3EWYA

K314a mutant of human orotidyl-5'-monophosphate decarboxylase soaked with omp, decarboxylated to ump
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRAFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewyA00
2GJNA 5H91A 2GVJA 1KM5A 1I2RA 4RZ5A 5FF0A 3STFA 1SW7A 4L4MA 3LHYA 2ALDA 2J9ZA 4LU0A 1Q6LA 4A21A 1K7FA 1TPVA 3R2GA 5BOOA 5LHEA 1I2QA 3EWWA 1SZFA 3DFTA 5HWMA 2ZRVA 4O17A 1G7VA 4P61A 4LUJA 1G67A 5K9XA 3FKKA 1TYGA 3R13A 1GVRA 3W74A 3W1QA 3OBKA 3IIXA 4YCOA 5LHFA 5BW6A 2DZWA 1OFDA 4KFNA 4CQ9A 4BFAA 2YZRA 4O4VA 1LP6A 3W2MA 1H62A 4KWVA 4PA8A 1SZEA 5ABTA 1FCUA 1G4EA 4HNTA 4KFOA 2A6NA 3L0NA 5AYZA 2GOUA 3W9ZA 3W07A 3EWBX 2NUYA 3EXRA 4MVAA 1EP3A 1QR7A 3BVJA 1Z41A 3HF3A 4O11A 1OX5A 4O15A 4NZFA 3O05A 2WPBA 3NQDA 3Q37A 2QUTA 3NGJA 1LDCA 1LZOA 3N9SA 4PODA 3PG8A 2YX0A 3UNDA 5EA9A 1MO0A 3OG3A 4IMFA 3S5OA 3R12A 4LV9A 4ADTA 5L6UA 3KVKA 2WSQA 3OHIA 2PRHA 5G1YA 1ZFJA 3YPIA 2NV2A 3DH7A 1K8XA 3H54A 1MEIA 4UTIA 5G4EA 1GTHA 3LCXA 2AQWA 2IQTA 3QPYA 4QM1A 5F2IA 1ICPA 3LCLA 4IMGA 2Y85A 1VYPX 2C0AA 4WX2A 3PY2A 1TJPA 4PCFA 3S0CA 1T0OA 1B57A 3NEVA 3QEZA 4IMCA 4LVGA 4JS3A 4E2DA 5D38A 3EX1A 2Y89A 4QITA 2NXGA 1VRDA 2A21A 1EIXA 3QSTA 3TSDA 3G3DA 2CZDA 1HG3A 3HO8A 4MFEA 3B03A 2FPTA 1G69A 3DFOA 4K36A 2A85A 5AYXA 3W1NA 1A50A 1QOPA 1ZHAA 3I7SA 3O15A 1XXXA 2EKCA 4UR7A 4YLWA 2H6RA 4O1BA 1TPEA 5KMYA 3QQ0A 3ABOA 1IXNA 4MY1A 2QCEA 1OFEA 3A24A 1R2RA 4UTLA 1NVMA 2CZEA 3BK0A 3I65A 1TTIA 4LWWA 2VFGA 2G95A 4K37A 5G1TA 3O6YX 1OX6A 3A9IA 4NNBA 2NZLA 4UMAA 2C15A 4R33A 1O95A 3A23A 2DJLA 3UXAA 4WD0A 2DJXA 4MIMA 4WQ6A 2FPYA 1N7KA 5LNVA 3GAKA 2QDHA 1AL7A 3MWAA 5D2TA 4IXXA 3VNDA 3LTYA 3PBUA 4JEQA 1JCJA 4C1KA 2V9DA 1JQXA 4GUFA 2WSRA 1SR9A 3JR2A 4AMAA 1VCFA 1GZGA 3M6YA 1OF8A 3DGRA 5G5IA 5D02A 5KTLA 5HR7A 3V1PA 2G96A 3LHWA 1YDVA 1BEUA 4MZ8A 1VLWA 2VEMA 3WFAA 3QYQA 4XTDA 4C1LA 1FWSA 3M5YA 3QQ1A 1TO3A 1MEWA 1LOLA 3QMRA 2QCLA 4UTTC 1KLYA 2LLEA 2CLLA 4GC4A 1L6SA 3W2NA 1TV5A 3EX2A 4UNLA 3NOEA 1KBIA 3LTPA 3EWZA 1KA9F 1N55A 1YTEA 2QAFA 4FX8A 4TMBA 1B4EA 2GQAA 1SPQA 1TPUA 5HMSA 4O1AA 5HR6A 4HNNA 1H51A 3MW7A 1QOQA 2XN2A 1LOSA 1NFBA 2GUUA 3EB2A 4JTIA 3HG2A 3C2EA 4U28A 1TPFA 3W87A 2CLFA 4MJMA 4RXGA 1DHPA 1OFRA 4JXCA 3W7NA 1WBHA 4N4QA 4LVFA 4K38A 3CTLA 4EF8A 5LGZA 1SZGA 1PHQA 4IOTA 2YYUA 1TSIA 1GG0A 4PL2A 3UWYA 2Y7EA 4EOUA 3O8AA 3P8IA 2AGKA 5F2LA 1EWDA 3IV3A 1GPWA 4KWWA 1PVNA 3CEUA 3TA6A 5IBXA 4OWGA 5F1VA 3L0GA 2JGYA 3MYPA 3GKFA 3CHVA 5AFDA 1FBAA 2X1TA 4XKYB 3C2VA 2TMDA 4CCCA 2VKZG 3KAOA 5FI8A 4CCEA 8TIMA 1VJIA 4N6FA 3HG4A 4ZQCA 5HJLA 3UQNA 5D2YA 4A29A 1R2SA 1KM6A 2Z1BA 3Q94A 3Q2DA 1RQEA 1YADA 2QF7A 5FF4A 3QH2A 2F7FA 4DQWA 2ZA2A 1VHNA 4ORIA 1W5MA 1FDZA 3IVUA 1MSSA 1H1ZA 1BTMA 4JY9A 4GUHA 4O8RA 4FNTA 3HGJA 1S3HA 4LW7A 2O7SA 3BG9A 2W0UA 3LXAA 1KM3A 4RK8A 3TKFA 4LC8A 3LHUA 3SW6A 2Q3OA 2QCCA 6TIMA 1JCMP 4LUIA 1W1ZA 2A5HA 2FLIA 3KVJA 2E77A 3TAOA 1W5NA 1EWEA 3FS2A 5A5WA 6ALDA 3NQFA 3USBA 1S5TA 4GRSA 5K9CA 3NYZA 4WOZA 1SSGA 2VENA 5C2XA 1SSDA 2DU2A 3NAVA 3G8EA 5E93A 3FEMA 3W73A 2OCZA 2Y61A 5G2HA 2E68A 4N9CA 4K39A 2ABBA 3S1XA 2Y7GA 4LVBA 4UXDA 4O13A 1QPOA 1G4PA 3U2OA 1OFBA 2QCFA 3B0VC 3EX6A 3GZ3A 1ADOA 3BV4A 5I3HA 2J27A 2WOQA 1SQ7A 1TPC1 3M5VA 3C0JA 2WSYA 4PFMA 4I7WA 4K7VA 3DAQA 2NV1A 4M7TA 3W75A 2HMCA 5AB3A 1VZWA 2HTMA 3HPSA 2YGYA 4MY9A 4DELA 1LTDA 4H6KA 5I3JA 3SI9A 1YXYA 3FJ6A 3BW4A 3T44A 4HSNA 3DHDA 2H8XA 1C9DA 1R47A 4O53A 1JCLA 5DY3A 3UZJA 1B9BA 3G1DA 2DORA 4GUGA 4UR8A 4NX5A 3MUXA 4LVAA 4DO4A 5KZEA 3C8FA 3IIZA 1XBXA 3LRLA 3C61A 3G1VA 1DV7A 1GVFA 2E5DA 3WJSA 3L5AA 3U8GA 3TIMA 4O14A 2BZNA 5FEZA 3ATZA 1VLIA 3ATYA 2JKPA 4LTSA 1VS1A 1UJPA 4S2BA 4P2VA 4UNKA 4CQAA 4Z1AA 2RDUA 3FIGA 2TRSA 4E2BA 4XQ6A 3KFTA 5BMXA 1YTKA 3FA5A 1QO5A 3DZ1A 2FDSA 4XZ9A 4Z1BA 3SIZA 3UXDA 3SY5A 3GX9A 5CZ0A 5AHMA 2CZFA 4WOQA 1F74A 4ADUA 2G97A 3MJYA 1W54A 3DFPA 2CLIA 3PUEA 1KV8A 4IX2A 3P5YA 1ME9A 4M7SA 1DJNA 1T99A 3CPRA 4ZQRA 1JRCA 4HN4A 1RV8A 4UTUA 1H63A 4N9EA 1GVOA 4LY8A 5EPDA 3TNOA 2VXNA 4GJ1A 4AHQA 5FF7A 4MYAA 2JK2A 3PAJA 3G8RA 4TMCA 2YFOA 3W84A 3W88A 3CIXA 2P1FA 2YR1A 1D3HA 3L2IA 3HPXA 3I68A 3W3OA 3B04A 3CM4A 1UBSA 2R94A 5DBTA 3PC0A 3LM7A 4NZJA 4CQ8A 3UWUA 2JKEA 3NL3A 1XDMA 1TPH1 3NQAA 3O63A 2X1SA 3E9AA 1FWTA 4AXKA 1GVQA 4IJBA 4I9AA 4PH6A 3Q58A 2C13A 2YFNA 4KFPA 3NDOA 1GYLA 3LXBA 1LCOA 1W5QA 2VELA 3NQ7A 1AW1A 3L68A 3EKZA 1ZJIA 3IIVA 4B5NA 3JS3A 3THAA 2NUXA 2A6LA 5GVJA 3NM1A 3C56A 4JDYA 1S5WA 4M6VA 2FB2A 3BLFA 4TU1A 4DO5A 4ZZ9A 1QWGA 1DL3A 1GEQA 3LERA 2FTPA 4JTSA 3BLEA 2Y88A 1G7UA 1TPDA 5CZTA 3ANYA 2DZXA 5DELA 4Q4KA 3BW3A 3GB6A 3M47A 1DQWA 3EEGA 1UUOA 3OVRA 4NUWA 3LX9A 1TIMA 2Y70A 1XL9A 3KOFA 1WA3A 1YXDA 3P62A 1M7PA 3PB2A 3A5FA 4DF0A 1ME7A 5K4XA 1RR2A 5KINA 1FWWA 3TUUA 3S9YA 1T96A 1VCVA 3E96A 3V75A 3G3MA 4FNSA 4AWSA 2Z2UA 1DORA 1TRDA 4O19A 3B8DA 3P80A 2ZZ6A 3QW4B 4N02A 4FO4A 3EX4A 1O94A 5KZMA 3WK0A 1HUVA 3NQEA 3KVLA 3QSRA 4K8EA 1XUUA 5HWJA 3QMSA 2WQPA 3NQ2A 1Q6QA 1ZCOA 3GDKA 3NZRA 1OABA 1A5AA 1FDYA 1W3IA 2CU0A 3M43A 2BXVA 3DI0A 1V5XA 4L4LA 4O0ZA 2BTMA 3W1LA 3ZFHA 4Q33A 3BGJA 