3EWNA

Crystal structure of a thij/pfpi family protein from pseudomonas syringae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
242
Chain Sequence
SLHPHAMPDMGPDMNKVPWMGDEQIAMLVYPGMTVMDLVGPHCMFGSLMGAKIYIVAKSLDPVTSDAGLAIVPTATFGTCPRDLTVLFAPGGTDGTLAAASDAETLAFMADRGARAKYITSVCSGSLILGAAGLLKGYKATSHWSCRDALAGFGAIPTEARVVRDRNRITGAGVTAGLDFGLSMVAELRDQTYAECAQLMSEYDPDPPFNAGSMKTAPAHVRTAMIELVAEFTKKADALAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of a THiJ/PfpI family protein from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
molecule keywords ThiJ/PfpI family protein
total genus 72
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ewnA00
3TQIA 1SOAA 2RK3A 4GUDA 1CE8B 4QYXA 4WINA 1JVNA 2AD5A 1K9VF 1PE0A 4ZGGA 5SY9A 3CZAA 3RHTA 3TTUA 3TTTA 1VCNA 4ENTA 1PDWA 3ZJ4A 1R9GA 2ZUUA 1QF7A 1S1MA 3R75A 2NV2B 2VKTA 4BTEA 1OX5A 1GGKA 1GGEA 4HCJA 2ZUSA 3NOOA 1P80A 4N0MA 4P35A 3EJ6A 4L8WB 5JZMA 3CYFA 3BHNA 4Y1RB 3SF8B 3UJNA 4UZSA 1OX6A 1G2IA 4S0ZA 4Y1EA 4AULA 1C30B 3M3PA 4JQSA 1I7QB 1FY2A 4D1YA 1VCMA 2AB0A 2H2WA 2ZUWA 4LRUA 1OX4A 1IPHA 3MGKA 4GE3A 4I2NA 4RKWA 2VXOA 3TTYA 3CY6A 1QVWA 1GPWB 3P9QA 2FEXA 1P5FA 2YWBA 1T0BA 3F71A 4ENVA 5E9AA 4B7AA 1U9CA 3UOWA 3NORA 4P34A 4ENSA 2RK6A 4XLLA 3SOZA 4BIMA 3PQ6A 4Y1GA 2ZUVA 1JDBC 1I1QB 2YWJA 3OT1A 3P9PA 5SY4A 3UK7A 1OY1A 4ZDKA 1QVZA 4ENUA 4OQ4A 1GGJA 2NV0A 2R1UA 3OT1B 3PQ5A 3UGJA 3PQ2A 4N12A 4Y1RA 3SF8A 5IP5A 4P36A 4PXYA 3FSEA 4MNTA 4ENPA 2V4UA 3L7NA 1ONSA 3F5DA 3ER6A 4BFLA 1KA9H 3PQ3A 1C3OB 4OGGA 1O1YA 3EZGA 1FYEA 2VRNA 3KKLA 5DFAA 1Q2UA 1L9XA 1OI4A 1GPMA 4OJYA 3NONA 4OGFA 4UCFA 3TTVA 1T3TA 2OR3A 3FIJA 1VCOA 4K2HA 4ENQA 2WJZB 1PV2A 4B40A 1KWGA 3TTXA 3PQ7A 1QDLB 2D7JA 4ENRA 1CS0B 5SYAA 1I7SB 3L18A 1WL8A 1QVVA 2R1TB 1T36B 3B3AA 3BWEA 3NOVA 1SY7A 1KEEB 3GRAA 2A9VA 4OFWA 1KXJA 3ZR4B 4ENWA 4Y0NA 3EFEA 3TTWA 4ZDJA 3PQ8A 3L4EA 4L7QA 4B31A 4Y1FA 5SY6A 4RKYA 4I46A 4P2GA 4MGHA 3TTSA 1P7ZA 1N57A 2ABWA 3B36A 3UMMA 4B2YA 2LXNA 3PQ4A 4UOZA 4R7GA 1GGFA 1UCFA 3D54D 4QYTA 4UNIA 1P7YA 3N7TA 3CZ9A 3R74A 4ADSG 4GE0A 2R1VA 3P9RA 1KWKA 1VHQA 3P9SA 1BXRB 4E08A 1M6VB 2R1VB 5LIRA 4AUMA 3R76A 2VPIA 3L3BA 1GGHA 4L8YA 4WXYB 5K4AA 4AUEA 1QWSA 2ISSD 3VU3A 4I4NA 1J42A 4OIFA 4AJ9A 3ZJ5A 1CF9A 3B38A 3EWNA 4L95C 4LGYA 4L78A 1A9XB 2VDJA 3NVAA 4L8FA 4AUNA 2YWDA 4MTCA 4B5KA 1OX4B 1PDVA 4UOQA 1Q7RA 5JZOA 1IZZA 3WFZA 2YWCA 2GK3A 1GG9A 2R1TA 2XF2A 2ZUTA 2W7TA 5BV2P 3CNEA 3NOQA 2GHRA 4P5PA 4ZDIA 1P81A 2RK4A 3MIIA 4E5VA 3EN0A 1IZYA 2IUFA
chains in the Genus database with same CATH superfamily
2XZOA 1G8GA 2BHSA 4MVJI 1AGRA 3TG8A 3MWGA 3M5PA 1JG1A 2VF7A 3JS5A 4A3SA 1XRQA 2H1RA 3W9BA 3I2GA 4NBWA 2Q6OA 1GGKA 3ZHXA 1M9NA 1ZL0A 1M10A 3SG0A 3GRKA 3K0KA 3GGCA 1M2OA 1XUOA 4IS3A 3WLHA 3IYLW 5AKIA 3AFOA 3SYKA 2CSUA 4Y1EA 2A0FA 4ER5A 4EMBA 1MIOA 2GXUA 2E3JA 2BKEA 1FDOA 3VV2A 4MZXA 3ZBQA 3PFBA 1XZIA 1BS9A 3WGZA 5B3KA 9MHTA 5B2FA 3MBKA 3MGKA 4WJZA 5BW8A 3CNQS 5EQFA 4G67A 4XTRA 3JSXA 4TZ0A 1VL1A 4P54A 2VT7A 4ENVA 3CO5A 1P5FA 3DFKA 3R6DA 4KQMA 3A06A 3C5HA 1XQXA 1RWQA 2H16A 2WHPB 4B75A 5DEIA 4ENSA 3GN1A 1C7ZA 2B35A 3PUWA 3PXBA 1A2OA 1S8AA 4I4CA 4QGSA 2YWJA 3D8SA 3GOHA 1F2TA 3OP4A 4ZVLA 2FPKA 3QJYA 3VR0A 4B81A 4MVJG 2CHQA 3EA5A 4RTMA 2GN2A 2GCOB 3W4JA 3INRA 1NQVA 4J94A 1CZOA 3SQLA 1I2MA 1JHAA 1SC1A 1T1GA 2WNSA 1SXJD 2Y1LA 5CT6A 3X1JA 4AVYA 2BH2A 2UZIR 1I32A 1K8ZB 2Z2JA 5DCYA 2EX1A 2F1HA 4IGEA 4BN5A 4ZYTA 1YRBA 2BZGA 1QO0D 3N28A 1ADFA 1B6SA 3SIPA 2YXEA 2WQ7A 5FBQB 1IE3A 1IN5A 1VSTA 1Q0PA 2GMWA 4ZICA 3ZZMA 5DNWA 5K8TA 3PP8A 1SIBE 2WTBA 3QBEA 4RHFA 2M6RA 1QIKA 3A1FA 5JBNA 3IOCA 4DMGA 2O4UX 4YV0A 5JAPA 4QPCA 2ZYWX 1U0HC 4PGMA 3ZWWA 3B7PA 1AUPA 3DBLB 4LZOA 4WK0B 3INGA 5EXPA 1CEEA 3GG9A 4BO7A 5KVVA 3EQ7A 4KO1S 2A6PA 4BE4A 5JS8A 3L4BC 1FSZA 4ZANA 2OQIA 3F3KA 4JDPA 3VR6A 4YGYA 3CEJA 2JATA 4CU2A 3WIVA 5K09A 1T0PA 4FJ1A 2IGBA 1MAHA 1EVLA 3WMWA 4MYRA 2YR0A 2O2SA 1CUEA 3DFIA 4JB2A 4EF5A 2R0QC 2IOFK 5DBEX 4LRQA 3QYPA 1YCHA 4GQAA 3PVZA 3KWJA 2RE8A 4HPWA 1CR2A 4KMRA 3W34A 4LJ5A 3DUWA 2CLOB 1TZMA 1M6VB 2VSNA 2BR5A 2W5UA 5F3RA 1GYRA 1Q44A 1VCHA 4PZAA 1USIA 4DLWA 1OC2A 3RC7A 1KJJA 4PHGA 4NR0A 3OLVA 1RAFA 3VAYA 3GLRA 1Z5GA 4ACAA 4DT1A 4EGCB 5G4KA 1RQ2A 4LC9A 4K6CA 2RHJA 1NNSA 4OB7A 2HR1A 2XHZA 1YUNA 1P72A 1X9HA 2HMAA 2AUNA 3H5VA 1N2ZA 1P2DA 2AC7A 4TZTA 2R6FA 2W2NA 3FVRA 5ALJA 4JBYA 5L3RA 7REQB 1LRKA 3GLKA 3IMGA 3O8OA 1T9DA 3GA5A 2CXUA 5GZ3A 2J3KA 5IWCA 3FCUB 3LECA 2D0IA 3GAMA 4ZALA 3ULKA 5CEEA 5E4JA 3AJAA 3DBLA 4NV1A 3M2TA 1SCDA 1OA1A 4PAOA 3IR7A 1H3EA 1JFFB 2ZE7A 1ECGA 1QIEA 2GYVA 3ZCVA 3UHOA 4DZRA 4GT1A 5K8IA 1NRIA 3BDVA 3QWIA 3EXFA 4FEYA 1DINA 3HFRA 4IIUA 4JLDA 1ENYA 2ATCA 2BDUA 2X13A 4WIAA 2ZP1A 4U7HA 5FHQA 3T5DA 4DBVO 4TM7A 2NVUB 4PPYA 4IDCA 4GWKA 3ISJA 3JZDA 4ZOLF 3ZCQA 4QNRA 1C30A 2YKGA 3UV6A 4AG5A 4BDSA 2F67A 2P91A 4FFNA 3EYWA 3PNVA 4IQ0A 3LNTA 5DKFA 3X43A 4ARSA 4FUQA 5KWVA 4F97A 4MPDA 2LV8A 3NPAA 2XE8A 5EE9A 4Q02A 5CXUA 1Z16A 2IEGA 1GRNA 5D87A 2Z2XA 5F7XA 1KEZA 1KQ3A 2AFIE 3EVDA 1T34A 3NHBA 3MQFA 4G0YA 4RIEA 4YRZA 1FNSA 1QYWA 2NPOA 2Q9UA 4XEUA 2IP1A 4DILA 1KO1A 3RSOA 3HADA 1O97D 5AUNB 