3EWNA

Crystal structure of a thij/pfpi family protein from pseudomonas syringae
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
242
Chain Sequence
SLHPHAMPDMGPDMNKVPWMGDEQIAMLVYPGMTVMDLVGPHCMFGSLMGAKIYIVAKSLDPVTSDAGLAIVPTATFGTCPRDLTVLFAPGGTDGTLAAASDAETLAFMADRGARAKYITSVCSGSLILGAAGLLKGYKATSHWSCRDALAGFGAIPTEARVVRDRNRITGAGVTAGLDFGLSMVAELRDQTYAECAQLMSEYDPDPPFNAGSMKTAPAHVRTAMIELVAEFTKKADALAGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ThiJ/PfpI family protein
publication title Crystal structure of a THiJ/PfpI family protein from Pseudomonas syringae
rcsb
source organism Pseudomonas syringae pv. tomato
molecule tags Structural genomics, unknown function
total genus 72
structure length 242
sequence length 242
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3ewnA00
4P5PA 5SY9A 2W7TA 1OX4B 1QDLB 2H2WA 1CF9A 4QYTA 2GHRA 1M6VB 1VCMA 3MGKA 3PQ8A 4GE0A 4AULA 3UK7A 4MTCA 5SY4A 4GUDA 1Q2UA 3TTVA 2ISSD 1GGJA 1KWKA 5E9AA 4ENVA 1PDVA 4ADSG 4BTEA 1I7QB 4UOZA 4I46A 2WJZB 4XLLA 1OY1A 3UJNA 4AUEA 2D7JA 1OX4A 4UNIA 3OT1A 1J42A 4OFWA 3B38A 1Q7RA 1OX6A 2R1TA 3ZJ5A 1S1MA 1C30B 1VHQA 3PQ5A 2GK3A 2NV2B 2ZUUA 4AJ9A 2AB0A 4L8FA 3NONA 1VCNA 5K4AA 1N57A 3EN0A 3PQ6A 1KWGA 1P81A 2RK6A 4PXYA 3TTXA 1UCFA 1I7SB 1QVVA 3D54D 4ZDKA 3R76A 1G2IA 4Y0NA 4ZDJA 3UGJA 4Y1GA 3UMMA 1P80A 2ZUVA 3FSEA 4B31A 3TQIA 3CZAA 3ZR4B 4D1YA 2A9VA 3TTUA 3VU3A 4WXYB 1GGHA 3TTSA 3BWEA 1P5FA 4ENSA 4Y1RB 1L9XA 3EFEA 1K9VF 1OI4A 4L7QA 3WFZA 4K2HA 3CY6A 4ENPA 4JQSA 4I2NA 1GGFA 4I4NA 3L4EA 4MGHA 1PV2A 4P36A 1JDBC 2V4UA 3GRAA 4Y1EA 1GPWB 1C3OB 3L3BA 3B36A 1KEEB 4GE3A 1OX5A 4N12A 4ENRA 4UZSA 3PQ3A 4BFLA 2R1UA 3L18A 2AD5A 3SF8B 4L8YA 1QVWA 4B40A 4HCJA 4Y1RA 4P2GA 2R1VB 1GGEA 3KKLA 2LXNA 3BHNA 4MNTA 4OGGA 3R75A 1O1YA 3NOVA 3PQ2A 4OGFA 5JZMA 1GPMA 2XF2A 3P9QA 4UOQA 3B3AA 4RKYA 1IZZA 2VPIA 1JVNA 1SOAA 4ENTA 4OIFA 2VKTA 3N7TA 3NORA 3NVAA 1GG9A 2VDJA 3EJ6A 3CZ9A 4UCFA 3ER6A 4L8WB 4B2YA 1GGKA 5IP5A 1P7ZA 2ZUTA 5BV2P 4ENUA 1T36B 1P7YA 1CE8B 4Y1FA 2ABWA 3MIIA 3P9RA 3R74A 5LIRA 4L95C 3M3PA 5SY6A 2IUFA 1CS0B 2ZUSA 4QYXA 1ONSA 1I1QB 3CNEA 1SY7A 1FY2A 3EZGA 4AUNA 3FIJA 2ZUWA 3EWNA 3P9PA 1VCOA 2YWCA 4E08A 4B5KA 1QVZA 4LRUA 3TTTA 2RK4A 1A9XB 1KA9H 3OT1B 2R1TB 1KXJA 4BIMA 4P34A 4S0ZA 3SF8A 1QWSA 5JZOA 1T0BA 3PQ7A 2VXOA 3NOQA 1FYEA 4OJYA 1BXRB 2R1VA 4B7AA 4ENQA 3L7NA 3F5DA 1WL8A 2OR3A 4ZDIA 3F71A 3P9SA 4L78A 5DFAA 2FEXA 5SYAA 2NV0A 3SOZA 3UOWA 1IZYA 4N0MA 3RHTA 3CYFA 3NOOA 3TTWA 4AUMA 4OQ4A 3TTYA 2VRNA 3PQ4A 2YWJA 4WINA 4P35A 1PDWA 3ZJ4A 1U9CA 4ENWA 2YWDA 1IPHA 4R7GA 4RKWA 1T3TA 1R9GA 4LGYA 4ZGGA 1PE0A 2RK3A 2YWBA 4E5VA 1QF7A
chains in the Genus database with same CATH superfamily
3EEOA 1DWPA 1BFKA 1ZC4A 2X23A 2JIRA 2R87A 2J07A 1QH1A 2EBUA 2JCGA 1WSBA 5JNLA 2PGNA 2XB9A 1UZLA 4AZ3B 4K6HA 1WXIA 2WPNA 3DEYX 2CVFA 3KTAB 4Q1VA 4LZLA 4QLAA 1Y7LA 3J7TA 4IHKA 2C5AA 3OEEA 4BUJA 2YWXA 2BDUA 4MDEA 4DPKA 2ODAA 1TGYA 3KWLA 3GN1A 3F3MA 1AURA 1SQ6A 4ZCIA 2HQOA 1AQNA 1KO4A 3T6KA 2HU2A 2XY4A 4UNQA 1OXVA 3HL4A 5DCYA 3AU9A 5HVNA 1XSEA 3H5IA 4QJ4A 1UOQA 2ZUUA 2F1KA 2J7PA 3FAZA 1YJCA 2E4WA 3FFWA 3PC7A 4YP7A 3VR5D 3BXHA 1L5FA 4GWKA 2W90A 1R9MA 3TLBA 1T4CA 3RVMA 4DTCA 2JGAA 2D2XA 1G8SA 3ELYA 2EBHX 3DZFA 4YHBA 3ANSA 3EXIB 2B25A 1IY0A 5ALRA 2ZIGA 4KTTE 3BTSA 1ND6A 4PAOA 1VDZA 2CGEA 4OQZA 2BMDA 2EQ5A 4BMOB 1O6BA 1KZ4A 3D43A 4MW9A 4FNMA 1IL0A 5KJCA 4P8RA 2HF2A 2YRXA 3AHFA 4OKSA 2C7OA 1E8DA 5DNUA 4F9EA 1XEWX 3B1FA 2H54A 1POXA 4X8LA 1D4ZA 2G4CA 3AHEA 3QLUC 4IO0A 3CW2A 2WJJA 3O2SB 1JH9A 4WE3A 3L04A 4EY7A 1GGEA 1R0WA 3AP3A 3QG1A 1PJQA 4BO5A 2V6BA 3MOSA 2XF2A 2F3QA 2HX1A 2V96A 2ZR7A 2ZULA 3F74A 4Y6GB 4EHIA 1L7QA 2XD9A 3N59A 4OQNA 2KMLA 1IWOA 1KRXA 1ZINA 4ALMA 2QMEA 4MVJH 2MOKA 1IZ9A 2XCIA 1P4JA 3HGMA 3MQ2A 1BQ3A 2ARKA 3UM9A 1V9LA 2QTWB 4ARZB 5M7EA 4YAIA 1KAEA 3CZPA 2IEGA 2R7MA 5CIYA 4RV5A 1TMYA 1SHKA 1DJLA 1P7YA 1KSGA 2XQGA 4X00A 1ACMA 3MYRA 1VLZA 1U8EA 3LV8A 5BYJA 3CMMA 1DQPA 1KERA 2PJZA 3PL1A 4DR7B 1A7UA 4K81B 3NRJA 1KJ9A 4D25A 3PEUA 1Q22A 1X3SA 5A0VA 3UHAA 4NU5A 4AJOA 4R1TA 1C9MA 2YL2A 1O58A 4HMPA 2ZBUA 3CM0A 3OZDA 3REFA 3OT1B 2X0KA 4JC4A 4PPFA 4JI7B 3DO8A 5IBCA 4W5NA 3R44A 4ALIA 1J9ZA 3QOWA 3U5ZB 1C1HA 2PSEA 3F3KA 3ORYA 2WMNB 4C30A 1UM9A 1VBMA 1P7PA 2IC5A 1AKEA 4DMKA 3LE8A 4FLFA 1LPSA 1RMYA 2R4TA 4ZT7A 4JEMA 3T3DA 4QJ3A 1I7NA 3DTTA 5KYUB 4GYKA 5KC8A 3NKFA 1RCFA 3LECA 4YUZA 2CUTA 1GUDA 3PEVA 4YBZA 5G1NA 2AFHB 2YJ6A 2X8AA 4TKUA 1X7YB 1D6NA 2UUAB 1U8CB 3R6LA 3MCTA 1CF2O 3IP8A 1WD5A 3HYNA 2J5RA 4LY9A 1R3DA 1HH4A 1H0KA 3AQ4A 2BGIA 4I3GA 1F2TA 4X1IB 1IB6A 2R1ZA 3DBRA 5AK3A 5E2BA 5FWNA 2AKYA 3MJ4A 1VCHA 3KQWA 2XKAA 5HKLA 1NDHA 4IDFA 5LZ9A 3CF4A 4TZTA 1TKBA 1UPXA 7YASA 4LFAB 1RRGA 4B3IA 2ZRFA 3ZDEA 1Q2UA 1ZM3A 4IO1A 1VB3A 2C3OA 4BFVA 4D4LA 4ENVA 1NNEA 2APJA 1II8B 5JAZA 1Z6TA 2ACKA 1CIVA 1XZCA 4EARA 1K75A 3E61A 4AQ7A 5EVJA 1NYQA 3P4UA 4GI3A 1GO2A 4BCCA 1Z26A 2GESA 2GJAA 4DNOA 1T5TA 2D0DA 1RWBA 2YR0A 2C3MA 1FUYB 1QE3A 2O2CA 3HY6A 2G9QA 4K28A 1OT3A 4L9SA 3LO5A 4YY3B 1H1DA 4UNNA 4E1AA 3M4JA 4GMXA 3E5HA 2JLSA 4BGDA 1GYQA 1CR0A 4LDNA 1K06A 4RPIA 4Y2SA 1BVHA 4J7CA 4C0KA 