3EWYA

K314a mutant of human orotidyl-5'-monophosphate decarboxylase soaked with omp, decarboxylated to ump
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
256
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKHEFLIFEDRAFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 97
structure length 256
sequence length 257
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ewyA00
2ZRVA 1B9BA 1M7OA 1G6CA 4QNWA 1H7WA 1AMKA 3BW2A 1T99A 4GUHA 2YFOA 4IXXA 4EVZA 3HMJG 3AO0A 3CWOX 4R33A 3EWXA 3MO7A 1SW7A 1R2RA 3NL6A 4LS0A 2QCEA 1TV8A 1XBVA 3M5XA 2DZXA 3CEUA 5D04C 1FWWA 3EKLA 5DBTA 1DOSA 2Y63A 5AHLA 1G4TA 4JYFA 1LYXA 3HIJA 3K30A 3MHGA 3LXCA 3NM3A 2ZTJA 3MHFA 2UV8G 2RDWA 2AQWA 1OX6A 1QDSA 3OVQA 1VYSX 4Q32A 2DZVA 3G24A 1Q6LA 4O16A 1KM1A 2C14A 3T4CA 2CWNA 5AFDA 3W7MA 4AH7A 4YXGA 1G7UA 1ZAHA 2GQAA 3V75A 1RQEA 1H7PA 1H7XA 4JS3A 1EP3A 2NUWA 2VFDA 8TIMA 4NX0A 3EX1A 5D05A 3O07A 1KM2A 2E6DA 5FF2A 4M7TA 4FNRA 3R12A 3P8JA 4X22A 2DZPA 2D73A 3H54A 3C2OA 3W86A 2CZ5A 3TH6A 2DJLA 5CPOA 5L9FA 5D32A 3ZWTA 1YTKA 2A5HA 3G8RA 1XXXA 2C13A 1QPQA 3GAYA 4FNTA 1PL9A 4HNUA 3QFEA 3GDRA 3W9ZA 3DHFA 2RDUA 2VKZG 1SO4A 5AYXA 3W7PA 4FX8A 2J27A 3KFTA 1XUZA 1KFLA 6ALDA 1EUAA 3HBLA 1OFDA 2ZZ1A 2HS8A 1NF0A 4UTIA 2X30A 2DORA 5EKYA 4KWVA 2BSLA 1FWNA 4MZYA 1MZHA 4N6EA 2Z2UA 1AL7A 1W5QA 3FOKA 3STGA 3W73A 3W6YA 2CW6A 1KFKA 3L68A 5HJLA 1PIIA 5DCDA 3NL5A 3TSMA 4OV4A 3WK0A 3H55A 1TQXA 4FNPA 4UR7A 1WXJA 3UWZA 3STFA 2FPTA 4GWEA 2CLHA 4HN4A 3ATYA 4UXDA 3KXQA 2C0AA 1DORA 2E77A 1WV2A 4TO8A 1QO2A 3FYPA 3W2LA 2QCDA 5FEZA 3GYEA 5IM51 2JKEA 4N6FA 5K4XA 3HG3A 1R47A 1X8FA 1SO6A 3H53A 2NZLA 4K7YA 2ZZ5A 3G1HA 3M6YA 3GDKA 1I2QA 3QMTA 4AXKA 4IUOA 1TO3A 2YW4A 3BLEA 1OK6A 3O6CA 2BTMA 1EPXA 1Y0EA 3R5EA 3LLDA 4RLIA 1SZGA 4MJMA 5FF7A 3TJXA 4QJ1A 3BV4A 4EOUA 3IEBA 1KV8A 2NV2A 3PBUA 3GXPA 4GUJA 3W2UA 3DFTA 3TJLA 2CLIA 1ICSA 2Q3RA 5AOUA 2Z1BA 2ZYFA 1BWLA 3GKFA 4RCXA 3RMJA 3NG3A 3WK2A 1W3IA 3UY7A 1KTCA 3HPZA 3W7HA 4KFPA 1SW3A 4XTIA 4MIMA 4DELA 2VFFA 4WOZA 5HWMA 4UNKA 3WJYA 3LHWA 1VZWA 5MHBA 1D3GA 3VE7A 1DV7A 4JIPA 1GVRA 5EYWA 2QUTA 2CLLA 1R46A 1XDMA 2O7QA 4LVFA 3O05A 4UTTC 1U83A 2ZZ3A 3N9RA 3SZ8A 4CNNA 1WDWA 5AHNA 4Y96A 1LORA 2E5DA 1XL9A 3BG3A 5HNRA 3FIGA 4NNBA 3W07A 1FCBA 2NWSA 2ZA3A 1TSIA 3PG9A 3LHUA 1R2SA 3W7CA 4L4LA 5F2MA 