5CB8A 4S12A 4JIGA 2JHPA 2CMFA 3HYLA 1U8XX 4Q3KA 4A4DA 1KDYA 2QRPA 4CTNA 4MPTA 5CAEA 1ATIA 2CNNA 3K92A 4RD6A 3T7JA 3DNFA 4PG8A 1R6UA 2O06A 2UVPA 4PCLA 1WDWB 2JGFA 2QLTA 4UHCA 1WXQA 3WHKA 2WJ4A 3TF5A 1Z5VA 4EJSC 1RD4A 3PYXA 5BO5A 3WK5A 4CMBA 1SKAA 1YR8A 5AK3A 3I64A 3IAM1 5A9RA 3KSZO 2JEZA 5H0IA 3TM5A 3SZLA 3A4IA 3RKRA 2IYUA 2X8BA 4MUFA 1R0KA 3LCUA 4PFQA 4UUNA 3OFVA 3V2IA 1V8FA 1DRKA 2ODAA 3NKFA 3ZWOA 4B2PA 2JFHA 4HB0A 1L8QA 1C9YA 2PL3A 2WAXA 4EJFA 1DT3A 4DUPA 1LWOA 5LP6A 1VTKA 5E2IA 2F4NA 3DVAA 5CEFA 4B6FA 4RHCA 4ZV7A 4YRNA 2IU0A 4DSAA 1Y89A 5LQNA 4I19A 1YQGA 1VLJA 5AYVA 5ICFA 4CBVA 4X65B 1C9JA 3VDQA 1O77A 2VZ9A 3WNZA 2IYTA 1M7HA 5HCNA 4DCSA 4LZPA 1MXHA 1TZKA 2H7YA 2A5GA 3B3FA 1HT0A 3AETB 2FR8A 1E6KA 4LC1A 4Q03A 1ZA2A 3VV3A 3KSMA 1X92A 4G97A 3AR8A 2P9QA 2PO5A 3GPDG 3N53A 3PNOA 4R7ZA 5FJIA 1USGA 1XF9A 3PWKA 1KARA 1U0LA 2YASA 1QIMA 3HJNA 2IYVA 3OIDA 4LZAA 2GAIA 3D7LA 4JJKA 1U7TA 4U7DA 3ROFA 2GDZA 8LDHA 1OTXA 3M33A 4J1TC 4LXGA 2G9ZA 3U80A 2HZ7A 4IX1A 4LFBB 4FB5A 1SVWA 3WLQA 1WXHA 1D0VA 2JFGA 2BZ0A 3A0UA 3EHDA 5I7RA 3QGMA 1JKJB 2FUEA 3GBPA 4LE0A 2MCFA 4E5SA 3KUDA 1SMKA 3VC3A 2IH4A 2EJVA 3KKPA 1O94C 2JZCA 1IYZA 2WIDA 3BJEA 2WVHA 3KU4A 4UM8B 5DHRA 3MB8A 2EZTA 4L6AA 2ZZKA 2ALJA 3IALA 3TGPA 3I32A 3ZI0A 4IOLA 4TN5A 3S2YA 5EWJB 2AD1A 2FN8A 2NXNA 5DHAA 5F5XA 3PXGA 1CVIA 1SXJA 1UH5A 3FNBA 1RS0A 3GEEA 1FRQA 3QBDA 2XYVA 1E0AA 4D02A 3GNTA 1I36A 3PR2B 4LHXA 4P86A 5IU6A 4WCFC 3IDFA 5AK6A 1QWOA 4OBEA 3W2HA 4FGWA 4H9GA 4TT3A 3KYDB 5ICEA 2R3SA 2HBZA 2FUG1 3PD1A 2HMYB 3D6JA 4LSWA 3RROA 1IDOA 4MVJF 1F2UA 1GXSB 3GJ6A 4M9UA 4WESA 4XCQA 3SR0A 1N2CE 1OIXA 3V7YA 4B34A 1E79D 1ZSNA 2OPBA 2JLSA 2V55B 2X5KO 3HXOA 3FVWA 3KSRA 3P2EA 4JBHA 4I6GA 3Q3JB 5IAOA 4FR2A 3QX7A 4M9XA 1I4EB 4YIHA 4KKVA 3DPSA 1KVQA 4R9NA 3NEJA 4ZOEA 4RJJA 2WHXA 5H59A 2WKQA 3F71A 3TN7A 1XT6A 5CCXA 1U6JA 1JFSA 2NOAA 4LBVA 5GONA 1WWKA 1OTYA 3OA2A 4JJFA 3AVUA 2H1HA 5IZCA 2HTFA 2F3RA 1MDFA 1G3RA 1PS8A 1NP3A 2H7CA 4HR7A 3FZGA 2ZJ5A 2J87A 1FFEA 2XCUA 1YB5A 2H9AA 4KI0A 3PC8C 4WD3A 5TPZA 5FTMA 4G5XA 4BLVA 4E5PA 5JNTA 1F3LA 2WF7A 3GJ3A 3MAGA 4PYMA 4X1OA 1OOEA 3RYIB 1J23A 2VYQA 3U4CA 2AFIB 1U3VA 4N47A 4HB4A 4IRMA 4ND4A 4RAOA 4EQ6B 2EGUA 1Y81A 3L9XA 5ALMA 1N32B 1O6FA 4GZMA 5EKXA 1A5BB 4MTLA 2JJYA 3PEWA 1Q0HA 2FLKA 1XO1A 2VWPA 3IPAA 3K7EA 1ZD4A 3LBHA 5IKXA 1V5EA 2CD7A 2QX7A 3ETDA 4M0EA 3FPBA 4C1NA 2D7JA 1M8PA 1Z8HA 1DUSA 1KI3A 3CR7A 2O9JA 2WFLA 2Z1MA 4DR3B 3H2BA 3QBVA 4ZVVA 4H4DA 1TU0A 3F3MA 2YHAA 1Z38A 2GF2A 2QHXA 2Q4BA 5CDHA 1O87A 2QL9A 5L6MB 1VIMA 2XUQA 2Y66A 4U2FA 4FFLA 1DPGA 1GITA 2CFIA 3HPRA 3KDAA 3RVDA 4OUDB 3GJ7A 4IF6A 3U40A 4NWIA 1Y5LA 2BUCA 2P69A 5F12A 1JIUA 4GXNA 4G0UA 1TYZA 3DMTC 4A0RA 2JRCA 1RACA 1TKBA 1W9MA 1N1MA 4TQ9A 5EHXA 2IPMA 1I2CA 1OHHA 4ESHA 2GVZC 3AUUA 4FYMA 2PZBA 3M0EA 4B7XA 1WEKA 2IK8A 3WLTA 5J2TB 3AVTA 2GXAA 2ZUFA 2ADMA 1LV8A 2JCXA 1IJKA 3AGPA 4AUEA 4Q1AA 4YRDA 4IH1A 1FX1A 2BMDA 4PZCA 3QE3A 4KSCA 3KQQA 1UM8A 2CD9A 3JQAD 1OVGA 2H5EA 2H17A 5CLLA 1XCMA 1GFZA 1T9ZA 2QTGA 3HKEA 5TSDA 1AUXA 1BXZA 1XZHA 2PH1A 2X7JA 3D6VA 4PZYA 2YBDA 3T1TA 4PM4A 2FZ4A 4UU8A 5ALEA 1AHNA 1GAQA 3UK0A 2CKDA 1RJ9A 4BNDA 4CG0A 4RK0A 2MU1A 1CPYA 4LXXA 2ATXA 4NY1A 2O8CA 1CJUC 3HKBA 1F60A 5D84A 4I14A 1SULA 4PIPA 4GGMX 1E3JA 4N3CA 4JVOA 3KVYA 4I9NA 3SEQA 2LDXA 3F78A 3OVMA 5DNCA 5KI6A 4GYKA 1D4ZA 2Y68A 1WUHS 4RW0A 2VIIA 5KPDA 1WS6A 3BL8A 3I1JA 3ONWA 1EHCA 3E9ZA 1GNQA 1KS9A 2IYQA 4N0MA 4RMGA 5DV9A 2J5BA 3E5RA 3H8WA 1FLDA 1SM4A 2LVBA 4P3XA 3ND5A 4G4IA 1X2BA 5M3BA 3HJFA 1PGOA 1F2TB 3HS3A 4WKOA 4C7OB 1YZUA 4CCAA 3COWA 4TUYB 2WT9A 1XG5A 3VYUB 1CG6A 1KP2A 3WYBA 3P4XA 4DQKA 4GE3A 4RKWA 1C8VB 1BROA 1PI3A 2HH9A 3I09A 3HKEB 3PUYA 4IDHA 2CEKA 4XIIA 1YVDA 5DTIA 4CI9A 4E33A 9LDBA 2J33A 1ZCAA 3CWCA 3I4FA 4K9DA 3T4UA 1Z73A 3QEMB 1P1JA 2ARKA 2H08A 4F5DA 1A9QA 4CLOB 3FB4A 3RSCA 1FZTA 3Q8MA 3IT1A 4HH1A 4GPEA 1SRRA 4QHSA 4BHTA 3VNUA 2ANBA 2WP0A 3SDBA 3RVPA 1SCAA 4IDOA 3FSEA 1GPUA 1Q15A 1L3IA 4LGVA 2YH2A 2FFRA 4F91B 3QA9A 1EIZA 1JLHA 4YQYA 1TT5B 3WADA 1R12A 1NVVQ 1PYGA 1RXIA 2FOIA 2RI0A 3JYLA 4NZOA 4WK4B 3IKTA 2FX5A 4BVLA 3V1MA 1L9XA 3QNWA 2QU7A 4NHOA 3SXUA 4YRCA 2ZE6A 2ZB2A 2PMCA 3D7SA 4KQKA 1BIFA 4D0RA 1CU1A 4ZHQA 4LQ4A 5HPYB 5JY1A 5KWSA 5FA6A 1N9ZA 1C9EA 3R0QA 3MINA 5FO0A 1G63A 2AC2A 3NH6A 1JQBA 1XLTC 2CXTA 3C45A 5HKBA 2WP8J 1G20E 4ENRA 3RJ5A 3DULA 1WY7A 2JA1A 4JYZA 2WJYA 2BTQB 3L0PA 2OBMA 4HV4A 4YR7A 3O83A 1H2WA 3QVKA 1JHMA 4MUAA 3ZGXA 1N77A 2VLIA 1FJHA 5DX1A 4W9NC 1JPUA 2JKVA 2WJPA 4I3GA 1F0PA 3TSZA 4DR6B 4Y1FA 3H8VA 1DELA 3MWFA 2FZGA 4H0NA 2ZRMA 4JI4B 3BXOA 4QFCA 5ELXA 3JQCA 2FW8A 1U0EA 2PRKA 2XB6A 1ECFA 3JAKA 3O8BA 4QOIA 4WVFA 3ZVRA 3IAEA 3Q8KA 1SHZA 3L1IA 2V5VA 1F4PA 1E8DA 2V58A 3ZCSA 2ONZA 3O2QB 2Q5IA 2XT6A 3FMVA 3PJEA 3W78A 4K03A 5I7EA 3T5MA 2ILTA 1ADBA 1H66A 4XIGS 4D9EA 2RDMA 3ROKA 4W9RA 3W2TA 2H5IA 5JJLA 5HS6A 2Y05A 3ZIAD 4DADA 4MV3A 3VSBA 4O2BA 2ZBVA 3T7SA 2O0LA 4JR0A 1NBWB 5L40A 1SC9A 1SCIA 3I0MA 4G5OA 4L51A 3EG9A 4X3PA 3OOWA 4RCZA 3T06B 1JSLA 5JZOA 2YNMA 5JNWA 4LXHA 1PVVA 5FFMA 4A5SA 5C4GB 1GXSA 2ACKA 2BGJA 4OK3A 5C8DA 1FMTA 4ZFNA 3W4KA 