3EWOA

Ibv nsp3 adrp domain
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
177
structure length
177
Chain Sequence
LGSVKPATCEKPKFLEYKTCVGDLAVVIAKALDEFKEFCIVNAANEHMSHGGGVAKAIADFCGPDFVEYCADYVKKHGPQQKLVTPSFVKGIQCVNNVVGPRHGDSNLREKLVAAYKSVLVGGVVNYVVPVLSSGIFGVDFKISIDAMREAFKGCAIRVLLFSLSQEHIDYFDATCK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Non-structural protein 3
publication title Crystal structures of two coronavirus ADP-ribose-1''-monophosphatases and their complexes with ADP-Ribose: a systematic structural analysis of the viral ADRP domain.
pubmed doi rcsb
source organism Avian infectious bronchitis virus
molecule tags Hydrolase
total genus 51
structure length 177
sequence length 177
chains with identical sequence B
ec nomenclature ec 3.4.22.-:
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3ewoA00
4ZYQA 3H8EA 3EJGA 4R76A 3IIDA 1LCPA 2EEEA 4ZY1A 3GQOA 3EKEA 4JCAA 5FSUA 2FG1A 3VFQA 2X47A 1YD9A 4J5SA 2VRIA 3SIGA 4ZY0A 2LGRA 4GVVA 1ZR3A 5CMSA 1LAMA 1SPVA 4IQYA 4ABKA 2FXKA 4UMLA 4X2TA 3EWRA 2BFRA 2BFQA 3H8FA 4K3NA 4KSIA 4ETKA 4TU0A 1HJZA 3IIFA 5E3BA 5AILA 5D8NA 1BLLE 1LAPA 3IJ3A 2XD7A 4JVVA 4ETJA 3EWPA 3SIJA 4J5QA 2L8RA 4ZX8A 3GPGA 3JZTA 2J9AA 5CBMA 5FSVA 3SIIA 3Q71A 2DX6A 4ZI6A 3EWQA 5CB3A 4GVWA 2EWBA 3GQEA 4JGKA 1ZR5A 4R6TA 3V45A 3EW5A 5FSYA 4K0CA 3SIHA 4D86A 3EJFA 3GPOA 2FAVA 3Q6ZA 5DUSA 4R7MA 4ZY2A 3V2BA 2ACFA 1TY8A 3KQXA 4ABLA 1BPMA 3PEIA 1NJRA 4KYBA 3KZWA 3GPQA 5HOLA 4JLLA 5CB5A 3KR4A 3EWOA 1TXZA 1LANA 1GYTA 3JRUA 4ESSA 5FSZA 1BPNA 4J4ZA 4ZX9A 3ETIA 3KQZA 4GUAA 1VHUA 5FSXA 5HIHA 3H8GA 3KR5A 2AFCA 3T8WA 4J5RA
chains in the Genus database with same CATH superfamily
2KQVA 4ZYQA 3H8EA 3EJGA 4R76A 3IIDA 1LCPA 2EEEA 4ZY1A 3GQOA 3EKEA 4JCAA 5FSUA 2FG1A 3VFQA 2X47A 1YD9A 4J5SA 2VRIA 3SIGA 4ZY0A 2LGRA 4GVVA 1ZR3A 5CMSA 1LAMA 1SPVA 4IQYA 4ABKA 2FXKA 4UMLA 4X2TA 3EWRA 2BFRA 2BFQA 3H8FA 4K3NA 4KSIA 4ETKA 4TU0A 1HJZA 3IIFA 5E3BA 5AILA 5D8NA 1BLLE 1LAPA 3IJ3A 2XD7A 4JVVA 4ETJA 3EWPA 2JZFA 2WCTA 4J5QA 2L8RA 3SIJA 4ZX8A 3GPGA 3JZTA 2J9AA 5CBMA 5FSVA 3SIIA 3Q71A 2DX6A 4ZI6A 3EWQA 5CB3A 4GVWA 2EWBA 3GQEA 4JGKA 1ZR5A 4R6TA 3V45A 3EW5A 5FSYA 4K0CA 2JZEA 3SIHA 4D86A 3EJFA 3GPOA 2FAVA 3Q6ZA 5DUSA 4R7MA 2JZDA 4ZY2A 3V2BA 2ACFA 1TY8A 3KQXA 2W2GA 4ABLA 1BPMA 3PEIA 1NJRA 4KYBA 3KZWA 3GPQA 5HOLA 4JLLA 5CB5A 3KR4A 3EWOA 1TXZA 1LANA 1GYTA 3JRUA 4ESSA 5FSZA 1BPNA 4J4ZA 4ZX9A 3ETIA 2RNKA 3KQZA 4GUAA 1VHUA 5FSXA 5HIHA 3H8GA 3KR5A 2AFCA 3T8WA 4J5RA