2QMZA 2X0NA 4CR7A 3FFTA 4I9NA 1HTTA 1FFWA 2VRWA 3IUBA 5FTWA 3IAHA 3N86A 3O2QB 4K26A 2YRFA 3BMNA 3RJMA 1Y8ZA 3R0VA 1FMFA 3SDSA 4MDHA 4RZ3A 1PTJC 2R2AA 4ZRDA 1IBMB 1LH0A 3PD0A 2Z4RA 2YIVX 2EJWA 4YX9A 4S1VA 5CP8A 3KL4A 4JIMA 2OGSA 3INGA 5FADA 5BWBA 5F1KA 4JQZA 1IUPA 3L9WA 4CTNA 1NBMA 1V71A 2RDMA 1H2EA 4AZ3A 5E3HA 1H0HA 2ZI4A 4PM4A 4AS2A 5T64A 2CHQA 1ZK3A 3BHNA 3SX4A 3F78A 2DC1A 2H4FA 3WIOA 5CFRA 1E5VA 4IJWA 4HUJA 2I5PO 4YPVA 4KFTA 2DUUA 5EJ8A 2HCTA 1IRIA 4GBJA 1CT9A 2HXGA 4KE6A 1U3WA 1VP9A 1XRSB 2N0SA 1GYRA 2W70A 3Q6MA 3LCRA 4E7PA 5HKBA 4GT1A 4PGGA 1G98A 1GG8A 3OH8A 5EAIA 4EHAA 5C7LO 1HZZA 3H1EA 5EY5B 3ZU4A 3VOTA 1E3TA 1SZCA 4MZDA 1K0UA 4WOPA 5EYPB 2CBZA 3ZGVA 2B6NA 3QKSB 3NTOA 1EFLA 2PU7A 3EXIA 3KTFA 4PZCA 1U7PA 3ROGA 4MLCA 3QE0A 2E4ZA 2H29A 5GAJA 1T2EA 1H1TA 4J9VA 2GJKA 1BVUA 3Q3JB 3S1AA 1CEXA 2H1VA 2QD1A 4EKDA 1L4BA 1U0GA 3UICA 1QGAA 2BGLA 2D1RA 3TTTA 1A9XB 3BB1A 4LWQA 3VC3A 4D97A 1VE6A 1CS0A 3E9EA 4HXFB 4PXSA 1QFMA 1W1UA 3KQQA 4G6ZA 2X1LA 3LX5A 4R16A 2IYOA 2RAUA 1ZM4A 4MUNA 4UMVA 5CT6A 1GKIA 1ZRHA 4KMSA 1XPUA 1V41E 4YCJA 2GF9A 4ZU6X 1HQYE 3FSJX 1MJNA 1GWNA 1Z38A 3FWPA 2R5FA 3HFRA 1MXHA 3O3MB 4RZ2A 1KY2A 3KXLA 1U90A 2DR2A 2GM4A 2IWHA 1P29A 2FZLA 4N0MA 4N48A 3P5BA 1CQWA 3ZV5A 1BMQA 2NACA 4Q3AA 4C14A 4WOJA 3CUYA 1I3CA 3GP3A 1MP0A 3G0GA 3ZI4A 5KX5A 4ARZA 5D6NA 1IZ7A 2ZJBA 3K4QA 5AM0A 3MS4A 4PONA 3SU8A 1WF6A 3I92A 4WDQA 4C0QC 4JI5B 5GMOA 2O48X 2ZJ3A 4U7FA 4ZK6A 2GZDA 3ZU3A 4XSHA 3U7HB 4FEYA 3QVVA 4O6VA 1YL6A 3G5TA 4HAIA 2AKEA 1NUQA 4K9PA 3ILYA 1WD7A 3OCJA 4G86A 1CERA 3GDGA 2AK2A 3GB9A 1QH8B 3ETLA 3VU1A 3OT1A 2OC9A 2UYCA 1M0EA 4BBJA 2DBVO 1D1QA 2ZBRA 4TTJA 4UJ3A 3NZEA 5D3MB 4A0QA 1MT0A 4BWYA 1HT0A 4KV9A 3I61A 4D3XA 4MWTA 3NRCA 2OCDA 1VJGA 1W93A 4KWTA 2X1MA 2BN4A 3PDHA 5KYUA 3VR3A 4BNYA 2X8BA 1FS6A 5JCZA 5K6AC 1GYPA 4L22A 2VSOA 3MXOA 2AFHA 3RODA 3VVBA 2GZ2A 4DMGA 4HX9A 4F4HA 2CV2A 1UDBA 1X7YA 2JRLA 4II3A 3FVQA 4ZVNA 1T9KA 1E1KA 3IVCA 4MWBA 4KXXA 4Y1EA 3V97A 4X1IA 1PV2A 4LC9A 2ATVA 1PR3A 2C8KA 2GPWA 4U2GA 5FO1A 3KB1A 4GE3A 1DFGA 3RTCA 3WAKA 1NSFA 2IYEA 3IVXA 4IIBA 3TAHA 4EY8A 3DL0A 3FE2A 1XMXA 3OZRA 4PG6A 2ONJA 5HRCA 4CXMA 4Q93A 3UWMA 3RRFA 1G9SA 1WIWA 2O4UX 1Z5PA 1C3JA 4FMCB 2J9YB 3RWBA 3G9UA 3WAGA 1II8A 4HLQB 3S2YA 1BEZA 2FK8A 5A2QA 3A1WA 1EB9A 5LMZA 3GJ5A 4YJKA 1ZR4A 3R6WA 1WBBA 4RUKA 3SYRA 1I7DA 1VHDA 1MX9A 2QROA 4YJGB 3YASA 2GPAA 2OGUA 4UUOA 2BAGA 5KTTA 2BGNA 3RK1A 1BMDA 1P3Y1 3PF8A 2BFBB 4JBIA 5HS6A 1NW7A 5LYYA 5D00A 4LHEA 2N75A 1FP2A 1G2OA 4BP1A 5C4MA 3X1KA 3AM3A 1MZVA 1QZZA 3OIYA 4H6XA 4I3FA 3V33A 4KV7A 4D8WA 3PNSA 4H27A 4S0XA 1TIBA 1SXGA 4D2IA 3IAS6 2FV8A 1FY2A 5E0KB 4CM9A 5KTSA 3FLAA 1VCOA 3RUPA 3WB2A 5KYTA 5JNUA 1IBLB 2I3GA 3JARB 4GOJA 3NH6A 4W6QA 1GLGA 2IU4A 3PF9A 4RK5A 1Y3AA 1YZKA 1QWSA 2J9FB 4MRSA 4QVIA 3NTQA 3R24A 2XT9A 1UKCA 5JAUA 1BXRB 3FHOA 3PP8A 2R66A 4EPRA 4D8VA 3GGJA 1CUUA 4DKJA 2JCBA 1RPAA 3L0CA 1LF0A 3O1JC 3GUCA 4I4TB 3TW6A 5HBRA 1NASA 1DB3A 4XPIB 4TSKA 3F1LA 5IJ9B 1K4YA 1YFLA 3A05A 3H17A 4F91B 1KAQA 4PBRA 1ZGBA 5CVVA 1Q3TA 2R8PA 4GU5A 3WJ2A 5EYPA 1C7FA 1KC1A 2P3LA 2PK3A 2YWBA 3DE5X 3QKSA 4LDZA 4NECA 2FOIA 4M3NA 1TMKA 2W7TA 1A3CA 3DTVD 2FCAA 4XWWA 1TMOA 1NBME 2HA3A 3SBXA 4N01A 1MU0A 2BSQA 2ZATA 2UUCB 3M4ZA 1GQYA 1D7OA 1VKJA 3AHIA 4OK5A 3WQQA 3RGGA 2AZ4A 4NPCA 3OKCA 4LHXA 3J81A 3GROA 4L0CA 5K2MA 2E6KA 1Y4ZA 3TO5A 4YJHA 5F2NA 3R5HA 5JS8A 4G84A 5CT4A 5FUBA 2EERA 3RARA 2IYVA 3DA8A 4QQNA 5FOQA 2G6BA 2FPLA 2VS1A 3GQVA 3W5HA 1JWLA 2RCNA 4D82A 3UY4A 4ROSA 2GKOA 1QYCA 2X2EA 4RAQA 1DTEA 1JR2A 1PJ8A 2BW0A 1MRZA 4PLCA 2WSYB 3ABQB 4ZYTA 5C5CA 3SQNA 4S1WA 3KDPA 3TCNA 2P40A 3RADC 2WJAA 2O8EA 3PXBA 4QQ8A 4RVDA 4EI7A 1USIA 1FL9A 2EKLA 3P9ZA 3X1YA 2YOFA 5I47A 3O4FA 1QB7A 4OHXA 1QV9A 2VT2A 1VPEA 4CHTA 4M9ZA 5B7PA 1KHHA 4D9FA 1A9RA 4P80A 5TIIA 1GN9A 4FWBA 2E55A 4O8ZA 3G13A 2PGIA 2JFBA 3GN2A 5JW6A 3BEDA 3IAS1 5K8IA 2I9KA 1GZUA 2QVCA 2W42A 3HXTA 3VNUA 1BN6A 1CUCA 4G1MB 1F38A 1K6XA 2W2NA 3NBKA 4F8JA 1X0XA 2J6CA 1I7PA 2AOTB 4DCCA 1C4XA 3RYHB 5A3SA 3SF8B 1VE1A 1H23A 1JFFB 2C5BA 3FTQA 3OO0A 3Q6IA 5CJ2A 5F7ZA 5LP1A 3L0ZA 1LLFA 2YHAA 4JEUA 2RHMA 1FFDA 2V54A 3HYRA 2W22A 3TVDA 3WL8A 4RPGA 3PTAA 3FLBA 1HE3A 1OH7A 1QH8A 1Z2EA 2FPSA 1I6LA 3ZZ1A 2IL1A 4V38A 4EW1A 4ENTA 3GPBA 1Y1SA 3PYMA 1UBNA 2GK6A 3NVAA 4KYTA 5D3MA 3FHCB 2JJ2D 5JCPA 2Q2VA 3H18A 2Q5HA 2DPYA 3FNEA 3I6YA 3QUTA 4ND4A 2FVYA 4NBTA 1Q7BA 2OLKA 5BSKA 4UAVA 3R7LA 4JYZA 2EP8A 3LMKA 3E9RA 3HBLA 3WA7A 4GDFA 1WHSB 3R74A 2DF8A 3EGIA 5DGIA 1EM8A 5LD2C 4LE1A 3CRW1 1M8PA 4G5RA 1KKLA 4KO4S 2ZJ8A 5DLQC 1GTSA 1DKPA 2XMZA 3VZDA 3DXFA 4K6KA 1U3DA 1LV8A 3TR0A 2FWBA 3TVYA 2FOXA 1XPJA 2IU6A 1DTSA 4MWCA 3OTHA 1VLVA 1USGA 1V0JA 3ZHSA 1AKWA 3I6QA 4OLFA 2O1XA 5HM6A 2FTKE 3OAAA 4IOJA 2V9CA 4REMA 4CEHB 3V3TA 3G9QA 3VJMA 1N6LA 4ME6A 1L5LA 1JHVA 1CR1A 3N53A 3U4CA 3ZWCA 2BFCB 2QUAA 2YFYA 2VA8A 1Z2NX 3ES9A 3CH6A 4J7AA 5LWQA 5FDFA 5FOUA 3MTAA 2YASA 1Y63A 3A36A 4C06A 5M29A 1GG5A 3FCUB 3ZK8A 1AS2A 4BLTA 2WABA 2Z5FA 1UFKA 2X6QA 1ZLXA 3BTVA 1FXWA 2AFHE 3KZKA 5IM4A 2PFKA 3E03A 3LJKA 5K8CA 1CJSA 1YC2A 3I9OA 3STHA 4E1BA 4MGEA 4YJGA 4YCBA 3FD8A 2BFBA 3PFBA 