYSA 1SG6A 1UAGA 1TQHA 2RGYA 3QELB 4U8HA 4G1FA 5I7WA 3T3GA 3LRPA 1U7XA 3ZWOA 2G40A 1ZRNA 4R2XA 1Z22A 4PLVA 4EWLA 4L6IA 3ZJYA 1RYFA 1Y82A 1ZD3A 2HWWA 3DDHA 1PZNA 3QMVA 3TRFA 1PT5A 3I6ZA 2F55A 3KYJB 3C8MA 3GDGA 4HQKA 1V7QA 2IUFA 3PS9A 4JODA 4DFDA 1XKXA 3ROKA 4JUBA 2Q1TA 2XE6A 2HA3A 3HDJA 1L4MA 2EWVA 2WSSA 3I09A 1SCDA 1QGYA 2DZDA 5F5LA 1CJSA 5JWHA 1E63A 3A1FA 3ICQB 3OE4A 4R3UC 3BIXA 4M0MA 4RDIA 2POQX 5CVEA 2JLBA 4PHTA 5EXPA 4L73A 3KTAB 5DN6A 4G01B 5ITZA 1T6ZA 1X7DA 4ZAGA 3ZDAA 3SBXA 4K9PA 1TKRA 2NXJA 4KXWA 4KMRA 4XPIB 5I8WA 1CQJB 3F47A 1UXOA 2CE7A 4EVRA 1BZYA 1RD4A 4C4SA 4OY3A 4I8IA 1IEVA 1ZGCA 3ZHOA 2J9ZB 3SN6A 3NTLA 3H4MA 4MEJA 1FC0A 2X6RA 5H82A 1L1FA 2UUOA 3TAHA 1WUKS 1MAVA 5TQVA 4P33A 1BDBA 2XF8A 4INJA 1MFZA 2V7QD 4A0QA 5TPZD 4MQLA 4LK2A 1XLWA 1WXHA 4EG1A 1LW7A 3GRYA 1AQUA 3CF0A 4A73A 1OJLA 4RY2A 3CX7A 3R7DA 1Z0DA 4QXAA 1M34A 3CXRA 4AVYA 1JG7A 3EFBA 1I7PA 3FVVA 3H8SA 5C35A 1Q1BA 2RK6A 3OFND 4U0JA 4D41A 3VSAA 2CLHB 4JHLA 5IVHA 2EL9A 1C4WA 2VJMA 1QVVA 3C7KA 1W4ZA 3K8YA 4J0KA 4URWR 4UVEA 2ZRQA 1C29B 1N2JA 2JFBA 4XYBA 3IKTA 4NYIQ 1F4VA 2PUVA 3FWHA 1DC3A 3T35A 4EJ6A 2B20A 2IEZA 5JYEA 4PNPA 3MOIA 3VR2D 1D0SA 2H63A 2V5AA 3QM1A 5DGTA 4RXUA 1RMYA 1E2IA 3K9NA 4M7RA 4WK4B 2KW5A 2BW0A 4MW5A 2IXAA 3KR2A 1OI7A 3T7EA 3EDQA 3EA4A 2O3UA 3JX9A 3OM1A 1YWGO 4G1BA 4KQMA 4MUYA 4NBSA 4CKWA 3T5DA 2BIFA 2A57A 5KOJA 4OHKA 2B83A 1YA6A 4LMAA 5K6RA 3FPBA 1AB6A 3RC9A 2C5EA 1NPDA 2HLPA 3FSRA 1R5OA 2AJLI 4O2AF 2Q7OE 2Q4EA 4X7PA 2ZM6B 4IS3A 1OLOA 2XUQA 2REXB 4W5HA 3BTUA 3LW7A 1BOOA 2YYAA 2PIDA 2XGJA 2O8BB 3UHPA 1X42A 3OT1A 4BFTA 4DMCA 1VMEA 3U2QA 4KFRA 1Q0QA 3O0TA 2JAHA 1NV9A 3D59A 4HL6A 3EULA 1Q7GA 1EP2B 1VQ1A 1IULA 2HPVA 2DFDA 3M4YA 1GD1O 