4OB6A 2PBFA 2VDWB 3HYSA 2E0IA 3INNA 2FSVC 5D6NA 3W2EA 3WL7A 4FEEA 2OK7A 1W0KD 1V16A 4JSYA 1PT8A 2OBFA 4WW0A 4YQFA 3UMFA 1R9GA 4PCVA 3TZBA 4P32A 3T0FA 3VTFA 4BNFA 1M7GA 4OKSA 4EG0A 2E2WA 5AESA 3TIVA 4P35A 5I7UA 2RAPA 3QLVC 4MJ7A 3JQ7B 3X3HA 4Y1RB 4C01A 1NJ8A 5IT4A 1Y8CA 4P7BA 2BFNA 3RRNA 5LXTB 3GXOA 3WK8A 5BSKA 1YBFA 1IOLA 4YAUA 2B5OA 1DC7A 2WU8A 5KTRA 1EX9A 4PV7A 4BKRA 1NKVA 1E2UA 2GBLC 1NN0A 3EA0A 3ESBA 2C4VA 4QDZA 1LSJA 4ZTBA 3ZZ1A 4C6TA 4IFEA 2N46A 3ESCA 1MENA 4JEMA 1XVTA 3RVOA 3ZGVA 3UUWA 1DIRA 2NYUA 1NHWA 2WM8A 4HNAA 1PJLA 3KKKA 2CLSA 3TL2A 1HMYA 1GLGA 2RMKA 2W83A 3O1LA 4WFJA 2IQIA 3K5PA 4JR2A 3R40A 5DRYA 1KEUA 2KMLA 1JAIA 5IF3A 2PZMA 4JXZA 1H4QA 1P9LA 1V9LA 1XVAA 4YJ2B 5JRJA 4B1FA 1GSOA 3OUUA 1FSGA 3BL5A 4QQFA 4YJDA 3DE0X 4UCFA 1W46A 5CVCA 1YS6A 3FIJA 5JLAA 1MZVA 2HWYA 2J0UB 3FOBA 3GMTA 3SBXA 2J5XA 3U1TA 1DSSG 4JU9A 4B40A 4KV9A 3OEHA 1FPQA 4YDHB 3AM1A 4DL9A 1MMFB 3ZKWA 3A6FA 1E9VA 3W5HA 5DTRA 1LA2A 1EBUA 2DM6A 3R5XA 4FSHA 4GBED 2R1TB 4V24A 5ADHA 4OQZA 4S1NA 3Q7QA 2JW5A 4C4AA 5K3OA 4CW7A 3TUJC 4IYRA 4RVGA 5IYZB 2AF3C 3KPVA 4NZMA 1Z2PX 1W47A 4RMIA 5IYZF 4C7JA 1HA3A 5LMCA 3SF0A 1MAVA 3A6ZA 3RFUA 5MF6A 3GDFA 3HDHA 4MYSA 3ZV5A 5BN4A 5KKNB 4M9RA 1QZZA 4PC3A 3I8XA 3V7NA 2X9GA 3VPCA 2JIDA 3OLQA 1Q1NA 3CX8A 4IIBA 5IC5A 1SJ9A 4AJLA 5BURA 3FBWA 1S9HA 4RM2A 1MJHA 4YCMA 3VO1A 4PTZA 4YAKA 1G8FA 1U8EA 4JXKA 4JY7A 5DOZA 4F9GA 1DKOA 1PZGA 2R8OA 2JIPA 4R8RA 1QP8A 5DTQA 5JD4A 4PIVA 1TCAA 1X87A 3EDMA 4UU7A 2J6CA 3RT9A 3PDHA 1KAGA 2BGIA 2P0YA 1QHXA 1U81A 1JEAA 1M7BA 2WFAA 2VQDA 5FV7A 3GFQA 1KSGA 2XAUA 1XR3A 3FKQA 5T8KA 2WSYB 1FNDA 2D62A 4NCNA 5KSZA 1ZMBA 3G8CA 4ZRMA 2W4MA 3MGBA 4PO1A 2L82A 4QU0A 3T7TA 3OTHA 4OYLA 4CNQA 2FYTA 3UMCA 3KS9A 1C9DB 1ESMA 3LO5A 4JI6B 4MRMA 1UMCA 2F9FA 2HHAA 1V9CA 1YVRA 4R51A 4D2IA 3VKVA 1PRYA 4DJTA 3V4PB 5BQFA 1XI2A 1LDMA 3NH9A 3ORQA 1TM7E 4JA2A 5CHEA 4Q9JA 3FUVA 1VE9A 1F0NA 3H2SA 2WWTA 1N2OA 4HKTA 4IDGA 4KGXA 2O8FA 3TQFA 2PX0A 2V0CA 1MPTA 3S5JA 3LXMA 5CH5A 3OZSA 3SXJA 5L6LB 3GLFB 3WJ7A 3AU9A 5AVWA 3HK2A 2XNCA 1GPH1 2VJYA 3CF6R 4HAIA 3JQ8B 4JL5A 3NUQA 4QOFA 1OAKA 1GY8A 3ZWXA 1EWRA 1P80A 4PRLA 4R9SA 2PUFA 4OMDA 5SZIA 1NUPA 1OBFO 3A37A 2BM8A 1IZ7A 5FWXA 2DY1A 2I67A 4S0ZA 1I94B 2ASVA 3ZW7A 4HYTA 2C9YA 4N7RA 4A6XA 1BDHA 3DAHA 4OP3A 3N2NA 3BORA 3SS7X 3ZHVA 1JVSA 3PHJA 3H05A 3FJYA 1U90A 1TEZA 1UT6A 4EI2A 3G2MA 4GYYA 2NO7A 2JZOA 4BLSA 1BGWA 3N9IA 4OJNA 1W1WA 3H2JA 4YK7A 3VR5H 4EF6A 2XCSB 2PRSA 3GFVA 3Q9LA 2Z58A 5F7OA 2XODA 2CL7X 3UICA 5G41A 1CXZA 4D8XA 1E6MA 1JJFA 4DLKA 3BXFA 1U1EA 3FNHA 4I5DA 5BQPA 2GPJA 4LJYA 3U0BA 4ZDKA 2C3UA 1O96A 5DGIA 3RI3A 2PX2A 1NTRA 1NVKA 5LWQA 1TYEB 4P36A 2P11A 4DY6A 1TW2A 3EZ2A 4NIMA 4UVHA 3VAZA 1NVTA 5AVVA 5AWFC 1UBFA 1ZI8A 1W87A 3WL5A 4G5FA 3BIFA 3U4QB 3R0JA 2O2CA 3JASB 4BUZA 4KQCA 5KCMA 3DMRA 1C9KA 2F00A 3QG5A 1DC5A 2R66A 2ZYSA 4XQCA 4KODA 4REQB 2VDRB 5C1BA 1BFUA 1JMYA 4P38A 4ROSA 1RABA 4FWIB 4GHWA 5T57A 1FA9A 1AB6A 2ZJBA 3NTVA 3Q7TA 3T7CA 3EQ9A 3WXMA 4F72A 2R44A 2Y4OA 4I5GA 3PFIA 1AO3A 4E6PA 1HY3A 1E59A 1L7XA 1WL8A 4DLRA 2D6FA 4EAAA 3M5WA 1YJQA 3K71B 1DG9A 3F7MA 4Q3CA 5CX4A 1JI0A 4YP6A 4TWZA 2LCQA 1KI6B 1E92A 1KJNA 3IAXA 3JQRA 4FYIA 3RSQA 3TIIA 1V7CA 3OU7A 2GCGA 2C95A 3GP5A 3VPDA 2O8FB 2W9XA 1Q5PA 4DAOA 1ZGZA 3ZK9A 3PPVA 1MR3F 1QMGA 3UMMA 2D1SA 2K6GA 2DHQA 1FYXA 2WTAA 2XNDD 1THGA 3DVSX 2JGAA 3NTQA 3QXCA 2X8JA 3DEAA 2W4QA 3NJRA 3OBBA 4G5YA 3DTTA 1II8A 2G9UA 2PJZA 2FRDA 1XCPA 3W5CA 2D3TA 4BFSA 1Y4SA 2WU1A 1DQSA 3A4YA 4TV9F 5CX1B 1C1HA 1Q22A 1QGAA 1SC3A 2GNAA 2E5LB 1J21A 1FP4B 1HDGO 3KZOA 1T2UA 2HCTA 3E9YA 1LUAA 3OOHA 4N40A 4AMVA 2NO5A 4BQQA 5L7WA 3VR6H 2ZSHA 3B7WA 1RRPA 1T26A 2FZCA 3IT0A 3AVXA 1JG7A 2I4TA 3EXAA 4LYFA 3IEKA 5HJ5A 1JHQA 5IAAA 4L0QA 2GWRA 2ZJ2A 4DCOA 4FHGA 1C8LA 4RIGA 1PNRA 3VH2A 5JO0A 5EC8A 5JSHA 1G1AA 1V25A 5DMHA 1PYOA 2EARA 3H1GA 3IUBA 1ZX1A 1M74A 5IF9A 3DS8A 3UW3A 4TL9A 3VNRA 4ER0A 5L45A 4O4IB 2R6JA 3TZLA 5CA1B 1IBRA 2XF8A 2C4MA 3N76A 5B1DA 4BN0A 1YZ3A 1P0CA 1QCDA 3STTA 3V6MA 3CH7A 4DXDA 2QNIA 1GNPA 5ECDA 3K16A 4BTEA 1MU0A 3ECAA 3LC7O 3ZV3A 3FW1A 1EQUA 1GGEA 4QHTA 3ZHBA 1Y1RA 1ZC4A 2DT5A 3IQIX 4TSFA 4EYOA 1S4MA 1YQTA 3DAPA 3I0ZA 3JVDA 4QBKA 2XB4A 5I9SA 4JJ8A 5HOEA 2QRNA 1GG2A 4QG7A 4AI6A 3ESQA 3TBHA 1H2HA 1ZZGA 3CC8A 5HXAA 4Q48A 5HJ2A 3RQIA 2YCBA 1US8B 5FO1A 2OECA 5U9CA 1YUBA 2FWAA 2PLAA 3BIWA 1IXYA 1BCSB 2J5RA 4XVQA 5DMXA 4LHZA 5HJEA 1QGOA 3CA8A 2OCAA 1VPWA 3QX9A 1V1RB 2FWBA 1GZVA 1T6BY 5AM1A 3T3IA 3ONEA 4FYWA 2VK1A 4Z1OA 1NBMD 5KOJB 2E7ZA 4D25A 4DS3A 5KNCA 4UAVA 3HB4X 3L1UA 4R68A 3H8JA 1EFHA 2B92A 4RHEA 4YRFA 2R62A 3HEBA 5HF5A 2GZAA 1KO5A 2VVTA 3AWDA 3C1AA 2ZIXB 3W8RA 4ES6A 3CN7A 4HD8A 4DB2A 1N8SA 2IYWA 5C1IA 2W37A 3WKDA 3ZZTA 4DKXA 2I76A 5HNKA 3CUKA 4MWZA 4NNOA 4DOMA 2C5SA 1OFVA 1SXHA 1XTPA 5HFAA 4ND2A 4D8UA 1HDZA 5EJ9A 3PFHA 4Q12A 2Y1XA 1JJ7A 2OHOA 3KT0A 3FPHA 4KQWA 5ADWA 1HSZA 1R16A 1QX4A 2ZIUB 4ZQEA 4GXTA 5FL3A 3DZKA 3EZLA 3QYJA 3OHMA 3EPLA 1K3FA 3I5XA 3ICQB 2VP6A 1X7ZB 4A23A 4LY6A 3IQWA 2IXBA 1Y9EA 2RHWA 2QTFA 3G9UA 1LW7A 3H18A 3ZVMA 1NSTA 4YI3A 3DHEA 2O6HA 1KRXA 1GDTA 1DC3A 2VQ3A 1P1FA 