1M5WA 4N6EA 1H7OA 1XI3A 3DXIA 3PSVA 5LKYA 3CC1A 3DKLA 1PV8A 1GJPA 4JTEA 4FNRA 3B0PA 1FXQA 1A53A 1NF0A 3TXZA 2RFGA 2AAMA 3ZWTA 2QCMA 2DZVA 4OHQA 1LBFA 1SO3A 5DXXA 2PE4A 3TQVA 2DZTA 4A2SA 3WK3A 3FJLA 1PHWA 1QPNA 1EA0A 3MP3A 1EP2A 1JR1A 4MFDA 4IX0A 2A4AA 1XDLA 1JUEA 4UTKA 3WJWA 3A22A 1E51A 3C4UA 4FNQA 1JUKA 1TPB1 2Y7DA 3O07A 4N2YA 1W3NA 1DVJA 3IGSA 4LV4A 4UTTA 3O16A 3TFCA 3ABSA 3R89A 1AMKA 4NT0A 3L9CA 2QCHA 5AHEA 3TC7A 4AWTA 4MYXA 1Q6RA 3MI3A 4X2RA 1BWKA 4O54A 5DXYA 3VFLA 1I2PA 4LS0A 3GAYA 4JIPA 4JN6A 3W83A 5K2ZA 1QNVA 3G1FA 3FLUA 1X7FA 1QMLA 2BSLA 1KM2A 3VE9A 1V7YA 3PM6A 4CLMA 2GQ8A 4EF9A 3G0UA 4JX6A 2QCGA 2WNNA 3M5ZA 4DF1A 1DJQA 1XBZA 3DBPA 4JIQA 4BI5A 1K3UA 3N3MA 2VEPA 2FB3A 3HMJG 1OK4A 1OYBA 4IMEA 2JGQA 1LRNA 3I7RA 4RV8A 3W7QA 1FY6A 1GOXA 5C55A 4PC8A 1P5BA 2J9XA 3WK1A 3TV8A 2QJGA 4FXRA 4M6PA 1SO6A 3HIJA 3UWZA 3MP4A 1I45A 1A5BA 3LLDA 4H3DA 3W7PA 1JCXA 1UB3A 4UTWC 4HSOA 1VPXA 1RZMA 2D73A 1F6PA 1H7XA 4HIBA 4YCPA 4FB7A 2ZRUA 3W1MA 3PSWA 1FCVA 2Q8LA 1TV8A 3LLFA 1IXOA 4OQVA 2RDTA 1K7EA 4JNMA 3MHUA 3W71A 1H7PA 3G0SA 1ONRA 1VGAA 4NJIA 1OX4A 3AO0A 2NX9A 4R53A 2FFCA 4ZVJA 3LRKA 5AC8A 2A7RA 2NXHA 1SW3A 3W7JA 1AG1O 3R5EA 3U6WA 3N9RA 1QCWA 5D32A 4JTUA 2ZZ5A 4MOZA 3TMLA 2VEIA 2P0OA 3QC3A 4UTJA 2W6RA 4O1DA 3CIWA 2ISVA 1KBJA 2B7QA 1I8JA 1JULA 2PRLA 3F4WA 3L67A 3IRDA 2C6QA 2DZPA 2ZRZA 3IGXA 4LS2A 4O50A 3P67A 4JTJA 4POCA 3GDTA 4M6QA 3WJZA 1W56A 3OIXA 5HULA 2VFIA 2QUVA 1Y0EA 4AEOA 1XBVA 4M19A 3CLMA 1SFJA 3N2XA 3NG3A 1LOQA 3ABRA 4LVDA 1F2JA 2Q8ZA 2X1UA 3W7HA 2QCDB 3W72A 3DENA 2CZ5A 2V82A 4K7YA 1KM4A 1H5YA 3L0KA 4UTHA 3H55A 2B4GA 4Y6GA 5G2IA 1EEPA 1GT8A 3HGSA 3S1WA 3N19B 1H7NA 2ZZ7A 1EX5A 1L9WA 4OU1A 1TTJA 1FXPA 4UC5A 3TK7A 5KITA 4LNYA 3TSBA 4LRSA 3HGRA 4PL1A 3LCWA 5EY5A 3DHFA 4HNUA 5D2WA 1VCGA 1LYXA 2PC4A 5F4WA 1P0KA 3W86A 4M5PA 5E0KA 3FOKA 1W37A 2EAWA 4NNAA 5DBUA 3H53A 4FIQA 3TROA 1WAUA 1ZENA 1H7RA 2QEZA 4WY0B 3SGZA 1PE1A 3W7DA 4FIRA 5AYYA 4GFSA 4Z0SA 5T26A 2PRMA 5HQEA 1K7XA 1ICSA 1OHLA 4OV9A 3GXNA 4RKAA 2E5BA 3RK8A 5CPNA 5FF3A 2ATMA 1X1ZA 1CW2A 5U4NA 3S6DA 2R8WA 3OVQA 4UIOA 1GWJA 2EHHA 3PBVA 1ICQA 4TR9A 3CQ0A 3BARA 4XBKA 2P10A 4O18A 4O0KA 4MLRA 4TX9A 4IMDA 1Z42A 2WKJA 1H61A 2E5CA 3IIOA 1NEYA 3LCFA 4BK9A 4MZYA 4JICA 2X30A 4XBSA 3W7OA 3VE7A 1BWLA 1Z44A 3GYEA 5FEWA 3PG9A 5CPOA 2WJZA 3FKRA 5AC7A 1GQNA 1TRIA 3THQA 5EL1A 3M5XA 3GDLA 4BR1A 1DQXA 3C52A 1WOAA 3C6CA 1RD5A 3F03K 2NLIA 3N34A 3STCA 2FPVA 1KV5A 3MP5A 3TE9A 5BNKA 1L2UA 1OFPA 4NJGA 5CPLA 4BF9A 1F73A 5DN1A 3KRSA 3FYPA 5LSMA 3HOJA 2VEKA 4UFJA 2ZRWA 3C2OA 3W7KA 5AN7A 4FX7A 3T4CA 4EWND 1F5ZA 3STEA 2NX3A 1IGSA 1K8ZA 3G0XA 2OT1A 2V81A 4UFIA 4AF0B 1ZAIA 3LXCA 5D2XA 2I9EA 1ME8A 4ZQPA 3QMTA 3GR7A 4QISA 3G1AA 3E0IA 3F1QA 4MJZA 1R46A 2ZA3A 2VC6A 2YCEA 3UZ5A 3PS7A 1AW5A 3GNDA 2TYSA 3P7YA 4WXYA 3M1ZA 4DO6A 1EUAA 1JCYA 2ISWA 2V30A 3HQ1A 4JX4A 4UFKA 5E1QA 1I2OA 3I6RA 4NXKA 2Q3RA 5MHBA 4RJEA 2J6XA 2YXGA 3S1VA 1LROA 3F4NA 2ZRXA 4NVTA 4AH7A 4NJHA 4UFHA 1XC4A 1FUYA 1UUMA 2F84A 1B4KA 1GVSA 2X1RA 3KVMA 2GQ9A 4LT9A 3OA3A 1HFBA 1SFLA 2YDAA 1KFJA 2FQIA 1LBLA 2BX7A 4OT7A 3G1HA 3MI6A 3L5LA 3NQCA 2EPHA 3W1PA 4N4PA 5D05A 4FF7A 2RKXA 2ZFAA 3NPVA 2QJIA 1W5PA 4OE7A 3NXFA 5A8GA 2ZBTA 2GJLA 3QJAA 1TCDA 4NXSA 5F1UA 4LOCA 3W2JA 1OYAA 2CLEA 3W7EA 1TQJA 3TDFA 2A7PA 4A22A 4X3ZA 4HT3A 4N9BA 1JJKA 3CU2A 1KTNA 3NPXA 1P4CA 3T78A 1F76A 4HPXA 4HPJA 3SFKA 2ZZ3A 5KSWA 1ZAJA 1L6YA 3TFXA 1QO2A 3UD6A 1D3GA 3W2LA 1PIIA 1F7BA 4LS1A 2H90A 5F2GA 4O4WA 2E6AA 3PUOA 1LLWA 2V5LA 1FDJA 4XKYA 4Y96A 5LZLA 3DU0A 4Q32A 2QCDA 1RQHA 3MMTA 3W7RA 1H7WA 1IF2A 4WZHA 3NVTA 1YDNA 4O52A 4BI7A 4ICNA 5CSSA 1SZNA 3O6DA 1VR6A 1FWRA 3DFSA 3UY8A 1K02A 4U4MA 1GG1A 3DI1A 4WJEA 1TV7A 4CCDA 3P81A 1Q3NA 3DFNA 3TC6A 4A2RA 1DOSA 3EWUA 4XWUA 4K8HA 2C18A 2Y6ZA 1PCWA 3SR7A 3LCIA 5HUPA 2QCNA 1H1YA 3GDMA 1N8FA 1OJXA 2OJPA 2V8ZA 4IGHA 4JGDA 3L5MA 1TB3A 3FFSA 3GXTA 1KLZA 5J5RA 2KZHA 3C2RA 4ONVA 5CPMA 5BMWA 2TSYA 2Z0IA 4O16A 4O10A 3LI0A 1O5XA 3MBDA 1I4NA 2RDWA 4NNCA 4UUIA 4NQ1A 4WY0A 3LHVA 2OZ0A 1UCWA 3QM3A 4GUJA 3W7IA 4BWLC 3SZ8A 4GNJA 5D09A 1KFLA 4FXSA 4RCXA 3D0CA 4EIVA 4XUGA 4ZMGA 3C2FA 1WX0A 4NJJA 4Z1DA 3TH6A 4Y90A 2QKFA 3KX6A 1G4TA 2JKAA 4JX5A 1PL9A 1TMHA 3LCGA 2UV8G 5C54A 3M41A 3R8RA 3M7WA 3PUDA 3M16A 1ZY9A 1IXPA 3O06A 1M7OA 5D2VA 3HGOA 4JYEA 3K30A 3W76A 2HS8A 5F2MA 1LM1A 2WNQA 4X9SA 1JUBA 3W7MA 2NXIA 2C14A 3UY7A 3W7LA 3TW6A 4UCGA 3W1XA 2E6YA 4O57A 2BLEA 1G6CA 5IM51 2Y62A 4J9JA 1SO4A 1XUZA 1SU5A 3EWXA 3G1SA 1XBYA 1Q6OA 3EKLA 3BG5A 1YYAA 4WXZA 3UPBA 5LNWA 3LB0A 3LHTA 3UWVA 1PS9A 3TSMA 1OK6A 3C3NA 3PF3A 1P0NA 4MPQA 2ZYFA 5LNSA 2I1OA 4DPPA 1KFCA 5G2WA 5TIMA 1TQXA 4IWWA 3GR8A 4QJ1A 3LOTA 4Z1CA 1LORA 1ML1A 4OV4A 1J2WA 4AF0A 3EXSA 2B7PA 3GDRA 3W1RA 1XKYA 4H4IA 3INPA 3RLUA 3S5ZA 4JD4A 3T55A 3NM3A 5FEPA 4YWIA 4UTWA 3W2KA 2A0NA 3G24A 3IIPA 1FQ0A 3UPWA 1H60A 1MXSA 4DPQA 3W1UA 3SGUA 2QDGA 4O1CA 4MUZA 2ZQ0A 4JTKA 3UYCA 1OFQA 5KZDA 2CLHA 3S8HA 2XN1A 4FNPA 1CI1A 3TAKA 3P5ZA 2WO5A 3NR0A 2X2GA 4JTHA 3L66A 1VYSX 3CWNA 3JRKA 3W6YA 2E09A 3NQVA 4YXGA 2I14A 