2IIQA 5I9TA 3TMAA 2G36A 1PT8A 1CVRA 2QLBA 1ZXLA 1DOAA 2WJHA 4EKNB 5HK9A 3FAZA 1ZQ9A 1ADYA 2H3EA 3U1VA 2XE8A 3UMCA 3WIUA 3B3FA 4PGMA 3GLIE 2C8KA 3RK4A 2ZRFA 5CA0A 2QD2A 1ULSA 2ZRMA 1K8QA 3ZWVA 1KEPA 1CJUC 1FDUA 5H9VA 1NVXQ 1HYBA 2GN2A 2QRQA 4MCAA 5K3BA 4BLQA 1HFJA 3DEZA 1Y1TA 1XL1A 4N12A 4L3WA 1U0BB 1D03A 3PDHA 3AUYA 5T5QA 1JWLA 1LPNA 4HXGA 1Q6YA 3WVNA 7AT1A 3BICA 1V37A 3BGSA 5DRTA 2PLNA 3H1GA 3B38A 4Q47A 3T5BA 2D7JA 2CNNA 1U2ZA 2G8LA 1ZH4A 2O2GA 2ZQZA 4IOKA 4D9GA 4DLTA 1G2OA 4PX3A 3HJCA 3JSAA 2PFSA 5EZ6B 3TSOA 1CY4A 4ER6A 3OM0A 1O95D 2KMLA 4ERNA 2ZTVA 2C7RA 3RSHA 3A6PC 2GNAA 2WAMA 2A1UA 5I7FA 4TV8A 1ZGGA 4CTKA 3EB9A 4IF6A 4Y1RA 4J1SA 2X0FA 3FHLA 4TRMA 4KH1A 3CZMA 3HKBB 1I7DA 4E5VA 1M1ZA 3ASZA 1SC9A 1A9XA 1P74A 4BVBA 1JL3A 5JZVA 5M2QA 4BKMA 3A6JA 3TIIA 2Q6LA 3WNDA 1JU4A 4X92A 5JC1A 1GRQA 1YFZA 1HMYA 2AZDA 2HA7A 1R15A 1SQGA 3AP3A 4KQWA 5EYPB 4CLXA 3LW8A 1CF9A 4KAXA 3M89A 3ND8A 2IV7A 1EVZA 1GTG1 1NN1A 1U94A 4ZK6A 4CEHA 1GILA 1ZMBA 3FFXA 1P2GA 1CF2O 5DHRA 1ORWA 3VPCA 1DB3A 2QLMA 2VSQA 3WRVA 121PA 2IHVA 4G0QA 4JY7A 5EIEA 1Q0LA 1LLUA 1X7ZA 3K0HA 3IUNA 2YXNA 4JDPA 1UQUA 2E0IA 1UADA 3AMVA 5E8JA 1RBQA 1B41A 1VKHA 4C0SA 3LTEA 2OGSA 2PMKA 3MCVA 1LS1A 4G86A 3NUGA 3ULKA 5A4DA 5DNYB 2C4HA 5U1PA 3RFCA 4F4DA 1YRBA 3FFWA 2D1SA 2HOQA 2NO9A 5F73A 1R74A 4OATA 4P54A 3OZVA 3QNWA 4L78A 3WB1A 3DT9A 1FDVA 1JQ5A 1JTEA 1VDMA 4CPDA 3FNEA 1MB4A 2OECA 2XOEA 1JAZA 1UDCA 3HACA 5C80A 3F98A 4HATA 3GEEA 4UVDA 1X39A 2OUKA 3H2HA 2VNJA 5IUKC 3QEKA 2XKAA 1TLTA 2JFOA 1L5MA 3V3TA 2HHLA 1V16B 3F6PA 1XVVA 4ETWA 5B55A 3BWYA 2BFDA 2B92A 1GGHA 2AEFA 4B2LA 4BXOA 1QORA 3EIUA 1BE1A 1ZSNA 2O6LA 2P0YA 2C5GA 4OLJA 4IDFA 1OKKD 3SF8A 2WYHA 1JLKA 1RFGE 5K0CA 