1AF4A 5TMDA 5FX2A 5AW7A 5AT1A 3R4VA 4H15A 3HCAA 5CHEA 1KFCB 1Y82A 2CLMB 3TOSA 3WGOA 4U8GA 3F2VA 4JIGA 4JP8A 3A6HA 2DQ4A 3INYA 5CFOA 4INPA 2NYRA 1KO1A 3DMYA 4NI5A 3RTEA 1MEEA 1G4AE 3Q7QA 4K46A 1GGVA 2HGZA 3DV0B 4GBED 4L16A 3AEQB 4MRNA 2E21A 4TN1A 3STYA 4B9AA 3JARA 1OX4A 4OFWA 1SG0A 3E5RA 5BQXA 4C6SA 1HL3A 4RJKA 2J9FA 1FXWF 2WF8A 4PYIA 4Q3KA 1G60A 4AWAA 4MVJP 1I6MA 4HI0E 1G4HA 1BXRA 5REQA 3NHSA 4CYMA 1ZONA 3I9JA 1UBMS 1YHZA 2NU6B 3JTMA 3VTFA 3AEZA 4TPKA 1KO5A 3VR0A 4HDOB 2OEPA 1T9AA 2DP4E 2G4LA 1SRQA 1W0KA 4XPIA 3V1TC 1NAIA 2JANA 1M2JA 1XV5A 2P6MA 5IJ9A 3QRWA 3TTSA 2V7UA 3A0RB 2DLNA 1QRAA 1TYEB 2Z58A 4MQ6A 1PQ4A 1A95A 1RM3A 1V5EA 3FB4A 1J0BA 4PLFA 1ZRMA 1ZKDA 3SNHA 4FNGA 2BSAA 4FQ5A 1Q6ZA 4PLZA 3A2NA 3B6EA 2PX8A 4M1TA 5FQNA 2QRLA 2ODQA 4AJLA 2ZSDA 2X0DA 4DA0A 1HFKA 1X13A 3AUKA 3KKLA 4HGQA 4J0EA 4UHFA 3SFZA 4BPBA 1ZD4A 1EP3B 4WOKA 1MOPA 2CVOA 3T7EA 3ESBA 3L49A 4I4TF 4AY3A 3IDZA 5DW3A 1X15A 2I4NA 4ABTA 3UXMA 3G9TA 2QPOA 5I3ZA 4Q4JB 3RC2A 1H8EA 1PUJA 2VPQA 1C3LA 4NOLA 3ZH2A 1SK8A 3SBEA 4HGRA 5JUWA 4MQUA 2YIMA 3PFKA 2FK7A 4URHA 1KAMA 2BF7A 3QWAA 4UVEA 3TJZA 4D8UA 2EYUA 2F1IA 4R2LA 1KK3A 3V55A 2BFEB 1ZHOA 1XROA 1P0CA 2IBMA 1QVRA 3T7DA 3T7AA 1E3LA 1Q6YA 2BH9A 2NPIA 3CUSA 3ENVA 4II7A 3QWBA 1LX7A 4LHVA 2IHBA 2EGHA 1X1CA 3KVVA 2I2DA 1V8DA 3NWEA 5AUPB 2IE0A 4KDRA 2AOTA 3C8HA 4HDNB 5GPBA 3RYHA 2VZLA 3SF8A 4KRFA 2Q9UA 1DT5A 5LOVA 2G9RA 1JFFA 1HPLA 1X2BA 3JQ9C 1CR2A 1B7GO 3KPVA 4NX2A 3JAWB 3DZIA 1XK6A 3ZVNA 3EVCA 1K5GA 2HDHA 1ZCFA 3EZ7A 3UMVA 3AXSA 3AF2A 4IDBA 4XYEA 1ISPA 1U9IA 4UUBA 4XFDA 4C08A 3DZCA 1GZ4A 5B58T 3JWGA 1QRRA 1CZOA 1RHQA 3KBOA 3RG8A 2JJMA 3R3JA 3INNA 2R68A 1NNUA 1VIVA 4L9RA 4Q05A 1UEJA 3AQIA 3CLKA 2PKEA 3FNRA 2W58A 5EHGA 1ZXBA 1ECBA 3ZZNA 4BMPB 3QE2A 2R25B 3R23A 4RVSA 3TNJA 1ID8A 4GS5A 2H5IA 4DREA 1WHSA 1N8TA 2B92A 4FOSA 2PZFA 4PZ9A 3G5AA 1R4NB 4JY7A 2GAIA 4OF4A 1MTOA 1XD2B 3U0BA 2XZTA 3HEBA 3KAJA 4I50B 4OBEA 3I01M 4PQGA 4UASA 5LR6A 4LMPA 1U7UA 3TSYA 1U3GA 2VHTA 3I09A 5IUJC 1OY1A 3F8WA 1I13A 2OHGA 4MRMB 5T4HA 1W0CA 4B34A 1WUHS 2ATCA 4CEHA 2HEGA 3R5TA 4HEQA 4BGVA 3PXDA 1OVMA 4TQGA 1HXHA 2EJTA 1KS9A 3GW8A 2HDOA 2JCYA 1JXQA 5EGNA 4E3ZA 2GCIA 4LF5B 2BFCA 4FFRA 3ASUA 5H9VA 3S55A 3BJEA 3BEOA 4LHSA 3IEMA 3TTXA 5BWNA 3PSHA 3W8DA 3CSDA 4F5ZA 1DO0A 1L5WA 3U26A 1FNMA 3CPJB 4YAWA 4IICA 1LDYA 1LBQA 1E8NA 1E9SA 1GADO 1IHYA 4QOHA 1SUDA 1HLPA 4JOSA 3E1GA 5L6MB 4N39A 4OJTA 4PZAA 2J3HA 3RPEA 1I6KA 5FB3A 2FWIA 1BS9A 4FQ8A 2NP6A 3HEAA 4LXGA 3ADOA 3WJAA 2FH5B 4EYEA 5B6IA 3RKSA 1DS6A 1LBTA 2Q1WA 1ENZA 3EEIA 1QANA 5B4UA 1ECJA 3I2YX 1M2VB 1YB4A 2JLAA 3BGSA 4JWKA 1C3VA 2RIRA 3JCZA 4RK4A 3RVDA 2BMEA 5AJUA 2W93A 4CI9A 3BA6A 1RRKA 1QO9A 3FRJA 2PMDA 3E1SA 3A2LA 5K3FB 2C7BA 3RRBA 3ZG6A 3B9QA 3PPWA 5LN1A 1E63A 3H99A 3NI2A 4FK8A 4HVLA 1ZAKA 4ZCRA 3A6LA 1AK1A 2B94A 2ZTLA 3GMIA 3PHHA 5EVCA 4R2XA 1P4AA 5IW8A 1E0DA 1OWOA 1KS2A 1VHTA 1EESA 4TLEA 3OPYI 1UL1X 1D4FA 3R3WA 3DZKA 5KNDD 4URYR 4O4JB 3REOA 5ALDA 4NU6A 2F62A 2J6IA 1RLOA 4M76B 1RM4A 1XVUA 2NU6A 4ENUA 2B1JA 3GYBA 1E1LA 3MJCA 3QVKA 2FWJA 2GA9A 4YR7A 5L3VA 4DR6B 1EWYA 1JYSA 1C9EA 2HLDD 1B00A 3BBPA 3PZBA 1X74A 2GARA 3U3DA 1XTVA 3VM6A 2VYVA 3OZWA 3WXMA 2GHQA 3LWBA 1BWPA 4FLEA 4ER3A 2VQEB 3OMLA 4W1RA 4O29A 1T9HA 1SCBA 1U3VA 2YWCA 2Q7DA 5INTA 3JAMA 1ZCAA 2IZ0A 3W9BA 2AJDA 1NPTO 1KA9H 3R0QA 5JCOC 1TTTA 1VKNA 3I32A 1IVSA 4DNXA 3KQKA 1E5QA 4D46A 3QU7A 1GNLA 3PPVA 3RNOA 1U5AA 1O77A 2HWXA 5J23A 2GZHA 1NRJB 1XF9A 2Q5JA 2YNMA 3ZKWA 4WFQA 3CVVA 2BFOA 1EGHA 3BERA 3MTJA 2G71A 4B6EA 1ZJJA 1EG7A 1JLLB 2PZGA 1FQWA 5FBWB 1U1IA 2TECE 4CMBA 5HTOA 3SZRA 2HF9A 2BGTA 7MDHA 5DYTA 5JAOA 3L6UA 1OBOA 3CE6A 2QVXX 3FCXA 4U2BA 4IOMA 4Q4JA 4AKEA 4C5BA 4FC6A 2CKMA 4NCBA 3OPXA 2QGNA 4AQYB 3AWDA 3MTIA 3MOIA 1NNSA 4QICA 3I9FA 4C4AA 1A71A 3DULA 3R9XB 5BNFA 2WF6A 4Z9YA 4B3GA 3GU3A 4I5FA 3DFIA 1OIXA 1EDBA 3BSWA 1ISRA 1YVEI 2BFEA 2OFOA 2ZSEA 3BRWD 4ISCA 4CMJA 2GBLA 4YRIA 1RADA 1FSZA 2AZDA 2R6GA 3D7NA 3E5NA 4RMIA 3M3HA 3I6ZA 2OHJA 1E18A 5LKAA 5J5VA 4AJNA 2XB2A 4AUEA 4NAHA 2DJ5A 4OLHA 3B38A 1A4RA 1QK3A 1OC4A 1YR3A 2C8LA 2JGIA 2Q5OA 3RCBA 4JK3A 4E1VA 1JB9A 4HDNA 5I9TA 3MILA 3W5VA 2FMUA 2UUOA 3AVWA 5AKKA 5CK5A 1TCCA 5K2OA 1U28A 3VH4A 3HQ4O 4CCWA 2Y0PA 3K0SA 4N76A 4QU9A 3S2SA 1DX9A 1CY1A 1ETUA 4JVLA 1FRVA 4NG5A 2GZRA 4RMGA 4K6MA 5FTJA 2YXNA 4JB3A 2WD7B 4Q9AA 4DA4A 2QTGA 3CQ9A 2NZXA 1T6NA 4L1KA 5AICA 4ZRMA 3UXHA 5ADVA 2V9ZA 2Q3HA 1G63A 2C5FA 4TLBA 3AINA 3QMWA 2GXSA 5C4IA 4XGRA 4H1VA 1QF9A 3HJUA 4D57A 2MSLA 3C8DA 5A6VA 3L84A 3O84A 1TU4A 1QCZA 1JU4A 2FNAA 3K5WA 4LTDA 5COQA 2HGSA 1PEKE 4WN3A 3ROXA 5B1HA 1EK1A 1R4NA 5J47A 1V8PA 2J45A 4DWOA 1I36A 1XCJA 2NUPB 2VDKB 2YHUA 4HRVA 4I50A 4TL8A 4IZOA 3F4BA 4IXTA 1DBIA 2ISQA 2GBFA 4E2XA 1UWKA 5KYVA 3IQXA 3VMFA 2DTEA 2DQYA 4HXGA 4MRMA 1LVHA 3RH0A 1GTZA 1Z33A 3QVGB 1SUEA 2B20A 5CAEB 2GAOA 3QLTA 1FZTA 1CZLA 5AJTA 3RU3A 4S05A 1ULHA 3FOFC 5M34A 1PFWA 2YXLA 2RGNA 2VDUE 3DWFA 2QLBA 4GZLA 1N4AA 4DSNA 5ICGA 2CFTA 1NN3A 1TM7E 2FU5C 4X7PA 3UHFA 4BWFB 4CV0A 3IAEA 2X15A 3P9RA 1UFQA 2W71A 3M0EA 4IH9A 4J8PA 3HR8A 4DDKA 2WT8A 4UNPA 3QLVC 2AXPA 2HY7A 4IJQA 1MVOA 3L4SO 