2XN0A 2V2HA 4R34A 4FNUA 3A21A 4G1KA 1VQTA 3HG3A 3B0UX 3W1AA 3NO5A 3W23A 5I3IA 3ZR4A 3UWWA 1UASA 1PCKA 1JQVA 5DCBA 1GYNA 3LHZA 1WQ5A 4IUOA 3A5VA 2E6FA 3TQKA 2J24A 3PVFA 2QAPA 4JTTA 3IVTA 5EBUA 3HJZA 3DKJA 3L21A 3BGGA 4GWEA 1JVNA 1KTCA 3NQGA 2HSAA 2C16A 2Z6JA 1W3TA 1FX6A 1G4SA 1O5KA 1B3OA 2ZZ1A 3BLIA 4MY8A 1C29A 3LCHA 2B7NA 3L65A 3WJXA 3BW2A 3G1YA 4ZQOA 2C3ZA 3TJLA 2Y63A 5J5DA 4HNVA 4TIMA 1YLVA 5F4XA 3PBYA 1MEHA 1EP1A 5EMUA 2PURA 5C5YA 5CZJA 4AAJA 4ADSA 3O6CA 5H2ZA 3RFAA 4FHAA 3RNDA 5EYWA 3IEBA 3P8JA 5CZSA 3LGEA 3PULA 4QQ3A 1NAL1 2ZRYA 3E02A 3WJYA 3VCRA 1KTBA 3QRHA 1OFAA 2O7QA 2FJKA 5FESA 4JYDA 2ZA1A 1KW1A 3SJ3A 2W79A 2WNZA 1JRBA 4EVZA 4CNPA 3NL5A 2X16A 3QPZA 5EKYA 4O12A 4XTIA 1X8FA 2DP3A 1S5VA 5C6MA 4D2JA 1AW2A 3P82A 1OYCA 4ZQMA 1KM1A 3HG5A 3MBFA 1YPIA 2R14A 4AHOA 2NUWA 1IXQA 1LRQA 3LV5A 2J9YA 4DBEA 1L6WA 1ZAHA 4IXHA 3KRZA 3ELFA 1HTIA 2RHGA 3MO7A 3GXPA 4AB4A 3SSJA 1WOBA 2H8ZA 3NNTA 1A5SA 1HO4A 2EGZA 5AHIA 5D33A 2CLMA 5HNRA 3G18A 1TPWA 2RH9A 1XM3A 4PTNA 7TIMA 5K3VA 4A3UA 3LBMA 4S1FA 3PR2A 3MI2A 3TJXA 4CNNA 3EWYA 3WK2A 4IPIA 4K6AA 4JTFA 5G4WA 4QIUA 4LRTA 2ATSA 4WUIA 3ZS4A 2R91A 1KFKA 3E12A 2G5WA 3LV6A 4FX6M 4I7UA 3BPWA 3HBLA 1VC4A 3ZWSA 4RZ4A 2JBMA 2B0MA 5CSRA 4NX0A 4RR4A 1X1OA 3E49A 2H3DA 4O28A 1NSJA 2ZDRA 3W7GA 4N9DA 1OVDA 4CNOA 3HB9A 2NWRA 2YYTA 4AVFA 2A2IA 1QAPA 5AOUA 1SW0A 1T8XA 4IPJA 1ALDA 1W8SA 3G22A 4YMZA 5FEXA 5DCDA 4S2CA 4Y8FA 5D37A 1GTEA 4OBTA 4BI6A 4DBDA 2EF9A 3IGUA 5CGQA 2VFFA 1LBMA 1RPXA 1HL2A 4IQLA 5BRBA 5FF2A 3N73A 1NF7A 2QR6A 3NPWA 3RU6A 3GKAA 2C19A 2CLKA 4RLIA 3GIYA 5AHFA 1F05A 4I7VA 4NU7A 1W5OA 5HUOA 4ORMA 1IIHA 1FCQA 4RZ6A 4NJKA 2VOMA 1QPRA 4X22A 1IIGA 3TW7A 3CT7A 3PWAA 1R30A 2ZZ4A 4UMCA 1BKSA 3QZEA 3S5YA 1RVGA 4MZ1A 2YW3A 4QSHA 1J4EA 4ZL1A 3STGA 1AL8A 1YTDA 1K8YA 5IBXC 3OVPA 2Y7FA 5I3FA 3NPUA 1W31A 1OF6A 3ABQA 2OT0A 1A5CA 1TTPA 1WBJA 3BO9A 5HINA 5LGXA 3TU9A 2V5BA 2XFWA 1JCNA 5SWUA 2BWGA 2GVGA 3W85A 1F6KA 1WXJA 5D30A 3N14A 4MLJA 3B05A 1H50A 1O60A 1WDWA 5TBOA 2YW4A 3VI2A 1YXCA 4DEFA 2WV8A 2B7OA 4MKNA 4JTLA 3EXTA 5K7JA 4AWUA 3M9YA 3TMQA 1R2TA 2CW6A 2HS6A 4RX0A 1DBTA 3MHFA 2CWNA 1P1XA 2DZSA 1I2NA 1SUXA 2J88A 3B4UA 1RQBA 3S1UA 1O4UA 2YPIA 1LRTA 2OX1A 1D9EA 3SECA 1C8VA 3TR2A 5CKSA 3GNNA 5DLCA 3LI1A 3P60A 4FEZA 3EX3A 3RMJA 1VH7A 4Z08A 4TO8A 4UTMA 4QNWA 1TTQA 1KM0A 1AK5A 4DF2A 3P74A 2Z6IA 5L9FA 3KHJA 3P84A 3KRUA 1OFOA 1THFD 1U5JA 4GUIA 2ZZ2A 3M0ZA 1VHCA 3PBWA 4JY8A 1QFEA 3OEXA 5DY2A 3BG3A 1QDSA 3N2MA 3QFEA 3RLVA 3I7QA 3TX9A 1X6UA 1KFEA 2TPSA 3LTSA 4OGZA 2QJHA 1EPXA 4PEKA 4Y9AA 3NL2A 1TREA 2ZTKA 5K9DA 4JTGA 2E6DA 2ABAA 4Z0JA 1VYRA 3S5NA 3T7VA 1K03A 2NX1A 5U7SA 2VFDA 2ZTJA 3NQ6A 3GLCA 5LNRA 5D03A 3NA8A 3MHGA 1OG0A 3O1NA 5AHLA 1XCFA 3VKJA 3LRMA 3QW3A 3W7CA 5AC6A 4GBUA 1SO5A 4JDBA 1J5TA 3W22A 3NL6A 2A7NA 1EB3A 1W0MA 2V2DA 1EUNA 5K4ZA 4BWLA 3LDVA 1YDOA 3M44A 2H3BA 3QF0A 3PB0A 4QAIA 2V0TA 4R7JA 3P61A 4YL2A 4RXFA 4KKXA 4ZQNA 3AJXA 3NQ8A 5DCEA 3B06A 2PCQA 1M6JA 1ZALA 2NWSA 3NQMA 4JR5A 3MYOA 2DZUA 2OMAA 3W70A 1WYIA 5LNUA 4GE8A 3NZ1A 2YSWA 2CLOA 3G1XA 4QNEA 5F4SA 3LBCA 1MZHA 4LC6A 4ALDA 4DXVA 4JYFA 4UFLA 4GXMA 3TXVA 1QPQA 4HKPA 2VFHA 2V2CA 2C1HA 1U83A 3FYOA 3GK0A 3W1TA 3CWOX 1CX9A 1ZNNA 2GVLA 2ISSA 3HPZA 4ML9A 3CB8A 3RF9A 1Z48A 2ZCGA 1YPFA 1WV2A 4E38A 2FIQA 4W9TA 5TQLA 1DKWA 1HO1A 1OX4B 2GPTA 4WY0F 1Q45A 1LLZA 5I3GA 5I3KA 2QUUA 3TQ0A 3UWQA 3GVGA 4UFMA 3IVSA 3S42A 3KXQA 2E1DA 4HHPA 3CEPA 3T40A 5HWNA 2CFFA 2VFEA 1FWNA 2A1YA 1FCBA 4UMBA 1XFBA 3DFQA 3W2UA 5D04C 5CG7A 3TCEA 1TJRA 5AHNA 4AHPA 1KFBA 4E0CA
chains in the Genus database with same CATH superfamily
3W00A 5LIKX 3GVWA 3N12A 5FF0A 3STFA 1RCOB 4L4MA 3AICA 4LU0A 1Q6LA 1M1BA 3PFRA 4S3CA 1OC6A 1G7VA 1MI3A 2I16A 1XYMA 1R8LA 2QVNA 4IPNB 1G67A 2OWCA 3FKKA 3R13A 3W74A 1MW1A 1CXEA 3OBKA 3IIXA 1RBOB 3RM4A 1NARA 4NILA 2E28A 3FYYA 3JUGA 4D1IA 3SCTA 4BFAA 1OD8A 4Z1YA 2YZRA 1CXKA 1LP6A 1XYFA 3B8VA 4KWVA 3DN5A 3MSRA 1SZEA 4I9MA 1FCUA 1W2PA 4KFOA 5AYZA 3ARQA 3ZXWA 5ABGA 2JF7A 4MVAA 1LL6A 1QR7A 3U2EA 3BVJA 3HF3A 1E0VA 4O11A 1J2BA 3O05A 2WPBA 1C92A 3NQDA 1BQCA 1LWHA 3PWIA 3NZQA 1VRXA 1V6VA 3GVQA 3EMCA 4E2OA 3ZJKA 3CV7A 3KVKA 5A6AA 3ENLA 2NQHA 2D22A 2X7WA 3DH7A 5M5DA 2G3JA 4RDYA 1MEIA 1GTHA 2AQWA 2IQTA 3LCLA 3ZQ9A 1VYPX 1L8PA 4IMCA 4JS3A 4C90A 3EX1A 4EX4A 2A21A 3NEHA 4OIFA 1EIXA 4KCVA 3QSTA 1J8VA 3L4WA 3G3DA 3CH0A 4MWAE 3B03A 4BEUA 2ACUA 5AYXA 4QS6A 1UA3A 1ZHAA 3OBAA 4L5ZA 3DYPA 3S2MA 2DW6A 2DW7A 1UH3A 4L1XA 3QQ0A 2VVNA 2GFTA 1R2RA 2Q8XA 1QHPA 2CZEA 3BK0A 3I65A 2OSWA 4F0LA 5G1TA 3A9IA 3AYSA 2C15A 3MCMA 3UA4A 2Z29A 2DJLA 1A0EA 2QIIA 4UOJA 2DJXA 3LG3A 3WMBA 5HQLA 4WQ6A 3QHMA 3N4EA 3N04A 4IXXA 3LTYA 3C5QA 3EPMA 1JCJA 1KFWA 1JQXA 4GUFA 1JYVA 1CLKA 3IJDA 4PB4A 5D02A 2I5GA 2G96A 3R10A 4QE1A 2R1KA 1OIMA 1YDVA 2OGYA 1GW9A 1BEUA 4MZ8A 3V0UA 1RD6A 4MF4A 3PZGA 3N9KA 1MEWA 3QMRA 5I0DA 1YDYA 2CLLA 3WDQA 3EX2A 4UNLA 2YA1A 3NOEA 1KBIA 4AY7A 1SR0A 1KA9F 4ZB5A 1SMAA 4FX8A 3TYCA 4P8UA 3ZOAA 2DSZA 4TMBA 1K9TA 2CZVA 3WLSA 4GO9A 5HMSA 4O1AA 4ZTYA 3MW7A 3ZJ6A 3GYCA 3WIJA 1MDLA 