4DR3B 1B8UA 1UBNA 4GE3A 4PQRA 5EVJA 3H87A 4XSHA 1KYXA 1UJ5A 3IAXA 1QE0A 3U4IA 3U9SA 3GRUA 1Q20A 1QXSA 3Q3CA 4NENA 5AOCA 3D3EA 1PK9A 4RYLA 1GYRA 3AFNA 3EGXB 3PI7A 4HEA1 2LXNA 4LW8A 3TEJA 3ZV4A 2CW5A 1ACLA 1G7CA 1B7GO 5FA6A 4I4TA 3I64A 2P3LA 3KNZA 4Q16A 5E6UB 3I12A 1V1JA 5K1ZA 1ISPA 2I2AA 3IBCA 3LLUA 3KXDA 5JCPA 2OCGA 5L6MB 4HXEB 4CMEA 1N92A 1U9ZA 3C8DA 4OMCA 1GADO 1ZX1A 3VI3B 3ICVA 3PTLA 4WH0A 4DREA 1CZRA 2PFGA 1UFKA 3U16A 1OBFO 1KI2A 3UPTA 4LTNA 4ZRMA 5AVXA 4HYTA 3RUDA 3DC2A 3VPAA 2FN9A 3OLVA 2EJTA 3GVIA 1HKHA 2I6XA 3CVXA 3SI7A 5KKAA 2Y0DA 1UMDA 5I4KA 3AVYA 4K7JA 3AW8A 5AHXA 3VDRA 2X41A 4IXNA 2WZBA 4XLTA 3ZCRA 3K7EA 4L5JA 2FW7A 3KZMA 4RDCA 2PX0A 1M6EX 3M6UA 4BZPA 1D6NA 2D59A 2XGMA 1K86A 4B09A 4YAUA 4NRDA 3BGDA 3HDYA 1QIHA 4ZQEA 4KGDA 3U1TA 1N5IA 3Q0EA 1KJQA 5CDGA 2ASEA 5EMLA 3GGJA 1L5LA 1SULA 4YR7A 3THXB 4Q7JB 3WQBA 2PHZA 3MNFA 3ISJA 3O91A 4PBRA 1A9PA 3HZRA 4M46A 5I7UA 4ZI7A 4G56A 1Y4UA 4E5KA 4EJSC 4IH9A 1YFLA 2VPXA 5AIBA 1CR6A 1G17A 4C0QC 1YQQA 4CQNA 3KXIA 3LK7A 1F5NA 1V45E 5HUJA 5DZSA 3M5PA 2V55B 4OGLA 1YKSA 4YQYA 2R8XA 3SY8A 2VDQB 4EY3A 3BMOA 2CB0A 4E2YA 1POWA 1RAFA 3I83A 4BS9A 1Y1PA 1GYPA 1ZS9A 4LDJA 4ZEOA 3A04A 5SY4A 3K5IA 4ZYLA 1RQNA 1H2YA 1ZM7A 2GPTA 1XNJA 2MU1A 3A4VA 5FPSA 4B7XA 3P2MA 1GWNA 4IRMA 4YRGA 2QBYA 2VYVA 2H7XA 4JB2A 1DTWA 5DBOA 2NVOA 4WSOA 2ZCJA 5CUQA 5K01A 3OFKA 3IPYA 4B6FA 3AEQB 4N5MA 2UYCA 4JT4A 3FYSA 3IXLA 1YDWA 2XYRA 4WCFA 4TUYA 3UMRA 5CAEA 2W0MA 3AGQA 3HFJA 1YL7A 2QYOA 3A70A 4QXRA 4RACA 1JDZA 4Y2PA 1PFVA 4ZQBA 3A6GA 3HL0A 1P4SA 1E66A 2Z6QA 2QUHA 5AM5A 1JJBA 1PV1A 5AW2A 4OM8A 4ZO9A 3G2OA 1U3DA 1J07A 1FP4B 3BRWD 3TPFA 3MJSA 3GLFE 4UU0A 3KG2A 5DTMA 3RYCB 4R2MA 2QMQA 3FHOA 1YT5A 1G5PA 