2FR0A 1E3DA 1AKVA 2I0FA 3NEPX 1LJ8A 4LOLA 4I5EA 5FIUA 4DF3A 5AW3A 1WMBA 1OU0A 5FPHA 3SQWA 3BH7A 2QZ4A 1RXVA 3ZS8A 4EI9A 2AEEA 3H9GA 4K28A 2CNKA 2OHGA 1XTQA 2R1VA 2QRJA 3EDCA 3IDAA 3KFLA 3GLHE 1E2EA 4IVNA 5DT9A 3RRFA 2GNPA 3L04A 3ZQKA 4YLEA 5IXSA 1KFBB 4E1BA 1DJPA 2H11A 1XK6A 4KLCA 3UT6A 3WVNA 3EC2A 2GPNA 2CVOA 1OWLA 1JG2A 4JHLA 1K2WA 2XAAA 3GGPA 4RPKA 1W4AA 3WSTA 5BVGA 5C3UA 1MAWA 4YDQA 4YJGB 2OHIA 2X42A 4WLEA 1PHPA 2DVMA 1USVA 3RHSA 1UBHS 1VYHA 3D8TA 5HFJA 3ID6C 2GBIA 2H0RA 1F8YA 3T1NA 5ESWA 2YJGA 1OAOC 1HT3A 1U1IA 1L8LA 2A5DA 2ZVPX 3KXKA 3KX2A 4HRYA 4X93A 3KM0A 4M1QA 2ID8A 4LY3A 1EXWA 1VDZA 3GJ0A 3K5WA 4K0RA 5A0FA 3C4QA 4G6ZA 3UUFA 3WNBA 1E1YA 4FGUA 2BFBA 1GN9A 5ALGA 3KT6A 2QWXA 5BYJA 1OPRA 3D64A 4XM2A 3PTLA 2B1GA 5TDHA 3FVTA 2WZQA 1RHMA 4LDAA 1NNEA 4LJAA 3THOA 4YCCA 2FDRA 2PKEA 2WWWA 5WRFA 4A6EA 1M8KA 5JANA 3G17A 1ONNA 3H4IA 3CXUA 4WBNF 3BIJA 1S8OA 4KPUB 2VSXA 1D4OA 2AKAB 1ULBA 3EMDA 3ON5A 5E4YA 4B4UA 5LL6P 5E7QA 3WMRA 4BQSA 2J8ZA 2VDPB 1PUXA 2VOJA 3QHPA 5JTTA 1H5NA 2A33A 1AO0A 1NQ5A 4CDNA 2HA6A 3GV0A 1GZ3A 1ZINA 3TX6A 4K2AA 4E30A 3E2PA 2OXFA 3IBTA 3U3RA 5HP4A 2J32A 2B34A 5E3HA 3CXRA 3FMOB 3U7EB 5CCBA 3DV0A 1DBRA 3CG4A 3NAZA 1SVSA 4D56A 4Z54A 2VJOA 2OKGA 3L6CA 1D6MA 1JLSA 3QG1A 1OT5A 4CIWA 4P22A 2OFFA 3SJZA 4I2VA 1O0CA 5KOIA 3FOWA 2Y93A 1JQJC 4I36A 2VDKB 3T3HA 3HMQA 2D2IA 3KOWA 1NNLA 3PD0A 4MDHA 4B7CA 4LSMA 4TWIA 5COAA 1ZR4A 3NHPA 3LOUA 4CEHA 2GI4A 3JQGA 4JASB 3EZGA 1KDRA 2IDZA 4CKZA 4OATA 4RS3A 4OSPA 4UE3S 3FPFA 4HJRA 3W06A 2GCPA 5LQJA 1JDUA 2IF0A 4CQMA 3G5LA 2FAXA 5J4YA 5F2EA 4M55A 2GEDA 1GTSA 2W8BB 4I1OA 3DBRB 3AKYA 1V3TA 4ARVA 1H69A 1DFGA 3IUQA 2XT9A 1Z9BA 2H1FA 3OZXA 4D0NA 2CWWA 4DR4B 2OMKA 5J59A 2EQAA 4KKXB 5FOXA 2C3PA 1KY4A 4QD3A 2P6OA 1QNLA 1QOPB 3EZYA 3K0AB 3OSZA 4UOEA 3A9WA 4GL2A 1P5RA 5JDIC 5BWOA 4XGIA 3I2JA 1AG9A 4L7VA 4OJKA 4R2IA 3FKJA 3KTAA 2B98A 2CNWA 3I23A 5ABPA 2J3EA 2AG6A 3OX4A 4K9OA 1MPXA 3EFHA 3P9RA 1A8UA 3QX3A 1FP7A 1TVKA 2YV2A 2NVBA 3M82A 3EZ6A 3TB4A 4NENB 3UM9A 5JVDA 4F6RB 3MWEA 1UL1X 4LNUA 1RWPA 3I72A 4LC0A 1M2KA 1SA0A 2HMVA 4WKPA 1A76A 2I54A 3OQJA 2ORED 3P19A 4QICA 4KFUA 4MUYA 4WY8A 4Z5XA 1KR2A 4OH7A 2AYXA 3KJIA 5THKA 4B4VA 1TX4B 2HWUA 5JH7A 2G5TA 2ETVA 4HDCA 3PFWO 5AFSA 4F4DA 4GDMA 3U81A 5LP6F 1DBPA 1LVUA 1X1EA 4B5KA 2DHDA 1XLWA 4PWZA 1E0JA 1NONA 3D4NA 2B5VA 5LA6A 2RH5A 3NO4A 1QIJA 2AIRA 1UFRA 3AJ9A 3ECCA 1KI1A 2NSLA 4UDYX 1E6EA 4YH1A 2GBLA 2GZ1A 1LVGA 3F2VA 3BILA 3U4DA 3WB1A 1IMOA 1XN4A 5AI4A 4UTNA 1JAXA 1UQUA 4TS1A 3TQCA 4D9MA 4EGSA 4C88A 3NT5A 4QOJA 1Y7TA 3JR3A 4E5YA 1BRMA 3C5WP 1XZQA 4MVXA 1UANA 2IF2A 4JFAA 2AI3A 1U0FA 4Z3KA 5JW6A 5K4GA 2JAUA 3MOGA 3X2EA 4MA0A 4M87A 1OBHA 3DCYA 2M6LA 4DQDA 1XZ8A 2AWNA 2FEWB 3JQ6A 1TE2A 1WE2A 4XM0A 1H2YA 4D9HA 1IQ0A 3ITEA 1T6XA 3RVRA 2A59A 2C8LA 3ICWA 3HYRA 3N39C 4UZSA 1RT9A 1V5IA 4NEQA 3PFKA 3R0ZA 4BKOA 1MH9A 1X1TA 3L7YA 3ZLJA 4PGHA 2I99A 1O3YA 1SG6A 2AFHB 3IVGA 1I7DA 2C2ZA 3BOSA 1U1DA 5J5AA 1Q14A 3AUAA 4UULA 1HI9A 3FRIA 4MQFA 4RH0A 1P9NA 1RFGE 4RIIA 4R54A 3IMFA 4US0R 1JNXX 2A0XA 2XUKA 1GG8A 1Y7LA 2RKOA 4MO2A 4DV6B 4C3UA 2ZUVA 4TMVA 1YZVA 3GDWA 4KOEC 3KG2A 3SQMA 5LVAA 3OZBA 4KRGA 3N2IA 3PU6A 3C24A 1QKIA 3BM5A 1JWLA 4IJKA 1X86B 4ZEWA 3I37X 3UMRA 5BUZA 3TW4A 3I53A 2DBRA 5BMVF 1H9AA 3M4XA 3BMCA 4YJ3A 2IKQA 2G1AA 3UJPA 3ZE6A 4E2ZA 5LN1A 3CLUC 4P31A 3NHLA 1AJEA 4MQ4A 5FUVA 4MUXA 3AUJB 3D8RA 4IQ4A 5EMMA 5CJJA 1KMQA 1TAHA 5FBZA 2O8BB 3SZOA 3DF9A 4JBWA 4KSBA 3E7FA 1LD3A 4IXWA 5C9ZA 5I8WA 2WMDA 2ODBA 2VI5A 3UFBA 2W2TA 5LJLA 5BN3A 4PHHA 2GKGA 1XVIA 2QL5A 721PA 4AO6A 4LKOA 5I6DA 1N7HA 5BPHA 2EWVA 4GM1A 1A4XA 2R4QA 4S0XA 5CNIA 3TLXA 1KMIY 4E14A 2WAOA 2QF7A 4OPMA 4PLTA 1BTOA 4X61A 5EJAA 3HC7A 2ZUDA 3AR4A 4IEFB 2H0QA 4G3XA 2A1TS 4ZO7A 1PJ3A 2EFDB 3EGIA 4XWYA 1N57A 3CX3A 3A1DA 3WYFA 5AVTA 1N5RA 3CF0A 3ENNA 1NVBA 2EKQA 3ZCTA 4MAAA 1VLVA 2JHFA 1EWYA 3CZQA 3N7TA 2UUOA 2Q5EA 3NHZA 3FG9A 4EYKA 1QVAA 1T5BA 2FN9A 3JSAA 4M2LA 1DX6A 3BJMA 4ALLA 1DFIA 4YRQA 3B2NA 3DE5X 1XDGA 2C9MA 3VO9A 4QA9A 5REQA 3EXEB 1JWBB 3HH8A 1RIIA 1FJ2A 1PLKA 1JLKA 2IU3A 2VC2B 2BW0A 3Q88A 4E51A 4Y0VA 2PX6A 3OP1A 1RMQA 3V2UA 2COKA 4C2AA 1FS5A 1NP7A 3A3KA 2VUSA 5FPTA 4C06A 2TRSB 1P29A 1XJWA 3FH0A 2J5KA 3L43A 2K5UA 4IZ6A 2AMJA 3OEHD 3TW6A 2IPAB 1N92A 3LIPA 2B25A 3KUXA 2QG4A 1KOLA 2DLDA 1IZZA 2B0JA 2J0SA 4ND3A 2QUIA 2D1TA 2XF2A 4MS1A 2VHYA 3GO4A 1G21B 1L9KA 1CZNA 2VDLB 4Q9DA 2A86A 2JIMA 4U7GA 1Z33A 4AROA 3R3XA 2WZDA 3ORSA 2YRFA 2F1KA 1NM5A 1L5ZA 4I4TF 3V55A 3HLYA 4X71A 2GRAA 2IYXA 4LMAA 3D81A 4X41A 5FBVB 2J9ZB 3IAM6 1T9GS 3ZDFA 5KU7A 2JAHA 1GKLA 1O95C 2W2QA 3FJ1A 4TVSA 5LMNB 3KSUA 1JQ5A 1Z7BA 3LUGA 3DD1A 4G5SA 3H5NA 4CF7A 4JEUA 3WLIA 3WDKA 1G5TA 4QNMA 1N0WA 2Z98A 1QU3A 2ATVA 4K8OA 5GGXA 3UK2A 1OYVA 2EKPA 2WDPA 4Q7EA 5B37A 1VC2A 4L5YA 1KEKA 1MKYA 3Q6IA 1EMDA 1H4VB 1OSNA 3GIWA 4D5GA 1Y9JA 2AFVA 2X9NA 2GFQA 3FF1A 2O7VA 1SVOA 4V0KA 1LF0A 2Q1WA 1V8OA 1N3BA 3Q4GA 1PL6A 1VMIA 2I4OA 2CLMB 3KALA 4U2BA 5DM60 4NABA 3U39A 2QXTA 3K1TA 5JI3E 4FYKA 4TKMA 5H9WA 1Z74A 2WE7A 4FYXA 1J2YA 1WMAA 1ZM2A 1R5OA 3PRHA 4EZBA 4IWYA 1C2YA 3PPXA 5BSWA 1DQPA 2W6ID 