3EWSA

Human dead-box rna-helicase ddx19 in complex with adp
Total Genus 136
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
136
sequence length
420
structure length
416
Chain Sequence
MEDRAAQSLLNKLIRSNLVDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQSGTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The DEXD/H-box RNA Helicase DDX19 Is Regulated by an {alpha}-Helical Switch.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords ATP-dependent RNA helicase DDX19B
total genus 136
structure length 416
sequence length 420
chains with identical sequence B
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00270 DEAD DEAD/DEAH box helicase
A PF00271 Helicase_C Helicase conserved C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ewsA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ewsA01
2BBTA 5EE0A 1L7VC 4JL6A 2HJGA 4DLUA 4O0MA 4FI3C 5BN3A 4GL2A 4TLEA 1G41A 2J3EA 1S4QA 1SKQA 1GM5A 4Q4LA 2ZI9A 3I8XA 5FR1A 1Q12A 1TADA 5CB8A 1VG0B 4JJKA 5JI2E 1W5SA 4EPRA 1NL3A 2PCJA 2V54A 4IVPA 1F3OA 1H8EA 5K8LA 5K8TA 5C46F 4GDFA 4PAMA 3AF4A 5J5CA 1HQYE 1W5TA 2GCOB 3AF1A 4C0LA 2W0SA 4BEJA 2BCGY 2IYXA 1IY1A 4UNSA 2HLDA 4DSUA 1MT0A 4CIDA 3QI2A 2YKGA 1G9XA 1XF9A 1N0UA 2MSEB 1QZXA 1PZNA 4QGGA 4PXAA 2BBWA 3AF0A 4TMVA 5JCZA 3THYB 1KI6B 2FF7A 2OILA 5JRJA 3GJ6A 2JLVA 4B33A 1ZVQA 2Z4SA 2GXAA 3OE7D 4PQFA 1XD2B 1KI1A 4O3MA 1QHGA 3IPXA 4GPTA 4CT4B 5JBQA 4G0NA 2ZJAA 1N6IA 1YR6A 4QHYA 4CW7A 3CR8A 3PEYA 2WWXA 1UBFA 2HLDD 1IJEA 2FFQA 1SVLA 2HJVA 3B13B 4Q4AB 4N0EA 1YZNA 2EFGA 2O0JA 4C4PA 5JRZA 1IXRC 1A1VA 4EFLA 4KITB 1E0JA 1DAHA 1E9EA 2PZGA 3GLIE 2C96A 2REBA 4DJTA 3OEHD 4DB4A 1DPFA 2ZE8A 2D7CA 2G9NA 5B2ZA 2BIFA 1N6KA 1VG1A 1KGDA 1UKVY 3PUVA 3ZH9B 3BOSA 3IGFA 4OHZA 2QE7D 2O8FB 4TL9A 3IBGA 2W58A 3DVLA 4KSCA 4Q5IA 4WBSA 4C0QC 5K8UA 2F55A 3T34A 1QRAA 2WAYA 1GL6A 5DHFA 5FUWA 2QP9X 2FX3A 2QRNA 2QMOA 2ATVA 4M9ZA 2BKEA 4XTRA 3RANA 2OAQ1 3RYTC 1R7RA 3B6EA 1W0KA 4KO8A 1DAIA 4XD7A 2A78A 3KDSE 2NO1A 1XB2A 4PQYA 5G40A 1E2NA 4Q9KA 3SNHA 1VTKA 1GTVA 5GVRA 4ZCIA 3LW8A 3L8ZA 1CXZA 4BUJA 2ODBA 3SC3A 5KNCA 4PC2A 2HYDA 2PEZA 5EE1A 1TQ4A 1BKDR 3J81k 4MGYR 2OLJA 4U00A 3ZLJA 4V0OA 1M7GA 3QXHA 3X1WA 2DPXA 1KKLA 2C98A 4OI1A 4MGZR 2F1IA 5F9HA 1KK2A 4RFVA 5BXQC 4U7DA 4D81A 2ORWA 1XD2A 1UBGA 1PLLA 3IHLA 1KJWA 4OHYA 1J8YF 2G0TA 2C04A 2WWGA 2B8WA 2Q21A 4A0FA 4URVR 2J7PA 3KKPA 5EZ6B 3RDPA 3I5YA 1E99A 4QFMA 1U99A 4EPXA 1GP2A 2QP3A 2AFHE 2VHCA 1YU9A 2QN6A 2EW1A 1X3SA 2GVZC 3AVQA 2ZI7A 1Z07A 4A2WA 3B7GA 4WXRA 4BLQA 4ZDJA 3M1IA 2JLUA 3OIVA 3OESA 3BFKA 1NI3A 2DBYA 3GFPA 2XEXA 3R9WA 1V5WA 1NLZA 2R2AA 4HDOB 5EXXA 1J70A 2ZRCA 1MRNA 5JI3E 2IS4A 1M34E 4X8HA 3OIWA 1N6OA 4PPQA 1S3GA 3IEVA 3BB3A 4UNQA 4XD7D 3MSXA 4HDCA 2F3RA 4V02A 3SJCA 3FHTA 4F4IA 5FH9A 4M21A 3K8YA 3OHMA 1CR2A 3BB4A 1O3YA 4LC0A 2FEMA 2JJ1A 1XRJA 2RGNA 2ZRMA 1AS2A 2W0MA 4M9SA 3GJ0A 1G17A 1DO0A 4DEXA 3FKSA 4XSHA 3ADCA 1VG8A 5CJPA 2Z4RA 4AD8A 3LQQA 2G6BA 3VHXA 2WSSD 4NPHA 3RS5A 2OO7A 3PQCA 4HB0A 4B76A 4TSFA 3EC2A 4RD1A 4GMDA 1T6NA 1CR0A 2IUTA 1EWRA 3RWMB 4TLCA 2TMKA 3IQWA 5L3SB 3SE0A 4DT1B 2EQBA 4Q4HB 5JEDA 2V6JA 1MOZA 1D2MA 4RD6A 2OFWA 5E4FA 1XD8A 821PA 4IDHA 3KQUA 1WP9A 4WA7A 4EJSC 2XOKA 2F43A 4AKGA 5AUNB 3A6PC 1ZM9A 2QZ4A 2QSZA 4ERNA 1ETUA 3TUIC 1OB5A 1HT2E 4DBLC 1X8KA 1W36C 2ZROA 5SZHB 4Q7MB 2I3BA 4OQLA 1E2DA 4BGDA 2RGDA 3NBFA 5P21A 2RGCA 4K8OA 2IC5A 3SS8A 4Q66C 1S3SA 1YQTA 2DB3A 4W5JA 2N42A 3FMPB 2GZHA 1MO6A 4YC7A 5G41A 3X1YA 3EX7C 1OF1A 5D3QA 5JJLA 3THOA 2VA8A 1XJQA 1NVWQ 2NMVA 3I4LA 3ZGXA 3NG1A 3MG9A 2O8BB 1ZM2A 4DCSA 4QBFA 2R44A 4DT1A 4EUNA 3W34A 1TL7C 3MLEA 4M2LA 2GBLA 3LO5A 2VP2A 1J2JA 2VBCA 4AKIA 1E9SA 2QBYA 4KYUA 5C4MA 1LV7A 4KHZA 2GCOA 1ODFA 2JGNA 3BBPA 5CM9C 2Q6TA 2VF7A 3LBHA 2RAPA 1OLOA 1UDXA 1OYWA 1J8MF 1ZNXA 3FFAA 2J59A 2JCSA 3LDAA 2PLRA 2FMXA 1RYHA 2Q9BA 2ZI3A 1AK2A 3V9PA 3WYGA 4ZKEA 1Z0IA 1Q1BA 2IYSA 3DM9B 1KAOA 4KCGA 3ZVRA 2GCNA 4B3CA 1JAHA 4LPSA 4ARZA 5EQTA 1XXHB 1VIYA 3BIFA 5LD2B 3ZZ0A 4HAUA 3C15C 4MYUA 2YHSA 1UBEA 5FOTA 3BJIC 1XEWY 2B7BA 1OSNA 4DLTA 4M22A 4V03A 3B85A 3P1JA 3KJHA 2ASEA 3K0AA 1CKEA 1W1WA 4PHFA 3AB3A 4C7OA 1ZIOA 2IL1A 5LDDC 3KXLA 4KFTA 2DFLA 4URZR 2IYWA 2P6NA 2CJWB 3MRSA 2F1HA 2C8VA 1IM2A 1LS6A 2AK3A 2VL7A 2ZPTX 3LA6A 3U44A 2ZU0C 2QENA 2LKCA 3B9QA 3BH7A 1XJ0A 1XZPA 4A2QA 1KI9A 1EFCA 4C0SA 1IN4A 4BLOA 4TN1A 1H8ED 1QF9A 1D9XA 1RRGA 1US8B 4PQRA 4JS0A 5JWRA 4US2R 1BYUA 3A4LA 4NYMQ 2FA9A 4P31A 2IYUA 1Q0UA 4B44A 1NN5A 1ZC4A 2OG2A 2V7QD 2AFIE 4IDOA 4NE2A 3AVUA 4Q4HA 4B75A 2FZ4A 2D2EA 3BERA 2I1QA 3VKHA 2WWHA 2VPPA 3F3YA 1GNQA 4B3GA 4M1MA 5IHPA 1IY0A 2OXRA 3A1VA 1XMJA 3L0PA 3TE6A 2R9VA 4IHQA 1CEEA 2BKUA 1OXXK 2FFHA 4LHYA 1GVNB 4JVLA 4MQBA 3Q7QA 2CL6X 2FSHA 2ZE7A 3QOFA 2NOAA 1OFHA 2NPIA 3A37A 1PLKA 3AF2A 3BH6A 3GJ5A 3MWLA 1NG9A 1XPUA 1E9DA 3VKGA 1IY2A 1OJLA 4AKEA 1E9AA 3TR5A 1R2QA 2CLSA 2OCBA 5FTMA 2PX0A 1OHHD 4CEIB 4LPKA 2B21A 1R5BA 4B2PA 2QU8A 2V55B 3FVQA 1AJEA 4IDPA 5FUXA 3TSOA 4EPWA 2BWJA 4TYWA 2D2FA 1EX7A 1JEDA 5FTKA 3UMRA 2N1BA 3A1UA 1IQPA 1T3SA 4DC9A 3LX8A 2A3RA 2FN4A 3ZQ6A 1KK0A 4P4TA 1N3BA 3WYAA 3QENA 3QKRA 