3ZTTA 3AY6A 3PNVA 4PHGA 3EVZA 4B48A 2YCBA 3OOJA 3R2JA 1IM5A 1NVVR 4UREA 3SHTA 1WDMA 5HE8A 2NZVG 2DLNA 5CIWA 1YL5A 4JP3A 3CX3A 4M0EA 5P8WA 5T41A 3SJCA 4BCDA 1QIIA 5BR8B 4PHCA 4JOQA 4F4JA 2ZWPA 4MLPA 2JG3A 1C14A 1UQTA 1CQWA 1UWCA 2PMFA 5JATA 1OFUX 4TVKA 2CVOA 4E51A 4YDSA 1OTXA 3EUAA 1AKUA 3C24A 2QM8A 1SQSA 5HXAA 1Y6JA 3W7BA 2J3LA 2JRLA 1OTHA 3G5LA 3N2KB 4GI3A 4P4LA 4QU8A 1UBOS 4RZHA 4AZTA 4IMIB 3SQXA 1OOEA 3A4YA 4P08A 3ENZA 5D87A 1KY2A 5DNWA 3VX3A 3KE8A 2AFIB 1A95A 4BLPA 1ODKA 3FUCA 2RGNA 2ISQA 4NBTA 1QWOA 4ZU6X 2BEWA 3FF4A 4QXMA 2QAGB 3H2KA 1G20B 4WXRA 4BUCA 2WRZA 3PF9A 4ZOLB 1PWYE 3NHAA 4JVNA 2NZWA 1BA2A 1F0YA 1T0HB 4O5OA 2I1VB 4TZTA 3KZNA 2NUTA 5HJEA 1V47A 2G83A 1O96B 1V5IA 2E89A 4YCSA 1D6MA 2G67A 4WNAB 2HFJA 4ZJPA 2BHLA 2DYKA 4QHSA 3MHTA 4OYRA 1HO3A 1LFAA 3D3JA 3SM3A 1II0A 4B82A 3DBIA 2VJPA 2YV2A 4YB8A 2CLSA 3RB8A 4IEFB 3T7AA 3UKDA 1JE0A 2I67A 1QTQA 1WZIA 4GW3A 1P7VA 4Z1MD 5B30A 1TVKB 1VPVA 1WEHA 4QHTA 4ZDJA 1U8TA 1H3FA 1A2QA 1OZAA 4DA7A 4KPEC 3SZLA 2AQHA 5JTUA 2L42A 2PGDA 2RI0A 4PWYA 1SXJE 3B6EA 1GG9A 3UJBA 3OEYA 2HA6A 5JE8A 4AWXA 4BX2A 1RZ3A 2H0RA 1T10A 4G5XA 2CFSA 1TF2A 1XXHA 2O9JA 3L1HA 3LDFA 4I1RA 5BPFA 3HVUA 4DDVA 2C97A 3EPJA 4REOA 3A05A 1PR9A 5L3RA 2H06A 3KHKA 2GKSA 4XIYA 2RBGA 1DQZA 3F6RA 1I6LA 1JQAA 2P1RA 2VO1A 4V1CI 3IAAA 3FKJA 3W34A 4HNHA 2IYYA 1Q1AA 2QI9F 4JVLA 1YTUA 1XD2A 1TAGA 3OO0A 1G60A 1JI0A 2JZOA 4GMKA 2JJ2A 1SD1A 1U31A 4J1TC 4TV9A 1RQ7A 5FNZA 1U98A 1LI4A 1FNMA 3IO3A 2A8YA 5DIZA 1JWBB 4GVXA 4LSMA 3ZWMA 2FI1A 2J6HA 3BYZA 3LXXA 3E18A 2RH4A 5JFOA 5A9TA 4TQ9A 1BC5A 3N28A 3PKJA 3ZVNA 3LYHA 1AUPA 4A8JB 4Q1AA 4U63A 1UKYA 1F4PA 1JALA 3C6MA 1ML4A 4L57A 4X1OA 1HDCA 3B3AA 4XWGA 2HL6A 1R64A 3WLKX 