2XA2A 4RH1A 4YROA 4RY0A 1XBTA 5HKAA 2HPZA 3A26A 3GFSA 5FNVF 3LVBA 1N0IA 2HBZA 4I50F 3S7ZA 4M0EA 4X1KB 4DLRA 4U7JA 4B6QA 2CDNA 1XKXA 1RXCA 3LRXA 1UBCA 2AG8A 2CB0A 5J1SB 1JFTA 1AH2A 1M2VA 5LL6P 3TSZA 5BQ3A 2FG6C 4J76A 2M98A 1SOWA 2OHIA 5D7NA 5CA0B 5K3FA 5GGYA 9LDBA 2XYQA 1U3FA 2FN9A 2ZRGA 3WG9A 5BVGB 2CZCA 2WZQA 1XRNA 2ONZA 1R0SA 2ZGVA 1KKUA 1U5BB 2UZAA 1Y42X 2H63A 3C1TA 5G1PA 5EXDA 3VGJA 4NBVA 5A02A 1UXJA 1W25A 3DJFA 5CR9A 2P79A 1E2FA 5FLKA 3PFCA 2ZUFA 4YAKA 4OHPA 1NBIA 2ZQZA 4KODA 1GCIA 1FDOA 3KLPX 4ENWA 4O4JA 1PV4A 4G89A 1OFIA 2P65A 4BRZA 1KQNA 1GCGA 2QA5A 1WJGA 3L8HA 4BMDA 2H59A 4X20B 3MMNA 3PHBE 1G4UR 3VJKA 1VLJA 2WIGA 5E2IA 1DOZA 2C94A 4KZKA 3B3FA 3N0TA 3VU0A 3WO1A 1LWOA 2IXTA 3GDOA 5DLPA 3NPAA 2OHFA 3HYSA 3O8LA 4KNVA 3SOPA 5IABA 1HNWB 3HUEA 1W6RA 2O2DA 4L8LA 2C78A 4RV4A 1XD9A 2IPOA 3LZDA 2QMQA 3BD9A 4PQFA 3FZYA 3IMKA 5DBIA 4JCCA 3PXUA 5CB6A 1ONNA 1HDOA 1NIPA 1XRRA 4XASA 4MUEA 1YRYE 3JWEA 2VH5R 2O2SA 2OUIA 1S2LA 1Z0FA 1UM8A 1J2YA 3GA7A 3NONA 4ZDWA 2FRDC 4YRDA 1JT2A 3FPBA 4LC0A 1W5BA 5IWCA 2IUYA 2IPNA 1O4VA 4IKPA 1OAOC 4O4JF 2XNDA 3DBIA 3F5FA 4CKWB 5KHLB 1JLLA 4BMSA 4F3RA 3K6KA 3OM1A 4TKMA 4B81A 4CFSA 4PINA 4ZI7B 3D3QA 1FYVA 3ER9A 5TJ9A 4I3HA 1IQ0A 4B1FA 4ZYUA 1LZKA 1SOVA 3JVDA 4EG1A 4PZUA 2O7NA 5AKXA 4IWXA 3LIIA 3RIXA 3RG2A 3V8RA 2GEJA 2WG2A 1I7LA 1YB6A 2QNRA 3M49A 1WS6A 2IU0A 4E4YA 4GGOA 3CVJA 3R9XA 3FGNA 1SC3A 5B2EA 2J31A 4KJXA 3E27A 4D02A 2QE7D 4NMHA 2YVAA 4F72A 2DPLA 2N1MA 3CGGA 4EA9A 1NKVA 4PPQA 1WSAA 1D2RA 4F8YA 3W9YA 5A6SA 1UXKA 4UM7A 4S1OA 2NSHA 1M7HA 1LLDA 2WT4A 5KTKA 1GQSA 4N1AA 2OCYC 1WUJS 4V0OA 4W7SA 1P7VA 2FY8A 3O4RA 5HKKA 1GP2A 5MN4A 3A11A 4TYQA 2YZKA 3ZWQA 1PUXA 1SUPA 3IEXA 3GIDA 1B6RA 3JQEA 2QX4A 3IULA 1YACA 3KB8A 3OJCA 4A6XA 4CKZA 2VAXA 4YGXB 2O54A 4J0GA 4OMCA 4C7MA 1IC6A 2DG2A 3LH5A 1MQ8B 2VWQA 4M4SA 4XOUA 2BEWB 5EQTA 1CUVA 1XEFA 1U8AA 2WD7A 4CCSA 1E96A 1J07A 2D06A 2ZQYA 4LJ5A 3MGAA 3N05A 4V0MA 3RT7A 3UH1A 3BJRA 5TARA 3THXB 4DG9A 3AMVA 1GRNA 3O8CA 3DO5A 2WJ3A 1SBIA 3IBFA 4JLNA 4R84A 4Y2JA 4TYNA 1MC1A 3DVQX 3P32A 4F9FA 2UXBB 1RTTA 1JEEA 4JNKA 3GUYA 3G8BA 2OZEA 2H1OA 4H59A 5C8YB 3EIEA 2VXOA 3AR2A 4GRIA 3HDQA 4I99A 2PKYX 2AC4A 3DMHA 2NUPA 3RJ5A 1Z2AA 3WNBA 3FBWA 3PX7A 2CBGA 3OLYA 3M4YA 2PYZA 3RHZA 1GILA 3PRJA 4BNDB 1NLFA 1PJRA 1HSOA 1T8RA 3QVGA 5C7YA 1QFSA 3ELWA 2P0AA 3NEPX 1XDZA 3DB2A 4OQ4A 5HFJA 1L7OA 4TVOA 5CAEA 1QORA 3R8FA 1W7AA 4D42A 1YQ9A 1T1EA 2HF8A 3SM9A 3V2UA 4HEA1 3S8YA 2GLTA 5J3JA 1O95A 1A5AB 3CF0A 1EJ6A 5EMLA 1JZTA 4E4TA 1YR2A 3EVDA 4CQJA 4L74A 1V3QE 4WFIA 3V4RA 4JCOA 4GW3A 5ALGA 1C1DB 2OM6A 3PC8C 3KP1A 4PWYA 1MW8X 4AD8A 4K9DA 5A06A 5JCXA 3NHZA 2F3TA 4LYDA 2Y3IA 4CDGA 4QTYA 1LLUA 3HA3A 1MX5A 2GVNA 3AM1A 4NFHA 2FA9A 1GL3A 1DC7A 4O1HA 1DBQA 2QY9A 4HQRA 1AMUA 4RADA 2DWQA 4QXAA 3G88A 5BYAA 3VR2D 2CVPA 4EUSA 4EGCB 4P32A 1TFRA 1UDAA 5H70A 1L8QA 2GRAA 5CA0A 5I4IA 2F4VB 1CHNA 4B3MB 5BVGA 3GLKA 2P30A 1X9IA 3KL2A 1YJBA 2FYTA 2BI4A 2RG1A 1PZHA 4LI3X 4WMLA 4KSCA 1YKSA 2FG5A 1U63A 1U5BA 3VO2A 4DDTA 4NH0A 5EUCA 1PL7A 5FBRB 1FLAA 4G97A 4RSGA 2H06A 2O2XA 3UAWA 4L7QA 1H0RA 3DOOA 1BHSA 3D6TB 2VBGA 4KAAA 2QRNA 3PHCA 1GGFA 3IBCA 2WQZA 4PAQA 3ZIAA 2DHEA 3PLNA 4LY0A 4Q4AA 3WBKA 4QUGA 4E70A 4V3BA 1IHXA 1R4ZA 4X20A 3ZWAA 3PQEA 1TQ6A 4C22A 1I4EB 4CKCB 2AQ8A 3EDCA 3A4YA 3KEOA 2M1XA 3BKXA 3OOYA 1DAFA 1E5TA 4MMZB 5E3IA 4OHZA 4ESVA 1QG0A 5SICE 2I6UA 1DAKA 3UKOA 1UJCA 1UZMA 1Z25A 2X40A 1DPFA 5FFFA 1UMDB 3E81A 1EWTA 3TZQA 1IAVA 1XZDA 1L8LA 3V4VB 1MORA 1NUPA 6AT1A 3O95A 4RSMA 9ATCA 2A30A 2DUNA 2OLJA 4X1OA 2AE1A 1G7TA 1PNQA 2ZJ2A 3G2MA 3AW8A 4F92B 1IATA 3OKFA 3OX3A 5ELLA 5KVCA 4I55A 4NHEA 1QG6A 2P5SA 4R31A 3U80A 3DONA 4UPVA 1MB4A 2RGBA 3CF4G 4CKWA 2AOUB 4ARCA 4L95C 2NVUB 1AK2A 2CMGA 1QS0B 3AWIA 2WTAA 1NUHA 3ZJYA 3KZVA 2H1FA 5JWOA 3IR7A 4RGBA 2W00A 5EA2A 2MTBA 4A2QA 4AJJA 4NBLA 4WA7A 4CMEC 1RRCA 1U31A 5CCEA 1IBRA 1E5DA 2E1PA 1J97A 3D6HA 4E15A 4GM1A 1FX1A 4E4RA 4OMDA 4EGJA 4PLGA 5JBQA 4JLPA 2WB2A 2W6JD 3AZQA 4DLPA 1RI3A 4BLWA 4I4CA 1ULUA 4JJ4A 4OJYA 5IM5A 1TEZA 4PC7A 3L7NA 5F64A 1LSSA 2Q0QA 2AWNA 3GFFA 2R6JA 1K63A 3AY3A 4B4KA 1KL7A 2AR7A 3P9SA 4PO8A 5K0GA 5I6DA 5D3KA 3B60A 3S27A 1R12A 3H4VA 2VZ0A 3JZMA 2NSYA 2OBXA 3L6RA 3W8FA 1ODFA 2JS7A 2YKGA 3A4NA 4IJKA 1YK1A 3GVXA 5F1OA 2EWWA 2VDWA 3CRZA 4BFWA 4DVGA 4ZI7F 1TLLA 2XTJA 1S2DA 3IP6A 5I7AA 2C7PA 4BU1A 3VR5H 1GLNA 3OTQA 2MR6A 3U37A 3MGBA 3ZXXA 2FPUA 2AJCA 2Q99A 4HAUA 1Q0ZA 5KO2A 3QVTA 3AGPA 3G1WA 2BEWA 4ABYA 3KOOA 4RPKA 2E7ZA 2IQ5A 3B78A 4X65B 3KLOA 3ENZA 2AN1A 2X0IA 4GKAA 2GS9A 4HXEB 1H2ZA 4OMUA 3THXA 2OGWA 1IEVA 1O97D 2ZTHA 3PHLA 4L5YA 3I04M 4EJFA 3GT4A 3A25A 2QUJA 4XGNA 2XE7A 1SA0B 5JD3A 4AJPA 1FFCA 1S1MA 4DV1B 3D2CA 3UGQA 2CB9A 2QLLA 3F7OA 4FIDA 4AAYA 5C8YA 3WP0A 4IX1A 3DE1X 2ZSIA 4Y2UA 5EP1A 3T1YB 2UYOA 2ZS8A 3BA1A 3KOWA 3L6CA 3PNQA 3T5CA 2G28A 1E3WB 4CNQA 4ZOBA 1JDNA 1KMHB 1E1QA 2EU8A 4WJZA 4LFCB 4AO6A 5ALTA 3NW9A 2H4HA 3ENNA 3BMXA 2JAUA 3ABZA 3ED5A 4UBMA 3U4MA 4FGUA 2HMTA 1YZUA 1JN0A 4UHKA 4ZAFA 4V0ME 1BH2A 3QHAA 4FUQA 4BRSA 2OV4A 4TMKA 3NG1A 1KI9A 3CPEA 1F0NA 2RHRA 2UU9B 2WU4A 4CW7A 4B7UA 2BMAA 2QVBA 4ZI3A 