4GISA 2EEXA 3W6LA 1PBGA 3IJQA 3HG2A 3I3EA 4HZMA 3BLOA 2R1MA 1TPFA 4MJMA 5GJMA 1N8WA 4F79A 1OFRA 1XSKA 3VD9A 1JI2A 4N4QA 2YLAA 1CGYA 2OZTA 1Y5WA 2G3MA 3OLDA 4PL2A 3UWYA 2A3LA 4EOUA 1NP0A 1XYLA 2AGKA 4IIDA 2PDUA 3SCWA 4LEQA 1EWDA 4V2XA 1W1IE 1JAEA 4GQBA 2RUSA 3QHOA 4KWWA 4INFA 5IBXA 4OWGA 5PTDA 1JXKA 1A5MC 3QPEA 5F1VA 2FZ8A 1XLHA 3WN6A 4B9YA 1Q7QA 1X96A 1E3ZA 3BXWA 2OEMA 2ZXQA 1CGTA 2ZX7A 5A6JA 3HG4A 1KCKA 3UQNA 5D2YA 1J96A 1FKXA 3DX5A 2Z1BA 1RQEA 2OODA 3PTKA 4TUFA 5EGRA 1B3WA 2ZA2A 1VHNA 3VUSA 1FDZA 3IVUA 1LUCA 1H4PA 4H8VA 1JL8A 4BQ3A 2C1IA 1NFGA 2O7SA 2GSJA 3BG9A 1SFTA 4FF5A 1KM3A 4ZCWA 3CQHA 3H7RA 4F4RA 2Y8KA 3WBEA 3EOSA 2Q3OA 1E9IA 3KDNA 1J11A 4WK9A 1JCMP 1IEVA 4C7DA 4FLSA 2W63A 3IAQA 3N25A 3UR5A 3USBA 4E8GA 4WOZA 4KS0A 1NQKA 2AL2B 4TXEA 5C2XA 1SSDA 4B5WA 2G4JA 2O0TA 3G8EA 1JYNA 3FEMA 3W73A 2Y61A 5G2HA 1YMYA 4K39A 2IXUA 3SUTA 2ABBA 3WNNA 2Y7GA 1KNWA 3Q67A 4O13A 3PANA 2WWCA 4Q4SA 4C1NB 3NQBA 4MKVA 3B0VC 3I3DA 1ADOA 3WKZA 5I3HA 1SM9A 4B5VA 2J27A 3TZNA 1SQ7A 3CUXA 3RM9A 1T5AA 4I7WA 4U5KA 2Y8UA 3NDYA 4AZ7A 4M7TA 2HMCA 2ZDSA 3HPSA 3PAOA 4DELA 1GOWA 5I3JA 1XHGA 1YXYA 2XIOA 3FJ6A 3BW4A 5A6MA 1R47A 4O53A 5DY3A 3TOYA 2DORA 3AU2A 4GUGA 2F2KA 2Z1SA 3C0SA 5G4HC 4GFIA 4LVAA 4F9DA 5KZEA 4D6GA 1CLVA 3UT0A 3C8FA 3IIZA 1XBXA 1RCQA 2PSNA 5XIAA 1V02A 4P8WA 3U8GA 1WUFA 1XYAA 3ATZA 4AX6A 1CZ1A 3AMGA 2JKPA 2PDFA 2EPLX 2PC8A 2VWTA 3N3TA 4CQAA 4Z1AA 2RDUA 1VJSA 3BMWA 1JZ8A 1AQFA 3BSMA 1MWOA 2CKRA 1UROA 4XZ9A 4Q7NA 1D8WA 3A3WA 1TMLA 3OA5A 4IPPA 3USZA 1K77A 4GJJA 1EDGA 4GYKA 1UZDA 3KDOA 3VA8A 2P5NA 4EAMA 1PX3A 3WSUA 5I24A 1R86A 1F74A 3GHTA 4GCXA 1W54A 4C6EA 3PUEA 3A4XA 1FOBA 3WCZA 3EZ4A 1JRCA 3SAZA 1TELA 1XC6A 1K4HA 4GX8A 4N9EA 4OUEA 2WCAA 1GVOA 4LY8A 3P0WA 2GQ3A 4H8NA 4AHQA 4F9JA 3QGAC 1T8QA 3PAJA 4TMCA 2JEPA 2PGRA 2TAAA 4DJFC 3VUPA 4YTTA 3BAXA 1BAGA 4AUBA 3HPXA 2IPGA 3B04A 5EB8A 3KCOA 3CM4A 2R94A 1REQB 5A6KA 1XG3A 3CGTA 4NZJA 1EC9A 4CQ8A 4C6JA 5T9CE 5A8MA 1UP0A 4MADA 3R25A 2OQYA 1Z89A 2J7HA 4EXAA 9XIAA 1DWIM 1W5QA 2VELA 3VNJA 3EKZA 3IIVA 2X8RA 3KBNA 2QT3A 3NM1A 3C56A 4RDWA 4RZBA 1S5WA 3BLFA 4TU1A 3RU8X 2F61A 3E0FA 1NJJA 1V93A 3QZAA 2Y88A 1DTUA 2XWEA 3OQEA 4Q4KA 3NXLA 3OZMA 2PODA 4Q6XA 5D8WA 4JFUA 2YDQA 3LX9A 3VYLA 2O4QA 3P62A 1KCZA 1DJGA 1XKJA 2HQAA 4LNCA 1FWDC 3AHVA 2FGBA 4H04A 5K4XA 3A47A 1FWWA 2XVNA 1XLFA 2HE8A 1T96A 2V5JA 4QFUA 4AWSA 1E73M 2X7VA 2Z2UA 4O19A 2WHLA 3QW4B 4N02A 4KETA 3KVLA 3QSRA 5BRQA 1XSIA 2XM1A 3QMSA 2WQPA 3T4WA 3GDKA 1OABA 1FDYA 1G94A 4DXXA 5DMLA 2GJXB 4R7WA 3QR1A 4D6IA 2WB5A 4H9MA 2BXVA 2WPGA 1V5XA 4L4LA 1CB2A 1I0DA 2X0YA 4KMQA 4IUGA 4HU3A 2DPEA 3CC1A 1XIJA 3VKAA 1CENA 4M51A 1D3CA 3G5EA 1RLDA 4HA0A 2NV9A 2DVXA 2QCMA 4OHQA 1MFVA 3VC6A 3CUJA 2IPFA 3RJYA 2XINA 4J28A 3CZEA 8RUCA 1Y8BA 4A2SA 4PMRA 3PNZA 1OC7A 4YWSA 1GQKA 2JIWA 4IX0A 2A4AA 3LZ5A 3V16A 1AODA 4WDXA 3DUGA 2CWXA 3MMDA 1IWBA 3A22A 1AMYA 4FNQA 3GS6A 3O07A 1AQ0A 4QQUA 1DVJA 4NIRA 4UTTA 1SYTA 3DG3A 2YL5A 4NT0A 4L64A 2QCHA 2VGFA 4AZCA 2PFHA 5E6YA 1OG6A 1Q6RA 3OIHA 1NFPA 2Q6ZA 4UWMA 2A3CA 2FKPA 1BWKA 4O54A 3HV8A 4AD0A 2PZ0A 3CH9A 4LS0A 4FK9A 3FLUA 2J7FA 4ZO9A 3VE9A 2GQ8A 4GY7A 4D9PA 3G0UA 1DJQA 1DWFM 3W01A 1XBZA 1ITCA 1N8IA 3ARTA 1E0XA 4UTFA 4DBSA 1VJZA 3OZPA 1OYBA 3ITGA 4IMEA 3S9ZA 1LRNA 3I7RA 4RV8A 3ZT6A 1GOXA 3VOHA 4CGTA 2J9XA 4ERAA 4LAKA 2P53A 2QJGA 3OLGA 4PMDA 1SO6A 3HTWA 3MP4A 4HK5A 5BWAA 3LLDA 4H3DA 1JD7A 2GGEA 4UTWC 2XZ9A 1VPXA 1F6PA 3PNUA 2VUNA 4L7ZA 4YCPA 1Q6EA 4FB7A 1ZPTA 2FHFA 1RJPA 3PSWA 2Q8LA 1A3XA 3LLFA 1V77A 4OQVA 1E6QM 1K7EA 3W71A 1ONRA 4KWUA 1OX4A 4ZVJA 5AC8A 1VBRA 2A7RA 1JPIA 2NXHA 5F7UA 3U6WA 3N9RA 4YTUA 3F5LA 1QCWA 1MXDA 3ZJ7A 4JTUA 2VDIA 4MOZA 3TMLA 3CPUA 3TA9A 5JIWA 4UTJA 4O1DA 2ISVA 1R9XA 3IRDA 2XSAA 1TJ1A 5E70A 5LYRA 1AJ2A 4M6QA 4REQB 3U7BA 3OIXA 3NIYA 5HULA 3BUVA 4JQ3A 1EOKA 1XBVA 4PCTA 3GNRA 4GO8A 4QX4A 4HOWA 2QCDB 2QJMA 4K7YA 3E74A 2REQB 4RDVA 3VOFA 3W29A 4Y6GA 5G2IA 2J8TA 1U5VA 3HGSA 3GUGA 3GSMA 1E1CA 2AGTA 2QHAA 4NASA 3WQGA 3NUKA 1H7NA 4E8CA 3QKEA 3SCOA 4BKNA 1FXPA 1F3TA 3TK7A 5KITA 2DGAA 1V3MA 3TSBA 3CZLA 3AI0A 2A79A 2I7GA 4HNUA 2Q09A 3LM3A 1VCGA 2V63A 4DM2A 2HWGA 1LQAA 4PUJA 1KWGA 4KERA 1L2QA 1DP0A 2EAWA 4NNAA 4G56A 4JBRA 4FIQA 3TROA 3UF9A 2NVDA 3K2GA 4WHBA 4CN4A 1MXGA 1EIBA 1PE1A 3W7DA 2E25A 3CBWA 4K68A 2PRMA 5HQEA 1ICSA 4CVWA 1IEIA 3H23A 3WLKX 3K5XA 4K8GA 1UA7A 3GFYA 1X1ZA 3N11A 1WDRA 3S6DA 2R8WA 4V1XA 1GWJA 4DZIA 4TR9A 4XBKA 3R6IA 1IR1A 3AS1A 1E5NA 2P10A 3UCQA 4E6MA 1F61A 4IMDA 4GIEA 1E40A 1Z42A 4EKJA 1NEYA 2X30A 3FSUA 3W7OA 4D6CA 4JTRA 5GPRA 3T09A 1BWLA 5LIYX 2O56A 2WVVA 2WJZA 3VKDA 5C7VA 3GDLA 4H6RA 4BR1A 1LWIA 2AAAA 1WOAA 2CESA 2IMRA 2BDQA 3F03K 2BY0A 3N34A 3SY8A 3MP5A 2C71A 1OT2A 3TE9A 3FVMA 5BNKA 4WSKA 1UOKA 4NJGA 3PTMA 3B8UA 3SM0A 1BG4A 2XGIA 2VEKA 2FZBA 4Z2LA 2EPKX 4LEFA 2QV5A 3STEA 1K8ZA 1JPHA 2WBGA 3QFWA 2OT1A 2V81A 4O8AA 4AF0B 3VABA 2I9EA 3QMTA 3GR7A 4KRZA 4ICMA 5CC7A 3F1QA 1XJBA 4MJZA 1R46A 2ZA3A 4TV6A 5HJYA 2YCEA 3IRSA 4L6DA 2ADAA 4KPLA 3F4DA 3JW7A 2JEQA 3M1ZA 5E6ZA 1TA3B 3HURA 3S46A 1JCYA 2FJUB 