1ODKA 1TUBB 1PEKE 3X2FA 4ER6A 1JAZA 1CDEA 4KQ6A 1GGJA 2NU7A 3UGJA 3OECA 4A2PA 3W7BA 3BXZA 2Y27A 2Q5QA 2WFZA 2NO9A 4LMPA 1F9EA 4XA8A 4MMZB 1ZGHA 1X13A 2V4UA 3KYCA 4TT8A 1T6ZA 1WPRA 2I1VB 4D26A 2NAPA 1UXKA 1R0SA 3MCTA 3MWYW 3CPSA 1NI5A 4IFTA 1ZXBA 3NP9A 2B83A 1EXNA 3CF4G 1KMHB 1K7FB 1KORA 2OAQ1 2JEOA 3IKLA 4BMDA 1JNYA 3PF9A 1JR4A 2GDJA 3LBIA 3MLEA 4Q3EA 2ZAYA 4N76A 4DV3B 3GMDA 1IAVA 2WU4A 1R6TA 1QHHB 3DCNA 1R3DA 4IKPA 4YGXB 4NPHA 621PA 2O2ZA 1SCUB 4E7OA 2G4LA 3P94A 5H7XA 1Y3DE 1E2HA 3DT8A 4FTWA 1L1RA 4FLMA 5K0FA 1HQKA 1FTWA 4WSOA 2YINC 1E1QD 2ZBPA 9LDTA 1ZGAA 1A27A 3LQQA 4P2BA 3DZFA 4HS4A 4YUZA 1UFKA 3RHZA 3LTEA 4BB6A 2DHEA 2VJMB 4N8EA 3HJUA 2WJ6A 3U7IA 3ZNOA 5TY0A 4J4TA 2XB9A 3V1LA 4QJIA 3K9BA 3CZ9A 4ZARA 5F9MA 3U4MA 1Z47A 4ROTA 4BJ3A 2RIPA 1UXGA 5JSYA 4EDHA 4IV8A 4OXYA 1USUA 3DVQX 4KXMA 3LFHA 4HSGA 4RPIA 3FKSD 5FOUA 3WA6A 3EZ9A 5CVDA 3R5TA 5K3BA 2IEIA 5HIAA 3UKJA 2JIZD 4I4NA 5MFPA 1XCOA 1IEWA 2I7TA 5ENVA 2O1SA 5DK6A 1V8PA 4KYUA 4L95C 4NZNA 4GD3Q 2PQ6A 2AGVA 3G8BA 4GR9A 1BZYA 4MP8A 4RVSA 3K8YA 3URKA 5LIPA 3NATA 5KYXB 3EDYA 2VHEA 4XTCS 3A7EA 4LV6A 3KZ1E 3T5GA 3TQQA 3H9UA 1CQIB 4IQFA 4EATA 3L1HA 4EMSA 1KZ4A 2GZMA 1N0IA 3CN9A 3EVNA 4DLPA 2WJVA 3HFGA 4JP5A 3DZBA 1PGJA 1XZDA 1OV4A 3OBIA 3FD8A 5F76A 4YJ2F 2A9KA 3DT9A 3EMBA 3O8NA 5F4ZA 3CEMA 5I8ZA 3CLRC 2AFHA 4PQEA 5GP1A 4MRSA 1MVOA 5IK2A 4HWPA 4X84A 1S7CA 3M9XA 2ZE5A 3OOJA 2XTAA 2FPSA 4FSDA 4GZ5A 2IE0A 1JLLA 3F6PA 4M1YA 1UMBB 2X1VA 5J2UB 5EZQA 5H3HA 4DIFA 1SN7A 4UD6A 4OGWA 1SU4A 2CUKA 2P4UA 4J4BA 5IXJA 3X1WA 4J0QA 2AZ4A 5BNZA 1NG9A 3D6UA 1A7UA 1AV7A 1PNVA 3L0OA 6REQA 4WUVA 3DL0A 2IYOA 4YJ3B 2NUAA 3ZXYA 4R1SA 4RYDA 2X0JA 2X9QA 2HFKA 4O2BF 2A0YA 1QVWA 2HSJA 4NBTA 3K70C 3MXOA 1FYDA 1NVUQ 3LIIA 5LXTF 5ALWA 4AF7A 5IAKA 2QY9A 4BMOB 4MQUA 1CQWA 1YOBA 1XZPA 1YI0A 4HJXA 3I39X 4UHBA 2EP8A 2ZRAA 2R2AA 3GHHA 4G0OA 5T41A 4EUNA 3HKDB 3C3CA 3KJEA 2E4WA 4OJTA 4MQFB 5KWEA 1P4RA 5SYMA 2N47A 2GLUA 3A3YA 1LNZA 2BF7A 1P2BA 3LD9A 2DERA 3LLUA 1EEHA 1NMZA 1E18A 2Q28A 4H08A 2R68A 4NQZA 4LE2A 4U3JB 4UCXA 1GRVA 3FOFC 2FQYA 2ZULA 3QPVA 4BRZA 1MDBA 1JEYB 4NICA 1B23P 1W88A 1IBSA 1P3DA 5HTOA 1KAMA 4DJEC 4TVOA 1K75A 3KJNA 2PU5A 4F92B 2QP3A 3COSA 1PQ4A 1N1DA 1FXUA 1J22A 2XUPA 4N5NA 4XSHA 4DUZB 1C1YA 3ZCUA 4OM7A 3G2KA 1FLAA 3QLVA 3DWEX 2O3SA 6PFKA 5CFZA 1IQRA 3BXHA 1ZMOA 4ZMBA 3IOYA 3LY7A 1X7GA 3SZGA 4DAEA 4Z0NA 3MMSA 4UAGA 3SOPA 1K7CA 5CLIA 1TECE 2QBYA 3FPCA 4ZI7F 3AVOA 2ZCVA 5DBOA 5H02A 4MQBA 3SU8A 2O3JA 2FPMA 3GRPA 3S8YA 3ZZNA 4JC5A 2Q6LA 4EDFA 5CT5A 1WOYA 2CL6X 4I1YA 1JB1A 2ZRLA 4GMFA 2Q2NA 2JGDA 3A1EA 2GF9A 3A6KA 1U7HA 3ILSA 1LBEA 2QX9A 2Q3MA 1R4AA 3BWCA 3LUAA 4HWRA 3FDZB 1RWMA 3GJZA 4UHDA 4QNNA 4IXDA 2FSIA 1H2FA 3UV3A 1QVRA 3TIFA 4N6GA 1NSFA 4HBZA 2WUVA 3R5FA 2JFWA 3RNLA 3L6UA 4BVAA 2FGJA 5JDCA 1DKNA 4HUQA 2PSFA 2IOFA 2JLQA 4Q4AA 4HNAB 1KI7A 2G36A 1E2LA 3AR6A 4NU0A 3WMXA 3BD7A 3EN0A 3FYCA 4QLAA 4V0SA 3S44A 5J43A 3RADC 1E4VA 1D2AA 1T8TA 2X3UA 2B8JA 3PWTA 1S96A 3I2HA 4F2HA 1X3SA 3ZE1B 3NMUF 1TK2A 5IN4A 2DXIA 3A4TA 3VISA 2ONCA 4KQIA 2BFEB 5FLXA 2O8EB 4JLKA 1YJAA 2CVHA 5E6RA 4UEQA 5DISB 5K03A 4O4JF 2O0JA 1VB3A 4B6GA 5HF8A 2WA1A 1LPPA 4J75A 4XE5A 1RBMA 2VBGA 4FNOA 1ISIA 2C9BA 1ABBA 2I3DA 2VR1A 1JEYA 1N33B 1J4AA 4QBIA 1Q57A 1XPRA 1EM8B 5HGXA 3SZ3A 1XTKA 3HRHA 2DFVA 1G20B 4LRUA 3VZPA 3QMPA 1IL0A 1OXTA 1Q7BA 2P1RA 3GNSA 5AK0A 3AF2A 3I28A 1Z6YA 3CONA 3TZCA 1BU5A 2P1ZA 2X1MA 1LI5A 1BSVA 3LT4A 2IZ5A 3UOAB 1YNSA 3LQ4A 3OD1A 5AQEA 5C2JB 3R6TA 4YBRA 1EGAA 3GPBA 4I81A 4N5HX 1EHIA 2H3EA 4KQXA 2NO0A 4R5MA 1VI2A 1AMOA 2P68A 2R1UA 3G6KA 3F6SA 2EHDA 3OCZA 4WBNA 3UH0A 4LHYA 3TKLA 5D7BA 3KVOA 3IV6A 1ENZA 2OT3B 4PBRA 5FBHA 3IP7A 4C7XA 4I55A 4QQ8A 1G18A 2QTAA 2ROQA 4YY3B 3STUA 3BMCB 1EAMA 3JZFA 4OJYA 1OXUA 4P4TA 3I6IA 2GZRA 1TPZA 5FNVF 3ZY6A 2FOXA 2FPIA 1NUTA 4K3VA 3MTJA 5GV8A 4FMDF 2UXBB 4KWEA 3ZHTA 3G0BA 4ZAXA 2FXVA 2YMQA 1YS4A 1L5HB 4Y3UA 2GJAA 10MHA 3LWNA 4NFHA 1DWPA 3A31A 1TUBA 1Z35A 3IT3A 4M89A 5EPOA 1VHWA 3K0FA 2ZSJA 1KOFA 4P82A 4BYGA 2QV7A 4PRKA 3TLZA 1T5OA 3KETA 3DLBA 2RGAA 1GAXA 4O5OA 5ER9A 2WJJA 4R2JA 4XYMA 4M53A 3S2ZA 3UWPA 3UOGA 2AEJA 5C8XA 1Q6YA 1PU2A 2CMDA 1NRJB 3EOBI 3A6PC 1YUMA 2BH9A 2CYBA 2EYQA 1IN4A 1Z4PX 2OV1A 4Y2JA 4MV5A 3WL3A 4RJ2A 1W85B 1JJAA 1V1JA 2F62A 4HVLA 1O9BA 1UBMS 1E7MA 3WAGA 5TT1A 3FLEA 1IC6A 3HU3A 3QKRB 4RPGA 5IBPA 1IG0A 1JDNA 3CRMA 4IDDA 3R76A 3NYIA 5H8WA 1A2KC 5JH7F 2ZJYA 1LLUA 5KWIA 5JAHA 3ZCRA 2ZXUA 3PXAA 1U8ZA 4G23A 4KDFA 4TMFA 1W30A 5HBGA 1VE3A 3NHSA 2XSZA 1ANKA 3A1UA 4YAJA 4AT1A 3MMXA 4GPIB 4DMFA 1NBAA 1GCOA 3NEAA 3ET5A 1PV4A 2OEPA 2OENG 4BNMA 4ALKA 4O08A 2A9OA 2MYUA 3E5MA 3PHCA 4YRSA 3K30A 3WV4A 2HBYA 2R86A 1L5RA 2W7TA 3LQFA 5BV2P 2GBPA 4NOKA 1RRCA 2HPHA 2IOQA 4U7WA 2YYAA 3RUCA 5EWLA 4G01B 1EX1A 3PCRB 3I52A 1E0SA 1KVUA 2HO4A 2PVCA 5DGDA 4N8SA 3RYFB 1OGYA 1W5BA 3C3PA 4B6SA 4EW2A 5ELMA 1J8MF 1NRXA 3I5YA 4K40A 4JI1B 3GA7A 4JOBA 2EYUA 2NNWB 3G88A 3ME5A 2WYUA 3P71T 1ACMA 1ZMRA 1I3NA 3H1BA 3EA4A 4RQTA 5F1KA 1PEAA 5B6JA 1EUDA 4C78A 1PT9A 5JNVA 1KBZA 1ZXXA 3E2IA 2F3PA 3QVGA 4FONA 1P8AA 4J2HA 1ISPA 1ZYUA 1RQPA 4JVLA 4MUGA 