5FBVB 2Y27A 4R2KA 5DJ5A 3T3MB 2O8EB 4BVFA 3HGTA 2B9EA 1Y1LA 1VOTA 2BMWA 4BP9A 2NGRA 4UVDA 3R7NA 3L07A 2PNJA 5C8YF 2BCJQ 1C1DA 4QTUB 2AKAB 2XV1A 4DIMA 4DJFC 2QZ9A 4DCNA 5DF1A 3RFVA 4EUKA 4PTYA 1V2HE 4EL0A 3KEMA 4FS8A 1OD6A 3AB7A 3Q72A 3HVKA 2WAXA 4J07A 4LGMA 4EYQA 4UTRA 2O2YA 3Q5DA 4IPTA 2EEZA 1JALA 1MC5A 1P2TA 3I0MA 4N5DA 3V34A 2YDXA 4II2A 2E18A 4EY6A 2XGOA 4KO8A 1W19A 1CR4A 2J48A 4Y2HA 2M6KA 5AOBA 3ZHTA 4NDZA 2X5KO 3A6FA 1ZXXA 2J3JA 1H93A 1GPYA 221PA 1SGWA 2F3PA 2XUIA 3G85A 3DZBA 3QLUA 1P3DA 1FOEB 3OLZA 1EFKA 2D1QA 4YA6A 3TOVA 4D80A 4M0MA 5A0FA 1NJGA 1QE5A 2AWOA 1U7OA 4JT2A 1JFLA 3C2QA 4G5OA 2V7VA 4NCHA 4TUYB 4KQJA 3ZE6A 1E7MA 1N92A 4RQUA 5BR8B 4Y98A 4CKCA 4JITA 1ZNWA 1AZLA 1O9GA 1YZYA 1VI2A 2G1AA 3MBOA 3VNVA 4FYJA 3DUWA 3W4JA 2AQIA 3A10A 2W2XA 4TLAA 3HCWA 4XX0B 3ZZ0A 4EHDA 1UMDA 2F59A 1GCOA 2IYTA 3KT6A 4US0R 3F6PA 4KW7A 4H1HA 1XCMA 4FX2A 5AI6A 1WXQA 2JA1A 2K4MA 3SCZA 4C0LA 4DBVO 2QB5A 2ADMA 4M8SA 1RHUA 2QTVB 3V80A 2GLUA 4RF4A 2J46A 2L19A 3PVCA 4BWVA 4A6EA 4TZ6A 2YJZA 4JLUA 1F3OA 4OK6A 2BKEA 2E4UA 1NQUA 1ZW6A 2W2TA 1T1RA 2ZTMA 1ZDMA 4RDCA 4XEHA 4XTRA 2QN2A 3RU9A 1KTIA 3CPHA 1ZFNA 2AOUA 3V6MA 5HJEA 3DR5A 2NVUA 2G7MC 1QS0A 2I62A 2P67A 2EKBA 3OWXA 3A32A 4CZ2A 2HNAA 3D59A 3L7CA 3V4FA 2AC2A 2C20A 5LP6C 3SX0A 4C0HA 1IBKB 2C2XA 2FKNA 2H5EA 1RHMA 4ADSG 4F2DA 4UOEA 5F9MA 5EIXA 2D7DA 3AFGA 3LQ1A 4LS3A 3QKTA 4D6YA 4Q7KA 4IS3A 2NVWA 1V1RB 4Q4LA 3RJ9A 4UFNA 1GTG1 4TV8F 4MR9B 1YQDA 1QOQB 1B15A 3I4CA 4JU8A 4P1ZA 3RU7A 4GL2A 1DWOA 2A14A 2J0UB 2J9GA 1UMCB 4LWPA 3VA7A 1HFEL 1ZSYA 2VT7A 3AX6A 4MJLA 3TW8B 3TL2A 3I9V6 1POWA 1VSBA 1Z68A 4EFKA 4RHTA 1F3LA 3OLVA 4ACBA 4WXPA 3TZLA 4PNZA 3SYKA 4L4ZA 1EJ2A 3FCCA 4URZR 4PZEA 3MJRA 1RYFA 3D8TA 1T25A 1RPTA 2I7VA 2I7CA 2Y1EA 2P41A 2ZJ0A 3WFZA 1C4OA 1IQPA 1BCRB 1A27A 1GAJA 2WD8A 3T9FA 4GHWA 1R0RE 1ZHHA 2ZRLA 1IM8A 4CF7A 3U7JA 1W46A 1XLUA 2VSXA 3QU5A 4L8YA 4ZK2A 3PJFA 4BATA 4BNKA 5CW2A 2RH4A 2X7XA 4X3PA 2IYPA 3RVLA 3ENKA 4E21A 1NMYA 4E5KA 3KQVA 5KDLA 3PHGA 3C6MA 1JHAA 3FR7A 1JDZA 3BSFA 4X95A 4ZGWA 1ZM2A 1ZUIA 2BBOA 1CRLA 1SA0A 4JGGA 2NPFA 3WYBA 3HU5A 1WV0A 4AICA 1DE0A 3OO1A 1I9GA 3DMDA 4UCFA 3HB7A 1AS0A 2HIMA 5AJHA 5JCJD 3VI4B 2Q8QA 1CW2B 3BM5A 4KQ1A 1VJTA 5HZMA 4Q3NA 1PTJA 5ARDA 1E9EA 1SPBS 1T34A 2I99A 2IXBA 3VYUB 2BJHA 6PFKA 2RJ3A 3MIIA 2ZRCA 3BAFA 1R4MA 4RU1A 4JLSA 4BNUA 3P9XA 2ZYHA 3JSXA 2X3FA 2P2LA 1M6WA 5EKUA 3T8YA 3TKAA 4S1PA 5CX4A 5AM3A 2FLWA 2OG1A 2JD1A 1SY7A 4AWXA 4RFSB 4IF6A 3RSQA 1WDKA 3FIJA 1N6PA 4X6UA 3BIWA 4FN4A 2LDBA 1S2MA 4A26A 3WRYC 5EFOA 5CB8A 2JEYA 3BOSA 5TY0A 3D4BA 2GYYA 2PVSA 3MIZA 3R9WA 3T5GA 1HG1A 1KI4A 1J2JA 4J49A 4J0QA 4QYIA 1K97A 2IZOA 1GOTA 2WAAA 1AUQA 4QPZA 3LZ6A 1Z8FA 2J7KA 5CEFA 1P3JA 4DCJA 4WCFB 3A31A 4YRSA 2L2QA 3I9V1 4BB0A 3HZZA 4OXXA 4DILA 2FX5A 3OZAA 1NUSA 1UEIA 3DEZA 4WVLA 2Z6AA 4PBSA 5K99A 4FR5A 4EOGA 1GZ3A 1P0QA 1G42A 2YFKA 1D09A 3CW8X 4HJRA 4NZZA 3BXOA 1WZEA 3I72A 2AE2A 1P1JA 1EDOA 1ZBDA 1LWNA 1ZNQO 3T12A 5B7NA 2R2GA 2AJLI 3GT0A 4M2LA 1F6DA 4X6XA 3U2QA 4BO7A 4A0RA 1L5GB 4AZ0A 2OAQ1 3NHRA 2WF7A 4CBVA 2QORA 5D51S 4UPEA 3AOEC 1U1DA 2OV2A 2AJ8A 3HPQA 2IODA 1U81A 3MMZA 3UUFA 5IXJA 3OQIB 2J5KA 1FLNA 2VL7A 1Y37A 3P2YA 4TL9A 2IDMA 1UFOA 5CIWA 5E6UB 2JH8A 3OPNA 4EF4A 1J24A 4EENA 4FR0A 4MA4A 3G6WA 1KR2A 4LJYA 4TUYA 3T5BA 4ETIA 1R0KA 4RDHA 3VAAA 5JSFA 3PIIA 4LXHA 1IXSB 4K9RA 3U48A 5ADUS 1ZPDA 3E82A 4F2WA 3LRTA 4TGLA 3HADA 1HFJA 5DGHA 2PVPA 3KSRA 3RIHA 1V45E 1RC0A 1DKLA 3HUUA 3HU3A 1NOJA 3UT0A 5KOYA 3UKDA 3H2BA 4I19A 1ZQ9A 4FNOA 4XX0A 1FNDA 2R4QA 1ETHA 3I2GA 3U7RA 3FI0A 4C3OB 3OQNA 4IBOA 1Y3CE 5BSTA 1PNRA 1D2EA 2NSJA 3ZDRA 2P0EA 2IEYA 3D8SA 3GUHA 4TS4A 4D0NA 4CV2A 4TL7A 2PX6A 1AKVA 1N2ZA 5MFPA 1JLRA 2QTVA 1IHUA 3KUDA 3PPIA 4W82A 4Y1RB 1L9XA 5C8ZA 2ZU0C 4CPDA 2FFRA 1CD5A 3T3IA 5IMSA 2BOVA 1W2WB 4R2JA 4XIJA 3MF4A 4B6OA 2ZQ5A 5TRTA 3OHMA 5DWDA 4IJVA 4PHGA 1DCFA 2A92A 4TUYF 1D1PA 1GTJ1 2CCKA 4O0LA 5CXXA 1XJWA 3OZGA 2B21A 4DRYA 1XT6A 1CBUA 4OX9B 1EFHA 2V0NA 2V4MA 3H84A 1DADA 5HRUA 1E1NA 1SOUA 1X77A 2A67A 3IAXA 4M0FA 4PCVA 1V1RA 2VZ8A 4HQ0A 4C21A 3W5IA 5K6AA 1ZD3A 3V46A 5LD2B 3CC8A 1NF9A 4MR9A 1QP0A 2AF4C 1B42A 2XUFA 2QGFA 4IH4A 3MT9A 3NM6B 3QYFA 2OBLA 2IW1A 3VR6D 2J0UA 3JQ6A 1A1VA 1GGKA 1UMCA 1I5RA 1TM5E 1NZDA 4OG2A 5B1SA 2W8ZA 3OZ7A 1XHLA 3DMGA 4JXJA 2EARA 2BR3A 3TW8A 2Z8ZA 4N9QA 5DLDA 1TUBB 3X2FA 3ID6C 2AUNA 3PDJA 4FGKA 3FVRA 1G8MA 1QAMA 2IUFA 3L0PA 4WOCA 4EECA 4YBRA 1ZO8A 1LQUA 4D4JA 2M2IA 4CR8A 3O1IC 3RS5A 2H85A 1TF2A 1P1HA 4AMGA 1BCRA 3Q2KA 4O2RA 1N2JA 1U0HC 3V2IA 3UJPA 2D5IA 4MICA 3MAJA 2LCFA 3UJCA 3KKPA 3VNBA 1TAHA 2R65A 3IP5A 1AY0A 3F6RA 3W6ZA 3ZD6A 5FV7A 3NHWA 1Z3CA 3B13B 4JJIA 3WJ1A 2QIPA 1HE2A 1P19A 3WGJA 4KVZA 1ZSNA 1OU0A 5FBQB 3RBVA 2OB1A 1MAAA 3PUXA 4QDTA 1YQQA 1I2CA 2I34A 4Q82A 1Y9JA 4X94A 4ZQFA 4PRYA 3ZDXB 1KFBB 3P7MA 4RACA 4CIYA 3NHPA 5MFZA 2Q0SA 1JIJA 2BM1A 2VNSA 4D8XA 4MOWA 3RVOA 1YJ5A 3G0OA 5DN9A 4B33A 2E37A 2J3DA 1Q1ZA 1EWRA 2PBLA 3GGGA 4R7GA 3ZHOA 1QP8A 521PA 1PLJA 1MB9A 1Q74A 1OIVA 4FT4A 1E6MA 1RJ9B 5I9SA 3HABA 2R6DA 2G5TA 2VDOB 2XTZA 3GNSA 4RK1A 4QYTA 1E2BA 4MK4A 4P84A 4RH0A 5CM8B 2KBFA 3AO0B 4LSMA 