3LHFA 2YJ6A 4JQZA 2VAWA 3KSAC 2Q2OA 4KH0A 4KVFA 5KZMB 1U11A 2JFWA 1J1IA 2P69A 2F67A 1JU9A 2QG4A 1E2EA 4NG4A 5LOVA 3ZWDA 4YLYA 3GZ4A 1KEEB 1FVXA 1Z26A 5KYUA 4ENPA 4XIFA 5DWQA 3LA6A 5JAZA 4ND2A 2X1VA 4EBBA 2BEUB 4LF5B 2EFEB 3GMTA 4HD8A 4GT1A 2PE5A 4B79A 2GJ8A 1OYOA 1DAHA 2J7PD 5G4LA 3SLKA 1NYRA 3K9WA 1ETHA 3NNDA 2YMPA 1T3LA 3PNSA 5B3LA 3BTOA 4QGGA 1R4MB 3RI3A 1ZVQA 5DGDA 4ZC8A 1HLDA 4RPKA 2O54A 4JLMA 5D1HA 4Z2AA 1GT6A 4GNKA 1P6QA 1OLXB 4PGHA 4A92A 1DBSA 2ZKIA 5H3HA 3EIEA 5A1TA 2WWWA 4QBHA 2ID9A 3I3SR 4WW0A 1K8RA 4EKYA 4G0WA 4CIXA 1IE3A 2PLAA 3FUWA 2A30A 1IUPA 3ZIAA 5AI4A 4YJ2A 1F51E 2V4ZA 3TAXA 4YPOA 3NP9A 3U17A 2XUKA 4LMBA 1W94A 3EIFA 4B6JA 2C4VA 4BB9A 4KR6A 3L4JA 3JTEA 1USIA 2PMCA 1K5PA 1W35A 2PUJA 4F3YA 4U3JA 3U7FB 1O03A 3RAJA 5TQ0B 3EPKA 1YC2A 4TZKA 2I4IA 4RORA 2YWEA 3K1YA 4YNBA 1TLLA 3N87A 5ED0A 3S8MA 1XNGA 3BFXA 4YRQA 5D7BA 3C6XA 3I4FA 2PH1A 2E4AA 3OMWA 1FJXA 5ALLA 3G2KA 2ZI7A 3H99A 2FRVA 4D56A 1BJTA 3GELA 2YQ4A 3UOGA 3QGMA 4YMGA 4NULA 1UCFA 3CCCA 2ZRLA 3FR8A 1IPFA 1AS2A 2H1VA 4A3SA 3KUDA 3QEBZ 1ULHA 5CJPA 5E7JA 1JLLB 4ZCPA 2NZ2A 3DE2X 2GBLC 3HSKA 2O8FA 4TYMA 1TCCA 2GETA 4I9GA 1P5HA 4OK6A 4N0QA 2MSEB 4Q4LA 3GR6A 4O2AA 4D3FA 2YN0A 1N9GB 3EY4A 2WWGA 3FROA 3F5DA 4RS3A 5ADVA 4F5ZA 3NHUA 3QW4B 3DYVA 1JZQA 3G0HA 1ESNA 1Z6QA 2A1IA 3BRSA 2QTCA 3PGKA 3L1IA 3RG8A 4LBVA 4CM8B 5IT0A 1EGHA 1A97A 1KO7A 1SC1A 3DE4X 1V8ZA 2W22A 4O25A 4RV5A 5GJWC 3GWGA 2GEVA 3NH6A 2HDWA 2XYVA 5F77A 5KJFA 5F51A 4BRWA 3VR6D 4MYHA 2VZEA 4KPUA 4A6DA 3Q8LA 4WXHA 3CF4G 3VR0A 3CU5A 2H54A 3EGDB 3GYBA 4YO7A 3RK0A 1RI2A 4MVXA 4PO9A 5C1OA 3OOHA 1DUSA 3IP9A 3M81A 4HYEA 2VF7A 2H4JA 4FZRA 4UMDA 4BQNA 1JEJA 5M29A 3H04A 4J9VA 3ANMA 2VXBA 1NKVA 3GP5A 