3UKDA 5KSYA 4CVNA 3RLFA 3PENA 3TSWA 5EE9A 3NIBA 3MWJA 2HT1A 1KZGB 1MKYA 4Y0AA 2Q0HA 3PUWA 4M8NE 5LB4A 1X86B 1UKEA 4L5BA 3CBQA 2NO0A 2OBMA 4FMBB 2CL7X 1OXUA 4Q4JB 2NGRA 1F2TB 4TLBA 4QJ3A 3QBVA 1UAAA 1K6MA 3CNNA 4G3XA 1DAMA 1ZD1A 3LXXA 3LH5A 3NEJA 2VHUA 4YMWA 1R0WA 2K5UA 1NSFA 3DM5A 2RMKA 3REFA 3ZD6A 3U2QA 4W9MC 5AUQA 1G8PA 1ZNWA 3CM0A 4XSGA 1OYYA 3TW8B 1OB2A 4LDJA 5L3SA 2BCJQ 2FU5C 3AP3A 5TXGA 2IHYA 3WNBA 2REOA 2VP9A 4LOAA 5EXSA 3R7WA 1AS0A 2CHQA 3W8NA 5HZHA 1EESA 5JCPA 3KUDA 4Q7KA 1HYQA 3W6PA 1JECA 3GPLA 2H57A 1Z8FA 5DSZA 3KXIA 4D26A 3LBIA 4LJ6A 4DLRA 1KOFA 2DFNA 2RGEA 2V3CC 3KQLA 4XTCS 3QPVA 4TYPA 2GF0A 1QVAA 3QF7A 2J7KA 1I4LD 1Z0FA 3TIFA 3UANA 1ANKA 1DG1G 4JKYA 2H92A 1J90A 3DPUA 3P27A 2CXXA 3KL4A 2NO9A 4QM7A 4LSGA 3RS2A 3IO5A 3EIQA 1G18A 3RABA 4BASA 4S2EA 1NN1A 4JLDA 1CTQA 3BWDD 1XEXA 1C4OA 3PUZA 2HCJB 2YNMA 1NJGA 2YVUA 2GJ8A 1CJUC 1E2JA 5SZJA 1T9HA 4L16A 4NDZA 4R71A 3L2OB 2J7PD 4MKIA 2IYRA 4CEHB 2HCBA 4JLKA 1SKYB 1TQ2A 4OHXA 5EXTA 2WSMA 2YWHA 1W47A 4NYIR 1KDTA 2ZRFA 5TY0A 1JI0A 2X1VA 3B82A 2F7SA 1Z08A 1Z0DA 4ASUD 3ZVNA 3U60B 2C03A 5FR2A 4BFYA 2CVHA 1U2RA 3P20A 1OIWA 1S1MA 5KTYA 3UK6A 4Q00A 2ZS9A 4US1R 3I1FA 1NVVQ 2J0UA 1JPNA 1UBCA 1I4TD 1LNZA 1JJ7A 5CJ2A 1WF3A 2QORA 4F4JA 1G3RA 1JQJC 1YKSA 5E95A 5J4KA 4PPGA 3AVOA 1LF0A 2GBLC 4B2LA 4BEBA 5J4LA 4Q4JA 3ZZTA 1N6HA 2PJZA 2WZQA 2GAAA 4C0KA 1XEXB 4GBMA 4IOMA 1GRNA 4MITA 3K0CA 1W4RA 4B32A 3VFDA 1AKYA 1E2QA 2QQ0A 1XTQA 4I1OA 1WBDA 5JLJA 2V8OA 3O47A 5KSPA 4R7ZA 1QHYA 4JLAA 5AWFC 2PZEA 3NVAA 4GT1A 3NHBA 4B74A 1ZJ6A 1YR9A 3FMFA 3RVBA 2OLKA 2JAQA 4S35A 2H5EA 5HE8A 4DDVA 1DO2A 4M53A 4BPBA 1HURA 5FOUA 5FOVA 4OL0A 1EFHA 1HTWA 2ZTSA 4BZXA 1CU1A 1VHTA 5AJXA 4D4JA 1EXMA 4BQSA 3LLMA 4IKEA 1XXHE 2AHOA 1PJRA 1E3MA 4OK3A 2ZUCA 4LC1A 4EJSA 4JVNA 4F38A 2JJ8A 5TMPA 2FDCA 1U8YA 3SQXA 3C16C 1ESMA 2AKAB 2JEOA 3LVQE 4KVGA 3WP0A 4A1FA 1OH5A 2OZEA 4HATA 3QG1A 4KXFB 2F1RA 1XTJA 1M6NA 2OFXA 3EXAA 3QPWA 4UNPA 5FUYA 4F7WA 2EFHB 2XZPA 3BORA 1OW3B 4BFXA 4ZKDA 4JMPA 4K46A 3F8TA 2CK3A 2RGGA 4ZCMA 2ZJOA 3LFUA 3V4FA 1CJTC 1O87A 2V6IA 4OQNA 3GLGA 4RY2A 3DHWC 4FW9A 2ZSEA 4IRUB 3VQTA 4L4UA 4U5XA 1VYVA 1YZGA 1ZAKA 2QA5A 1UF9A 1P60A 3A36A 2CLDX 1MV5A 4ZCLA 2Q9AA 2WJYA 3U3JA 3VX3A 4BLPA 1U90A 4QC2A 1T8UA 1OFTA 1E9RA 4GZMA 1P2TA 3SJZA 2XNDD 3M0EA 1HH4A 2WKRA 3B9PA 2WIBA 2ZYUX 1TQ6A 5C4GB 3TUZC 1N5IA 2FSGA 3KFVA 2ANBA 1FTSA 4TQ9A 4FCTA 3IIMA 3R7WB 1G4AE 1G3IA 2NO7A 1LW7A 2LKDA 3QG5A 4M1OA 1FX0A 1K8RA 3CX6A 1M2OB 4QGAA 1ZM4A 5HR5A 5FPKA 4RJLA 2C2HA 4JVMA 2C9YA 3ONWA 4Q7JB 4RD3A 1T91A 2BJVA 1ZP6A 4BZQA 5L3VA 3L0IB 1TQDA 1KSJA 2OUKA 1KO1A 4NBSA 5EP3A 4TLAA 3AUYA 3DZ8A 1ELOA 2YOGA 3EAQA 4UXJA 4X8OA 4AC9A 3KQNA 4Q19A 1LF5A 1FTNA 2F9MA 3LNCA 2A9KA 3W8RA 1RIFA 1HE8B 4Q21A 2FSFA 1GG2A 1DG3A 1GAJA 1E4VA 1YZQA 4A0RA 1SVWA 5ELXA 4MDFA 1E0AA 1G64A 4KI0A 5JZVA 3OEED 1XU4A 5TARA 3ZIAD 5HCIA 3F5FA 2ZRKA 3QXJA 2ZAOA 2J0SA 2E9SA 3AQ4A 4GOXA 4V0MA 1DARA 1VECA 1KMHA 4YXWA 1U0HC 3ZD7A 3H84A 3H86A 4HDQB 4DUGD 4Q02A 2GWHA 3UIEA 1UJ2A 3W6OA 2CCKA 1ZNYA 3ZQJA 2AD5A 4HAVA 4QHTA 2ERXA 2BMJA 3T1QA 1CJMA 1R4AA 2BBOA 1G7TA 1E98A 4A8JC 2ZEJA 2CEAA 3LBNA 1EK0A 4TSFD 4TYYA 1JXOA 4TYQA 2YC2C 3DZDA 3FPAA 1RJ9A 2CBZA 1AM4D 2EWWA 2VP6A 2W6ID 4B48A 1T4GA 4MUBA 2GVDC 4W7SA 3VNUA 3KKNA 3K09C 5KDLA 1N6LA 2P67A 4B3DA 4DCUA 2OCAA 3HR7A 4GNKA 5G53C 2IW3A 3MUFA 2G0NA 2QMHA 2WJGA 2WWWA 4DSOA 3AVTA 1PUJA 3P32A 2NZJA 1G20E 2GZDA 1E32A 3NBZC 2IYTA 1FL9A 1ZINA 4TMZA 1HT1E 4MGIR 3RRZA 2CHVA 1P6XA 1IN7A 1VHLA 3KB1A 4PPNA 1GL9B 1NBMD 2ZXUA 5EUMA 4N1AA 4DDWA 2WKPA 2A5DA 3DOEA 1BMFD 2IBMA 3SU8A 1TU3A 4B3XA 2JDID 1S2MA 1R6BX 1MR3F 3K53A 1DS6A 1RPZA 3I92A 4FIDA 1OV4A 2UVQA 1Q1ZA 1D2EA 4OK6A 5FTLA 4I99A 2NIPA 5F9FA 4UJ5A 2REXB 1A5TA 1LS1A 2AD1A 4CEJA 1YVDA 3AKDA 4BFWA 4DLYA 5CK4A 1AQUA 1GSIA 4DCNA 4XWKA 521PA 1YRBA 4OHWA 4DVGA 4XH9B 4NKRA 2ZJYA 4P4SB 3K0CC 1TEVA 3K0EA 2XJ9A 1UFQA 2O8DB 5FBLB 1EWQA 1KNXA 1V43A 4MKHA 4JYBA 1Z47A 1Z28A 1S9DA 4WXPA 1CBUA 4JBXA 1YR7A 2R65A 2H18A 2VEDA 4A0HA 2PT7A 2J87A 1T8TA 2WJIA 1U0JA 3B5JA 1S1CA 3VR3A 1PV4A 1RFLA 3FE2A 1E96A 2JLRA 2QT0A 5JECA 3O8CA 1IN6A 2ZR0A 1KSGA 2UZIR 1BYIA 2CCGA 4PHTA 1LY1A 5HKKD 3GP8A 1YRAA 4FMCF 4PTLA 1NIJA 3MJRA 3ZVLA 2BEKA 3B8HA 1Z6TA 3W3ZB 1G19A 1U9IA 1GRRA 2O8EB 3CPEA 4CT5A 4G01B 5J47A 2IWRA 3MD0A 3K9LA 3NWJA 2GNOA 3KJGA 4WZBE 4C2UA 4NHOA 1XX6A 2CDNA 2QSYA 4KYIB 4RD0A 3T35A 3KJIA 2QPTA 1R0YA 4HAWA 1W4AA 2IWHA 2V7QA 2VH5R 4EFMA 2O8DA 3QY0A 2BMDA 1X8LA 3IO3A 1NP6A 4N0DA 4M4SA 3FHCB 4HB4A 3ADDA 4FMCB 4JIMA 4NCNA 3IIJA 3PEUA 4LJYA 4EKDA 1HEIA 5BQ5A 2RB4A 3U4QB 3R8FA 5LD2C 2BM1A 2WWFA 2B6HA 3CF0A 2JATA 3I3SR 3X1ZA 4BWYA 4MRRA 3AKCA 2GXUA 1T3HA 1S96A 5IRCD 4V0LA 1MABA 2HF8A 4A6PA 3SQWA 1JJVA 4TTPA 5FL7D 2ODWA 3SJAA 1SULA 4XVUA 2JJ2A 1GKIA 4KVAA 4D82A 2P0EA 3QKSB 2J9RA 4OK5A 4Q1EA 2CVFA 1SXJA 2DWQA 5FTNA 2JIZD 1TPZA 4B35A 2ZJ5A 1KMHB 4I1UA 5A0FA 4QXAA 1NNEA 4JLVA 2GA8A 2CCJA 1XMSA 3AP2A 3NH9A 3LQRA 3RS4A 1TEXA 4ZV4A 2XX3A 3VR4A 1N6NA 3I72A 3KTAA 3GLIB 3CIOA 4IW3B 4E5UA 1RE0A 5KU1A 4H9GA 3AGPA 5JS7A 2CLCX 1UDWA 1T0JB 2J46A 3HU3A 3JVUA 5BYKA 5KPDA 2VP5A 1KZ7B 