chains in the Genus database with same CATH topology
4ZYQA 3H8EA 3EJGA 4R76A 3IIDA 1LCPA 2EEEA 4ZY1A 3GQOA 3EKEA 4JCAA 5FSUA 2FG1A 3VFQA 2X47A 1YD9A 4J5SA 2VRIA 3SIGA 4ZY0A 2LGRA 4GVVA 1ZR3A 5CMSA 1LAMA 1SPVA 4IQYA 4ABKA 2FXKA 4UMLA 4X2TA 3EWRA 2BFRA 2BFQA 3H8FA 4K3NA 4KSIA 4ETKA 4TU0A 1HJZA 3IIFA 5E3BA 5AILA 5D8NA 1BLLE 1LAPA 3IJ3A 2XD7A 4JVVA 4ETJA 3EWPA 3SIJA 4J5QA 2L8RA 4ZX8A 3GPGA 3JZTA 2J9AA 5CBMA 5FSVA 3SIIA 3Q71A 2DX6A 4ZI6A 3EWQA 5CB3A 4GVWA 2EWBA 3GQEA 4JGKA 1ZR5A 4R6TA 3V45A 3EW5A 5FSYA 4K0CA 3SIHA 4D86A 3EJFA 3GPOA 2FAVA 3Q6ZA 5DUSA 4R7MA 4ZY2A 3V2BA 2ACFA 1TY8A 3KQXA 4ABLA 1BPMA 3PEIA 1NJRA 4KYBA 3KZWA 3GPQA 5HOLA 4JLLA 5CB5A 3KR4A 3EWOA 1TXZA 1LANA 1GYTA 3JRUA 4ESSA 5FSZA 1BPNA 4J4ZA 4ZX9A 3ETIA 3KQZA 4GUAA 1VHUA 5FSXA 5HIHA 3H8GA 3KR5A 2AFCA 3T8WA 4J5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZYQ A;  3H8E A;  3EJG A;  4R76 A;  3IID A;  1LCP A;  2EEE A;  4ZY1 A;  3GQO A;  3EKE A;  4JCA A;  5FSU A;  2FG1 A;  3VFQ A;  2X47 A;  1YD9 A;  4J5S A;  2VRI A;  3SIG A;  4ZY0 A;  2LGR A;  4GVV A;  1ZR3 A;  5CMS A;  1LAM A;  1SPV A;  4IQY A;  4ABK A;  2FXK A;  4UML A;  4X2T A;  3EWR A;  2BFR A;  2BFQ A;  3H8F A;  4K3N A;  4KSI A;  4ETK A;  4TU0 A;  1HJZ A;  3IIF A;  5E3B A;  5AIL A;  5D8N A;  1BLL E;  1LAP A;  3IJ3 A;  2XD7 A;  4JVV A;  4ETJ A;  3EWP A;  3SIJ A;  4J5Q A;  2L8R A;  4ZX8 A;  3GPG A;  3JZT A;  2J9A A;  5CBM A;  5FSV A;  3SII A;  3Q71 A;  2DX6 A;  4ZI6 A;  3EWQ A;  5CB3 A;  4GVW A;  2EWB A;  3GQE A;  4JGK A;  1ZR5 A;  4R6T A;  3V45 A;  3EW5 A;  5FSY A;  4K0C A;  3SIH A;  4D86 A;  3EJF A;  3GPO A;  2FAV A;  3Q6Z A;  5DUS A;  4R7M A;  4ZY2 A;  3V2B A;  2ACF A;  1TY8 A;  3KQX A;  4ABL A;  1BPM A;  3PEI A;  1NJR A;  4KYB A;  3KZW A;  3GPQ A;  5HOL A;  4JLL A;  5CB5 A;  3KR4 A;  3EWO A;  1TXZ A;  1LAN A;  1GYT A;  3JRU A;  4ESS A;  5FSZ A;  1BPN A;  4J4Z A;  4ZX9 A;  3ETI A;  3KQZ A;  4GUA A;  1VHU A;  5FSX A;  5HIH A;  3H8G A;  3KR5 A;  2AFC A;  3T8W A;  4J5R A; 
#chains in the Genus database with same CATH topology