2ZR9A 1M6NA 1AD2A 1SCJA 1NUTA 2O06A 4ZVSA 2WJHA 2O1EA 5BY2A 3AUAA 1CJCA 4MUKA 4RFSA 1VI5A 6YASA 4GC5A 1DBRA 3PFNA 4H4EA 1L5OA 4XLLA 4WADA 5AP9A 2I4LA 4N82A 4YFVA 5FLXA 5F7XA 4BJ6A 1LPPA 1Z7GA 3C3WA 4EP1A 2Y1CA 1TGVA 4M1WA 5E6SB 2NO5A 2XD4A 3MJHA 3CXRA 2OMEA 3A9RA 2VJOA 1M75A 1GQRA 3AHJA 1JAYA 5AK5A 2WFMA 1Y81A 5SZJA 3SLRA 3X44A 2C97A 1NR5A 1C0PA 4TTAA 2XTMA 3WGTA 5EXTA 1NW6A 1PWHA 2LIPA 3K72B 2A9JA 1DRVA 1LVUA 5C0OE 2C9DA 3AB3A 3AJDA 5CT5A 4UAUA 4YJ2B 3KWJA 4H4CA 4L28A 4P86A 3N3AC 4UZEA 4EQZA 4MW2A 1CYDA 1OILA 3JD2A 4NIMA 3STUA 1A9TA 1O97C 2EKZA 1MPTA 2GXUA 1UBEA 1N5DA 2UUPA 1YS2X 2YC2C 3KUCA 4MPRA 3T52A 4D3ZA 4ZMBA 5J2UB 1YS4A 5E4TA 5B1DA 3WL5A 3WAJA 4DZTA 1R5OA 3T9CA 4M7OA 1GIAA 5JVDF 5BSGA 1FQOA 2E85A 3K1JA 2CVQA 1XGKA 2WU1A 3VKFA 3WLMA 2OQ2A 3RFTA 5HQ3B 2E82A 1B0PA 1MQAA 4TOIA 3OQIA 2QRHA 5EKDA 4UXHA 1MQ9A 3CCBA 5E6UA 3GDHA 6REQA 1U9JA 1ORVA 2PLAA 5JV5A 2WJYA 1X94A 2ZW9A 4R8VA 3FMVA 1MV5A 1KPGA 3L46A 3BK1A 3ZWBA 3ZI0A 5F52A 1LI5A 4AROA 5JROA 2Q6IA 1VLMA 1QIIA 4G07A 5BQPA 1BXKA 4HB4A 4I1SA 3BWBA 4RD6A 1VJ1A 3BS4A 4EKYA 3KHSA 5K0SA 4JOCA 5L7TA 1ZVKA 1GSHA 4X7RA 1MNQA 1UKEA 4YUWA 1HSZA 3WRWA 3LUBA 2DY0A 5WRFA 5A4JA 2J5XA 2VAWA 5EJ2A 4ZYLA 5KINB 1GPNA 3W5CA 1O54A 1QZ3A 3MT8A 1YWGO 4MQFB 1H4VB 2DFLA 2HAEA 2K5UA 2I2FA 2WILA 3D31A 5DHUA 1TO1E 1T6ZA 1GT91 3SS7X 4W5HA 4JGBA 4AYXA 1XQ6A 3AOGA 3B1YA 3EF1A 4OKIA 2ZYRA 3RFFA 2HUPA 3MUOA 1TJYA 4AB1A 1H6CA 3H3XA 3VPDA 4JBXA 5FYDA 4BNFA 5K0JA 2ZEJA 5JALA 4AJKA 3DPSA 3U6KA 4DB4A 1EEXB 2IBTA 1K27A 3VZBA 4ND1A 3F5DA 5BXQC 5HUHA 4RY8A 5A5GA 1OFUA 3OX4A 5K01A 1VG8A 2EG5A 1UDCA 4FYVA 1M72A 2HW8A 4P3NA 2WSLA 4Y9TA 3MN1A 4CWAA 2A9PA 1EVKA 1T4DA 3TBKA 2B2XA 2O19A 1CUHA 1BZYA 1CLUA 4YDSA 1XRJA 2GJSA 3AI1A 1Q1GA 3HB4X 3MWJA 3PJEA 3I2KA 1K8QA 4ZYYA 2O6LA 2PA0A 5HF5A 2G5CA 4FVTA 2G88A 2NXEA 2QT1A 1RP1A 3EISA 4HC4A 5DPMA 2ZBEA 3T3PB 1TUBA 4Z8XA 4Z4IA 2PSDA 4AMZA 1YTUA 2VJPA 3ELUA 4EO9A 1CF9A 1DQYA 1EK6A 1FFBA 5K7SA 2WWFA 4QO8A 4UBIA 5EXPA 3L8EA 1NATA 4WNAB 3LQ2A 8ADHA 5EE3A 3QVLA 1HUQA 5EOVA 5FI1B 3DEIA 3RUCA 3C1UA 3RSHA 4WVFA 1Z4NA 4JUIA 4RPCA 3S8EA 2BZ1A 1YOVB 1F5SA 1BGWA 2A6PA 4ZYVA 3DBHB 4UUPA 2IS4A 4K9QA 3L6BA 2ZXFA 4A23A 4QVKA 4MUAA 3RIYA 5KPJA 2PUAA 1CSEE 1XDBA 1EK0A 1RWMA 2YFHA 1NQ5A 2OLEA 1BG6A 3G2NA 4RPLA 4XLTA 2B7LA 3LWDA 1O0BA 3MJVA 1PGJA 4Z4QA 3DP9A 4Q9NA 1TX4B 4CIXA 2GPJA 2J3LA 3P5SA 5JSHA 4ZVTA 5AK6A 1OCEA 1VMAA 1TOAA 1P5FA 2HJRA 4GPD1 3WGMA 1E1CB 1K6IA 1SM4A 1SQGA 1K9VF 3ANMA 3TQFA 7MHTA 2XVZA 4JQSA 4OXQA 1ORWA 2O2HA 1RAFA 2YS6A 1XTUA 3R76A 4CIWA 3GF4A 5DASA 1RJ9A 4QDUA 1JQEA 2YUTA 3C97A 4J16C 2PIAA 2JK1A 2HSEA 3DDWA 4KQWA 1IXRC 4D44A 3V8NA 2YZMA 1KEWA 2PKXA 4K6CA 4QDOA 3NBXX 3U3RA 4Y8VA 4QGBA 3VYWA 4FDTA 3MEQA 4CN8A 4DIOA 5JD4A 5JXGA 2ZJ6A 3EEFA 4UOQA 2E5LB 2W2PA 2WWTA 3OEWA 1FDTA 2R6FA 1U4NA 2HQ1A 3MG9A 4GX2A 1N7IA 3U3MA 1UBKS 3B20A 4DSZA 5K03A 4D4GA 2HWKA 3OIVA 5E6SA 1ULZA 1Z13A 2WG1A 3HJGA 3SQXA 1D7AA 2ZDHA 4Y2YA 4MR7B 5AKHA 3VDXA 4ARBA 1Z0JA 1UP4A 4Q4DA 2Q0HA 3Q3GE 2QU7A 1SK9A 2HZBA 3SZLA 3UIEA 5JTTA 3HU1A 4YPOA 1K0FA 4I1OA 2NZYA 1S2IA 3QU9A 4GLJA 4LK2A 2DRIA 2W0MA 4M8LA 2D1TA 3M2PA 1BX3A 3AY7A 1DKOA 4K1LA 4Z3DA 3EIOA 1V8OA 1YB5A 3WLSA 4YJ2A 5DK6A 2WKPA 4M0KA 3W1EA 3SLKA 4TM8A 3D4LA 4OB7A 1E6WA 2GJ4A 1EFDN 3DAGA 1WUIS 1BMTA 1RAAA 3LHIA 3QBEA 4RQAA 5AJWA 3ZCVA 4G8JA 5J2UA 1G6KA 1A1SA 2O3QA 2YJ3A 3IO3A 5ALXA 2GN6A 1WCYA 4L8VA 4E13A 2AW3A 3O4IA 2C0CA 3A3PA 3PT5A 3R0IA 1ZNZA 1BS1A 621PA 4BDSA 5HQ3A 5IRCD 2VJNA 3I1FA 2KB0A 2HSDA 4ZEXA 5LLTA 2WJIA 2VHCA 2FEXA 2OGTA 3CVOA 3QEBZ 3QFCA 2X4LA 3TIIA 5JPCA 3T0IA 2O1SA 1N0VC 3D6MA 2ASEA 1JHPA 2W6MA 1SXPA 3KT8A 3T5PA 2A0KA 5P21A 3TIVA 3O8OB 3WOVA 4EI9A 5KSWB 4XR9A 3EXFB 1ODLA 1RLJA 3CUWA 5FBHA 3ZNNA 1XAJA 1QQAA 2ZZMA 2NSDA 1FIUA 4D0RA 1K5DA 3SC4A 4F86A 1WVMA 2KHZA 3PKIA 1DGQA 2PGOA 2NXCA 3HC7A 3MA0A 3HV0A 5ECGC 5J2UF 5E7JA 1MV8A 3H5VA 4XVUA 1KU0A 5K0TA 1ZAYA 3HFGA 3TLXA 3WC4A 4MQFA 1C9JA 3ISJA 4B84A 6NULA 3BHJA 5KSOA 3JQ9A 3RAEC 1RBZA 4DLNA 3UK6A 3W3AD 2VSYA 3I53A 4M21A 1Y7HA 3QIVA 4OHWA 4W9RA 4BVGA 1XPOA 3CB4A 3J7AC 4NS1A 4XCQA 3WV4A 1N2BA 2J3MA 3C4JA 1C2YA 1IUNA 1ICEA 2F00A 3E15A 3OOJA 5H02A 2JZOA 2CHFA 1JDSA 3PIRA 3DTVB 3O4JA 4OEHA 3V4OA 1SCKA 1OQAA 2XCOA 4NL4H 4UUQA 3SWWA 1GY8A 1MENA 2P9CA 3MQFA 4IFBA 1DBSA 1YTLA 1T3HA 4PZDA 2N42A 2PN1A 5A03A 1IIRA 1TK3A 3D3NA 3NLLA 1W36D 4HXYA 3A1FA 4MO9A 2HIAA 2B1GA 4I1RA 5IFKA 5FUQA 1QWOA 3EJWA 3K70C 4OFXA 4QBHA 1KE2A 3IMFA 3GMSA 2QZJA 4FGLA 2Q6OA 4Q66C 5EJGA 3SBDA 4BNVA 1UUFA 3JVIA 1X7HA 3I76A 4TYYA 4GVPA 4KITB 5KNDH 1N0HA 4JA0A 1HEUA 3KSMA 2J7PD 1XA4A 3SJZA 3UB3A 1VKHA 1YZNA 2WNHA 4GIBA 4F06A 4RZSA 2JJ1A 1B8UA 5I4BA 3O93A 4ER6A 1SIWA 2C5SA 3M9XA 3L7YA 1R6VA 3GEDA 3O74A 1HEIA 5CLGA 4UM8B 1K92A 2WHYA 4WNYA 4EB0A 3CKLA 1PI3A 1HDXA 2BONA 4FDVA 5BPFA 4O4HB 1YOVA 3BAZA 4RK6A 2VK4A 1Z2OX 2FP3A 3CZ9A 3I1JA 5EPUA 2VOJA 2C5GA 5FBKA 1HV8A 1KQ3A 3IKJA 3Q9LA 4DRZA 5FR2A 1YD7A 2O7RA 2WG0A 3C3JA 4G41A 4C1NA 1BWRA 2HJHA 3AVXA 2H11A 1OGJA 4IFEA 4DWWA 4HVAA 2X0JA 5SY6A 1M67A 2PFGA 4R51A 4D3FA 3P0JA 3UPUA 4KTVE 1JR6A 2QS9A 1Z6PA 1E1CA 4FEAA 2P4UA 2VIIA 4LGVA 