4Q1DA 5KO2A 3UWKA 1JR3E 4D4KA 2CHGA 1GZSA 2ZUDA 3ADKA 4KFSA 4CZ2A 4DCVA 2DR3A 5B58C 3OAAD 4RZ2A 4LHVA 1OIVA 1KI7A 2DY1A 3EG5A 3L0OA 3FOZA 1P9RA 4QOSA 5BN5A 1Y63A 5DI3A 4URUR 4RD2A 4IOKA 3H4MA 5KDDA 2JLYA 1NLFA 3GJ3A 4C0AC 1G3MA 2VYFA 2ZRLA 3GD7A 3QKTA 4NYMR 4OQFA 3GJXC 3PUYA 1NN3A 1AN0A 5EP4A 4MRNA 3SHWA 1XWIA 4DKXA 3GLFB 1XTSA 2AN9A 2ORVA 4HAXA 4MKFA 3Q5DA 4Q18A 4C0BA 2ZRHA 3HPQA 4YMVA 2O52A 3KQHA 4BRWA 2XITA 2ECKA 3BB1A 5B30A 5M04A 1Z0AA 2O0HA 3B1WA 3D3QA 2HT6A 2IT1A 4LUCA 4PC7A 421PA 3AVVA 1N5JA 2IXFA 3KTAB 4B47A 1HY3A 1GNRA 2ZRPA 4AG6A 3T5GA 1ZBDA 1RRPA 4XVQA 1QHIA 5LBIA 4TYNA 2OEPA 1UM8A 2XSZD 1G7CA 3GLHA 3AVXA 2ZYVX 2O8FA 5TVKA 4RSGA 1NF3A 4HZUA 2QTFA 4PHGA 5B64A 4X8MA 4DUGA 2O8BA 5G3ZA 1H8HA 1JR3A 2QM8A 3IIKA 5JJIA 5L3QA 2OV2A 4ITRC 1P73A 3OF5A 4HEJA 2XXAA 3WNCA 2BBSA 3CPJB 3I8SA 2J0QA 1VYUA 1RZ3A 4NU0A 1JNYA 2ZRNA 4A92A 5J4HA 2C9CA 1NMZA 4BFZA 2GK7A 3AEZA 5E7JA 4QBIA 3K9NA 4DLWA 2KWIA 3MGCA 2OT3B 3HU2A 3LLUA 1F6BA 3SFVA 2WPDA 1NVUQ 1SZPA 4LYFA 3QEJA 1SXJC 4IVRA 4DIEA 3U7GA 1E4YA 2E87A 3N2IA 2ODEA 5DH9A 4HZIA 3CRMA 3VR5A 5AUPB 4IXMA 3D7MA 3UPUA 1GUAA 5CIWA 5CM8B 4E09A 1YZKA 3GEIA 1G6OA 5FL7A 1XTRA 2GETA 1HV8A 3OE7A 1NMXA 1TF7A 5H70A 2YWFA 4R2IA 3CF6R 4D4MA 2RCNA 5B57C 3VTKA 2BMEA 1A7JA 4P0TA 5H68A 4GRAA 1OFIA 4NYIQ 1MH1A 4L8GA 4DLVA 3RS0A 4C3ZA 4LZZA 4YMSA 3IQXA 3TLXA 1RYFA 3KKQA 1P9WA 4D25A 1NBMA 1OKKD 3RAPR 4LHZA 3GLFA 3QNUA 4YDHB 2X19A 3CUEF 1A82A 4JLJA 3ND9A 3I73A 1P2UA 2IEYA 3CRRA 3NC1C 3ZIAA 1KO5A 1LTQA 2XNDA 3B2EA 3B1YA 3A1SA 4WAUA 5SZIA 5IT5A 1N25A 1KDOA 3EZFA 4O2LA 1W0KD 3RRMA 5DNYB 2GILA 2RGBA 2ZS8A 3E5HA 4QG7A 1YZTA 4FWIB 1BIFA 3WP1B 1FP7A 1SGWA 5GADl 1JR3D 1OPXA 5FFMA 2A5GA 2WBLC 1OXVA 3TUJC 2ZE5A 1L4UA 3EPKA 3VNVA 3GMTA 3TQFA 3HP1A 1G8GA 1U9IC 2Q9CA 3ZYCA 3U6KA 3CH4B 4UXHA 4TT3D 3ZS8A 1EFRA 1JEEA 2L0XA 3CR7A 3WHKA 1AZSC 4QKQA 1IN5A 2C95A 2P5SA 5L3QB 2G77B 4HI0E 2QGZA 2QQEA 3P4XA 1KO7A 1W46A 1AGRA 4TMKA 3PR1A 3QF4A 3LY5A 1ZMXA 1DEKA 2ZYWX 3W5IA 1YE8A 2ZJ2A 1DADA 1SXJB 4JLNA 1W36B 2YYZA 5DI3B 1NKSA 2BOVA 3SDZA 4A8JB 4RVCA 1W48A 2ODNA 1NG1A 4U02A 5H8WA 2O8EA 1XFAA 4GI7A 4QNMA 3B1VA 4ZDKA 5K8IA 4DIDA 3SBEA 4MDEA 4HUQB 3TVTA 3ECCA 1E94E 3HR8A 3T61A 1FMLA 1IXZA 3V4RA 3QJYA 3PFIA 4YLGA 1LFDB 3DMNA 1Z0JA 4ASUA 3M4YA 5DLQC 4LBZA 4P3YA 5KSOA 3WY9A 3EWAA 4EPVA 1M1YE 2JASA 2BMFA 1JALA 2GEDA 1NMYA 2W83A 4PSVA 1YHNA 3LXRA 4HLUC 4KJZA 1G16A 1MO5A 2AR7A 1C9KA 2R62A 1FUKA 3BAFA 1OXTA 3TKLA 2EFDB 1NLYA 1AKEA 3ASYA 2OBNA 2PL3A 2XB4A 3IPYA 1R8QA 1U98A 3VMFA 3WBKA 1E69A 1W0JD 1XTIA 4UXIA 2PBRA 4LJAA 2ANCA 4AKHA 4CYMA 2ZI4A 3Q7PA 2ATXA 2ZRJA 5AJVB 5CK5A 4WIAA 4CEJB 4UQOA 3HYTA 2QTHA 3DMDA 2J41A 4JBWA 4DZZA 5E7IA 4QGHA 4Q9IA 4JLPA 1FNMA 3T06B 3SHFA 2EFEB 1DVRA 4TMXA 1Z63A 4UJ3A 1XNJA 4H1VA 3C8UA 4PHHA 1VDZA 2NTYC 4UKDA 5FUVA 3U6BA 1GNPA 3VU9A 5F3WB 1P61B 1QBKC 4XVRA 2FSIA 2H1LA 3GQBA 4Q1AA 2YC4C 1P4SA 1U94A 2ZU6A 4JYCA 4HAZA 4I1VA 5FPTA 4XWOA 1IXSB 3THYA 4IEIA 1NSTA 5AJZA 1UADA 4YMTA 5AK0A 4FWTA 1COWD 4A8JA 4M1TA 2GESA 4PSAA 2DYKA 4G5OA 4QL3A 4CGZA 5J40A 2HYIC 2HF9A 2WV9A 4JSTA 3EIEA 4HSEA 3BXZA 5KUTA 2PEYA 1D5CA 1VIAA 3MAAC 4BZPA 1DAEA 5HTKA 2EYQA 2E1RA 2FV8A 3U61B 1E1QD 3RC3A 3VHLB 3FFBA 3SYKA 1CS4C 1Q1EA 4C0JA 3OIYA 4G5SA 2W2VA 4OQXA 2HEIA 1C1YA 1DELA 4HLDA 4AWXA 3GEHA 4Q47A 4D0NA 5DN6D 2ZVQX 3K0AB 1S9HA 1N0WA 1KHTA 3BFXA 1SQ5A 4MRVA 2XZOA 1RC8A 3LW7A 1XZQA 5TB5A 5HKKA 4R98A 1AA9A 4LV8B 1E2GA 2W6IA 4LYJA 4Z8XA 1E2EA 1F60A 2VIIA 4DLSA 1NKTA 1U8ZA 3DOFA 4CDGA 1OT3A 3EA5A 1R8SA 2KBFA 4MH0R 2FE4A 4URXR 3TVDA 5JHGB 4D0GA 1DE0A 5KPJA 1Z3IX 1GILA 4HYYA 1GRQA 3TR0A 2J45A 3OEEA 1XMIA 1L2TA 3HJNA 5FOSA 4NCKA 1YJ5A 3CO5A 3ETLA 1NVXQ 5A5GA 2XXAB 1Y3AA 2R6FA 3RRNA 2QAGB 4DXAA 3TNFA 4F93B 3T15A 3G5UA 4KBFA 4PZLA 2O8CB 4URWR 1KIMA 3VR6A 2V1XA 1ZC3A 2BDTA 1VCOA 1QG2A 1DOAA 3CW2A 3W9YA 4UNNA 1OKKA 1CULC 2H7VA 1FUUA 1E0SA 2OCYC 2A30A 2QP4A 4KV9A 4LYHA 4Z8YA 3TAHA 1F2TA 3QF4B 1TU4A 3X2SA 1K5DA 1G8HA 2VP0A 5JSZA 1EX6A 4CF7A 3ND8A 3AGQA 2JA1A 4NH0A 3A1TA 3A8TA 4GZLA 2XTNA 3U3RA 2VRWA 5KOYA 2ORIA 1YR8A 1II8A 2P2LA 4POAA 1D9ZA 4YMUA 5G3YA 3RS3A 2GRJA 1JAIA 1G5RA 1KY3A 1ZUIA 2WPDD 4QRHA 3RHFA 3LV8A 3RSLA 3SFZA 1G21E 1G3UA 3GEEA 4V0NA 4DSNA 3DL0A 2ZR9A 2F1JA 3EZ6A 4K81B 2QNRA 2VHJA 3MFYA 3K09A 4G5GA 2ZSAA 1XBTA 4XJXA 2GF9A 1G7RA 2Z83A 1XCPA 3U44B 3IDQA 2RGNC 5IDVA 1RRCA 3I32A 1S8FA 2VHTA 3E1SA 2F9LA 2ZI5A 4PC3A 2BVNA 3AKYA 2NQ2C 1Z0KA 3AM1A 4M0LA 4Z1MA 4TQUS 1NJFA 2X2EA 1BMFA 4FMDF 4TQAA 2LWIA 2XSZA 4ZPXA 2A7QA 2BEJA 5FOXA 3EW9A 4CEIA 1BOFA 4FN5A 2G83A 1E1QA 4BFTA 2GCPA 3K1JA 3MJHA 3A4NA 1ZM3A 3WNDA 2QROA 1Q21A 2WOJA 1E1RD 4GSYA 3U3MA 2FGJA 1EGAA 4KAXA 1VCIA 2ZM5A 3U7HB 4BLTA 1OIXA 2AKYA 4OHVA 4PAQA 3EPJA 4LI0A 1R0XA 5KNDA 3OFNA 4LJ9A 2D4HA 4NL4H 3SI7A 5A4JA 2CNWD 1SKYE 1E79D 2RHMA 2XTMA 4AIIA 4YONB 4HUQA 3T5DA 4NCJA 1AQYA 1T5LA 1TUIA 1CRPA 3LWNA 2ZR7A 4EFNA 3H2YA 4MA4A 1ZU4A 2O8CA 2Z43A 2IS6A 1XPOA 1X6VA 2ZI6A 2MMGA 3CZPA 4PO9A 1CIPA 1G5PA 1RVDA 2W00A 3FGNA 4I4LA 4KODA 2RHDA 1P5ZB 2EYUA 3PVSA 4FCWA 1F2UA 1NY6A 3HPRA 4PAOA 4KLZA 5AJYA 2KE5A 2OCPA 2IS2A 5HE9A 4B73A 2AX4A 1FNNA 121PA 