4JL8A 4Q7EA 4S2UA 1S2LA 3DBHA 4C0HA 3ESBA 4J6EA 3OZCA 1U9JA 4ZVQA 2RBEA 4Q1FA 4MW7A 3ZU3A 1MGOA 4V24A 1ZDMA 2HTEA 2YNMC 4N01A 4REQA 5LZ4A 3ZDQA 1Z6AA 1NVKA 2BMFA 4J0DA 1TT5B 2N3ZA 3FI9A 4LRWA 1OBOA 1BVUA 4NE2A 3TTXA 3V33A 5CDFE 3K5PA 4Z4HA 5ITSA 3ABZA 3N07A 1OH6A 3VH3A 1T4BA 4RHXA 3QU5A 3WK6A 1FP6A 3PA8A 4C07A 1IZZA 1MF7A 1RKXA 3LSYA 1P4RA 1GFSA 3EK2A 4WOCA 4JXZA 1JEAA 2FSHA 4H3HB 1Z2DA 2CL5A 3PEWA 1OF1A 1SB9A 3UJ8A 4BEVA 5BV8A 1DGQA 5CITA 4LJ7A 3RUCA 1QPZA 2AFVA 1S2OA 1UBJS 3DP9A 3LMKA 2FX2A 1N2SA 1FU4A 3ICEA 3AVQA 1JYSA 3S8YA 2ZEJA 1IVNA 1QG0A 3JQCA 3R6GA 2J30A 1H2HA 1H22A 3CH5A 5KVAA 1YI0A 2FXIA 2JC3A 3L1UA 4QOHA 4DQLA 2A59A 1CY6A 2FFJA 4Y1GA 1X77A 3U3XA 3VPGA 3UOWA 4DS3A 1EFVA 2AG8A 3PNLA 2NPFA 4XWOA 2R65A 4B7AA 4GUDA 4DPLA 5KX5B 4K2HA 3TQFA 3FB4A 3DE6X 4OBEA 2PWAA 3U7HB 3MRSA 4LZNA 3I5YA 3DZHA 1YRAA 1T5IA 1ZOIA 2P5SA 4KB5A 3QEMA 1U04A 1PTKA 3DQPA 2VNKA 3CR3C 4X84A 3R0XA 1NOIA 3VQTA 1C3OB 2DFKB 2V7PA 4FCTA 3FCYA 5K03A 4GYWA 5TNXA 2FUKA 5I7VA 4H9GA 3NPAA 2W6QA 2ZIEA 4BFLA 1PP4A 1LCIA 3E9ZA 1GAJA 1WU8A 3DZDA 3LX4A 3PR1A 3C3EA 1WLYA 4LG1A 3L4BC 4HEQA 3JQFC 5DSTA 4KE9A 1NKSA 1ZUNB 2R4QA 4BO3A 3AKDA 4FKZA 1T2UA 1WCV1 2EFDB 1S01A 2ENWA 3M6XA 1PT7A 2ZG6A 5JXWA 2FFBA 3HKCA 5JJBA 1GGEA 1T8TA 3I9NA 2YMLA 1UBLS 4CM7A 2FE1A 5C3MA 5C4IA 1E77A 1CY7A 3O2JA 4LMRA 3QI2A 5C5CA 3MINB 2IYXA 4X91A 1G2QA 1GZ3A 4NZPA 2FPKA 2ZBPA 3BORA 1IEWA 3MWLA 3HU5A 3PNQA 2XB6A 3OTIA 2MR5A 3EGVA 3VR5D 4TS4A 2DWCA 1K5GA 1KGSA 2C00A 1ND6A 4F9GA 1C3EA 3DTYA 1V7ZA 1JQJC 3A0RB 4UFOA 4ZZIA 4AN1A 3KD3A 1OT5A 1KAQA 4DZZA 1DDGA 2B3TA 2V65A 3MN1A 3V00A 5EJ6A 2VJLA 1CZKA 1YNOA 2OXEA 2IDKA 3OCCA 2WP0A 4UEWA 5E7IA 3RS5A 2EJBA 1W19A 2QQEA 2QZPA 4YAIA 2O7QA 