4PFSA 3MSCA 1XDWA 4NOKA 5G3ZA 5DXJA 3D5EA 3W5SA 3WYNA 4CFYA 1N6HA 2WTXA 1UXIA 3ESDA 3OY7A 1E69A 4PPYA 1UBLS 3D5QA 4LEIA 1JAHA 1EI9A 2CWWA 4PLWA 4MVYA 4DC9A 1QMGA 1JIKA 4WXMA 5DE3A 1EJBA 4XVHA 3TOCA 1F48A 4YRAA 4X64B 1DWQA 1I1NA 2L17A 2VF5X 3U4AA 4DHEA 4I9HA 3K31A 5JADA 4JXKA 3JYQA 3DT8A 1Y0BA 3HVJA 3DOFA 1JEJA 2GEVA 2QVZX 5CDFA 2ZRPA 1PNVA 5CXQA 3CPSA 5JMWA 3FHLA 3N5KA 5CDSA 4DJAA 2VRNA 4LGCA 4GOXA 4P35A 1MRNA 1QYRA 3FPAA 1SUAA 1GZ5A 3TMYA 2FZ4A 2J0EA 3LQ4A 4F96A 3KUKA 1T5SA 4MGIR 4OLAA 1DXOA 5JCOA 4C7JA 1NBHA 3E22A 3LA6A 1RDFA 3SFVA 4U63A 3VNAA 2LCIA 5B6JA 5KVSA 3T06B 4FX5A 4KPEC 1LDGA 4MVJF 1L3CA 1EVEA 1ZC3A 2GFHA 4NYJQ 5EUBA 4X6LA 5T67A 2DQSA 2DSTA 1ES9A 3COSA 3F7TA 3PDUA 3IVGA 4XIGS 2JZNA 2HBYA 3GK3A 3NEYA 4B75A 3NCTA 3IP9A 2UKDA 4F1KA 4MCIA 1YASA 4ZVUA 2IWRA 2ZOSA 3BF8A 2QQGA 4G0PA 2A0FA 1P9WA 4PCUA 1WULS 2WZDA 3CNOA 5AOCA 3LY7A 4Q9KA 3GOQA 3IPXA 1XDSA 2OBFA 3TE7A 1Q7GA 1XWFA 2CNNA 1ML4A 1M1YB 3FF1A 3I8OA 3L8FA 1J5PA 3VBEA 4MI3A 1FFYA 1PJ4A 2XWQA 1YI1A 2ZANA 4FZ3A 4HS9A 4ZTBA 4BMNA 5JSKA 1GNQA 1OV6A 4XUGB 4ZALA 1Z4JA 1A50B 1FFSA 1U8TA 3O8OA 3ZDDA 2PWAA 4RTRA 2MMGA 3RS4A 3EXFA 1Z4PX 3BH7A 1KYZA 4HFMA 3L1HA 1OGIA 2QTFA 3BKWA 2C4NA 1R6DA 3DCIA 1Y9EA 3O75A 1ZD8A 4ARSA 1N8NA 3IAM1 4OLJA 4XQGA 3PJRA 1I4DD 4RJLA 3TEMA 4Y6RA 4QBGB 2Z0MA 4B47A 5JD6A 2FAXA 4MNTA 1Z17A 4GEGA 5G4KB 6ABPA 2H07A 1GU7A 2HO4A 2XMRA 5E38A 4CUKA 2B4KA 2XMSA 2HFKA 1D1SA 1PJAA 1YS6A 2QRVB 4MW7A 3DTVA 3P9CA 4ECAA 1R7RA 3LM8A 3QG5A 4R2HA 5JPIA 5B6PA 1N4DA 1UXHA 2ZUTA 3VU8A 1UPUA 5AW8A 3LLVA 4DEVA 3MFYA 4B17A 1XTKA 1NBMD 1UWVA 1Y8QB 1UJNA 1XCLA 4JQOA 1U0EA 3DT6A 3QVUA 3CCCA 4ZO6A 3A06A 1I1QB 3JD1A 4IIEA 1KFKB 3HXPA 1NONA 4TTTS 3WLHA 5EIOA 2VI5A 1CJKC 2ZUWA 1Z6ZA 1L0BA 5AW4A 1Q7CA 2C96A 4LJKA 2WJVA 2RKWA 2ORWA 3ONVA 5FTKA 2PR7A 3AXTA 3B3QA 3WYGA 2ZYAA 3SSAA 1U4OA 4Z7OB 3KSUA 2VLIA 4ZQCB 5JU6A 4R4JA 4MWZA 2QJTA 5K45A 3IP3A 4EHLA 2JKVA 2R8XA 4O4HA 3GFTA 4R8MA 1IXYA 3TQOA 1RMQA 2A88A 4EJ2A 1R0ZA 3DGEC 4LBWA 3QLVA 4WWHA 4HQLA 1RLMA 3EQZA 4GKJB 5HK9A 2DTDA 1JW9B 3I0ZA 2JCXA 4Q9HA 3AERB 4KPFC 2OXCA 3LA8A 5CBPB 3FA2A 3H86A 4QJBA 4Q16A 4E5VA 1EE2A 3GCGA 3R5FA 4EATA 3UKJA 3CG4A 2DZDA 2GNAA 4MI9A 4E22A 1LLCA 1J39A 4M0DA 2GSDA 5CFPA 1R0BA 1GM5A 3KK0A 3I37X 1EQ2A 2OY0A 2JJ2A 3QOXA 4K6GA 3V1LA 1JHOA 2I2BA 4JP1A 1EVZA 4PCAA 4BNLA 4M9UA 4UU1A 2JFVA 3ZHUA 1WNTA 3KLNA 3OCVA 3PC3A 4OXKA 1S6YA 2XVXA 2OCKA 4O4HF 1GTL1 3VV3A 4FOTA 4MVJM 2EWVA 4IMPA 1SFRA 2PQ2A 2P69A 4R3UC 2IDKA 5ALWA 3IIJA 5JATA 2UYHA 2OC4A 1G5TA 1PSDA 1R10A 2ADFA 3PUVA 5JO9A 5K3SA 2Y6UA 2PRJA 2L18A 2M1ZA 2FP4B 1E7WA 1SCQA 3TD6A 4F6RB 5IFLA 3UWKA 1OKKD 4KC0A 2OXIA 3ZWVA 4GGPA 2WOJA 1IEWA 2EL9A 3IRVA 4JAVC 3THYB 4PO9A 2BUAA 2IGBA 3ROPA 2E1RA 4YRTA 4EKEA 1UK6A 1KDVA 1DAGA 2X8JB 3KKNA 4AZWA 2QVYX 3UMMA 2H2AA 2HB6A 4FMBB 4WZBA 5IAGA 1D8AA 3HDGA 4HAYA 1UK9A 3C7AA 2CHVA 3OM9A 2A0WA 2VDLB 1F60A 4BWGA 1ZN8A 3D8BA 5EKSA 2JEZA 2ZAGA 4F5EA 1Q0LA 2COUA 4JBLA 1YGPA 4Y6PA 3DOJA 2AA3A 3ZTWA 5DWVA 4ZRNA 5CDFE 7GPBA 3CLUD 1OAOA 4QOGA 2F64A 1FYDA 1QE0A 1QVAA 2VKTA 3RABA 1IG3A 1HE5A 2XAAA 4H4DA 1HLDA 4AP5A 3BL5A 3EY9A 4C0BA 3HO1A 1ZGZA 3RLFA 3VV2A 2H51A 1LBHA 4KR2A 4IS2A 2VYQA 2XKBA 3IMCA 3R5JA 4LIPD 4DIEA 3OD1A 4KE7A 3B7GA 3JQAB 1M1YA 2G5PA 2JLBA 4IUYA 4Q1AA 5DCWA 2QT9A 2JAPA 1BMFD 1L5SA 4L76A 1E6LA 3O91A 1NF8A 4Q7MB 2EW2A 2HCBA 5A04A 4ZQEA 1YRLA 4FD2A 4B6SA 1E0JA 3U49A 4FJ2A 3NH9A 5DNAA 5TQJA 3ROEA 2XQKA 2ZR8A 2VJMA 4HYYA 3WMXA 4E08A 2HXYA 3AUTA 1KDZA 5CFZA 5EQJB 3WDMA 4P0PB 2R84A 4C7OB 4BECA 3LUFA 3L6OO 1E62A 2GJ9A 4D3DA 2RBKA 1BCSA 2HJ9A 2VF7A 3AC0A 2HNKA 1RTKA 2FMHA 3OE7D 4RV9A 1AKQA 4FYXA 4GMKA 1KJIA 5EWJB 1NC1A 4ENQA 5FT9A 1YS9A 3BJIC 5G4KA 4BEVA 4CIVA 4ZDIA 1TAQA 1RQNA 2AF3C 5JI2E 4HB3A 4EG8A 4IXWA 2AQHA 4KRGA 1NFFA 2WJWA 2ZT8A 3FRIA 2Y92A 4KE8A 4W5WA 2BFFB 4PHFA 1Q1NA 2I9PA 2D4HA 4HYTA 2I29A 1Z6GA 2QRVA 4B2PA 3V8QA 2QRGA 1JDUA 1JMVA 4HGPA 1HE4A 2GWRA 2IYYA 3LUAA 5CYOA 1BYIA 3ZDYB 5HNKA 1UMKA 1WAMA 2WWRA 3RVJA 1KY4A 5MHTA 1GPJA 1YR1A 2AD1A 1TEXA 3GI1A 4WESB 4MV4A 3TLKA 1PR1A 3OKPA 7ABPA 1ZUWA 5L8VA 1Y8QA 2W6ID 3AIMA 2ODBA 5JAHA 3KQUA 5AVVA 1ZCBA 4G8BA 4G0WA 1M6VB 5CIQA 4WKNA 3QE3A 4KPGA 1VBKA 1HMPA 3GRRA 3ROKA 2I1VB 4CNBA 4TMXA 3N8NA 1U65A 1I5EA 3LS2A 4OAPA 3PWZA 2WJZB 3RYFB 2ZYDA 3FYCA 3TRKA 2HCJB 1Z07A 2QUHA 4YP0A 4KVGA 1GKUB 1N5OX 3G6KA 3HBMA 3OTGA 1COZA 4PC2A 1IM2A 2WM8A 5CURA 3A9VA 3P52A 3CIFA 3W90A 5LZ7A 3GPDG 1H2RS 1KK2A 4RXUA 1Z45A 3E2PA 4LV6A 4C0WA 4BQOA 3K0FB 3SEZA 5JJIA 4CMKA 5KNCD 5CITA 1AKUA 2JIDA 5I7RA 1I0IA 1RLUA 2AFIA 2QTTA 3EQ6A 3WBFA 1NU6A 1GARA 4KWCA 3SIXA 3L4KA 5C5EA 3VVMA 3V1NA 3ZNPA 3AL0C 3AERA 3UHJA 1Z08A 3TTUA 2CNOA 1BU5A 1HRKA 5CBPA 3IHWA 1M2EA 1J1UA 3K71B 1JAZA 1WXFA 3Q0TA 1KOGA 4NBWA 1V7QA 1QQBA 5FOVA 3L18A 2EBFX 1Z2CA 2IJGX 2WIAA 4IEEA 1L5HB 4KIGA 2YV5A 3WLTA 4EMSA 1TTQB 2CKDA 3A6EA 1RC1A 4P2GA 5A4FS 4DB2A 3G2LA 4Z6KA 4BB9A 1C3OA 1BE6A 1QDEA 1JIQA 4TT3D 4CF3A 4NTZA 5ANRB 4UHEA 3VX4A 2HM7A 2FLVA 3K1AB 5EZYB 3I4LA 4BEJA 5JECA 5JJBA 4NXNB 4OV6B 4ZOLB 3DEFA 4Z49A 4FP9A 2A2ZA 3AESB 3G2HA 5DOZA 4ECEA 4KGXA 3ZS9A 2QTZA 2ZAMA 4BTVA 1VJ0A 4HV4A 