3PUXA 4II7A 3QKUA 3SZRA 4A82A 1ZD8A 4QNRA 2OESA 4BFVA 3Q9LA 1XEWX 1ESNA 5FI1B 3PEWA 4Q03A 2JLXA 1L8QA 1SVIA 2IUUA 1SVKA 4OQMA 4OBEA 1OFUX 2OAP1 1S0UA 3LD9A 2ZRAA 3NDBB 1G8FA 4KSBA 2MSCB 3HDTA 2C77A 2A2ZA 2IYZA 4EQ6B 4CEHA 4JKIA 2JJ2D 2WICA 2NPFA 1R5OA 3QXCA 2W6JA 3UWOA 4HAYA 4AURA 5BYJA 1ZIPA 4ACAA 4M1SA 3GFOA 4C7OB 4AI6A 1W36D 2JLWA 5FBQB 1QHNA 1B0UA 3JVVA 2FZLA 2QG6A 3TMKA 621PA 5FBVB 4FXPA 4P4UA 3ICQB 4MRSA 1RKBA 4LY6A 3F0TA 5DGXA 4NTZA 2JLSA 5DO9A 1IHUA 1SXJE 4F92B 2GK6A 4TTQA 2ZIAA 1ONBA 1KI8A 1J7KA 1FMJA 3UG7A 2WWIA 3KKMA 1RRFA 1TAGA 3TH5A 1GL7A 4QJ5A 4WZAE 4R9UC 3KB2A 4XIGS 1COWA 3JZAA 3Q3JB 3FWYA 4Z1MD 3VR1A 1IOZA 4RCZA 3BS4A 2J0VA 3R20A 2FPKA 4G5RA 3NHAA 3H1TA 4HLUA 3KFXA 1W49A 4FD2A 2FNAA 1AZTA 3B1XA 4JSYA 2ZJ8A 1W4BA 4KFUA 1Z6YA 1VKJA 2AL7A 3Q8XB 1KJZA 4GP7A 3REGA 2YINC 4XWAA 1NN0A 2P6UA 1WBBA 1FFHA 4LHXA 5J4YA 5BW8A 2OXCA 5JS8A 2Z5FA 2Q3MA 1GKYA 3PJRA 1FP6A 3CRQA 5DN6A 4AYWA 1PVOA 1XJCA 4NYJQ 2G3YA 2SHKA 2ZE6A 3TGPA 3GCGA 4LJ7A 3BRWD 1N5LA 4AK9A 1Z22A 1Z2AA 4A9AA 4MKGA 4JL8A 3FMIA 4PC6A 4MGKR 1JR6A 1QHXA 4KU4A 3X1XA 4D0LB 3FHOA 4E22A 1GFIA 1E0KA 2XAUA 3D8BA 3P26A 3WHLA 1UKYA 4OI4A 3DKPA 4EQ6A 1Z29A 1G291 2GAOA 2VSOA 1MO4A 3GLIA 1IAQA 2QAGA 2ZSBA 3EARA 1XPRA 1VYTA 2ONJA 1R5NA 3VKWA 6Q21A 1T5IA 5CDFA 2D7DA 4EIWA 2BC9A 3Q85A 2R6DA 1ZUHA 1J99A 3DKVA 1UKZA 2NO6A 1BS1A 4NONA 2Y8EA 2GTPA 1WB9A 4LJ5A 4Q01A 2KB0A 2C9OA 5BN4A 4W5WA 3WRYC 1US8A 4LHWA 3OFND 5CYPA 3RRYA 4PSKA 4EJSB 4TZ6A 1WXQA 5GJWC 3EZ7A 3PCRB 1W7AA 1YZUA 1N0VC 4PZZA 2OFOA 5H1YA 4ESVA 3A1WA 1KO8A 1ZM7A 4Q7LA 4MUAA 4LV6A 1KYIA 3TSZA 5TDHA 1E2PA 4UNRA 3UMSA 1E9BA 3UG6A 1IN8A 3CWZA 3WMGA 1OHHA 3I62A 4L9WA 4DHEA 1L4YA 1ZW6A 2WIAA 2YOHA 3H0KA 3CLVA 3HYRA 4BFSA 4P33A 1HA3A 1ZCBA 4MRPA 3ADBA 1XTKA 2F43B 4TT3A 2DCUA 3FMOB 1IJFA 5C1BA 3O8BA 2A5YB 3PITA 3FTQA 3NXSA 2QT1A 2PX3A 4ZDIA 3SOPA 4LBWA 1KKMA 2P5TB 2KBEA 5GJVC 3WMEA 4LBVA 3MWYW 1D8TA 3C14C 3NBXX 3GLFE 2WJJA 5LPNA 3PEVA 5JJKA 2CE7A 1Q22A 4BFUA 5FL3A 1NY5A 1Q3TA 3C4JA 5D3MA 3B60A 4JL5A 4EDHA 2AK2A 2FH5B 2ZRDA 3CRW1 2WAXA 1Q3HA 2EU8A 4B43A 2QPAA 1II9A 4D4LA 3CX8A 4B3BA 2AXPA 4JBYA 4JLOA 1GDDA 1ZUNB 1WCV1 4DDUA 3B78A 1Q57A 4RKFA 3QKRB 4D2IA 3QIAA 1JPJA 2PMDA 1VG9B 1M7HA 4DDTA 2ZAMA 2GJ9A 3IEUA 1EG7A 2RGAA 2C99A 2CJWA 2QBYB 4ZO4A 4IVQA 3AH8A 3RWOA 4WW0A 2GXQA 3ZDQA 3IUYA 2QAGC 4B71A 2HUPA 4G1UC 4KLNA 3CNOA 2WMOB 5CITA 4P4SA 1E9CA 1ZRHA 4Q9LA 2H16A 4AYXA 1T0HB 2OE2A 1SVMA 1UEJA 2KSQA 4JLMA 3I5XA 3RNLA 4NCHA 4IFBA 5E3HA 1F2UB 3QEOA 4Q9HA 4JZKA 5D3MB 1SXJD 1CR1A 3S1AA 1II0A 3AVPA 4ACBA 4EAQA 3QXSA 1G3QA 4BECA 1XXHA 3K70C 1II8B 5JHHB 1DAGA 3U3KA 2D3WA 5DYIA 2XB2A 3BH0A 4TL7A 5CDFE 1E6CA 3S1AB 1MO3A 4L15A 1Z5ZA 3U7EB 2WTUA 2QPOA 3BE4A 2LCFA 5CYOA 1GOTA 3GLGB 1RJ9B 1Z6AA 4DEYA 4ZI3A 1W0JA 1ZD9A 3JZMA 4PO1A 2P6RA 3RC8A 5TV2A 3L8YA 3FKSD 2Z6VA 1Z2CA 3QXXA 3B1ZA 2ZETA 1KJYA 2B7CA 1MRSA 4DWJA 4E07A 1EFRD 4AG5A 1NVVR 2GXSA 3PV0A 3GJ8A 4IJMA 1DAKA 2KI5A 4NCIA 1B23P 2QI9C 2QE7A 3IILA 3A58B 3WRXC 2IS1A 2D06A 2ZRIA 5FBRB 3E2IA 3BGWA 2Q3HA 3R8CA 4A2PA 4V0KA 5HPYB 1TUEA 2GEVA 3MWKA 5DE3A 1M7BA 2PZFA 2XTZA 4YXWD 2J1LA 1XEFA 1XCGB 1M74A 1GIAA 5C2JB 1KI3A 1IONA 3CH5A 4TL6A 4RZUA 3ZVMA 2BHRA 2IYQA 2IYLD 3IKJA 5EP1A 1QHSA 3MCAA 2G1KA 3FDIA 3U7FB 4OJKA 1BH2A 2BM0A 4RZXA 4C0HA 1NIPA 1N6RA 3SN6A 3A4MA 4HLQB 3IHWA 2WM9B 4IOJA 4B2IA 3NH6A 1UEIA 2O0KA 3D31A 5EXPA 1KY2A 2J0UB 1XMVA 2EFCB 4PPFA 4JT4A 3TK1A 2QUZA 721PA 4GOKA 5GJBA 1E9FA 1XCMA 1GKUB 1ZYUA 1W2GA 4Q1BA 1G1MA 2FJUA 4LRWA 3BD9A 1X1SA 1TTTA 3K0FB 1G4UR 2CNWA 2C78A 2ZUBA 1G5TA 4RFSA 2ZSDA 4LJ4A 1A2BA 3T1VA 3C5HA 2QMEA 3N70A 5EE5B 2FG5A 1KDPA 5EJEA 3SYNA 3U3OA 1NBME 3QSYA 5FPSA 4CRWB 5BWMA 3CPHA 2XJ4A 1WE2A 1EFTA 4LGMA 2BJWA 2R6GA 4M1YA 4ABYA 3SR0A 5AUOB 1JBKA 1E2FA 4MYTA 2F6RA 5FOWA 4GMXA 3Q5EA 1SVOA 8OHMA 1M8PA 3AV0B 3T1OA 1KSHA 3CNLA 2PH1A 2ZREA 2OSBA 4MYCA 1H65A 3DDCA 2CK3D 4NP6A 3SEAA 4DLXA 3THXA 5DHAA 2A5JA 4FCVA 3AVWA 3DEFA 1VCNA 2VLIA 3AUXA 4B34A 3C7KA 5C18A 5DYGA 3THXB 2O5VA 1A2KC 2DFKB 4B6FA 4RKEA 1Q1QA 1VPLA 4JT2A 1E2MA 2XNSA 3WYFA 2IX3A 4KBGA 2UZ3A 4GP6A 4PZYA 2ZYTX 2EWVA 2ZJZA 4Y0VA 4QBHA 2FEOA 2N46A 2NZ8A 3W5JA 3WMFA 3VX4A 4DRZA 3UMFA 3FB4A 2OHFA 4BE7B 4M1WA 2GZAA 2QM7A 4HB3A 2IXEA 2X77A 1W44A 5JEEA 1IBRA 1DTSA 1AGPA 2WOOA 1Q20A 4QHSA 2ZS7A 4YQFA 4TMTA 2B92A 2WMNB 2DHRA 3TBKA 4HUTA 4Q9JA 5CLQA 4GOJA 1W2HA 3AF3A 2CL0X 4V0ME 5HZKA 3CZQA 1Z83A 4ON9A 4A36A 4A4DA 2FGKA 1TMKA 4QJ4A 3ZJYA 1E2LA 2UKDA 4OYHA 2IF2A 3QQ5A 3QVUA 1FQKA 3KUCA 3K70D 4W5HA 1FX0B 3GJ4A 4LJ8A 2P65A 2YWGA 2ZITA 3PIRA 3BFVA 2D62A 5E7MA 5FTJA 1EFUA 5HCNA 5UKDA 3UXMA 1VMAA 2WHXA 4TTRA 3TQCA 4LX0A 4O25A 4Z51A 4D6PA 1FPMA 3EASA 3L0SA 1PLJA 2IYVA 5J4VA 5DIFA 4M9XA 3O8DA 2I4IA 1OE0A 2QGNA 1XP8A 2DFTA 4F91B 2YOFA 4WZ6A 1HUQA 1N2CE 2V9PA 4MYHA 3QKSA 5LB2A 2WWYA 3OEHA 2YWEA 3EA0A 4OI2A 5F2EA 1TX4B 1KTVA 3TW4A 3FYHA 4FINA 1FQJA 2OM2A 3KX2A 4PR0A 1W4CA 1F48A 3K9GA 5JMTA 4LBYA 1DAFA 3NC0C 3QUSA 3R9XA 1KSFX 2W2TA 3EC1A 2FFBA 1KMQA 1G7SA 1CJKC 5DI9A 3CKLA 1K5GA 2GKSA 3ICEA 3BK7A 1ZU5A 5DISB 3QVVA 3K0FA 2G1JA 3SJBA 1WDTA 3WBJA 1SHKA 5EP2A 2VO1A 4RFSB 