4JX4A 2FTWA 3D46A 5E1QA 5FSEC 1GQLA 3I6RA 2Q3RA 1K9FA 2V3GA 5MHBA 1MW2A 3S2CA 2G0WA 1BVWA 1LROA 2CBVA 1UZ4A 1GVSA 2WBKA 3KVMA 4LT9A 1W3HA 4WLCA 2YDAA 2HVMA 1KFJA 1S2TA 3LBOA 3IJ9A 1V4YA 2Q71A 3PHAA 4XKMA 2VZOA 4FPSA 3NPVA 5DF0A 5TD4A 1W5PA 4DBUA 3NXFA 2GJLA 4KEVA 5I02A 1FWBC 4A22A 4N9BA 4Z2IA 4DIAA 1GJUA 3CU2A 2OVLA 2VT0A 4HYVA 4HPJA 3DERA 3UZWA 5KSWA 3A12A 5CSYA 3UA3A 5GJPA 1ECQA 2YL6A 2XYLA 2ZXDA 3W2LA 3UNTA 3AIBA 1F7BA 5F2GA 4O4WA 4XIAA 3NO3A 4DYEA 1GOOA 5LZLA 3DU0A 4Q32A 2XVPA 2GL5A 1H7WA 3NVTA 1YDNA 2HV5A 2Z00A 4BI7A 4J3TA 1VR6A 1FWRA 1BGGA 3HN3A 1GG1A 3KCLA 3TYZA 1V0LA 3P81A 4XG1A 3TC6A 3SCNA 4JHOA 4DJDA 3GW0A 3LCIA 1BF2A 5HUPA 4QJ3B 1N8FA 2W92A 3L7RA 3SUWA 5EBAA 4JGDA 3L2MA 1TB3A 3FFSA 3PUGA 5C2GA 1EH9A 4ATLA 1GYMA 3BTNA 5J5RA 2KZHA 3C2RA 3KBSA 4NNCA 3KOYA 2GVEA 5C70A 4F2UA 1UCWA 4H7VA 4GUJA 4V1YA 3W7IA 4BWLC 2WMIA 4GNJA 3VNZA 3IK2A 4FXSA 3F2CA 4EIVA 4XUGA 3U3HA 3VCNA 3QV9A 2ZX6A 1JAKA 4Z1DA 3M0XA 3T0BA 2NT1A 3H22A 3WD1A 3LCGA 4GHRA 1UD2A 3QXBA 3M7WA 3M16A 3O06A 1BVNP 5FJIA 1ZTVA 4W89A 3VX1A 3K30A 3ITYA 1XCWA 5F2MA 2PU0A 4R27A 3ZSTA 3UY7A 3W7LA 4UCGA 3W1XA 4IFKA 4O57A 1U1HA 4DJFD 2GUYA 2BLEA 4J9JA 1VEOA 4AEEA 3BSGA 4D6HA 4WXZA 3HQNA 5LNWA 3LHTA 4XSMA 3C3NA 3AAMA 2ZUWA 3R7MA 1P0BA 1J0JA 1KFCA 3CK5A 4I5XA 5H8PA 2BOGX 4IWWA 3GR8A 1VENA 1HF6A 1ML1A 4YU1A 1J2WA 4LF1A 3SN0A 1R9YA 1UR8A 4H4IA 1UWQA 3C86A 3LA4A 1R3WA 4YHEA 3B8WA 5FEPA 1M68A 1UWSA 3G24A 1Q8JA 1YX1A 4UQDA 1XIFA 4DPQA 4HZ7A 1DJWA 4JAWA 4MUZA 3KRBA 4JTKA 1HVQA 4LAUA 5KZDA 3WEZA 3VX0A 3KL5A 2XIBA 3TYDA 3JRKA 3W6YA 1GCYA 3EB3A 4JN7A 7PTDA 3EPOA 4YXGA 3BCJA 2I14A 2XN0A 2V2HA 4EPDC 1KGXA 2J6VA 3ZR4A 3DCPA 3BLDA 4QSFA 4PULA 2HDJA 1GYNA 3F2BA 4PYSA 4FOJA 8XIMA 1UJQA 4J3SA 4GVFA 2J8FA 1FP8A 3S6TA 2I56A 3SFWA 5EBUA 4UQ9A 1JVNA 1K9DA 2VI0A 1VF8A 2HSAA 3VOJA 1W3TA 1MRQA 3BLIA 1HT6A 1C29A 2PZNA 1WAWA 3ZZ1A 2CETA 4TIMA 4IM4A 1MEHA 3TW9A 1EP1A 3T8QA 2PURA 3KS5A 3REQA 5H2ZA 1UHVA 3RFAA 4FHAA 1R3RA 1DTNA 2GK1B 2WVSA 1BYCA 3VCRA 1KTBA 2Y8VA 1XLEA 3GHRA 1E6XM 5A1AA 1TZ9A 1SFSA 2WNZA 4QBXA 4CNPA 6XIMA 5D9PA 4O0QA 2J66A 4GXPA 5EKYA 1OINA 3BANA 2DP3A 5JU6A 3WF3A 3EMQA 3WH5A 4IISA 4OBSA 2WLYA 2R14A 1J0ZA 2AOSA 1GNXA 3BV7A 2PDMA 2IPJA 1I60A 4E2VA 1E72M 3OBEA 1L6WA 4PB5A 3WLMA 1FHVA 1HL9A 1Y65A 4AYGA 2OG9A 2DUAA 2CLMA 3MDWA 1V3JA 2J7DA 2YBUA 5CBBA 2OSYA 1TPWA 2RH9A 4IGMA 4GI6A 7TIMA 2W62A 3B8TA 4LF2A 2Z1VA 2DIKA 4YNGA 2I9UA 4PBEA 2QIWA 3RN6A 4CNNA 3KOZA 3O0KA 1ZJAA 1E6PA 3AHZA 3AFBA 3MUY1 4OFCA 4QIUA 3HZ3A 3PZQA 4WUIA 3LQLA 1IEQA 3ZS4A 3U4AA 3N29A 4FX6M 3NSNA 4RZ4A 4QDPA 4B91A 1HGWA 1XX1A 4RR4A 1HKMA 2GYIA 3PPFA 2H3DA 2ZDRA 3GXIA 2YYTA 2P3EA 4DLFA 1R87A 5AOUA 2XIIA 4IPJA 4J3XA 3UG8A 1GKRA 3KM8A 4LX4A 4JFVA 4YMZA 4NAEA 1PEZA 3MSYA 4Y8FA 1VEMA 3M4HA 1GTEA 4ZFMA 4BI6A 3CS2A 1WKFA 2XM2A 1QBAA 3IGUA 1RPXA 3T0TA 4DBDA 5BRBA 3L4VA 3N73A 5FF2A 2QUMA 1E4IA 1O1HA 4HPGA 4K2SA 4YYCA 3RU6A 3GKAA 3U2CA 4U33A 4AW7A 5AHFA 1F05A 1W5OA 3V3WA 1IIHA 2D0HA 1Q7ZA 5C71A 1V6TA 1XLKA 4KCWA 3CT7A 3P6LA 1XIBA 1BKSA 1RVGA 1E70M 2YW3A 3DFYA 2GSHA 1J4EA 1XCXA 1K8YA 2VDHA 3H12A 2OT0A 5HINA 1TTPA 3BO9A 3TU9A 4MJ4A 5SWUA 4J2PA 4L9YA 1WXJA 3N14A 3RPTA 1YBQA 1O60A 1WDWA 3BICA 2VVSA 2YW4A 3VI2A 3HA1A 4IP4A 1YXCA 2WV8A 4OUIA 4MKNA 3TLLA 4JTLA 1GHSA 4TTGA 4AWUA 1ITQA 4IHCA 3VD3A 3TMQA 2HS6A 3OGSA 2CWNA 5LXEA 1I2NA 1SUXA 4TTUA 3S1UA 1O4UA 2YPIA 3H2MA 3FJ4A 5HK4A 3SECA 3A4JA 3WLPA 4OTKA 3TR2A 2BY2A 1JDCA 4ATWA 4X0NA 4A8IA 3GNNA 5CPTA 5DLCA 3LI1A 1UWAA 3P60A 3EX3A 3XIMA 2WMFA 3VZZA 1XH0A 4Y7EA 4DXKA 3ECQA 4UTMA 1DWJM 4JNZA 3UJEA 2O55A 2YIHA 1AK5A 3S2NA 2Z6IA 5L9FA 4U10A 3P84A 3KRUA 4KWSA 2ZZ2A 5TF0A 3W53A 5FJPA 3IJ8A 3VAVA 4HU4A 4PUDA 1C91A 1X6UA 2TPSA 2FMNA 1U30A 3LTSA 3HFTA 4ATDA 4OGZA 4B92A 1EHAA 4PEKA 4Y9AA 1TV4A 1TREA 2ZTKA 4UZUA 3VGFA 4G1NA 1EF3A 1K03A 3M0IA 5U7SA 2ZTJA 5D03A 1FWJC 3QR3A 3NA8A 5AHLA 4RPPA 3IARA 3LRMA 3QW3A 2BVTA 4GY0A 4L56A 1SO5A 3W26A 3TTYA 3WO8A 2V2DA 1EUNA 3VNIA 2ZOXA 3LDVA 2H3BA 2NSOA 1F07A 3P61A 1H0GA 4RXFA 3WH8A 3NQ8A 3LUTA 2NWSA 3AIEA 4QEHA 3MYOA 3MKCA 1ZP3A 2PWDA 5LNUA 4GE8A 3NZ1A 3FSTA 2CLOA 4NZ3A 2PDGA 1DJXA 3E5PA 4GQRA 3CMFA 4UFLA 4GXMA 4C6IA 2OEKA 2NW0A 1QPQA 4RPQA 2OB3A 3Q65A 5A2BA 1WXZA 1ZBCA 4J3UA 3LPOA 1CX9A 3HPZA 4ML9A 3CB8A 3RF9A 1YPFA 2BVYA 1HO1A 3KL3A 1LLZA 1QTWA 5I3KA 1WNOA 3T8LA 3UWQA 3SCPA 3IVSA 1E3XA 2DDXA 4Q3MA 3OPSA 3V0TA 2NSXA 4M0XA 3DFQA 4J3WA 1GOIA 4JQ4A 5AHNA 3WF4A 3CASA 3CUGA 2ZUNA 3WH7A 5H91A 1I2RA 2PB1A 1FFRA 1MUCA 5BXTA 4LAMA 4A21A 3VIFA 5T9BG 1I2QA 3EWWA 4DNMA 1XG4A 1R38A 4NYYA 4O17A 4P61A 4MNJA 4YVXA 4PTWA 3CV2A 3RITA 3VK5A 4ERGA 2GVYA 4MGGA 4HGXA 3L2LA 1YRRA 4MSSA 1JZ2A 4GZEA 2VRQA 1V08A 5AVNA 4NAFA 4CQ9A 4DUVA 3TVAA 1UP2A 1NU5A 3QZ6A 4PA8A 2IPWA 2WVTA 3MCOA 2J13A 2PWGA 4DVOA 2GOUA 3W07A 7A3HA 1LUCB 5CC6A 3ALFA 1K4GA 1IEWA 1VFTA 1MFUA 4QP0A 4NZFA 3B4YA 1M01A 3CUZA 3LEPA 3ARVA 3MUZ1 3GG1A 1DQUA 1EXBA 4RL3A 3UNDA 2CXEA 2VTFA 2VP8A 4E4FA 1MO0A 3S5OA 1VFUA 3ALGA 4I9TA 3OHIA 2PLMA 3AQUA 4ZFCA 5G4EA 3CQJA 4QM1A 3RO8A 1TJPA 1T0OA 1B57A 