 2KQV A;  4ZYQ A;  3H8E A;  3EJG A;  4R76 A;  3IID A;  1LCP A;  2EEE A;  4ZY1 A;  3GQO A;  3EKE A;  4JCA A;  5FSU A;  2FG1 A;  3VFQ A;  2X47 A;  1YD9 A;  4J5S A;  2VRI A;  3SIG A;  4ZY0 A;  2LGR A;  4GVV A;  1ZR3 A;  5CMS A;  1LAM A;  1SPV A;  4IQY A;  4ABK A;  2FXK A;  4UML A;  4X2T A;  3EWR A;  2BFR A;  2BFQ A;  3H8F A;  4K3N A;  4KSI A;  4ETK A;  4TU0 A;  1HJZ A;  3IIF A;  5E3B A;  5AIL A;  5D8N A;  1BLL E;  1LAP A;  3IJ3 A;  2XD7 A;  4JVV A;  4ETJ A;  3EWP A;  2JZF A;  2WCT A;  4J5Q A;  2L8R A;  3SIJ A;  4ZX8 A;  3GPG A;  3JZT A;  2J9A A;  5CBM A;  5FSV A;  3SII A;  3Q71 A;  2DX6 A;  4ZI6 A;  3EWQ A;  5CB3 A;  4GVW A;  2EWB A;  3GQE A;  4JGK A;  1ZR5 A;  4R6T A;  3V45 A;  3EW5 A;  5FSY A;  4K0C A;  2JZE A;  3SIH A;  4D86 A;  3EJF A;  3GPO A;  2FAV A;  3Q6Z A;  5DUS A;  4R7M A;  2JZD A;  4ZY2 A;  3V2B A;  2ACF A;  1TY8 A;  3KQX A;  2W2G A;  4ABL A;  1BPM A;  3PEI A;  1NJR A;  4KYB A;  3KZW A;  3GPQ A;  5HOL A;  4JLL A;  5CB5 A;  3KR4 A;  3EWO A;  1TXZ A;  1LAN A;  1GYT A;  3JRU A;  4ESS A;  5FSZ A;  1BPN A;  4J4Z A;  4ZX9 A;  3ETI A;  2RNK A;  3KQZ A;  4GUA A;  1VHU A;  5FSX A;  5HIH A;  3H8G A;  3KR5 A;  2AFC A;  3T8W A;  4J5R A; 
#chains in the Genus database with same CATH homology
 4ZYQ A;  3H8E A;  3EJG A;  4R76 A;  3IID A;  1LCP A;  2EEE A;  4ZY1 A;  3GQO A;  3EKE A;  4JCA A;  5FSU A;  2FG1 A;  3VFQ A;  2X47 A;  1YD9 A;  4J5S A;  2VRI A;  3SIG A;  4ZY0 A;  2LGR A;  4GVV A;  1ZR3 A;  5CMS A;  1LAM A;  1SPV A;  4IQY A;  4ABK A;  2FXK A;  4UML A;  4X2T A;  3EWR A;  2BFR A;  2BFQ A;  3H8F A;  4K3N A;  4KSI A;  4ETK A;  4TU0 A;  1HJZ A;  3IIF A;  5E3B A;  5AIL A;  5D8N A;  1BLL E;  1LAP A;  3IJ3 A;  2XD7 A;  4JVV A;  4ETJ A;  3EWP A;  3SIJ A;  4J5Q A;  2L8R A;  4ZX8 A;  3GPG A;  3JZT A;  2J9A A;  5CBM A;  5FSV A;  3SII A;  3Q71 A;  2DX6 A;  4ZI6 A;  3EWQ A;  5CB3 A;  4GVW A;  2EWB A;  3GQE A;  4JGK A;  1ZR5 A;  4R6T A;  3V45 A;  3EW5 A;  5FSY A;  4K0C A;  3SIH A;  4D86 A;  3EJF A;  3GPO A;  2FAV A;  3Q6Z A;  5DUS A;  4R7M A;  4ZY2 A;  3V2B A;  2ACF A;  1TY8 A;  3KQX A;  4ABL A;  1BPM A;  3PEI A;  1NJR A;  4KYB A;  3KZW A;  3GPQ A;  5HOL A;  4JLL A;  5CB5 A;  3KR4 A;  3EWO A;  1TXZ A;  1LAN A;  1GYT A;  3JRU A;  4ESS A;  5FSZ A;  1BPN A;  4J4Z A;  4ZX9 A;  3ETI A;  3KQZ A;  4GUA A;  1VHU A;  5FSX A;  5HIH A;  3H8G A;  3KR5 A;  2AFC A;  3T8W A;  4J5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...