3ZZUA 3KQKA 3NTUA 3CONA 4C30A 5JWOA 4A15A 1NRJB 3LX5A 2PMKA 5JWHA 1E2KA 3GFTA 2QEQA 1CP2A 1OH6A 3UATA 4R2HA 4M1KA 3R9IA 1D6JA 2FOLA 4LYAA 2HXSA 3G0HA 4ZIRB 4HLCA 4PFSA 1CRQA 4HZUB 1WQ1R 2W2XA 1Z6GA 3EIHA 1MABB 1E79A 5CIQA 4ZI2A 4TWZA 4JJZA 3I61A 3OAAA 1AS3A 3THWA 4ZIRA 1P72A 2CMKA 2JDIA 4OI0A 1PUIA 2DWOA 2QL6A 3EZ2A 3CF2A 3NBYC 2ZRBA 4TLDA 1X8JA 1Z06A 3AP1A 1QG4A 3U5ZB 5KYKA 5L3RA 3EZ9A 2IHBA 2RKOA 3HU1A 4L9SA 4OJQA 4WOPA 2ZRGA 1KK1A 1P3JA 2MMCA 1FOEB 4AY2A 3TAUA 2RGXA 1P9NA 4O2RA 3CWQA 4PANA 4DSTA 1KK3A 3CB4A 2A5FA 2MSDB 2QY9A 2IXGA 2GDJA 2ZANA 4ZDWA 5GVSA 2FWRA 4BLRA 4ESHA 5AJWA 4B6EA 2EVWX 1R10A 3TRFA 3AKEA 5SZKB 1DBSA 4OKSA 2J5XA 3L82B 3OZXA 4KFRA 1Q44A 1OH8A 2KJQA 2ZVPX 3C5CA 4RZ3A 1E2HA 1G6HA 1JXMA 4JLBA 2X2FA 1UPTA 2W6JD 3CX7A 3IBYA 4LK2A 3RSOA 2WJHA 4WVFA 1WRBA 3W90A 3THWB 2FPMA 1AIPA 4QGFA 3DO6A 1KI2A 4IOLA 4LCBA 2DWPA 3LAWA 4NMMA 5KDOA 4H1UA 3X1DA 3MMPA 3W6NA 3GJ7A 1I4DD 4C2TA 5AR1A 2H8KA 2ZJBA 2HDNB 2IA5A 2H17A 1SHZA 1P7CA 1KI4A 2AXNA 2Z0MA 3K0SA 1CLUA 5KHOC 2WKQA 3VR2A 4IXNA 4IDQA 3T12A 1KAGA 2HXYA 1U81A 4I1SA 4DLZA 3BC1A 4HB2A 2AWOA 1N5KA 4M9QA 3SBDA 3PXGA 3W3AA 1I2MA 4F4CA 2JJ1D 2F3TA 2HV8A 1WMSA 3L43A 3QPUA 1H8HD 1YZLA 5FI0B 2P3SA 3VAAA 2IK8A 5L8VA 4X8LA 3LVRE 3N5CA 1ZCAA 4C9BA 4Q48A 5FPHA 1KI6A 4FMDB 2FPLA 4A6XA 4A0GA 1T3LA 3GLHE 4DCTA 2PJRA 1GWNA 2WVJA 1OH7A 3G82C 2PCLA 1XDBA 3QBTA 3AVYA 4PO8A 2ERYA 5EUQB 3K9HA 1KO4A 3GLGE 1TNDA 1LVGA 1P2SA 1TF5A 3PG5A 1QVRA 4XOIA 1A4RA 2PLFA 3LRPA 4JVSB 5IK2D 5KNBA 2JLZA 3N2EA 221PA 3D6TB 4TZ0A 1TF2A 2GJKA 2VHQA 2QTVB 4TMWA 1KNQA 4QBGB 4URYR 4EPTA 2IUSA 2IF0A 3EWSA 5KSZA 1RW4A 4NZYA 3HWSA 1GITA 3E70C 5GJCA 4EPYA 2YV5A 1OXSC 1E2IA 3KZ1E 1N6PA 2WJVA 1CF4A 1JQLB 4PC1A 3EPLA 2VP4A 2VTKA 2VSXA 2OBLA 4ILEA 4E03A 5F98A 1XD9A 4NYJR 5IK2A 3CRVA 3KKOA 1G8YA 4Q4AA 2FFAA 2ZSFA 2VF8A 4N3NA 1QDEA 2ZQ5A 5ANRB 4LV5B 1HE1C 3M6AA 3SYLA 4Z54A 1FW6A 2RH5A 2VQSA 1X1RA 3RS7A 1BO6A 4Q1CA 1E1RA 1HQCA 5CB6A 4PX9A 1LB1B 4G5QA 3EPHA 4I81A 5FPYA 4QM6A 3Q72A 2JIZA 4RD4A 5CLLA 2GEUA 2WSSA 2GHIA 5EZ5A 2D74A 3V00A 3ZS9A 4BLSA 2B8TA 2CE2X 2JLQA 2V4ZA 5IF9A 3T1TA 2YJTD 3P4YA 2AWNA 2ONKA 2QAJA 1P62B 2Q3FA 2I1VB 2BV3A 1D2NA 5JSZB 4GFDA 1Z6XA 1F5NA 2V1UA 2G88A 2GJAA 2QRZA 4D80A 4ARZB 1R0ZA 3QE0A 1SVSA 3GLHB 4RCYA 3NKVA 2IEZA 2PT5A 1P75A 4TL8A 3C41J 5EE3A 3O8RA 1QHHB 2XOKD 2NG1A 2R6CA 1U0LA 5FBWB 1U8AA 1JB1A 3KJEA 1FZQA 4IFEA 1QHHA 3KXKA 3OIUA 1I2DA 4BRUA 2YZ2A 1VCMA 2R8RA 1KDRA 2GJSA 3K70B 4J0QA 3VU9B 1WA5A 3WXMA 1ZNZA 4AYTA 2XZLA 1CR4A 2X8AA 3U4QA 1P2VA 4Q1FA 3FKQA 4DB2A 4P32A 3ASZA 5JFGA 2IYYA 4LWZA 1CJVC 2QMUA 2VSFA 4YDSA 4US0R 2XGJA 4B3FX 3NEYA 3TJZA 4IEEA 3NDPA 2R6AA 4IDNA 2C5LA
chains in the Genus database with same CATH superfamily
4MMXB 4XR9A 5C0OE 3ESYA 1L7VC 4I0WB 3SX4A 2HJGA 4DLUA 4I6GA 4NEQA 4TLEA 1G41A 2M1XA 4LDQA 1DB3A 4CF3A 5GAJA 5KNCD 4TKVA 1DCTA 5H81A 2ZI9A 1U31A 3I8XA 2PWPA 5D7NA 1E1NA 2QIOA 3SMQA 3FI9A 1TADA 5CB8A 1VG0B 4WK6A 1I10A 1NWCA 1MG0A 3DGEC 4IVPA 5K3FB 1N8NA 1T6YA 5K8TA 2QJTA 1IIRA 2HXGA 4O8ZA 2WW8A 4PAMA 4RTQA 4GDFA 1NTRA 4CIXA 1F0KA 1W5TA 1M72A 3WA7A 1XA0A 1E3JA 2CNKA 2RC6A 1SOWA 4IKOA 4MWTA 4RHYA 4BEJA 2A86A 4X7MA 1IY1A 1IMOA 4DSUA 3LOQA 4QPDA 5JVDB 1JWBB 2R7MA 1IIBA 1S02A 3QI2A 1HZJA 2AX3A 5ALZA 4EP1A 1PZNA 3E7PA 4QGGA 2OO5C 4G24A 4PXAA 5AW8A 3EXIB 3QEBZ 2G8LA 2Y0BA 3GJ6A 5CD1A 3WQBA 3ZHTA 1UJ6A 1EG2A 2JIPA 4KN5A 2Z4SA 1Y3HA 1JXAA 4B33A 1SBIA 1NQAO 1Y9EA 3EVTA 7ABPA 1PJ4A 4GOND 5LQUA 1R6XA 5JBQA 5ALFA 1DIOB 2H54A 3WYCA 3VPAA 4JC8A 3HVUA 1A7UA 5D51S 2BHTA 1YR6A 4R3UC 4JXKA 2A8YA 4QHYA 3CR8A 4CW7A 2W2LA 2WWXA 1EXNA 3NHFA 1UEXC 1KJ9A 1BWRA 3ZDRA 1B26A 3DGFC 4Q4AB 4N0EA 4BN0A 4HK4A 2Q1UA 4DJJA 2QX4A 3OLXA 1Y8AA 4D98A 2NYAA 4P38A 5BRAA 4P1ZA 3E5NA 2R86A 5CIYA 1CUGA 4CFSA 4KTTE 1OBOA 3S55A 4ENPA 2RKBA 3ROQA 1S4MA 4F3NA 1JHPA 1XUOA 2V5VA 1ZJ4A 3MS4A 4OA5A 4DB4A 1S8OA 3FVVA 2G9NA 2QE6A 1T26A 4MVJE 5B2ZA 5L53A 1M1NB 5A9SB 1N6KA 1X7ZB 2FG6C 4EGQA 2WABA 4ANFA 5CLFA 4NPAA 1K9SA 1TZMA 2QLJA 1XROA 2C7OA 4KPUA 1AK9A 4TL9A 4BU1A 3RVSA 1D3AA 4RLHA 3PRHA 3MIZA 1PJQA 2WAYA 1FUIA 2INGX 1GL6A 4CTOA 3LDUA 2DE0X 1L8XA 2QP9X 2VJQA 3AERB 1HXHA 4HD8A 1NC1A 1XL0A 4YI3A 1WNFA 1YI1A 4YIHA 3DBRB 5GONF 4QTXA 1W0KA 3VTZA 1Q1AA 1GQQA 4U1RA 4XD7A 2Q2WA 5TMBA 3LDHA 1O58A 1IATA 2D5AA 2NO1A 1XB2A 2HK6A 4XWGA 2OOKA 4PQYA 1E2NA 1L3CA 1F6DA 1VTKA 4NZMA 5GVRA 3ZY5A 2WSLA 3LW8A 3M5WA 1BWPA 3LP6A 3ILYA 3TINA 4UARA 5IX8A 3LZ6A 3KUUA 3SC3A 5EKSA 5KNCA 1TQ4A 3EMBA 4RANA 3DB2A 1P4HA 1WJGA 2R97A 3S5JA 3J81k 5KTMA 1W4ZA 2OLJA 4U00A 1K8QA 3U37A 3MA0A 4NFLA 5ALQA 1J9ZA 4RF4A 4UHDA 1Q84A 4OI1A 5F9HA 4U7DA 1JFTA 4D81A 5BN1A 2ORWA 5AIAA 1YJAA 2XXJA 1M10A 2AHRA 3QMPA 3IAUA 3Q9SA 2WWGA 1KQ3A 1P0CA 2JARA 3BFJA 4PLHA 2DWUA 1U65A 4IG4A 2GH1A 1C4WA 4UMFA 2IP1A 1HNNA 5FRDA 3B51X 3RDPA 1E99A 2Q1YA 4JSRA 1U99A 3KZXA 4QFMA 4DMKA 1MU0A 1QAQA 2VHCA 3BDVA 3RS9A 1YS4A 3PRYA 4ZDJA 3B3FA 3B53X 5LP6F 1XWFA 1AQ6A 3DBRA 3HCNA 4ITUA 1BEZA 3AW9A 3BFKA 3W04A 4YH1A 3O1LA 3JAKA 2IZ7A 3R9WA 1V5WA 2FW1A 2B2XA 3KYDA 2CFSA 2A35A 4DA4A 5EXXA 1J70A 2HD4A 2ZRCA 1MRNA 1TD9A 5IZCA 2PGXA 1EDDA 4DEVA 