2GN9A 1EJ0A 2N47A 1RJGA 3K72B 5BVGA 1AZLA 4JOSA 4B3IA 1T35A 4PCVA 3REOA 2B1JA 3LO5A 3VNSA 1UK6A 4B74A 1MEJA 2RI6A 3KDAA 3MJCA 1SVKA 3N8KA 1VTKA 4ZVRA 1G6Q1 4DIOA 2WWIA 4NBNA 2QGNA 1I1OA 3E2IA 2DKOA 2V0NA 3AV3A 3PRHA 4JU8A 1AUOA 1XRNA 4C03A 1CT9A 4HDQB 5I7OA 2W6JD 3T38A 3EEBA 4QDKA 4FT2A 3BWXA 4DAEA 5BSWA 1T0IA 2BFMA 3FCAA 3ZJ5A 4HBGA 1PNOA 1QUEA 2F59A 4BN4A 2FEXA 1EXMA 3K31A 4UPDA 2YVUA 1NX6A 3RKRA 5KYGA 1ADCA 1HV8A 2JANA 5T3YA 2M6RA 3QF4A 4UULA 2HXYA 4RVOA 3JYOA 1BTOA 3C1OA 4J1NA 2DR3A 2IVFA 5GMOA 5GAJA 2J45A 1VHJA 3LL7A 3G6WA 1FLVA 5EOVA 3WMGA 4FWIB 1FDWA 2JW5A 2OBYA 3HJGA 2C5AA 4XGNA 3TSCA 1NU8A 3M6IA 4V0QA 5T4BA 1E92A 2PX8A 1P7YA 1MDFA 4LZOA 3NRBA 4IIDA 1LKZA 1XMVA 3SZRA 3K71B 4BB5A 4OI4A 1KTIA 4CQMA 2PV7A 5AJWA 3MXOA 1HWYA 3IJRA 2IXTA 3OD5A 2V7QA 2C9MA 2C4MA 2Y1EA 4KLNA 5TPZA 4C7VA 5LWQA 2PH3A 2Q4DA 3CWQA 1UMBA 3NONA 2O2EA 3SBDA 1S2MA 5JCOA 3OMLA 3H5TA 4DZRA 4AMGA 3PU6A 4LHVA 4E5PA 3BSWA 2P78A 3EOBI 3K32A 5B3KA 4TYYA 1E1LA 2JAPA 2XCUA 4O1IA 2CXPA 5EJAA 3TD6A 5TY0A 5A0VA 3OFNA 2FNAA 1DIOB 1P45A 3CKMA 2ZU0C 2PSFA 3PDUA 3WIDA 4FX5A 4B6EA 3VKVA 1IRIA 1NVFA 2IPAB 1Y9AA 4WIAA 5IJXA 4K2AA 1HY3A 4MO9A 4O4JA 5BYKA 3ZWAA 1Z13A 3MC1A 2LCQA 4PX5A 5AI6A 1E20A 3LUJA 3GLFA 3T9EA 5EN4A 1EXDA 3OZ7A 3GUHA 5HF6A 4XEUA 4P7FA 4JYAB 3A0UA 3TZBA 1JU3A 4US1R 4C0LA 1Y48E 3B89A 5H02A 3TKYA 5BOSA 4KHPB 2DE0X 3SYMA 3OJCA 2BM0A 2YFKA 2WA2A 3UAXA 3PUZA 1GQFA 1NJFA 4MVJH 4ZGBA 4LF9B 4I1PA 2P3OA 5IAEA 1LK0A 2I1LA 2ZBRA 4RA6A 3B5JA 1RJWA 3VOSA 3KP1A 2VSNA 1PNRA 3V6MA 2JFUA 5FUBA 4LCBA 1NQUA 4D4HA 4E5YA 3KEFA 4XYEA 4Z49A 3OFSA 3FTDA 1KMMA 1Z83A 4FUTA 4N5HX 2RHWA 1E3LA 2PYIA 5HZGA 2PUBA 2XTJA 4N47A 1J8FA 1XJ5A 5FNVF 2NTNA 1GKYA 1P0MA