3T9BA 4EUKA 2E55A 4D8YA 1MVNA 1NW3A 4KXVA 4N5MA 5CYOA 3EB9A 1H2EA 4DFDA 3IQZA 1J8QA 4DUYB 5CNJA 4NE2A 1VCMA 2AN4A 3RRMA 2OCYC 5G2OA 4IO0A 5CBPB 5FBRB 5EYPB 1EDDA 1ZY2A 2RGNA 2DHCA 1ARZA 3O2SB 1RPTA 4CM5A 5K0ZA 2BFCB 2OYSA 1QIFA 2VRWA 5K8JB 4Y6QA 1KQFA 3LZ6A 1YIAA 1T4MA 4D3ZA 2NO1A 2FPWA 4YDSA 1W36C 3E70C 1PG2A 3C15C 4GPBA 1GZDA 2B6NA 4B3JA 1NP6A 2ZB7A 3D3JA 1NUAA 3PQ2A 4HQ6A 5KHAA 4CIBA 4G65A 3JVVA 3H99A 3OFND 1A7AA 1VKRA 4Y2GA 3VR4A 1NVMB 5EERA 3T3NA 1UBUS 3M9LA 4O8CA 4F6CA 4NK5A 4JVNA 1O1YA 1T0JB 1H0RA 2WB2A 1QE0A 3BXXA 1ZVMA 4LJLA 4FP9A 3G9QA 5E8JA 4FC7A 4BV2A 3SX0A 5LA6F 5LQDA 1JECA 1NQUA 2ZDQA 4FFRA 4JYCA 1QPZA 1I2ZA 4Y7DA 4GR5A 4C0BA 2C00A 1XEWX 1RXCA 1V8ZA 3O7MA 5CFOA 1JS1X 1YZNA 2BFFA 1Q2XA 4FWBA 4RZQA 5LR6A 4HBGA 4XWKA 5EKSA 4YUXA 3ASVA 2F43B 4D46A 3GLGE 2G4VA 4J76A 1ZD5A 1BHQ1 4TZKA 5CLGA 4ZU6X 5B4VA 5L4NA 2XGSA 4Z6KA 4NH4A 4O4IA 1QTNA 4BMNA 1NKSA 2EBHX 2ZJ0A 3WMFA 3UN1A 4JI5B 1YSCA 4PC6A 3SYRA 4ZN6A 3RS2A 1N6OA 4XSGA 3AU8A 2H4ZA 3RTGA 4PONA 4OHOA 5GMOA 1X8JA 1U3GA 4R0VA 1DIGA 2PEZA 1S1CA 2Q27A 1NI3A 1XMQB 5EJ6A 3KNZA 2HJWA 4MQEA 1YCFA 1G5QA 4MR8B 4N0DA 1P31A 5LZ9A 1KYXA 1YI1A 2NUTB 3GAAA 3GFGA 3THSA 2CXHA 2WVAA 4A6PA 2WEKA 4Z9BA 2B7BA 3STVA 3PL5A 5DK4A 1XPOA 1UK7A 1VIDA 2SKCA 3SIXA 1U3FA 2FK8A 2H5LA 2X8AA 3EBOA 5M7EA 1CUIA 3MF4A 2Z9CA 4G8BA 4IS2A 4KTVE 3U9LA 3VHXB 1UAAA 1OX4B 3C6BA 1KH1A 1TZ2A 3LSYA 3SYMA 3ZDRA 2ZIEA 1H1DA 3G5AA 1KK0A 5EZYA 1H8HD 5IKEA 1C7FA 1Z5NA 2HV8A 3N07A 2PFSA 2OWDA 5LZ7A 1VA4A 3U17A 3ROXA 3GBVA 2X2FA 3UJ9A 4AJ2A 2PH7A 3P0EA 3E3AA 3AG6A 1BKYA 1K92A 2PVPA 3O31A 5DCWA 4EYEA 1J70A 1JYEA 4V0ME 6REQB 2G63A 1B15A 1VCNA 2PZEA 2W4IA 2YHUA 3ANYB 3FBGA 3LOPA 4HYQA 4LRWA 4ZWNA 5JE8A 4AJEA 2IBTA 3LYHA 3IT2A 1EFLA 3TMKA 1VPVA 2QR5A 3L4JA 3QF4A 3NHMA 1P0IA 4AZ3A 5JJ5A 4AG3A 4NC9A 2W22A 1UMBA 2QYTA 1VBNA 4A0QA 1X1SA 5EMJA 1JLLB 3VXKA 1T91A 5K3AA 3D6MA 1ZRHA 4TOIA 1CHNA 2KWIA 3HI6A 2I87A 3CNLA 3G5MA 4W7IA 1Z56C 3C7DB 4LFCB 2EATA 2Q3FA 3CX7A 2QG6A 3NS7A 4OQDA 2IHUA 1ZW6A 4E5NA 3MUOA 2BFCA 3BSFA 1ZOOA 2C94A 3K6SB 5CJ2A 2PU7A 2GTIA 4Z2AA 5JJIA 4A0HA 2VJDA 3ZHSA 3K53A 4LTDA 4P34A 5G1OA 5L3SA 2AOTB 3WGLA 4BEJA 4I9UA 1POXA 3IR6A 3GGJA 1W0KA 3P0RA 2COUA 5EZYF 2Z6AA 2B3DA 1BX1A 4ZYVA 1YR9A 3DBRA 4FBGA 4X44A 1EKXA 4LCEA 4IM7A 3G0IA 2L17A 4QDXA 5FFNA 3UAYA 4F86A 3G7UA 5KTKA 1JTEA 1S4QA 1VKNA 2V45A 5GJCA 5TQVA 2FW6A 2FPPA 4K6MA 2QRQA 1Q19A 1YOVA 3H17A 1ML4A 4HGQA 2NSJA 4LG1A 4MSUA 4PC2A 2CBGA 4YXWD 4YJ2A 2C4NA 3AM5A 1EAYA 1W34A 4IY1A 1G4UR 3ZY2A 3RVBA 2E18A 4OHWA 1CE8A 5FV4A 1GQSA 2G6TA 3U7QB 4U5XA 1VA5A 5LDGA 5HX7A 4CMEC 2NYVA 2CW5A 3T4EA 4DWWA 5KSWB 2J6HA 4YQEA 1PJ4A 5I7WA 3S8EA 3VVMA 2O5RA 2CK3D 3HB7A 3VKGA 4BEBA 2VTDA 2YV3A 3IIKA 4CGYA 5HKKA 3HJRA 5ECYA 2H2HA 1EPUA 1G7RA 3MNFA 2MTBA 4LXTA 3UB2A 1ID8A 1F4VA 2DYKA 5BRNA 4NMMA 1DADA 5CITA 1ID1A 1R74A 1R27A 2G77B 3IVAA 3ZLBA 3O4RA 3QVMA 5F2NA 5C7OO 2BCEA 4OIMA 4C21A 3MHPA 5IBRA 3WTCA 2FSSA 1DKMA 3FCXA 2VQSA 4HWGA 2QUKA 2R6AA 3IR5A 3CUTA 4LYDA 3ENWA 3KQMA 4OF4A 1EFRA 1PFGA 1YKSA 2G17A 3MTBA 2Z3WA 5BYKA 2R7LA 5FDFA 4PPFA 3K0HA 1A95A 4KPUA 4ARCA 1SXJC 3KDPA 4TKUA 2ZRQA 3ZDCA 4RHTA 2YW9A 2D5AA 1C0EA 4JYBA 3GEHA 4MUHA 4BV3A 2AK2A 4QEDA 1RPNA 1FE8A 1PJ8A 3PHIA 3CF2A 4AJNA 2FF5A 1R4ZA 2HIAA 3HJHA 2E5WA 3EWNA 3RYFA 3CVJA 4N18A 1XJQA 2VAMA 3COZA 4X00A 4DV0B 1HDRA 1L4KA 1MC4A 4PO9A 3GRVA 1MCZA 2Q5OA 4H7JA 5D3KA 3SFZA 3T3DA 1MUUA 3RRZA 2W6MA 4R1UA 4YP7A 4ON9A 3TLJA 1NLUA 4NMLA 2ST1A 3ZC3A 5K0SA 1B2LA 5L3QA 3GT3A 5EKTA 2VLBA 5AVQA 4GS5A 1J1IA 1GUBA 1PR6A 3IVXA 3QIAA 4TMKA 4BNXA 4BXOB 5FNVA 3A32A 4JSRA 4AF6A 1C8BA 3ND6A 4KO8A 3LDHA 4AL4A 5KDOA 1NXPA 4IH4A 1GG5A 1SC4A 1UOOA 2ODEA 2FPGA 5ALKA 4FIZA 1JWAB 2ZPAA 3FWNA 3OTWA 3P26A 3ZLUA 2RI1A 5HOQA 4OD0A 3AP2A 2WQZA 3S2FA 2WAAA 1SFRA 1EVIA 2B7LA 2HDNB 4HSEA 3RJMA 4E2WA 3IEXA 3LBAA 4ISBA 1GEEA 1DCFA 1E9RA 2PGIA 5HFNA 4HDQB 5BOVA 3SDSA 2WU3A 4ZAGA 4IHQA 1C4OA 2QAGC 4L75A 1IN6A 1E98A 2BKUA 2WUFA 3JVEA 3NJ4A 4JWKA 5CYGA 3EXFB 4B46A 2FWJA 1E96A 3SZUA 2XDQB 2GAOA 1AURA 4GZ6A 1U9CA 3I9MA 4O4HB 3L8MA 2Y1GA 1IBKB 3FYHA 3QVUA 2A2ZA 3GWGA 3LDUA 3C16C 4IJMA 5HK9A 5M2QA 4ZVUA 2VF4X 4AY2A 4H6WA 1UBNA 2EP5A 3I5AA 1TFRA 3MT7A 3NNSA 3P2YA 5TC4A 4UTVA 4ZIRB 4AMUA 3LYUA 4HXFB 5AK4A 3IHWA 3A9CA 2ZYRA 5LDHA 3F9IA 4I50B 3PIIA 4FOPA 3CLSC 2Q3DA 1N5DA 1DEOA 4M9ZA 3KR2A 4RHUA 4DSOA 2ID4A 1XNGA 2KE5A 3KKLA 4YACA 2BRUA 1FDSA 1QV7A 2VPWA 3ZXXA 2CJYA 3EXEA 3U4QA 2QRUA 4IIJA 4GEGA 1ZAYA 2BGTA 2X3FA 3QQPA 4PPGA 3M1IA 4X3CA 4Q1VA 2AKEA 1HRKA 3WRYA 1XRPA 4HGNA 4QUGA 1O95A 1U0SY 2A3NA 2VJNA 2AYZA 4HVTA 2DWUA 2CDNA 4UNPA 3L8CA 5D3QA 4DR7B 1DKPA 3U4AA 4MA4A 3LCJA 1V5FA 2XZLA 2YX1A 2ECPA 2YV1A 4FN5A 1I6LA 2VPQA 2ECQA 4R1OA 5DYTA 3OURA 1K7YA 4CF4A 2MHCA 4RY0A 5B1HA 1KI9A 2RHDA 3E7WA 3R6LA 4FXOA 1GZ5A 1TJ4A 4MW4A 4R2XA 5C37A 1M73E 4UAJA 1O8BA 4NFSA 4B3SB 2HT6A 1QGYA 1WCV1 1BGXT 2G83A 1I3LA 4HB2A 4NENA 1E2PA 3V4FA 2IHKA 3T3MB 3L7AA 3TSYA 1SVIA 4XQ9A 2QW1A 3OPNA 1QFSA 3Q12A 5A7GA 3SSMA 3VFDA 1QDUA 4NOJA 2XWBF 4AJJA 3GLIB 2ZFUA 5CYPA 1G8JA 2BE9A 2VHQA 1GYQA 1NBME 2BGLA 2CJWB 3DE2X 2AC4A 1CRWG 4I55B 