4X8HA 5HQ3A 4MGEA 4PPQA 1N6OA 2X4IA 1MCZA 1S3GA 3G02A 1K0UA 5FPPA 4BNZA 4COOA 2QIPA 3BB3A 1BWSA 4UNQA 4XD7D 5CNIA 3UAGA 2F3RA 3ENZA 3DHYA 3LIPA 1JYFA 3AB8A 4IDBA 1BXRA 1GNSA 5FH9A 1UINA 2NWQA 1DJOA 4M1EA 4NSNA 3QVSA 3L4EA 1RYZA 1C3XA 1Z7YA 1JBEA 2I78A 3OHMA 1O3YA 3T9CA 3BG5A 1Y3CE 1UBSB 2B9VA 4B40A 1PEDA 2XVMA 3DR3A 2OSVA 1TYAE 4ZU3A 4HFRA 4V1CB 4XSHA 2VNJA 2C9DA 3GRCA 4KSYA 2GN4A 3N2NA 2ORED 3QVOA 4ZYYA 4AD8A 4BKPA 3PPYA 4J1NA 4QOEA 1HSZA 3VHXA 2Q5QA 3WIOA 5CFNA 4C01A 4A3SA 3RIEA 3ORSA 5ECGC 3ZE8A 1ZXXA 5AESA 3EC2A 4UBNA 2NZYA 4O2AF 5BMVF 4OBXA 4AJ4A 4UREA 3MQ2A 2ZVDA 4EA8A 1JVNA 1YASA 1I7SB 5L3SB 4BL5A 4RW0A 2R47A 2AMLA 2NXJA 4LF8B 5TJHA 3OLCX 3OSUA 1GT6A 4HH0A 2D1QA 1D2MA 4EKEA 3ESDA 4RD6A 4NC9A 1CVIA 821PA 3S3TA 2A0FA 2EL9A 2YWBA 5BV7A 3KWLA 2V97A 4Y2UA 1VP3A 1N0HA 1X19A 1ZM9A 4BMNA 1OB5A 2FPSA 1QRRA 1W36C 4YJ2A 3UJ6A 4ETIA 3IAS6 1NJ1A 1NKVA 4Q7MB 3QUQA 2VJDA 4IDFA 1E2DA 2H1OA 2G6TA 5P21A 2RGCA 3A4YA 2PXAA 5KQPA 5DP2A 5AKIA 3UBTA 3PEYA 1JIQA 1UT5A 2LCIA 2POCA 3QZUA 1R1DA 3BMCB 3VZQA 4W5JA 3ETGA 1DC6A 1BE8A 5HF6A 2GZ3A 5E6SB 5FUMA 2NP6A 2AIRA 2JGKA 3X1YA 5LQDA 4H18A 1A2OA 4UEKA 1OVGA 1TK9A 1NUQA 2C31A 5MFPA 3IPRA 5CA0B 1IPFA 1XJQA 1Y5MA 3FHJA 3HRIA 5ER6A 4WKPA 4AJHA 3ZGXA 2WP0A 4FDLA 1GPKA 4UDNA 2GFQA 3MYYA 5BXYA 3V4OA 1QOPB 1ILEA 4JUIA 2LDXA 4FSXA 1HE4A 2F3SA 4I1IA 4MSUA 3RFUA 4ZVQA 1XNQB 4ZJPA 1IB6A 4DCSA 2GZ2A 2AXQA 3CLTD 2IXTA 1TL7C 3MLEA 3I9NA 4EUNA 3Q10A 1T2DA 1FRVA 4WMLA 4RJ2A 4URHA 4DIOA 2QBYA 4UM9D 2G28A 1LV7A 4RMNA 1GGKA 3DAFA 3VPDA 1ULBA 2GCOA 5CM9C 3AEQB 1YU6A 3U48A 2Q6TA 2ZT8A 3RTBA 3L04A 3UAWA 5HM8A 5IHXA 4HX5A 1J8MF 4E7OA 1BRMA 2JCSA 3LDAA 3RU2A 4EHFA 2ZCJA 1JJFA 4FKBA 2FR8C 2P2SA 3L8FA 4Z9BA 4D1YA 1IUOA 4PYNA 3F98A 4E94A 3K31A 2DC1A 2IYSA 3DM9B 4C88A 1VL1A 3GCDA 3KOZA 1VE6A 1AN9A 4PN3A 1U3DA 4ARZA 1XXHB 3BIFA 3PI7A 3BWCA 3V97A 2LE0A 3C15C 3DO8A 3VHRA 3BGOS 3IUEA 3GZJA 3WS7A 4UHKA 3MEQA 4UTZA 2W8BA 1AUXA 1J2YA 1RLIA 4KBYA 5G02A 4Q7EA 4GRDA 5G0UA 1AGYA 1L7MA 1XEWY 4XQGA 5GWXA 2H85A 3DBVO 1KDZA 3WK6A 4AMYA 4DLTA 1TUBA 3DXXA 2DFVA 3I0ZA 4F06A 1JVSA 2PSDA 1GZ3A 3PPXA 5EXDA 2I7TA 1RDFA 2R96A 1Z4PX 3KJHA 3K0AA 3UM9A 4OOEA 2Z08A 2Z98A 5H7XA 3KQOA 2EJBA 1AKMA 4YRTA 4F3YA 5LDDC 3KJXA 3FAZA 4NI5A 3ZOKA 4KFTA 1ISPA 4URZR 2P3QA 1KMCA 1UZMA 5B2EA 5C37A 3Q8MA 2P6NA 1VCHA 2E89A 3ZHCA 1QWOA 1AO0A 1ZOLA 3N2KB 1U7OA 3CX3A 3OCXA 2C8VA 4R6WA 1HM5A 4K26A 1C50A 4NCXA 4YRRA 1PCXA 2ZPTX 3OQVA 3BIJA 1UBNA 3U44A 3BFPA 4DQXA 4KQ6A 1AB5A 1E1YA 1ZXBA 4MCAA 2G4CA 4TWJA 1QP8A 1XPOA 1V4VA 3AIIA 2MU1A 4RM2A 4QTYA 1IN4A 4BLOA 4J29A 3HB7A 3OCVA 3MS2A 4ZPJA 4TN1A 1US8B 4MWCA 2BZGA 4XIJA 3OJFA 4JS0A 4PWZA 5ED0A 1ATIA 2AOTA 5TQJA 4DJAA 4W9RA 4EI2A 4RULA 4RJTA 3TLYA 3O8QA 3Q9NA 4RAOA 5B4TA 1RJGA 1ZC4A 1ZGBA 1KEUA 5F64A 4JJ4A 3LTNC 1CZNA 1WZCA 4TTVA 4DDMA 2FMFA 4B75A 1LV8A 4D92A 1OXBB 3IDOA 3D4NA 1MVLA 3NATA 2I1QA 1DDIA 2VPPA 3KEGA 2HU2A 3U40A 1OZGA 2VXCA 2ZIVB 3KDAA 3EK2A 5ALGA 3L0PA 3UT5B 4IHQA 1ZH4A 5EQDA 5EIEA 1IZ8A 3CLUC 3GDGA 1BDHA 3PQEA 5B58T 4BN4A 4D9HA 3GEDA 5BR7A 5I4KA 1Z7EA 4JVLA 4LHYA 4IUBS 1Q14A 4I8IA 3V7UA 1Y80A 2YWXA 2E2WA 1Y5IA 3CWCA 1QQ5A 2RCYA 3HABA 3AF2A 3OX2A 1XU9A 1PLKA 2ZBVA 5T4BA 3JSAA 3MWLA 1MXHA 4BGUA 3VH2A 4AKEA 2W8BB 3KSMA 3C7DB 1EM6A 1OHHD 2GCGA 2PX0A 4I4TF 4B2PA 3H83A 2CMFA 4PLCA 4BUCA 1NW7A 1WSAA 2KS6A 2QU8A 1Q7RA 1FSGA 1TUBB 3FVQA 4IDPA 4PO3X 4XW2A 3MGAA 4QXPA 3TSOA 4DWOA 2XYVA 1OTYA 3JQEA 4FEGA 3R3YA 4LXHA 1ORRA 4WINA 1JEDA 5FTKA 4ZC8A 1F8GA 1ZIDA 1P39A 3BCHA 3NHJA 1IQPA 5IU6A 3BUSA 2CFIA 1DBPA 2M6RA 3COWA 2AB0A 3JASA 4TV9A 2FN4A 1N1EA 2HA2A 3O4GA 1KK0A 4P4TA 3P9XA 1WUYA 2ACWA 3IODA 3QENA 3QKRA 3N2KA 2FFRA 4FFSA 5E1DA 3UKDA 3AT1A 2Y71A 2EC5A 3PENA 3TSWA 5KSYA 3ER9A 5HYVA 5K0FA 1UXKA 1N2GA 3E9ZA 3MWJA 2HT1A 1KF0A 2PRZA 2Q0HA 5AKYA 3EVEA 3TIGA 1O5IA 3VO8A 1RBMA 1X86B 3L1VA 1Q0RA 4DNQA 3PNQA 6LDHA 1E1KA 3V1TC 1Y1RA 2CL7X 3VZSA 3LPMA 3PHGA 1VJ0A 4O2BB 2HLPA 2NGRA 3SDSA 3NYWA 4WKOA 3K8QA 1BCRA 3CNNA 5LJLA 4L5JA 4TS1A 5A3RA 3WBFA 2WU0A 4HNHA 2E0IA 4DSAA 4DKJA 3VH4A 4XZ3A 1YB1A 2K5UA 2RHCA 1UANA 3ZZNA 1PGQA 4RLFA 4CLHA 5AUQA 1ACLA 1PR2A 4HQFA 4D3DA 1OB2A 1JKFA 4QUDA 2BCJQ 1QUFA 4DV0B 3HSSA 3PPVA 3BE5A 3WKCA 2VP9A 3R7WA 2W6MA 2O7RA 2CHQA 3KNZA 5JOQA 4HG2A 2O5EA 1I6KA 1QG6A 3KUDA 2QHXA 2QVYX 3O4JA 4P58A 1UM9A 3LGAA 4Q7KA 3W6PA 4GQBA 5ADWA 2FPGB 3D43A 2KW5A 3EEYA 4GKAA 3E5MA 3UT6A 4DLRA 2DFNA 2QD3A 2ISCA 2RGEA 2HW8A 4DLAA 2V3CC 3KQLA 3D8UA 5AVSA 5IXYA 3C7TA 2MINB 1GLNA 1QVAA 2X8JB 4DLLA 4EO4A 1TVEA 3CNQS 4MWZA 4N01A 4PR3A 1Z15A 5K3AA 1T1SA 2JH9A 1LRLA 3BWXA 1G6KA 5I3CA 4M8SA 3L77A 1ZBQA 3WLNA 3T7AA 3INTA 4EENA 5IJ0A 1P0QA 3TN7A 2E4AA 2TRSB 1JB9A 3KOMA 1LLCA 4QM7A 1LNSA 2PH7A 1Q7CA 1CJBA 3EGDA 3RABA 1D2HA 2BZSA 3MF4A 1GFWA 1CTQA 3BL5A 3BWDD 1MXFA 4BRZA 3ZJVA 1XEXA 1V35A 1C4OA 4D46A 1YB7A 2XUHA 2Q6VA 3ABOB 3TQTA 5JAHA 1UPXA 1NJGA 4CL8A 3GOQA 1QNLA 4JAVC 3V32A 1NQOA 3PEEA 4XX0A 5KS2A 3MRTA 4NBUA 2ZOSA 5CVTA 3EG9B 4KWTA 1RC1A 2J7PD 3BD6A 2IYRA 4UBLA 4BKRA 1EX1A 2NUAA 2B78A 1YC2A 2P78A 1W2WB 3V8VA 1K7FB 1IBCA 3RGWS 1Y3FE 2QRPA 1YS2X 1SB9A 2WSMA 3FLEA 1YIDA 