3NEVA 3QEZA 4E2DA 4LVGA 2HNEA 2CZDA 1HG3A 2PTDA 3GXDA 4BF5A 1JZ4A 4MFEA 1XH1A 4HK6A 1IR2A 2IKHA 3UR8A 3CUFA 2FPTA 1S38A 1G69A 4H00A 3DFOA 3W1NA 1A50A 1QOPA 1XXXA 4F0RA 4PMXA 2WKLA 2EPMX 1LG1A 3PJUA 5KEZA 2OO6A 5BZAA 4GX9A 1EYEA 1XRSA 1NVMA 2AQVA 4IT1A 1TTIA 3WUFA 2VFGA 2YCIX 1BTCA 2G3FA 4UB9A 1OX6A 1OEPA 4E4UA 1ZBKA 4JFSA 3UXAA 3EOOA 1H3GA 3GTNA 2FPYA 5LNVA 1E6RA 2D0GA 3N4FA 1QPKA 2DVTA 1AL7A 3MWAA 3VNDA 4WIWA 4JEQA 4CD7A 2V9DA 4AMCA 1SR9A 3JR2A 2DY3A 6REQA 1QNOA 4PRRA 2PTXA 5KTLA 5AC5A 5HR7A 3V1PA 5HAOA 1BYBA 3VGBA 3WFAA 1VLWA 3ZT5A 1EKOA 4QEEA 4XD4A 4RE4A 1JZ7A 3W2NA 1L6SA 1XLAA 4GPNA 2E7FA 1WDDA 1CPUA 5JMUA 4UR9A 1EHNA 3E3HA 2XH0A 3VZXA 5BCAA 5HR6A 4HNNA 1H51A 1JFHA 3KBJA 5CLTA 1QOQA 2XN2A 1LOSA 1NFBA 4URIA 4G5DA 4AFYA 2CBJA 4JTIA 1KKOA 2E9MA 4U28A 3WQFA 4RXGA 3VDBA 2CKSA 3I4KA 3R94A 3VKKA 3MKKA 3W7NA 3O3RA 4DI9A 5IOBA 5ABEA 3CTLA 4EF8A 1SZGA 3RGTA 1A5NC 4L9ZA 3LZ3A 2V38A 5I5RA 5H8MA 3VDCA 3WH6A 1PAMA 3MMUA 1MRAA 1FVPA 3IV3A 5CBIA 3DESA 1VPYA 3CEUA 4IP5A 3E0WA 3BAKA 3TCSA 3GKFA 5AFDA 1JGIA 3C2VA 3VIMA 5FI8A 2ZKMX 4ZQCA 4HZ8A 3JZUA 5HJLA 1AZ2A 2GWNA 4A29A 2P3ZA 2IUZA 1OZQA 3H2OA 3Q94A 2D2HA 5DO8A 3VNMA 1EZ2A 4WSJA 2F7FA 2RDXA 1S1PA 7TAAA 2Y5JA 3CTTA 1H1ZA 1BTMA 3N6QA 4JY9A 4O8RA 3W25A 4FNTA 2Q02A 5FJJA 1S46A 1F9CA 3OGVA 3LXAA 4W87A 2UBPC 3HPAA 4OVXA 2BOFX 1WCGA 1BQGA 4LUIA 4RNFA 1XYZA 1QHOA 2A5HA 4ML4A 1U2YA 2PDKA 3KVJA 3I4EA 3II1A 2E77A 4HYRA 3W82A 1EWEA 2W91A 3QOKA 1JF5A 2HZGA 2PBOA 2JE8A 1AJ0A 3DOPA 3VU2A 2DU2A 3UBPC 4PUKA 5E93A 5GNYA 2A3HA 5DMYA 1YNPA 4JHMA 2X40A 5FJUA 3SRDA 3E0LA 1FHLA 2E68A 3WEOA 2WJEA 4OOZA 4UQAA 1BLIA 1TJ0A 3N2TA 3VM5A 3CMJA 1H5VA 1TZ7A 1QPOA 3TYUA 1G4PA 3S5SA 1OFBA 1JPKA 4RE2A 4AC7C 1LT7A 3KP0A 1TPC1 3M5VA 4JTQA 3C0JA 4ACYA 1NQ6A 5A6SA 2BG5A 1S5MA 2WLZA 3W75A 5T91A 5AB3A 2YGYA 4MY9A 4Y9MA 1WDPA 3W4RA 1RCXB 3LK6A 3HFYA 1UD6A 3DHDA 2H8XA 4E3TA 2GLKA 3UZJA 3G1DA 1E1EA 2WZMA 2DZBA 4ZOEA 1NH6A 1XLJA 2XGZA 1V6XA 2JF6A 3MZ2A 3U2ZA 4HMCA 4TX8A 4ZO7A 4KGJA 4NG3A 2QPSA 3ZSSA 3LRLA 2YA0A 3C61A 2E5DA 3WJSA 2QQ6A 3L5AA 3VKCA 4O14A 2BZNA 3CWHA 1UG6A 3KCJA 3WF2A 3ATYA 4DJED 4HYWA 4MDOA 3O9NA 1GORA 1UJPA 4UNKA 5I7GA 3UGRA 1AFSA 1EGZA 4AZCB 2YXOA 1CGVA 1MQPA 2QJJA 3RAOA 5BMXA 1YTKA 4M29A 1QO5A 3DZ1A 5KZ6A 2FDSA 3GU1A 4Z1BA 3SIZA 2AKZA 4NZ4A 2WZIA 4QROA 4GYFA 4C6DA 2AMXA 2ZUUA 3PZ9A 2VX6A 1CNVA 4I5UA 1TX2A 4ADUA 2G97A 3MJYA 2BASA 1ME9A 4GACA 2E0PA 4ZQRA 3PJWA 3KWXA 1GOQA 2VNCA 1O7AA 3E2QA 2VWSA 3QTGA 3H24A 4XV0A 1H63A 3EDKA 3AYRA 2IQDA 2VXNA 4AD5A 1IZCA 2W67A 3KZPA 2YFOA 3K46A 3W88A 2PU1A 3CL8A 4PRWA 4K1GA 1D3HA 5REQA 2X41A 3DYMA 4FMVA 3BMVA 4WKAA 2WKGA 3GZAA 3LENA 2WJDA 1R3TA 4JQAA 3ZR6A 1XDMA 1TPH1 2FDMA 1FWTA 5I06A 1J0HA 2R1PA 4AXKA 4YTRA 5E9AA 5IRPA 1IT0A 1H49A 4HQVA 1GYLA 1LT8A 1AW1A 3P93A 1EDQA 3JS3A 2E4TA 3SCSA 1XV8A 3GY1A 1E6NA 2WVUA 2GJRA 2NUXA 1CWYA 2VL4A 5A69A 3NGFA 4BQ5A 4B16A 1GHRA 1I1XA 1PTAA 1GEQA 2Y5SA 2FTPA 3IPWA 1RJRA 2ZWYA 1FH8A 3GBEA 1UC5A 4DAIA 3M6DA 3EEGA 4CQDA 1RVKA 3GIQA 3OVRA 4NUWA 4WKFA 2XDFA 4D72A 3UR2A 2ZVIA 5AY7A 4DF0A 1ME7A 3NTYA 1XFCA 5HPCA 1VCVA 3RM8A 4Q8TA 3V75A 3G3MA 4FNSA 1RHCA 3OZOA 3SCUA 2BVDA 4LBSA 3VIGA 1E1CB 1V6YA 1O94A 1BSIA 1EGMA 3NFUA 3NQEA 3NZGA 1J9YA 2J4GA 2Z1WA 4LALA 3NQ2A 5CXPA 3L4ZA 1WP6A 1FTXA 1W3IA 2CU0A 4EANA 3WZ0E 1IT8A 3M43A 3AWNA 3SRKA 4AG0A 4O0ZA 3UW6A 3W1LA 3BGJA 4U2ZA 1R3YA 4N6EA 1PV8A 2CLPA 2ZUMA 2W27A 4FNRA 1NF0A 5E0FA 3TXZA 2AAMA 3KTXA 3R79A 2VZVA 5I2UA 4B15A 3N2BA 3WK3A 3FJLA 1QPNA 1EA0A 1XR2A 3T1GA 1EP2A 4N0RA 1JR1A 3WH9A 3A6OA 3ABXA 3DHPA 1LL7A 1JUEA 4UTKA 2UWFA 4AZHA 1XIGA 3RRXA 1E9LA 4ROPA 4X2PA 5B80A 3C4UA 1TPB1 2Y7DA 3IGSA 4LV4A 5DX7A 3ABSA 4XO6A 2C91A 4TQTA 3L9CA 1NP2A 5AHEA 2VMFA 4H9ZA 3WL0A 4AWTA 3WDJA 4MYXA 3GO2A 3GH7A 2PMQA 2R1NA 2WVVB 1XSJA 3MI3A 4JL1A 4X2RA 3EOEA 3VFLA 1I2PA 2QUNA 3LYEA 4JIPA 1TR1A 4JN6A 3GVRA 1RALA 4GI9A 3W83A 1QMLA 3GH4A 3PM6A 2Z4GA 3F5KA 3WQVA 1QWKA 4FZIA 3IAPA 3S83A 2QCGA 4GC3A 4JIQA 2PDIA 3N3MA 2FB3A 5FSDC 4C6LA 4CEUC 1XIEA 4KEUA 1HJUA 3WBXA 3FXGA 3H2AA 3KEHA 4LYPA 4JFWA 1FY6A 3LGGA 1V0KA 2HXUA 4Q8QA 4Z42C 1VEPA 4KW2A 4AD3A 2GUBA 2D2GA 3TQPA 4M6PA 1EL3A 1I45A 1B90A 4MUPA 4IIEA 2OOFA 2XVGA 1VBGA 1RZMA 4HIBA 3APTA 1KXVA 3WQ5A 1GJWA 5B7ZA 2RDTA 4JNMA 3G0SA 3WF0A 2XG9A 3AO0A 2FFCA 1SW3A 3BC9A 1IE7C 2RJGA 2VGBA 2ZE3A 1T7LA 4CQBA 1UPMB 3QC3A 5C0QA 2B7QA 3QHNA 4JTCA 4S3BA 2C6QA 3I6EA 3MVIA 2ZRZA 3IGXA 4LS2A 1L6GA 5CBJA 4JTJA 4CU7A 2VCBA 4POCA 2DQXA 4AZBA 3SGGA 3PPHA 1V0NA 4PRTA 1LF1A 3EA1A 1ZUAX 1EC8A 4TVDA 3WJZA 4GKTA 4W8LA 4KBXA 1EQPA 2QUVA 1Y0EA 4AEOA 4J27A 4M19A 5IFTA 3N2XA 3VIOA 3NG3A 4LVDA 4IZGA 1Q7MA 3DENA 3Q45A 2HPMA 3UESA 3AS2A 3NO1A 1H5YA 3FY1A 4UTHA 4Q4QA 5LXXA 2ACQA 1UKPA 1V51A 5HNUA 1EJXC 1L9WA 5AECA 1TTJA 2P50A 3GU2A 4PFHA 4PTMA 1C3FA 2SFPA 3HGRA 2WZEA 4DY1A 3LCWA 4HCHA 1K1DA 1DXIA 1IWPA 4EPEC 1LYXA 1HJSA 2PC4A 2X05A 4H9TA 1WPCA 4Q8MA 1R9ZA 3FOKA 1WAUA 1M9HA 5IDZA 3N2OA 3RRAA 1ZENA 1H7RA 3M0JA 3SGZA 3VVGA 1W91A 3H6OA 4FIRA 1HL8A 4GFSA 4Z0SA 4OV9A 1MW3A 3GXNA 3TYAA 2WMIB 2E5BA 