2GJ9A 2GM4A 1O94A 1C7JA 3UBTA 2VPYA 3H6KA 2ILVA 2H54A 2D2EA 2CLLB 3PUIA 3CZMA 1L7VC 1DAKA 3HO8A 4O3MA 1M1NB 3H11B 3LP6A 1KZHA 2DCMA 3RS5A 3D7NA 1WDKA 2HK6A 5CRIA 3AUYA 2FHSA 2IHBA 3DDWA 4TTIA 5JCJA 1MAUA 1XXHA 2D4AA 5FUBA 2WDZA 4DRYA 3KLBA 4QE3A 1L4BA 4OQNA 2MMCA 1U1FA 2AD5A 2LZ0A 5ADVA 3O21A 1DQYA 3FDZA 3BF7A 2XOEA 3HR7A 3MWLA 3BL6A 3QU5A 4FZJA 1C3EA 3KEQA 4NBVA 5F78A 1KDZA 3SC3A 1MB4A 4IMJB 1GFSA 4DSZA 2FNAA 4H17A 1KAEA 1J2EA 3V4VB 4M4SA 3PT5A 2DUJA 5EIAA 5CFPA 1OVMA 4M54A 3KKNA 2DULA 2G82A 4B84A 3QWFA 1BC5A 1BHSA 3LUPA 4AICA 1IWPB 1QIGA 2O2DA 3UF0A 1X7HA 4CQNA 1PT5A 2WWIA 5F64A 4RZHA 4O4IF 2P2LA 1IG3A 2QMUA 3QU7A 5A9SA 4JUFA 2DFNA 1XEAA 3WWOA 5EJ4A 3IURA 1F1BA 3KE9A 4Y67A 3LPMA 5D00A 3U3JA 3DBOB 1CF4A 3SOZA 3LBFA 5LU8A 3RU2A 2E21A 5AUPB 4F56A 1ABEA 2PDAA 3SJUA 4BGDA 4TVBA 4DV4B 1I7LA 4XJXA 1NLFA 3GARA 1ZK2A 3B48A 3ZKWB 5JMOA 1P60A 3EXHA 3HR8A 1XCBA 3CKMA 2ONYA 3NKVA 4CL3A 2WSMA 5BORA 5AVSA 5J2UA 4EP1A 4EUSA 1ORHA 1PK9A 5EWMB 2Z4TA 1IB0A 2G40A 3K0CC 3OG9A 1E2NA 3IHKA 4A82A 3BZBA 5ICSA 1RAEA 4F6LA 5TX7A 3A4LA 2ORYA 2HAEA 2C04A 1FU8A 2OGUA 2PQ2A 4MIOA 4YI5A 1TEXA 2MWMA 2YZ7A 1YR2A 4M0CA 4WX2B 1ZXLA 2IPLA 5KCZA 1Q1BA 4CEJA 3WMGA 4CLHA 2P3OA 4ZC8A 3SIWA 1I30A 1LK7A 5C1PA 1V47A 3QUAA 4F1KA 1NQWA 3SQXA 5L9AA 1EDZA 1T5HX 3FDFA 5KJ1A 4XH9B 1JFVA 3KKEA 2Z08A 4LZJA 2Z5VA 2ZYGA 3OQIB 1GNTA 2BDEA 1KXJA 1LFAA 2G1JA 2OV2A 3H9JA 5F5NA 5H83A 4MCHA 2J31A 1TADA 3F4KA 2X14A 3EEQA 1EHYA 4GPD1 3L41A 4JUIA 4TL7A 4BZZA 2FPIB 4MUEA 3I8OA 2QTMA 2CV0A 5K3CA 2V6BA 3A36A 5HZGA 4B3MB 4BP3A 4UNRA 2NQTA 1RIFA 3E22A 2J3DA 4CMHA 2BM1A 3U3MA 1FLVA 1S2LA 4AY5A 2CUTA 1TC1A 3N7UA 1Z83A 1CNFA 1ZD1A 3I12A 3VM6A 3EQ8A 1ZNXA 3HJCA 4FB4A 5LM3A 3GBSA 2PWPA 3AL3A 4HQFA 1OBCA 1L5KA 2Y1EA 5HUQA 2R1VB 5K3SA 1EG2A 2BD0A 2Q7OE 5KOYA 4YCNA 3L7KA 1PZHA 1NVAA 1Z4JA 1NFQA 4NARA 4EVRA 1IOVA 2GEKA 4G0PA 3CT4A 1TMGE 2Q1SA 3I83A 3IUMA 2IGTA 1F4LA 2IYAA 3QA3E 4UVDA 2NXWA 3FVVA 5C51B 5TPWB 1W36D 3R3WA 4EPYA 1ZVVA 2JB9A 1TF7A 1JBEA 1R00A 6Q21A 2AFHE 1YIOA 2R11A 3CLVA 2GK3A 1PVOA 4UVIA 2FEAA 4F06A 2JJ1D 4N6OA 2FSVA 3GK3A 1GPJA 4EPTA 1BA2A 4UUOA 2QD5A 3CH6A 1MQ9A 3B6EA 4LQLA 4RENA 3TQIA 2RSLA 4DHWA 2NUAB 1C80A 2OP0A 1GEGA 1X94A 4H1TA 3FNEA 4PYOA 5DP2A 2JFPA 4QRHA 3QI7A 3K9CA 1P3JA 1M6YA 1O5OA 4W8HA 4EJ2A 4CNBA 1IZ8A 3QU4A 5EI5A 5KC8A 3ER8A 3F8WA 4ZAWA 1Y80A 4J8PA 1HE1C 1T4CA 2H9YA 3W3AD 3NTUA 4CIVA 1O6BA 3Q9SA 1JF8A 1SUBA 2DHRA 2EFCB 1UXOA 2IBMA 3G85A 3JZMA 2Y1OA 2YC2C 4IGKA 5BT9A 3G0HA 2YXNA 1SUAA 1OIVA 1JIJA 1WJGA 1FLNA 2NU7B 4TTAA 4F4FA 1PR0A 1C4XA 5A1TA 1A98A 1MX1A 2P79A 4OQXA 4TLEA 3SM9A 4L5JA 2HF7A 4BVEA 1K2VN 3RRXA 2GJ8A 4EB0A 2NZWA 3RDPA 2JFXA 5CDTA 2VP9A 3O3OB 1K6EA 221PA 4JQYA 5BN4B 3ZGNA 5LYJF 1CNMA 2WILA 1NNI1 2XEXA 3ORRA 5D1NA 2G72A 5EWJA 3PGLA 4QHYA 1TQ8A 2O2IA 5E2AA 2ODQA 1T9HA 3R7DA 2LW7A 4NU6A 2BUBA 4AMBA 1UIRA 3BJIC 1BQEA 1GDDA 2WJHA 4GP7A 1H9CA 4N12A 1T13A 2J48A 4JP1A 4PZLA 4D3YA 4P3KA 4E1AA 2PLFA 3WSWA 1HXHA 2DU8A 5J4KA 3ICEA 2R8RA 4BP1A 3KHTA 3VZSA 4C0HA 1KMHA 5BP7A 4YO8A 3GP3A 3QIVA 4MGZR 2EW2A 5BSMA 3U5TA 13PKA 4BX8A 5EMHA 1GPMA 1AZTA 1Q12A 1DMRA 1QSGA 1V26A 4LCJA 3EEYA 4NK4A 2GX6A 1TA0A 4CKYA 1UPTA 3I34X 5JVDF 2C5FA 1JYFA 2QGZA 3P2KA 3DOCA 1Q77A 2K2WA 5A6VA 1BVYF 4HGRA 1JJBA 2PKYX 1X7DA 5KOJA 3OM8A 1CF2O 3ZDYB 2ZIVB 1XWWA 5EJ7A 5A03A 1KETA 4RLQA 1RBZA 2IY8A 1XJCA 2I4NA 4D0LB 2ZRBA 3G9XA 1C1DA 1QX3A 1E62A 2XDAA 3GDHA 3DMGA 3QH4A 4RK7A 2FU5C 4JC4A 2RJ3A 3WI7A 1TYAE 3ZHYA 4BJ6A 3IQDB 1BJKA 4JZYA 2WSBA 1G3UA 1KTVA 2FP4B 2N3ZA 4B79A 1UKBA 4NKRA 5DTMA 5A3RA 4AZ0A 1IWOA 2WHEA 3C4VA 1AXRA 5ICCA 5IS2A 3FKSA 1CR0A 2ZRDA 3SLRA 4DZTA 1BS1A 3ANLA 3CX6A 3DEJA 4LF8B 4OAOA 4UM9D 1M54A 2GEFA 2PT5A 4JOCA 4TS3A 1C9MA 1I6MA 4ZO9A 4ZO8A 1J0XO 2H2GA 6ABPA 1KRWA 4TTPA 5JSQA 4BNNA 1W0JA 4IVPA 1B8NA 4QM6A 2FN7A 3HNOA 3DAFA 5I4KA 2Q4OA 3WP0A 5C5DA 3QRWA 2QZSA 4L16A 4DC1A 4U2EA 2P67A 5LLSA 3V2GA 4B4OA 2SKEA 1TQ4A 3M6LA 2OUIA 1FQKA 5FPSA 4LJSA 1CJTC 4EHNA 2UV8A 1DAIA 3RVJA 7ABPA 1UXIA 3NAGA 1PTKA 4KLNA 4QTXA 3WNQA 2FWIA 2FCAA 3DZ8A 4G25A 4GP6A 4EG6A 7YASA 1UJNA 1G6OA 4MULA 4YJ3F 3K20A 4YWJA 4Q7JB 2XBMA 3GYBA 3BERA 3TAXA 3N5KA 4IDNA 4BL5A 3PX2A 2QROA 2C4TA 1ACJA 1OF1A 4Y98A 4O4LB 3IUJA 1QKKA 3JQPA 2R87A 2CVFA 1XB2A 1YO6A 2HNKA 3JQGB 4QECA 1VE6A 3TTUA 4DEXA 1NPYA 2BTOA 3IO3A 4PYNA 5KTPA 5AI8A 4C87A 2PCLA 4RVCA 3TLGB 4KO2S 4W7SA 3HCFA 4KYTA 5AW4A 4KXWA 3ZV4A 1Z6XA 4CHTA 3T54A 1QORA 5LP6B 4E4RA 3WWCA 5CK4A 1GTZA 3SNHA 5DYNA 3T0GA 1A9YA 1R18A 2XCRB 1TIKA 2WHYA 4RORA 3S8MA 5BV8A 3AY7A 4BNWA 2WWHA 1OX4A 1DOZA 2QN8A 4U6NA 3WFIA 4I1UA 4W5RA 2XVZA 1E1QA 3VTZA 1UBRS 2GXQA 3FTPA 5DHFA 2WAMA 3ZOZA 2XHEA 4FGSA 1U3WA 1P4HA 4RD1A 4IP0A 4WRRA 1RCTE 2JARA 3ROGA 1SURA 3UK1A 3WGKA 3ND7A 4OHPA 4WK2B 1XMIA 2A78A 1GZUA 2ZIZA 4HAXA 4AJKA 4ARIA 1BE8A 3OLZA 2EG9A 2VSYA 1RWKA 3C98A 1HLFA 3CVUA 2VUTA 3TQOA 1U7ZA 3ESXA 2R6ZA 2NSDA 1KBQA 1M3SA 2HDHA 3WP1B 2QD1A 4UTXA 4ARUA 1R88A 1W5FA 7MHTA 1TZBA 3DAYA 2BGGA 1MHPA 3AJEA 2D00A 2ENWA 4ISCA 4BJ5A 5HYVA 1NJFA 1M8JA 4BS9A 3U0VA 4AXBA 1F20A 1GAWA 1MOZA 2WMYA 3PTZA 5DX8A 3IMCA 2L0XA 1FSSA 3R77A 