1JI0A 3B82A 2F7SA 1Z08A 4ASUD 1T0IA 2GASA 1MVOA 3U60B 1QPZA 2RSLA 1DKRA 1SJ9A 2N3ZA 1SUSA 1NVBA 3BE8A 3OFJA 3OCCA 1GQ2A 2JLCA 1M2VA 1U2RA 3BYZA 4N3GA 4O5OA 1JG2A 1P5RA 1ZH6A 2G0AA 1TCCA 3UK6A 4F4HA 1YI8A 2GPBA 1NP3A 1U8TA 1CHNA 4UTRA 3HH8A 4RVDA 1U8XX 1VRVA 1VE9A 2V7PA 5M29A 1EA7A 3LJKA 3GA5A 1YKSA 4H4CA 3ITEA 4RXMA 3GIWA 1LF0A 4DIFA 3H3FA 4B2LA 1DWOA 4C3UA 1C3VA 2JI9A 2UZ1A 2P2YA 3PHIA 3CZ4A 4Q4JA 1KERA 4NVRA 2L18A 1XEXB 4O5AA 3A2MA 1WXWA 1ESDA 4IOMA 4MITA 2GN2A 4QYTA 1JJAA 4D97A 2GFIA 2HQ1A 3JPWA 3IP9A 2OZLB 3B20A 4XYGA 2QRKA 4LTNA 3W7VA 3OZBA 4CDMA 3H65A 4KXNA 1XTQA 4IIUA 5AVKA 1LBTA 3EQ6A 4R7ZA 1E3EA 1S2DA 2PZEA 4HWPA 2E4WA 1TM4E 4GT1A 2RDMA 1KP3A 2WE8A 3EN0A 2WZBA 3K4PA 4UHHA 3W4KA 4A7PA 3O2SB 4PLYA 4S35A 2H5EA 2JK1A 2JZCA 4W1PA 1DO2A 4M53A 5L3VA 3H19A 5T5QA 4B3SB 4OL0A 3V8RA 2ZTSA 1QO0A 4FZJA 1L6RA 3FNEA 1VHTA 1FXWA 3W78A 1X1AA 2TECE 3OLZA 1INLA 2C9ZA 3PGKA 4IKEA 4LZJA 3T0GA 1VJ5A 3N2ZB 1A4UA 4EJSA 4F38A 4JVNA 5EYPA 2JJ8A 4BZWA 1AD2A 5DX1A 2AZTA 5A2QA 4BTEA 2JEOA 2ZUUA 4IDCA 3LVQE 3N5KA 3NJ8A 1U02A 5DLDA 1KFJB 4XUDA 1Z7WA 4RPGA 1FJGB 3D64A 5FP0A 4BNMA 1XTJA 2DUJA 3R23A 1M6NA 1WXDA 2OFXA 1SZCA 2PPLA 3L6DA 3OZSA 5THQA 5FUYA 3TZBA 3WGUA 1ST2A 1JH8A 4RK7A 3F8TA 4MPRA 4ZCMA 5JAPA 3G3EA 5A3VA 3V4FA 5EUCA 4QTTB 2V6IA 3ZCPA 3H2SA 4XWWA 1QGAA 4GWLA 3DBIA 1FU8A 3CB2A 3KDPA 2OD2A 4WNAA 3WNZA 1T8RA 2ZSEA 1DWQA 3UCEA 1P2BA 4EMTA 1T43A 2ZIUB 1N7HA 2GWRA 4EHAA 2FMUA 1L4MA 3WIUA 2FUNB 1VYVA 1U4SA 1ZAKA 3MTJA 3SF0A 4CKWB 2QA5A 3FNGA 1K63A 2W6CX 2QTAA 3LT4A 5AM4A 3RRXA 3CCFA 4XQCA 2Q9AA 5EFOA 4CKYA 1ZKMA 1NU8A 2GN6A 1GG5A 3C6BA 4R0VA 4S12A 1U90A 2ZWIA 4FJ0A 4GZMA 4MKZA 5LDGA 3ENQA 3M0EA 1H9BA 1TLFA 4G5YA 2ARKA 3B9PA 5EINA 4MYDA 4YVFA 2PH3A 3CLKA 2FSGA 2FWIA 1OGYA 3MGKA 5FUBA 1H5QA 2YASA 4MV8A 1PYDA 1QCDA 1GUFA 1FTSA 2B0CA 4FCTA 1GNVA 3R7WB 2VWGA 1G4AE 1G3IA 2BP7A 4PHCA 4UOEA 3R0JA 2LKDA 1QCYA 5GZ6A 2H0QA 3BJRA 5E2IA 2FTKE 2IOFA 3B6JA 3HKEA 4R40A 4JDUA 3TL3A 5FPKA 3TOVA 4PTZA 3S2GA 1ZVJA 1GY8A 1SQ0A 4TS3A 5CNMA 1NQVA 1T91A 3F46A 2QW0X 1ZP6A 2R7KA 4BZQA 2XODA 2YW2A 4EKGA 2OUKA 3QU5A 1KO1A 2RHTA 1WKCA 4NBSA 5EP3A 4NZNA 1XRMA 2P8JA 3AUYA 3IA2A 1RPTA 1RE1A 4RPCA 1ZONA 2ZYDA 1LSOA 3EAQA 5ESRA 3GFGA 3KQNA 4U39A 1B8UA 1FTNA 1RHMA 1UZLA 3HRKA 1V6AA 4YQZA 3L0BA 1M1XB 2FSFA 1XTPA 3IXLA 5FORA 2QX6A 2WPNA 1DG3A 3CZCA 1E4VA 3QEKA 3EH2A 4G67A 1E0AA 3OPXA 5LCXA 1WWKA 5BV2P 3PNKA 4E5SA 2JCXA 2RE8A 2IZ0A 2QX7A 4EB3A 1DWUA 1S2OA 3FW1A 3MCZA 5JALA 1ZOOA 2E9SA 4GOXA 4LNUA 1HZZC 2IYFA 1U0HC 3DDUA 3USZA 2A7XA 4H15A 1DC7A 1WQ3A 1U1FA 4BP9A 3UIEA 1UJ2A 2GTHA 3S28A 5F7ZA 3W6OA 4FFWA 5EWMA 1A97A 4JOSA 4QHTA 4HAVA 2F00A 3TOCA 1GYPA 2GNAA 2BMJA 4AECA 1R4AA 4C6TB 2PGNA 1SG6A 2CEAA 3I53A 1EK0A 3LBNA 1PO7A 5NULA 4DZRA 1YJ8A 1EIWA 2Y6UA 3DFUA 4HGPA 2XDQB 2G9VA 3DZDA 5CG2A 2IYOA 3AMVA 1ADFA 2VP6A 1PQPA 1FRZA 1U7XA 2CC2A 1YTLA 2W6ID 4X6UA 4MUBA 1EI9A 1RC0A 2ZJ1A 3VNUA 1E7YA 1OWLA 3IEXA 3K09C 3KKNA 4K9KA 4MVJH 4B3DA 3CKMA 1ECFA 5B1DA 4CMIA 4DCUA 2WIJA 3HR7A 3VZDA 3W8FA 4GNKA 5G53C 5HX7A 3OA0A 2ASVA 1SAYA 2G9RA 2WJGA 2AF3C 3AEUA 3ICPA 3AVTA 5T3YA 3P32A 3PC3A 3ZC3A 1IVYA 4AWBA 3KQMA 1G20E 5FLYA 2GZDA 2P90A 3ASUA 3UO8B 2GKGA 4U8HA 3DP7A 3UK7A 3GJSA 1LQUA 1P6XA 3BDAA 3H3XA 3FOFC 2BR3A 3DHEA 4K7JA 1ECLA 1I3CA 1ML4A 4CV2A 1W7AA 4PPNA 4IGIA 4O4IB 1GL9B 2H65A 2VT6A 4HXFB 2ZXUA 3WL4A 1S2IA 4N1AA 1JWAB 1TA0A 1PJCA 5F1PA 3WL7A 1XALA 3OZ7A 4F4FA 1BMFD 4NBWA 2R1VB 2O2YA 4ZMRA 1Z38A 4MVJG 5AW3A 4CTJA 5TVGA 1RM5A 4R1QA 4TV8F 2BGWA 3UICA 3DOIA 3K53A 3KVYA 1DS6A 5FBHA 5FWAA 1GA1A 1ENOA 5H83A 5LZ5A 2EX4A 3I92A 1UBRS 3I5MA 3GUVA 4C4OA 1Q1ZA 1D2EA 3EDRA 5F9FA 3D4IA 4UJ5A 1NRIA 1LS1A 1YAHA 4Y6OA 1R0BA 3AKDA 4DLYA 3VU8A 3B70A 1PF7E 4H60A 3D7NA 4DCNA 3ZCXA 4JI2B 521PA 3W3AD 4QUBA 3AOGA 5DTIA 3R76A 1EZ4A 3TLBA 4OHWA 3V1LA 3V9AA 4BGEA 4X94A 2ZJYA 3BRSA 1FX1A 1CPYA 1TEVA 4HDKB 2XJ9A 5IDWA 3I0NA 3N28A 3L18A 5FBLB 1EWQA 4KQCA 4EY4A 3NO4A 4JK3A 1CBUA 1WZ2A 3B1JA 4LYDA 5IC4A 3DZHA 4JBXA 2R65A 1X1TA 2I2AA 2XKAA 2OGZA 2VEDA 2PT7A 4ZD6A 3D3EA 2H0AA 3NPAA 3RIHA 4O4IA 1NE2A 4A0HA 1AGNA 4YHBA 2XDQA 2JLRA 1FA9A 3EGXA 3O8CA 4OHPA 5LQMA 2HM7A 1UJBA 4HNSA 1UOOA 1USVA 5IDYA 1E66A 4PTLA 5IH3A 3ZVLA 2EZ4A 3MUEA 2LZ0A 1DMSA 1GGEA 1XZFA 3A4VA 1KDYA 1T0BA 3T3IA 1JU9A 2PZMA 4NJOA 4EG8A 1E2BA 2QVXX 5IKXA 1Z7BA 2WR8A 1TCVA 2AR9A 1GRRA 4CT5A 2R6R1 2WRZA 5J47A 4CNBA 3JQ9A 3Q1KA 1XQXA 4TWAA 2GNOA 3IP1A 2A9RA 3L7OA 4TPKA 4TV9F 4YLEA 4HEQA 4L28A 4DMCA 1PEKE 2V59A 1V7QA 1TIPA 1VLQA 3KJIA 3LUFA 4HAWA 2IDMA 1OILA 2J4DA 2IWHA 2V7QA 1GARA 1TW2A 2VH5R 4EKNB 9LDTA 4I9GA 3TRJA 1A9OA 1XQ9A 3PP8A 3QY0A 3OQIA 4N0MA 3RNOA 1NP6A 3HL0A 1ZJJA 4HL6A 3G17A 4RF2A 2WT9A 1CY2A 3E8SA 4BB0A 3PEUA 3VISA 4CUJA 1SA0A 3AW8A 4E30A 3BX1A 3M8KA 5CURA 1PK9A 4JYPA 3PVZA 1WUJS 3KZMA 2Z2YA 1XHEA 4FYPA 4G5HA 6YASA 4RE5A 4L4SA 2HJRA 3DS8A 4ZODA 3WLEA 1PZFA 5IRCD 1NJ6A 4F1JA 1MABA 1QDUA 5ESWA 4A6PA 5HRAA 3SQWA 4J9UE 1I4OA 3FRHA 3FUCA 3GD5A 4GECA 4TTPA 5FL7D 2GS9A 5LOVA 1SULA 4ZQHA 4XVUA 1YRQA 3N0WA 1CX9B 4KVAA 5K8JB 2BGIA 2DHCA 2VSQA 4WA8A 5KWJA 3S8EA 1W34A 4G4SP 4OIMA 2UYOA 1KY5A 1LRKA 1Y48E 