3ARYA 1ISWA 1V3HA 3VGDA 1KC7A 5FF3A 3GTFA 3BAIA 4MB4A 1B30A 3ES7A 2EHHA 2NVAA 3BARA 4GH1A 3P14A 4O18A 4O0KA 4W5UA 2QZRA 1EJWC 4A8NA 2WKJA 1H61A 1KRCC 4MZYA 3V5CA 3MUIA 1GUVA 4XBSA 5JH2A 3VE7A 4DAFA 4JCMA 3G2GA 3GYEA 5FEWA 3PG9A 1NDYA 1KCXA 4IFKB 3THQA 1DQXA 3LPGA 4AZ5A 2IKJA 5HMEA 3H8AA 2FPVA 3SBFA 4I3GA 2GDQA 5CPLA 3GG8A 1LQ0A 4UFJA 1OBAA 1PKNA 3W7KA 4S3FA 1VFOA 3T4CA 4EWND 4GBDA 1IGSA 3FAXA 2QMKA 4UFIA 3LXCA 5D2XA 5A6BA 3N6JA 1EBGA 1ME8A 4WDUA 2VURA 3FDGA 7ODCA 4US5D 4MKSA 3PS7A 4XZHA 2TYSA 3XISA 1I0BA 4F2BA 2V30A 3H4XA 4UFKA 5H1WA 1S3TC 1LG2A 3UFYA 1G5AA 4RJEA 2J6XA 2YXGA 3S1VA 3F4NA 4DWDA 5AKQA 3CXOA 4NJHA 2J25A 1RLCL 1XC4A 2FYMA 1H09A 2X1RA 4BEQA 1SFLA 4DWSA 2CBUA 4IH3A 1LBLA 2BX7A 3MI6A 1UR9A 3NQCA 3W1PA 9RUBA 4Q4PA 4FF7A 2BODX 4CNTA 2ANUA 5E5CA 5A8GA 5CZKA 4IQDA 4MNKA 1TCDA 4AX7A 4NXSA 4LOCA 1YNQA 3W2JA 1OYAA 3B8IA 1UD4A 2Z2BA 5LIWX 4X3ZA 4JIEA 3BCFA 3MO4A 3S6OA 1KTNA 1SZRA 3NPXA 1F76A 1K9EA 4QJ5B 1B3XA 2PDCA 1QO2A 1UH4A 2AQOA 3WBWA 2F9RA 1LLWA 3VNKA 3WQ6A 3AZTA 2V5LA 3AU6A 1FDJA 4I90A 5RUBA 5I03A 4Y96A 4KRTA 1RQHA 3WQCA 4WZHA 4ACZA 2IQ0A 2OYKA 1SZNA 4NP7A 1Q63A 3UY8A 4PBGA 3APGA 1DXEA 4BJHA 3FAWA 3M0MA 1TV7A 4CCDA 3WQ8A 1WO2A 4ZO6A 3BE7A 2Y6ZA 4XBJA 2MUCA 4AVOA 2V8ZA 5CAHA 3MSGA 4H1ZA 2DSWA 1FH7A 4W5ZA 3GFZA 1ISYA 3WLTA 4ONVA 5BMWA 2WJFA 4O16A 3LI0A 1O5XA 1I4NA 1VIWA 2RDWA 1CECA 3LHVA 1S39A 3QM3A 3RPDA 5I3DA 3OQ8A 4QR6A 2GGIA 5D09A 4RV3A 3TC3A 2ZWZA 4JQ2A 2YXXA 3RPMA 4RCXA 3EMZA 4ZMGA 1J10A 4ZA0A 1ONEA 4U3CA 1GGOA 3TH6A 3GQYA 3LPFA 2XJ7A 1G4TA 2JKAA 1EQCA 1DWHM 1J0KA 1DIKA 5C54A 1NELA 3ARUA 3CNYA 4P7NA 3PUDA 4GD0A 1GZ1A 1IXPA 4X60A 1M7OA 5M1TA 1Q5MA 4V28A 4JYEA 4C1NA 3W76A 4X9SA 1EEXA 2ZC1A 1JUBA 2DVUA 2NXIA 3ICJA 3LQGA 1XRTA 1V79A 2X42A 1W9DM 5IM51 4FALA 1UIOA 1SU5A 3EWXA 1XBYA 4NRSA 3UPBA 1M53A 1DYSA 3QOMA 4DO7A 1PS9A 4NAEB 2YA2A 4R85A 4KGLA 4DPPA 1F6YA 5TIMA 3DC0A 2OO0A 1J6OA 4H01A 1UQYA 3KUMA 3LOTA 4Z1CA 1LORA 1VFSA 3EXSA 1DEDA 3W1RA 2EG8A 4LYRA 3MV11 2GJPA 3RLUA 4JD4A 1V6WA 3T55A 3NM3A 3IJ7A 3BJTA 4MMWA 4CU8A 4NHVA 3IIPA 3UPWA 1H60A 1MXSA 3W1UA 1HW6A 3SGUA 4RNJA 3RMEA 1BRLB 1XICA 3UYCA 3ITCA 5E09A 1OFQA 2CLHA 1BXBA 4JTAA 4LPCA 2XN1A 1CI1A 4S3KA 3TAKA 4Q4MA 3A13A 2O92A 2WO5A 3WUGA 4JTHA 4FR6A 3L66A 1BD0A 3LLXA 5FL1A 3V1HA 4GNKB 3W23A 2YZ5A 5M03A 1PKYA 4PUEA 3R4IA 4IUOA 1WQ5A 3O6AA 3A5VA 2E6FA 4GZIA 3PVFA 3D3FA 4HMEA 3LS9A 4MWAA 3BGGA 2CITA 1KTCA 3NQGA 3VGGA 2Z6JA 1B3OA 2OZ8A 5BXPA 2PP3A 1XYBA 5HDRA 3ONCA 2RGLA 3L65A 3KW3A 1KBLA 3G1YA 2C3ZA 1EOMA 4B2DD 4WGXA 5A6LA 4HNVA 3FCPA 3VMPA 4XAGA 4GKLA 5CZJA 2CBIA 3GH5A 1BVZA 3O6CA 1CXHA 4C6MA 4AVNA 3ZVHA 3P8JA 3PULA 4QQ3A 2OELA 4XAFA 1NAL1 3E02A 5FAGA 3UXKA 1XGZA 2Z26A 2FJKA 2ZA1A 1BSLA 1KW1A 4GYPA 4R9OA 2W79A 2NLYA 2V3FA 2PUZA 4UQEA 3NL5A 4P8VA 1CGUA 2HVNA 4HA1A 1HKVA 3QPZA 1Z7AA 1YEYA 1X8FA 1WE5A 1IZJA 1AW2A 3HG5A 1XP3A 3UYIA 1Q2SA 4FLOA 1ZAHA 1XWYA 3D6NA 1QW7A 4IXHA 3KRZA 3AYTA 1BXNA 3GXPA 1K6AA 1HKIA 4AB4A 4ZO8A 2H8ZA 4AYSA 1A5SA 3ERPA 3F7JA 1DJZA 3G18A 2P8CA 3ZMRA 4UQCA 1PJ9A 4IPIA 2UY5A 3VXGA 5G4WA 4V15A 5JUVA 2R91A 1KFKA 3LV6A 3BOLA 1VC4A 4UCFA 3ZWSA 1KQZA 3VIHA 3GU9A 5CSRA 2PDHA 1JPMA 3E49A 3FX4A 4Q6JA 4O28A 3F4VA 4HHMA 3W7GA 4LCQA 1OVDA 2HXTA 2QW5A 4CNOA 2WNWA 2NWRA 4Y9OA 4AVFA 2YBTA 1SW0A 4QLKA 1W8SA 1S2UA 1VBHA 2R6OA 3NYDA 2DSUA 2WAGA 1FWHC 8XIAA 2EF9A 5CGQA 2VFFA 1HL2A 2IKGA 2DT2A 3RG6A 1TVNA 4O1FA 2VO5A 3URQA 3OB8A 4GJIA 4U2YA 3VMOA 6CGTA 3GIYA 4NU7A 1L8NA 5HUOA 3C0QA 1FCQA 5CSUA 1QPRA 2ZUTA 3PWAA 3L4TA 4MZ1A 1UKQA 4QSHA 1A47A 4ZL1A 4HU8A 2FZNA 1AL8A 1YTDA 1KD0A 5IBXC 1Z3NA 3OVPA 2Y7FA 5I3FA 3NPUA 2MANA 1ZBWA 1TX0A 5D9MA 2Z25A 4NAFB 2WXDM 2XFWA 1JCNA 2E40A 4E3VA 3C8NA 3VNLA 1E4LA 3B05A 4F3HA 3CHCA 1ESWA 1YE4A 4EXBA 2ISFA 2CIPA 4W7WA 1QVBA 3RJXA 1BXCA 1PDYA 2B7OA 5A8QA 1AZ1A 2XH4A 3M9YA 4YVPA 2DZSA 3B4UA 1LRTA 3RLHA 2J8GA 2VR4A 3D5HA 2OX1A 4JTDA 4PMUA 1C8VA 1I75A 3RUBL 3GHUA 3RMJA 1VBUA 2QYGA 4PMOA 4Z08A 4TO8A 4QNWA 1DIOA 1MMFA 2VGIA 1E0UA 4N7QA 1OFOA 1GK8A 1V7AA 3BAJA 1EXPA 1VHCA 4JY8A 3UGVA 1EJRC 3FK4A 4YIWA 2XH7A 5DY2A 3BG3A 5A6TC 1RBAA 1CTNA 1Z69A 3I7QA 3QN3A 2YKKA 5I00A 3TX9A 1KFEA 4NRRA 3PTDA 2VCAA 3OODA 1TZZA 2J79A 4JTGA 2E6DA 1P6BA 3CAVA 3DDMA 3TWAA 1I1WA 2BOEX 3B0XA 3EBVA 2NX1A 2VFDA 3QBUA 2ZXBA 2A3BA 1Z32X 4JKKA 4J1OA 2UZ9A 3MHGA 4PMNA 4IFOA 1UIPA 4QS5A 5AC6A 1FP9A 4JDBA 1VKFA 3EWCA 1J5TA 2VUYA 3W22A 3NL6A 2Z27A 3DC8A 1KBKA 4DUWA 1H0IA 1YDOA 2VX7A 1X39A 1WZKA 2WMGA 4QDMA 3P3BA 3PTQA 1JZ6A 4KKXA 2G4FA 3COTA 5DCEA 1JYWA 1M6JA 3NQMA 3OYZA 1EC7A 3XINA 1TUXA 6REQB 2VJXA 1CB7B 4QNEA 2XHYA 5F4SA 3BH4A 1W1YA 4DXVA 2Z24A 4JCLA 3BCDA 3TXVA 1DJYA 4HKPA 2X2YA 5HNTA 2CC0A 4PMVA 4RDZA 2F6KA 4GQ0A 3VDAA 1XLMA 4W9TA 5D4YA 5TQLA 4WY0F 2GPTA 1Q45A 2POZA 3S42A 4HHPA 3CEPA 2VD8A 2GDUA 1QATA 1ENUA 4PMZA 5CH9A 2VFEA 3ZIZA 1HJQA 5D04C 3CIVA 4GG9A 3CHEA 4AHPA 1KFBA 3M0YA 4IIBA 3AZRA 2OSXA 4HJFA 1G9HA 2GVJA 1KM5A 4M3PA 3U4FA 1KXQA 2NQ9A 3UEQA 5FACA 1X6LA 5A3HA 2E67A 2J9ZA 1NWSA 2EKGA 1S2AA 5HWMA 3M0HA 1PKLA 1HIZA 3T0CA 4Z17A 3ITXA 5EFDA 1WDQA 