2FP4A 3GQBB 3HXLA 5FFNA 4NZMA 3RUIA 1IOVA 1I32A 3P9IA 4PYLA 4ZJYA 2D54A 3OZFA 3THYA 4YP6A 2YOGA 1DBVO 3B1VA 4MLZA 4OB6A 1K8ZB 4RORA 2V7BA 3SHVA 3P96A 3V5NA 1N34B 2ZB3A 4G0UA 5LDGA 2Y0CA 2X8JA 4IL5A 2CMDA 4L0QA 2IHTA 3GBVA 3PUZA 5FCDA 1JSRA 4EHKA 1AUVA 2PH5A 1WQ4A 1M2WA 5KWIA 3AHHA 5DDIP 1B2RA 4BKUA 4BYMA 2COKA 3H1GA 4KO2S 1E7YA 1M5RA 3GPLA 4URFA 1RXSA 1ISJA 1J9EA 2DAPA 3E2IA 1A97A 5DFAA 5LC1A 3UWDA 2X4IA 3GH3A 4UHHA 3P2IA 4MS4B 4N7JA 2JDID 3KRTA 2RIPA 3EZNA 1MA0A 1C7EA 2NNWB 4XQCA 5F4BA 3ZK9A 1NVXQ 4ZJPA 2MYPA 2WF5A 4O1MA 1RU3A 5FPPA 5A5VA 5LP6B 3EWIA 2GPSA 4JA2A 4WZBE 4YJ3B 3U62A 4CMEA 4QEZA 2PGLA 4C6TB 3JQAA 1TT5A 4KDCA 1C1XB 1P5HA 2FWMX 3H7IA 3HKDB 1MO3A 3MUNA 1P2DA 1M0TA 2O8NA 2WUWE 4JR0A 3N39C 1RBYA 2YYSA 5EWMB 1M73E 1VPDA 2EOAA 3IEPA 3KS9A 3T5MA 1M8JA 2QM8A 4O2AB 3SICE 1PDVA 1V8FA 4IGKA 3UF0A 1RBMA 1YQWA 1NHWA 2PMBA 1V2GA 1DCKA 2PXXA 3HB9A 3OI7A 3T41A 3TUIC 5F7JA 5K4HA 1L7EA 4C7OA 2OK8A 5LQKA 3NDBB 3VH3A 1EFRD 1WP9A 2FWAA 3MLAA 4MJ7A 5CHYA 4F4IA 3ZDFA 1H2YA 4Q3OA 3OPMA 3WK8A 2PE5A 3C0KA 5KWJA 3KQMA 3PEWA 5EWJA 4PXAA 4U9HS 2JJQA 4NJMB 4PICA 1W5FA 1OBHA 2GCNA 4RO0A 1ZU5A 1M1YE 8GPBA 2ZRDA 5C35A 3A58B 5ALEA 3HDVA 4DDWA 1DMSA 5LM3A 5LPNA 2J0QA 2BFFA 3N2YA 5EJAA 3SXPA 4A5SA 2EIHA 2HI0A 4BFCA 5SYMA 3G7NA 3JD0A 3LYHA 3UMCA 5AVTA 5H7XA 4PTZA 3RVRA 2QVLA 3GXBA 4MS1B 1HYHA 1L2TA 1OLSB 2BHLA 3UJAA 1V37A 1RR6A 2VRCA 4KIUA 3GFQA 4JR2A 4WESA 3NXKA 4I6GA 3G8DA 4YTEA 1C9NA 1E3JA 3HFJA 2HMWA 1TLTA 2QTHA 4U2KA 5CVCA 3WS7A 1TD9A 4N5MA 4KXLA 4ND5A 4Y6QA 3LW7A 4HAZA 2WAMA 3RVKA 2GB4A 2O7SA 4EK9A 1JQAA 3RSOA 5MN5A 2BGGA 1UC9A 4NULA 2J5QA 2ZKIA 4B87A 5AVWA 3MWGA 1OFGA 5CJJA 1QP7A 3LHSA 1DJMA 2R6AA 3GPCA 4Y3UA 5CGQB 3G0BA 1I2MA 3RYFA 1W96A 2QENA 5AKJA 4L5CA 3V8EA 1FS5A 5F77A 4LYFA 2ODTX 4TMWA 1PWXA 3GP8A 4P82A 1NV9A 1V43A 2RGEA 3GRVA 4ZHQB 2UXDB 1RI1A 1WB6A 4FXPA 4XQEA 4YT4A 1ZOLA 4FHFA 3ESRA 2QRJA 1E7SA 4HDQB 4KVFA 1G7SA 3W6OA 5IVPA 3DZDA 5KIAA 5KSPA 3K0FA 3OQ1A 4QUDA 4BLRA 3U7EB 3AV0B 1RLIA 2A5JA 2EGUA 1A8SA 2O9JA 4AURA 2DEUA 3UZUA 3KOMA 5KZMB 1E1MA 1DRUA 1YV9A 4GPBA 5J1TB 3CRQA 4H7HA 2PBZA 4UULA 1JR3D 1FVOA 1RYHA 2ZZKA 4L3VA 1U2ZA 4C4TA 2W2VA 4LDRA 1AKRA 4GP9A 2GXAA 2ID7A 2BHNA 3HM9A 3M6WA 2ZI6A 5IARA 2CW5A 3AFIA 3WVNA 2GAJA 3A6JA 4HRAA 4ZCTA 1NHGA 1KZYC 4ZV4A 1E99A 2C57A 2HLPA 4S0ZA 1PN3A 2WUEA 2JGEA 2C2HA 2NTJA 2G07A 1L5HA 1V8ZA 5JISA 1IWBB 1U7WA 1Y1QA 2WQ7A 2VPXA 4BBAA 3TLAA 1GKLA 3RKRA 4BO0A 2WUVA 3GPIA 3EIUA 4XUEA 3RFCA 3SR4A 1S3SA 2IZ1A 5BW6B 4KKXB 1K7SN 3K1AA 1F0PA 3FMGA 3DXZA 4MRRA 5EZYA 4AUMA 2NP7A 2RGYA 2B82A 2JCVA 3MTDA 1KNXA 4ZOLA 2KPOA 3FPLA 3AESA 2AW5A 4ANFA 1JEQA 4YRGA 3CVXA 1KJJA 2GZMA 1AQ6A 4KYUA 2GILA 1F17A 2C1ZA 5BQ5A 4YXWD 5JWRA 2FFQA 3BULA 5IG2A 1P74A 3M5DA 5JNVA 3LAWA 3N87A 2XDYA 1XP8A 1Q17A 2QUIA 3OBBA 5HQJA 5TEWA 3GQBA 4Z3KA 4OQXA 5HIAA 1GPH1 1LPNA 4F8EA 3Q8MA 1OZFA 2GHRA 3EVAA 4HTFB 5ALOA 3NHFA 3ITEA 1PTKA 3SMQA 3JASB 1ZK2A 3K9WA 4ILEA 1PKEA 3GIWA 4NR0A 2EHDA 4R98A 1GFZA 2XGGA 2ZWIA 4WHMA 5EKXA 4ETMA 4O8CA 4F0JA 1Q77A 2EHJA 4L4SA 3OPVA 3QKRB 4Z2AA 3NYWA 3LT2A 5DXAA 5EMMA 1VHQA 2IHKA 2RAVA 3QU2A 1V1MB 3O4VA 2NV2B 4DIFA 4KMRA 3BD7A 3I30X 2A1TR 2GAAA 1WR8A 1WLYA 3OA2A 3C5HA 3D54D 4G63A 3N5CA 2BMFA 1KXZA 3K0AB 4IQGA 4QDKA 3JPYA 4ZN6A 4H0FA 3BH6A 2JI7A 2BFMA 2GRUA 3IMGA 4MS4A 2BDTA 4PR3A 2JLUA 1T2DA 4FBGA 1D8TA 1HYGA 1ULAA 5DN6A 3WGIA 1E6EA 2A7QA 3IELA 1FSFA 3QVOA 4G5GA 2F17A 2F3SA 4GM0A 2V98A 3DKRA 4MKXA 4IV0A 4QD3A 2GF2A 2J0SA 5LP6A 1UT5A 2JI4A 3UUGA 3E23A 4YJ3A 5IJWA 1XTSA 4C6TA 3NANA 4IGFA 2ALJA 2HYIC 1G8FA 1C1XA 2WI8A 2Z08A 4J3NA 1P0FA 1STOA 3I23A 4FFDA 1XTBA 3JRNA 4JI1B 2KLHA 3DBOB 2OXFA 4O2AA 2OWDA 4K9OA 1Z4MA 3W2FA 3GJ8A 2X0EA 4F3CA 3B3AA 1P0PA 4XD2A 4DADA 4FUTA 1NN0A 4UAJA 5KNLA 2GSWA 4FDAA 4MWOA 4F3NA 2Q4TA 1KIMA 2Y9PB 1A5BB 4OHYA 1NL3A 1JS1X 3V9PA 3SYTA 3IE2A 4YIKA 2AGVA 2OFFA 5HJ5A 4MQMA 1BIFA 3PIDA 4NJMA 2BGUA 5F9FA 4EI8A 2RD2A 1H5QA 2XMDA 2GBPA 4LF4B 2R7NA 1VI6A 4G26A 1HNNA 3QMMA 2N1BA 3IJEB 3GARA 3H5OA 4BKRA 3F9RA 6LDHA 1T0PA 2CYCA 1M74A 1ADGA 1GTRA 1MZPA 3LPLA 1KMIY 2FEKA 4Q9LA 5JMTA 2HA5A 1XMQB 1QYWA 3HJTA 4MS1A 3T3OA 4NWIA 4O2AF 2AK3A 3BE4A 1A4UA 4KYIB 4KXUA 3RNLA 3T9EA 5KEIA 1PZMA 1FFXB 1WVGA 2XOKA 3CLUC 2GF0A 1DC4A 4UPDA 2LTAA 5A7HA 1VMEA 2AZXA 4S35A 4HWKA 3L4BC 1RYBA 3NOQA 3V7WA 3R0ZA 1M7GA 1B0ZA 3PU6A 4DL9A 1DDGA 4D0LB 4WK2B 4XOIA 3WNDA 2I4OA 4QJIA 4AMYA 1XMPA 2QOEA 1Z37A 1Y98A 2VPWA 3B2NA 3DNMA 3WZMA 5TMPA 3ZDAA 1JDVA 2XECA 3O21A 4KQGA 3LQQA 4TMVA 3NNSA 2PXAA 3PA6A 5LSAA 1XA0A 4JC8A 1O08A 2R7KA 1D4OA 4MB2A 5G0WA 3CLVA 4IRUB 1S3GA 3FNHA 3FOBA 1VZ2A 4ZHQA 2NZJA 4KX5A 1U9CA 4PQEA 2QE7A 4C1BA 4U02A 1UJ2A 4YQYA 1CJMA 1LFDB 4MP6A 3QM1A 1S4MA 4JMLA 3PD7A 3UCFA 3CZRA 3WRYA 4OH7A 1W73A 3OZXA 5TQVA 1IK4A 5FOTA 3PL5A 3SR0A 4WKPA 2SKCA 3WWEA 4RQTA 3EQ8A 2AS0A 2NN3C 2DQZA 4DAEA 2Q07A 2C8VA 2ZIEA 1UBTS 1NVDA 5T4BA 3ZWKA 2RGCA 4GI2A 3W6PA 1MPXA 2CL6X 4WACA 5D1HA 4JOBA 2OWEA 2Z2XA 3LHDA 2JFQA 3HNPA 4DQXA 2D5AA 2OSBA 1KOJA 3C6YA 1G1AA 2MINB 1JBQA 2VAMA 2QGZA 1YMUA 2HZ7A 4KACA 4E0BA 2A9FA 1J4AA 4FZ5A 3AONB 3GLFB 2VSNA 2AG5A 3F6EX 3OFND 2XZPA 4OXRA </