2YJGA 4IRMA 1H1LB 1JYEA 4OVKA 1B15A 3EVGA 5DBFA 5FNVA 1YJQA 1KMHB 1AXGA 4B35A 4I8XA 4QXAA 1EGMB 3RAGA 3GFVA 3QTTA 4JLVA 4CTNA 3ZWBA 5JH7F 4YRSA 2AZXA 2Q7DA 1F4VA 1ODTC 2X76A 3NH9A 3WRXA 4GRIA 3LIIA 1L7PA 2IPLA 1TEXA 4HF7A 3VR4A 2CB0A 3QLVA 2B98A 4AQDA 1JFLA 2KM1A 5KU1A 4H9GA 5GOZA 3AGPA 3SBOA 1IXKA 1TYBE 1L7BA 1X7WA 1E8NA 2CLCX 1UDWA 1T0JB 2HH9A 2ZFUA 3P8ZA 1AH2A 4H16A 1KZ7B 3E2PA 1QZZA 3CVJA 1EK6A 3QA9A 1T5SA 2Z09A 1SUBA 3UWKA 4A0SA 1O95A 5DIZA 4D4KA 2G09A 2H5JA 4DCVA 5CBPB 5I45A 3FOZA 2DR3A 2GJ4A 2IY7A 4KL8S 5B58C 4UVIA 5ELLA 2XTJA 3PGJA 5LUAA 1YZVA 2PSFA 1KI7A 4E13A 2IU3A 2YMPA 2P9HA 2LNDA 1P9RA 2V7TA 1NW8A 3IV7A 3L0OA 1Y63A 2B1GA 4Y1RB 4URUR 4WCDA 4RD2A 2ESRA 5C7YA 5IYZA 5JJBA 3CVWA 4C0AC 3GJ3A 1KRXA 2QUBA 3T41A 1CZLA 5EP4A 3CNBA 2OCXA 3SHWA 1P45A 5CD9A 4DKXA 4QLAA 3GLFB 1A3CA 1G8JA 1VMIA 5IYZB 1UK9A 3WB1A 2QW8A 3OC6A 2AN9A 3BTOA 3MGGA 2EEPA 2ORVA 4NV1A 4Q18A 1QGOA 3TLMA 5HBGA 4YMVA 4YUWA 2XMGA 4I55A 3RU7A 3WAGA 5HFJA 4IEFB 1GNLA 3DTYA 2X41A 4X20A 2XITA 3OTGA 3NGXA 4BRWA 3BB1A 3GAMA 5B30A 5JNWA 2Q5LA 1EA5A 2ZB2A 3FUTA 4LUCA 3D3QA 3OI7A 2IT1A 4G2TA 1N5JA 3AETA 5I9TA 2GN9A 1D1PA 2IXFA 2WHPB 3KTAB 4WXHA 5HNKA 3WKBA 1CNMA 2Z9CA 3T5GA 5LIRA 1F12A 1L3IA 3L5OA 1EXVA 4TKUA 1RYMA 4JVOA 1PT9A 2OEPA 1UM8A 4RBNA 2ZYVX 1AX9A 2CW5A 2WHPA 2A84A 3SS9X 4IBOA 4B0PA 4KKVA 4JJ7A 5TVKA 2O8FA 4L6IA 4HZUA 2QR5A 3FUWA 3R24A 4RPKA 1ES9A 5G3ZA 1VL6A 1H8HA 3K72B 2JHCA 2ETXA 4PAWA 2FSUA 2ROQA 2OV2A 3L6EA 4FHCA 3OF5A 4HEA1 1WAMA 4ITRC 4RZSA 3SD7A 3WNCA 4ZCQA 3VHQA 2BH9A 3CPJB 4LYEA 4HDKA 2XB6A 1VYUA 3QLVC 1RZ3A 1KYQA 3IULA 4NU0A 1JNYA 2ZRNA 4GSLA 1R88A 2C9CA 4A92A 4KXMA 4DC1A 4DVJA 1ADYA 2ZCUA 1RM0A 3F7TA 3KT6A 3OHPA 1B74A 4KZPA 4LTDA 3URKA 5KJFA 4PYOA 4IIJA 4IM7A 2NZWA 3HU2A 1S3FA 3LLUA 4G8CA 2XOEA 4JASB 4OQDA 2F1KA 4BLWA 3ZQUA 1NVUQ 2DFPA 4HDRA 2G5PA 1SXJC 3JQ8A 1CS0A 3A32A 1E4EB 1H66A 3KOXA 4UBJA 3U7GA 3UPUA 2ODEA 1FUEA 1T9KA 3E05A 1GUAA 4X6YA 5CIWA 1G6OA 1SC6A 1XTRA 2WD9A 2V6MA 1LSUA 3U17A 2B0JA 2FB9A 1NMXA 4R7GA 1NMEA 4DNOA 2YWFA 4R2IA 2PHZA 2HRBA 3PQ4A 3R6TA 2XCSB 5C52B 3VR4D 2AOXA 1AQNA 4I08A 1BJRE 4LZZA 2F8TA 3I6BA 2VDLB 1RYFA 4E7PA 1P9WA 5TS3A 3GLFA 1TJ4A 3QNUA 4YDHB 2FVYA 1FFAA 2X19A 3CUEF 1H2XA 3DTTA 3FPGA 3MOIA 2X0FA 4XARA 3W5DA 1P2UA 2IEYA 1JG1A 3A6HA 1FLNA 4NFSA 3GF4A 4RWEA 3B2EA 2XNDA 2G1UA 4G9GA 3N3BC 4WAUA 4ZJUA 1J5PA 1ZWKA 1M6EX 3GGCA 4K9SA 1WXHA 5AKLA 2UYCA 4FFNA 4JDPA 4KGVA 3HZOA 5KWSA 2I5PO 1CDOA 4D45A 3VYUB 1IM5A 1DRKA 3M3DA 2ECFA 3TNYA 1M0TA 2WUFA 3GUUA 3QTBA 5EMMA 1YCFA 4LXTA 2WBLC 1HRKA 2X1MA 4MPTA 3TUJC 2AOWA 3AHDA 2B69A 3JQ9C 2WWTA 4WZBA 3TQFA 1TVMA 2J9GA 3NYIA 3QEMA 4C03A 1M8KA 2PS9A 5DJ5A 5L7WA 3CH4B 3U6KA 4TT3D 1LK0A 3ZS8A 5THKA 1JEEA 2L0XA 1E3SA 4OOFA 1AZSC 2HY7A 4OG2A 4R8KA 4QO8A 2X6RA 2WWVD 3V2UA 3VDXA 2UU9B 4JBGA 1ODLA 2G77B 5L3QB 5IABA 4NICA 4WKBA 5A5FA 4XFKA 5ICGA 4TMKA 4UDOA 3KT3A 2ZYWX 3W5IA 1SUWA 4Y3UA 5I01A 1ZHOA 3HDVA 3QJ5A 1DADA 4QUAA 3IV6A 2YYZA 2QLLA 3HE3A 4N5IX 3H2JA 2VAVA 3FDXA 5DI3B 5K4HA 4S24A 2YBEA 3GAAA 3HCFA 3Q0IA 5K03A 3G89A 1QRTA 3WICA 2O8EA 1WO8A 2OL4A 4R54A 3HI6A 2DRIA 3P7MA 1MHTA 3HKCA 4LJRA 3U0BA 2IGTA 3ZWOA 3FWPA 5BRNA 3L7LA 3ZE6A 4DIDA 4GVXA 3T7CA 3TVTA 2FPWA 1QAMA 4MDEA 2X14A 3HR8A 1BROA 1H5UA 2G76A 2R68A 3LRTA 3UK0A 4GPBA 1LFDB 1M33A 5MN5A 3M4YA 1JDJA 1YS6A 1W75A 2JD2A 5HRUA 3WY9A 1PGJA 4K40A 4I1RA 2GEDA 2W83A 1NMYA 4WTOA 2PNFA 1AV6A 5I51A 2PRJA 4AO7A 1JQKA 4KJZA 2OHOA 4Y0NA 3OZFA 1G16A 1MO5A 4BQNA 1XCBA 1FUKA 3VMMA 1OXTA 3LDFA 1G8AA 3WI7A 4G2NA 1NLYA 2H2AA 4RQTA 1ZEMA 2PWBA 4CQLA 1PSZA 3WOHA 5EAIA 1U8EA 4MI1A 2J4CA 1XTIA 3KPVA 4UXIA 3LT5A 2Q4EA 4RF5A 4DIUA 4BMOB 2HNBA 1O97D 4CKXA 4IIDA 4TKVB 1E20A 4HWTA 4BMSA 1E1DA 2KHZA 1VKHA 1W5AA 2X5JO 4IWYA 3HY6A 4CEJB 3RYIB 4JOCA 2FW9A 2Q8PA 3DMDA 3NHUA 5J5AA 4DZZA 2E3JA 3G13A 5E7IA 5FYQA 2ZUEA 3NI2A 3TOZA 2IUFA 3PF8A 1IK6A 2BEUB 3KAQA 1DZIA 1NR1A 2WA1A 1N1MA 4R8MA 4UCXA 5TPZA 3T06B 2NV2B 1KVUA 1DVRA 2PKEA 4TMXA 4F7DA 1Z63A 4IDGA 1XNJA 3OQHA 3JQGB 4H1VA 1QG0A 2Z2IA 3U6BA 3KUXA 5BWOA 4YLYA 4Y1EA 5F33A 1I0LA 2C61A 3HKBB 3B1FA 3TNLA 3GQBA 4Q1AA 3BQNB 4G0QA 5ADVA 5E6RB 1N8KA 2ZU6A 4JYCA 3THYA 4HAZA 5KVAA 2Y0DA 1IXSB 1NJSA 3EB9A 1L5RA 4YMTA 1K8ZB 3O91A 3HKBA 2O20A 5KCMA 3GYBA 5CDTA 1PFQA 3PQ5A 5E6RA 3AEKA 4CGZA 1PNVA 4D4GA 4FFBA 2HF9A 4CCYB 1TD1A 2EIHA 2J08A 2WLSA 3CN7A 4PCLA 3JYPA 3JAWB 5ALKA 1MQAA 4OUDB 3V5NA 1D5CA 1J1ZA 2VDQB 1W5BA 2VT2A 2ZWMA 1W96A 3OJLA 3WP1B 4BC1A 2CT8A 1V71A 3CIFA 4HO1X 4HQOA 3PKZA 3PZBA 3VHLB 3N0VA 2W48A 3WGQA 1Q1EA 1O0CA 1HOXA 3M6MD 2PBZA 2DPGA 1SFRA 2W2VA 5DW3A 1QCCA 3IQIX 4QOIA 1P2FA 1RWBA 4HLDA 4X93A 4AWXA 4L5YA 2MINA 4Q47A 5FUQA 3RYFB 4GSKA 5HQTA 4IZIA 5EPOA 3K9WA 1NUHA 2OXFA 4QUEA 4KNVA 1E9VA 3N0RA 3TTVA 3W4IA 3MUOA 1TJPB 1AA9A 1QR2A 4LV8B 2B20A 4MW1A 3Q3IA 3GB9A 4Z8XA 3RKSA 3ULKA 3PDUA 3HCAA 1T5TA 1TM2A 2YHIB 4BV8A 1VBMA 4CDGA 3WQQA 1OT3A 3EA5A 4W9NC 1R8SA 4ONEA 3V42A 4MH0R 3WKAA 1I14A 1LBIA 2FE4A 3DVSX 3GDOA 4PG4A 1C1XA 2I2CA 5GM1A 1XVVA 1GQYA 1WB5A 3IFSA 1GILA 5KPJA 1VI6A 3TR0A 1U3VA 1QVZA 3ZDFA 2J45A 2YRFA 2BGTA 1CRZA 1UOPA 1J0XO 1L2TA 1TRKA 1XMIA 3FPHA