2ESCA 4LUJA 5K9XA 3E0VA 4PB3A 3H7UA 1TYGA 3NJ3A 3WD2A 3IUDA 4DNHA 2P76A 4DHGA 5EMMA 5FIPA 2P0IA 1EJTC 2DZWA 1N2VA 2NVCA 4KFNA 1TWSA 4KESA 1NTHA 1U5HA 3WNMA 1R5YA 2CXGA 3TN3A 2A6NA 3L0NA 3L4UA 1JYXA 4KEZA 3V18A 3C2YA 3EXRA 3M0VA 1JGMA 3BLKA 1OX5A 4O15A 2PWUA 3URNA 3NGJA 3A9BA 1LZOA 1ZBVA 3T2OA 3UJRA 3PG8A 1ZZMA 1TCMA 5I77A 1QRQA 3OG3A 4B5TA 3R12A 4LV9A 3MB9A 5L6UA 3RO6A 5G1YA 1ZFJA 2OGJA 3YPIA 3AXXA 2J7EA 3RCMA 4HA4A 2VC5A 4UTIA 2PS2A 3TTOA 1OC5A 3QPYA 2J7CA 2ZVRA 1ICPA 1E6ZA 4ECLA 4IMGA 3C3UA 2C0AA 2D69A 5I23A 3CYJA 4PCFA 3S0CA 2OLSA 2ALRA 4WGHA 2Y89A 4QITA 1VRDA 2YCLA 1PO9A 2Z7KA 4PR4A 3HO8A 3PZUA 2F38A 3HQPA 3MY9A 1W6TA 4HP5A 2A85A 2EKCA 4UR7A 3OLIA 2XIJA 1TPEA 3URBA 1C8QA 1IXNA 4IIHA 4Y2WA 1EPVA 1OFEA 2QCEA 3A24A 4GNVA 3WF1A 5CG0A 2W9MA 4LWWA 3MUAA 2G95A 5JBFA 1IV8A 3IUHA 4PMJA 4HHLA 4NNBA 2NZLA 2F6UA 3RX3A 2QPXA 3HQOA 4NYUA 3V5OA 4MIMA 3PZOA 2PDWA 2INFA 3NCOA 1JG9A 5JXQA 3KS6A 3TOPA 1GW1A 2PAJA 4GIYA 1Q6DA 3PBUA 5CJMA 7REQA 2ACSA 4Z2GA 2WSRA 5ABFA 1VCFA 1J18A 1GZGA 3M6YA 4Z2HA 3DGRA 4JIIX 2ODOA 3LHWA 5CC3A 2YB4A 3IJ6A 2Z1XA 4S3GA 3QYQA 1NOFA 3N15A 3QQ1A 1XD1A 3W28A 1QOXA 1P7TA 4PBFA 1LOLA 1XLCA 2WHKA 1KWKA 4UTTC 4GC4A 4FR1A 1TV5A 9CGTA 2ACRA 2ICSA 3VD5A 2W3ZA 3LTPA 2AMGA 2E3ZA 2Y0FA 4EE9A 2PDYA 2QAFA 2OTDA 3OOQA 4PCPA 1CCWB 3AZSA 1SPQA 2GQAA 1KRBC 2CPUA 3ONBA 4Q8WA 2QNEA 3TEVA 3C2EA 2J62A 2BXYA 2C7FA 1DHPA 4LBRA 3MS8A 2PWFA 1ZCCA 1XLGA 5EFFA 4K38A 3QV7A 4IOTA 4G7EA 2YYUA 3JVAA 3TN6A 4C6QA 1TIWA 4M1RA 1FWGC 4LAOA 4GGHA 4AY8A 1OZMA 3NWRA 3O8AA 3TN5A 3GC2A 3P8IA 4X9YA 1W9UA 1GPWA 1DXFA 1PVNA 3OGRA 3H2EA 4B9ZA 3TA6A 2VX4A 3L0GA 2JGYA 2DIJA 3B40A 3CHVA 1FBAA 2X1TA 4XKYB 2VKZG 3RHGA 3WMLA 5REQB 4CCEA 2NQZA 1W9PA 4N6FA 1UZHA 4I5RA 1JDAA 4H7CA 1R2SA 3AMCA 3LSCA 2FH6A 4LUTA 3Q2DA 5FF4A 1PZ2A 4ORIA 3MWCA 3L23A 1MSSA 1PYMA 1KGUA 1QNRA 3N18A 4GUHA 3HGJA 1S3HA 5I79A 3MDUA 4LW7A 2WHMA 5GNZA 1JI1A 1UD3A 4RE0A 4ZE5A 4R7OA 2HNHA 3MZNA 4LC8A 1RXOB 3CZJA 3SW6A 2QCCA 6TIMA 2PWVA 1T41A 3FA4A 1EJSC 4UBPC 1W1ZA 2EBNA 2FLIA 4XZNX 1ZB5A 3TAOA 4DUXA 2BNJA 5A5WA 3NQFA 2PLCA 2VEGA 1S5TA 3MKVA 5K9CA 3NYZA 4BZYA 3WD4A 3S3GA 1SSGA 4M80A 3MV01 2D23A 2VZTA 1XRFA 2D3NA 2ZE0A 2OCZA 2PDBA 5DQPA 4N9CA 3WLLA 3CMGA 2QLYA 3S1XA 1S1RA 1X8CA 1S2VA 2X09A 4XD3A 5HJXA 4UXDA 4A8LA 3THUA 3U2OA 3ITTA 2PPGA 4ZOBA 2QCFA 1YE6A 3TONA 2OQLA 3BV4A 3EB4A 1OSEA 2XPKA 1EJUC 4PSRA 1B54A 4LXFA 2WOQA 4EACA 3LMZA 2WSYA 1UD5A 3DAQA 2NV1A 2HTMA 3ARRA 3SI9A 2GSEA 4H8HA 5JQ9A 2EXOA 1C9DA 3WX7A 1U1JA 1JCLA 1B9BA 2BY1A 4ZB2A 5C7HA 2PF8A 4DLMA 5D8ZA 4MAZA 1VIZA 6PTDA 2HK1A 2XU2A 3G1VA 1DV7A 4HNOA 2O9RA 5H6HA 5TAOA 3TIMA 2BMBA 4G7FA 2D0FA 2YB1A 1VLIA 3F4CA 4Q8NA 2PD9A 4LTSA 3TTSA 4DZ5A 1VS1A 5EMYA 1MZRA 2VCCA 3EPNA 4S2BA 1ZSXA 3UP8A 1CGWA 1JIBA 2VR2A 3BAYA 2TRSA 4LFYA 3AIUA 3N13A 4XQ6A 3KFTA 4DX3A 2WCGA 2OZ3A 4WDWA 4US6A 3OU8A 3UXDA 4XVEA 2TODA 1HZYA 3GX9A 4GVGA 3M0LA 3AYVA 5AHMA 3HM7A 4WKHA 5J04A 1FHUA 4WOQA 3UXLA 2B31A 4R88A 4CD4A 4LYQA 3BWWA 4IX2A 1UW9A 2JIEA 1W1B1 3EYPA 3P5YA 4XZMX 2UY3A 3HV9A 4M7SA 4L61A 1DJNA 1UWTA 4I6VA 4QDWA 4DM1A 3EDDA 4L6HA 3FN9A 3TR9A 2DUZA 3TNOA 4H7ZA 4HCDA 1UD8A 4GJ1A 2VEFA 5FF7A 4YTSA 3G8RA 2OWWA 3H7VA 1J79A 2HBVA 1GVYA 2YR1A 5D9OA 3L2IA 3I68A 5GNXA 5C2CA 4HK7A 4CEXC 1UBSA 3LM7A 3S2JA 3UWUA 3NL3A 4BHYA 3NQAA 3O63A 2X1SA 3E9AA 3SRFA 1GVQA 4IJBA 4XISA 1A5UA 1PZ1A 4ZTXA 1H11A 1OWQA 4KFPA 3NDOA 3NQ7A 5C9XA 4L4PA 1ZJIA 1OY0A 4B5NA 3ZT7A 4W4QA 4XAYA 1WZAA 4CD5A 1TVLA 4JDYA 3OP2A 1XD0A 4M6VA 3EDEA 2FB2A 1JZ3A 2J47A 1HKJA 3UZZA 1DL3A 3LERA 4PZVA 1D8CA 1QU4A 3SQLA 5CZTA 1AUSL 3ANYA 1BHGA 3D3AA 1UUOA 4XUYA 4QE4A 3WLQA 2Y70A 1WA3A 1YXDA 4HD5A 2F8QA 1RR2A 5KINA 3TUUA 3S9YA 4IIFA 1OIFA 1TRDA 3K4AA 2NQJA 3GXFA 3QV6A 2ZZ6A 3VPLA 2D2JA 4MM1A 5KZMA 3BMXA 4K8EA 1A4MA 1XUUA 5HWJA 4IF2A 3VZYA 3NZRA 1W2VA 1A5AA 3KLKA 5CQ1A 4XIMA 3B0YA 3M64A 5FAJA 4DJDC 4QG8A 4PMQA 3DI0A 4AD4A 3ZFHA 1H7OA 1XI3A 3DXIA 3PSVA 4ZEPA 3DKLA 2OOGA 1GJPA 4JTEA 3B0PA 1FXQA 3ZWTA 2RFGA 1C9WA 4Q8VA 4A05A 1XLDA 4RE3A 1PB0A 3G1RA 4CQCA 2PE4A 3TQVA 4JIHA 4M6UA 3CYVA 1J6PA 4LANA 1VPQA 4AXNA 1GQIA 4C60A 4B5UA 1GKPA 4MNLA 2EG6A 4LQ1A 3SIMA 3U7VA 3WJWA 1E51A 3PJXA 2DSKA 2O9PA 3O16A 1AMKA 4GI8A 1V3KA 3SUSA 3EA2A 5KETA 2WC3A 2W66A 1HKKA 1XLBA 2QMJA 2HBXA 4UZSA 5DT7A 3B8SA 5K2ZA 1QNVA 3G1FA 2H9AA 1X7FA 4ZOCA 1KM2A 1TVPA 3AUJA 4G6CA 5XINA 1WB0A 4CLMA 1JNDA 4JX6A 3V0SA 2WNNA 4FOKA 5GQBA 3STPA 3M5ZA 1LLOA 4DF1A 3B9NA 4BI5A 3BURA 5DFAA 1AVAA 2VEPA 1US3A 3HMJG 2JGQA 3WNPA 5HANA 2HJPA 3W7QA 3QV8A 6A3HA 4PC8A 1OCQA 4DI8A 3TV8A 3SO7A 4FXRA 1M41A 1UMLA 1A5BA 3NSMA 4DRSA 5HBFA 3ITLA 1UB3A 3WMSA 4HSOA 1ZS2A 5A8OA 2D73A 4UNIA 4XZIA 2G41A 4KF1A 5C8BB 1Q85A 1F4AA 1IXOA 1F3XA 4GMEA 1H7PA 4F8XA 1EJ7L 3FEQA 3BJFA 4DWSB 1TWIA 3KOWA 3LRKA 5BROA 3L4YA 1BPLB 3W7JA 3R5EA 4DN1A 4L1GA 2FVLA 3K8MA 1PTGA 4KT2A 2VEIA 2P0OA 2BGNE 2W6RA 1OGBA 1KBJA 1PIGA 2DZPA 4KH2A 4O50A 4WEVX 3GDTA 2RJHA 4W86A 3BAWA 5LA2A 4IIGA 1US2A 3CLMA 5A95A 1A80A 1SFJA 1OCJA 3TNBA 3LY0A 1LOQA 3ABRA 1F2JA 2Q8ZA 2X1UA 3W7HA 3W72A 4GVHA