3AHJA 3PUKA 4OSOA 2CDAA 2X77A 3SQOA 4AK9A 2D7DA 4ZOBA 3JARB 1HZJA 3D5QA 3MAJA 4MVJE 5DX0A 2YJZA 2Q8NA 1II8B 3PVCA 4J91A 1C5KA 2E89A 4M1ZA 5E6UA 2IHYA 3F1LA 3VPHA 3JXEA 5B1EA 5JNRA 3HACA 1HDYA 5KYXA 4CLOA 1J0EA 3Q0EA 3GRAA 2PX5A 3TPCA 4RL6A 4K6FA 4DANA 3EFEA 4GNRA 5FUMA 3QKWA 2JC3A 4LBWA 2JLXA 2QKYA 4YJGA 2YDYA 4US1R 1ODJA 4DVJA 5JNSA 3N8NA 3RRBA 4HX2A 1SOMA 5KTOA 4AQYB 2GGSA 3KFVA 3ZIAA 4A73A 2PZGA 4PG5A 1WVIA 1U1CA 4KREA 4F84A 1YCDA 3PQ4A 1AQLA 3K09A 1I4TD 3EPPA 1MO5A 3FDJA 4TYMA 1B0AA 1GUDA 2ZQ5A 2IP4A 1A7KA 3WQSB 2P7IA 2WW8A 5E8RA 4BPBA 2ZETA 1B6TA 5I5GA 2NZJA 4BZXA 2FPLA 2QD4A 2O8BA 2JKZA 4G4GA 1ADJA 4L8YA 5T8KC 3MRTA 3FB1A 3ILVA 4RH3A 2C3YA 1EXDA 2CHUA 1JW9B 2WJWA 2DOKA 3EUAA 1YS2X 1RMTA 2V7VA 4Q37A 2C84A 2D1RA 4KQHA 3TR5A 5BMVA 2CJXA 3WB2A 4CF6A 2JCVA 2BMVA 4GYWA 4H27A 2DRIA 2IYSA 2DSTA 1A4RA 4FT4A 5C5IA 4DYVA 1JEEA 3I6MA 4KHZA 2ERYA 5C7YA 1ZJ4A 3B2EA 3BTSA 4KIGA 3M4JA 3QSGA 3LE8A 3KAKA 1XJ5A 3CM0A 4B47A 5A5FA 1YU6A 4NS4A 3P7MA 4NBLA 1R6DA 3TIXB 4PO8A 1HYHA 1P6XA 2QN2A 5E4FA 5LYJA 1II9A 4W6QA 2D7CA 3TAUA 2PUTA 3LZDA 1EK2A 2O20A 4FNMA 3AHEA 2XQVA 1RBYA 2C83A 4HNRA 3CVVA 3UWDA 2FSPA 4GBJA 3J81A 1IAQA 4YMIA 4ZCSA 1P6UA 3GGGA 3ZPXA 4B9EA 1C3LA 1DAPA 1SA0B 2ECOA 3NOXA 1K8RA 5FUXA 1AV6A 4MMYB 1IZ0A 5IMBA 4Z4IA 2ZS9A 2SCUA 1IN1A 1PFVA 3Q3IA 2R6CA 1MB2A 1B00A 3IESA 3LV8A 4KLAA 4QYMA 4U0KA 1OX6A 3TNJA 4KR7A 1UQTA 2TMDA 1W581 5AIAA 3WLAA 1QQTA 1HRDA 3IMKA 4Q4JB 3S5UA 4LF7B 1QR2A 1XYYA 1ZK1A 4AN1A 4X60A 1SD1A 2I2CA 4IDEA 2QG9A 3E35A 1JMKC 2Q5HA 1KAQA 2B0CA 2VH5R 1G5FA 3KWMA 4N9QA 5HMMA 3O9ZA 4RFSB 4MWEA 1RM5A 4RKQA 4XLLA 4AY4A 3JZAA 2WSSD 4B17A 1ADCA 2HJRA 5DGCA 4FYPA 1FP6A 5LXTA 3MGAA 1FVFA 2X4GA 2FQQA 4LI3X 2X4IA 3KQYA 4IUBS 5DLPA 3RU7A 5I9NA 1HYQA 1EWTA 3C0KA 4E11A 2H00A 4Z51A 1WMEA 4D4MA 1TUIA 3TAHA 2HFJA 3DLTA 1FRZA 4HGZA 2ASEA 2PKXA 3PZRA 1JHUA 1JRLA 1HOXA 2IW1A 1T0IA 1EJ0A 2XWJI 3BMXA 3KZNA 2O2EA 5J40A 2KLBA 3X1XA 5CA0B 4BX2A 5K99A 4KVZA 4Q00A 2JFFA 5AIBA 3M2PA 5F9HA 3RIXA 3F6BX 3E05A 4MQ6A 4EPVA 5KYKA 1JPVA 2WLTA 1TMOA 3OQNA 1REQA 1FXWA 4XVRA 1U8YA 3TTXA 3BVPA 3CHYA 3F46A 1KZGB 4LSGA 2EAUA 2O1WA 5AVZA 5JZBA 3A2MA 1GNSA 2AQKA 3D4PA 3MCVA 4MV1A 3B5JA 1CUGA 4KQEA 3P9XA 1L7QA 5GONB 4ZPXA 3GLFA 1V7QA 2F1RA 3O4JA 3OJWA 2Q5CA 1CUJA 1HFWA 5F2KA 3L7JA 4LXUA 2ZT8A 5BUQA 2QRGA 2P90A 2R9VA 3M49A 4P2GA 4ZQCB 3V1YA 2X41A 3B36A 3DB2A 3ADOA 3CE9A 4I7EA 4ZPJA 1L6RA 2X5NA 3E9RA 6NULA 4CUZA 3OKFA 5DN6A 1X1RA 1X6VA 4DDHA 4ZQHA 3QKRA 2FPXA 3PD7A 1XTJA 1CDDA 2GWHA 3WRWA 1K06A 1RWXA 5E9JA 2ODNA 5BN1A 2Q3HA 2CDRA 3FY4A 3UJAA 1L7PA 3UK6A 2FEMA 1NURA 2DTDA 3OX2A 1HBJA 4KAAA 3ONDA 4GKBA 2CB9A 4Q66C 1XDUA 4WPGA 3BWMA 4Y6GB 1RM0A 4TTRA 5FWNA 1RRKA 5HKAA 1OXBB 1ZIYA 4MJLA 1QHYA 1KI6A 5TPWA 5LQKA 3SYTA 3PFFA 1NXTA 1RYBA 2I62A 3NWBA 1VJ0A 4MW0A 2XCTB 3EVGA 3IDQA 3PNMA 3A6EA 3T7IA 2RGNC 1XD9A 4PPNA 2YWCA 3II6X 1GG9A 1SUEA 4B73A 5KQSA 4K5QA 3UO8B 2QMHA 1CEQA 2BFAA 3C3DA 4IV5A 4MUKA 4OFXA 5JQGA 1PSZA 4HI0E 1MXFA 1U4NA 4OUDA 4QULA 4AS3A 4DQ0A 1K1EA 3MINB 1RYMA 2Z0MA 1H1TA 3NV7A 4HZGA 4LAFA 3UAOA 7MDHA 3I9JA 2CLEB 3PYLA 4OBBA 2G9RA 1L5FA 3E7XA 3WLEA 4XPZA 1YOVB 1G0NA 4K8RB 1FTGA 3V6LA 3B6IA 1H42A 4UE2A 4BLUA 1ZN9A 2FPPB 1W76A 4MGKR 3OFNA 2X2PA 5KYYA 3DM9B 3ED5A 4M7WA 2Q2OA 1WG8A 3IGFA 1ORWA 2RHCA 2ZAIA 1NUQA 1T5LA 4TUYF 3D6TB 1OZ0A 3A0RB 4NESA 1SUCA 3Q6MA 1OFIA 3G23A 4YRGA 2HLDA 2JEYA 4FK8A 4NJMB 4NLLA 1Z7YA 4KJXA 3BMNA 3ZI4A 3G68A 3DCJA 2ZI4A 1ECLA 4KW7A 1JTFA 1JIQA 1T0UA 5EZ6B 2IV2X 2A7XA 2Y76A 1ZRMA 2NYRA 2QTZA 5BWBA 1RC1A 2Z4SA 2CYCA 1M67A 3LFUA 2B20A 4RGQA 1NVVR 1OZAA 3CSSA 4MX8A 4R3NA 3BRQA 4IF4A 4P1ZA 4ARAA 1QVZA 1WM1A 5BN3B 5KTTA 2HBRA 3TZEA 4RADA 5IKOA 2PEYA 1WMFA 2C9OA 3FMFA 1TVKB 1WDLA 1GN8A 4WZ6A 1VL6A 4MKZA 1CIPA 2I7CA 1QTRA 4IOJA 2FLWA 3RR2A 4V2IA 1E5LA 3DE4X 1N6HA 5IN5A 3NM4A 3W9SA 5B4TA 4YMLA 2A5JA 1SXPA 4JJ7A 3ABRB 3PKJA 5EJ2A 4G2NA 3TLYA 3DQZA 2O7NA 4CCYB 2QN3A 1PWHA 4EY8A 2HTEA 1B74A 1GGNA 2LUOA 4KVFA 3GOQA 4OU4A 5IT5A 3QXGA 4OSEA 4L4YA 2ET6A 3TUZC 2XMCA 4ABYA 3F3YA 1LQ2A 5LA6B 5HQTA 1I7SB 2YMLA 1ND5A 3ESYA 5EUMA 2EHJA 4UMDA 2C96A 4G8DA 4DARA 4R3UC 1WRBA 2IUTA 4HOYA 5TXGA 4RTQA 2J08A 4NYIQ 4L5CA 2RHGB 5ALVA 5EMNA 2QVLA 4L74A 1IHDA 1LBQA 3WV5A 2Y0EA 3N7AA 3THRA 2WLSA 2IZOA 4U39A 2DUUA 1DKQA 1W0JD 4MUJA 4MWDA 2C3OA 2HHCA 1AX9A 4CG2A 4RIHA 4A6DA 3QE9Y 1MOSA 4M22A 1WZ2A 1E32A 3UFXA 3L8YA 4M0KA 3TW0A 3R2JA 2P4EA 4LVOA 3ENVA 1CQJB 3Q0TA 1E79A 2Z43A 1DJNA 1JAYA 1E64A 1P75A 1EFPB 1SEPA 1U2SA 2AMVA 2FHPA 2G25A 4EELA 5KYTA 4JI7B 1JSXA 4PSVA 2VQ6A 4R40A 4XUCA 2A14A 4NYJQ 2QIOA 2JFQA 2MJLA 4QDOA 5L53A 3D4BA 3LRPA 3T3PB 1T15A 4J1SA 4XYGA 2IPXA 1D2HA 2ZGVA 2GYUA 4BB5A 4JBIA 3QW2A 3OQIA 5ESXA 3K4HA 4A1OA 4BUCA 1ISSA 2KHZA 4DA6A 5HKOA 4CQLA 4M36A 1BDIA 1DIBA 1S0UA 3LHDA 1OWPA 2YIJA 3L0YA 2I8LA 2IPOA 5AXDA 4CIAA 2AN3A 3TG2A 4QODA 5ISMA 2LNDA 3CEAA 3QEMA 2AZXA 1Q0UA 3ENKA 2HT1A 2BPOA 3FWKA 1GPKA 1YL5A 2RK4A 3BCRA 3TMAA 3ZU5A 4BTLA 3SK0A 1MORA 4O2AA 2OUKA 5AW0A 5ED4A 4MROA 3UJ7A 5BOSA 1T8WA 5HWSA 2BFWA 2Q3JA 2XQKA 2X8LA 4XM1A 3RHTA 1EP2B 3A6JA 2XRMA 5DYYA 3SHFA 3DLHA 4EGAA 2PK3A