3GDMA 1XFBA 1G4SA 3QSRA 1YDVA 1TQJA 4O50A 3NQCA 4U28A 1K7EA 4UCGA 3W87A 1TYGA 4Z1DA 1LLWA 4QSHA 5LNUA 4HPXA 1X1ZA 4FIQA 2Z6IA 3G1VA 3QW3A 2QCHA 2CLFA 1DKWA 1THFD 5AHFA 1IXQA 3JR2A 3GKAA 3P62A 4JIQA 4UFJA 4JTKA 1N7KA 1W5MA 2ZZ6A 5D2XA 1UCWA 4K7VA 1TTPA 1XDLA 3S5OA 3FA5A 2WNNA 4HPJA 3LDVA 3PB2A 5LKYA 2J9ZA 3M44A 4DPQA 5J5RA 1ME9A 2VFHA 2WKJA 3CU2A 3GXNA 5F4WA 4L4MA 3DH7A 1W5PA 4EF9A 2O7SA 1JQXA 1A5CA 1CW2A 1G69A 4N9DA 1JCLA 5D37A 4NJIA 5HR7A 3PB0A 5F2GA 4O1CA 1TV7A 4OU1A 2E1DA 3EWWA 3B03A 4Z0JA 4NJJA 4AF0B 2Q8LA 2VELA 2X1SA 1KM4A 1GJPA 2VEMA 2WSRA 2GPTA 1LBLA 3UZ5A 3S5ZA 4O14A 5IBXA 5K2ZA 4NUWA 3NQ8A 3HG2A 5D03A 4LC6A 1QOPA 3CM4A 3G8EA 3BGGA 4PFMA 1YADA 2C6QA 2ZRYA 4LVDA 3S1UA 4XKYB 5GVJA 1VLIA 1AW1A 1TREA 3CC1A 4UTJA 4P61A 4ORIA 1EP2A 2ABAA 2ZRUA 4JNMA 4YL2A 3W1NA 3L5MA 5F1UA 4JY9A 1QMLA 3UXDA 3HF3A 2F7FA 3GZ3A 4PEKA 4IMGA 4QQ3A 1JCMP 3B0UX 3BG9A 5HR6A 1JUBA 3BVJA 4ZQPA 1HO4A 1SZNA 1YPFA 3W1PA 3NQ2A 2KZHA 3HG5A 4JDYA 3DI0A 1TJRA 3S5NA 3GLCA 4JTLA 3I7RA 1ADOA 1JR1A 3WFAA 4MY9A 4O1DA 4G1KA 4Z1AA 4N9CA 3HPSA 1H7OA 1VJIA 3TA6A 2OCZA 4IMCA 4XBKA 5BNKA 1QO5A 3MP5A 2A6LA 3BGJA 4GUFA 5LHEA 5DCEA 1FBAA 1KTBA 4MUZA 4DO5A 1SPQA 5EA9A 1T96A 3B04A 1I45A 1X1OA 3RLUA 2QKFA 3DHDA 3W1LA 4UUIA 3R8RA 1OFQA 3F4NA 2QAPA 2ATSA 3UYCA 3PAJA 1BTMA 3DI1A 3W1XA 2XFWA 2B7QA 3MUXA 4QITA 4HHPA 1LM1A 4FEZA 5CZSA 3S1XA 4Z0SA 1UUOA 3NVTA 3EB2A 4OQVA 5AC8A 4QM1A 4YCPA 4LU0A 1PVNA 4NNAA 4LVGA 4ZQMA 2PURA 4O11A 5C55A 4K6AA 2Z0IA 1FXQA 3SGUA 2E09A 2PRHA 3G1DA 1VCGA 3IGXA 5T26A 4IXHA 5F4SA 3S9YA 3FYOA 2A4AA 2CZEA 1ALDA 1I2NA 2E6YA 1EWEA 2FDSA 2X16A 3LXAA 1D3HA 1TPH1 4O0KA 2NX9A 1QPOA 2VFGA 1YYAA 3LX9A 6TIMA 3FS2A 1H7RA 4Y6GA 1TMHA 3LCHA 3UPBA 1CX9A 1RD5A 3A5VA 2TPSA 4M6VA 3N2MA 1ZENA 1JQVA 2RKXA 1Q3NA 2BZNA 2WSYA 1H61A 4BI7A 5LGZA 3GDLA 5SWUA 3PUEA 5G1TA 5G2WA 2QDGA 1OF6A 4FX7A 5G4WA 1S3HA 1KM3A 1GG0A 5EMUA 3TV8A 4JD4A 4N9BA 4TU1A 1QR7A 3ZR4A 2Q8ZA 1TTQA 1QNVA 3T44A 3SR7A 2EAWA 4BI6A 1OFPA 3HGSA 4UTWC 1XBYA 1FDJA 3L0NA 3W7RA 4K38A 5G4EA 1JULA 4QNEA 1NEYA 1RVGA 1Q6QA 1L9WA 1T8XA 4EF8A 2ZZ7A 3LTSA 3M47A 1BWKA 4IMFA 2V81A 1LDCA 5FF3A 3T7VA 1C9DA 2X2GA 3EWYA 5CGQA 1TCDA 1JRCA 2I1OA 3WJXA 2FB3A 3SFKA 1IXOA 3P67A 3W2MA 1VPXA 2C16A 4O17A 4M6PA 3GK0A 1TPC1 3NQMA 1OX5A 3KRUA 1WA3A 5J5DA 4IJBA 4JTEA 1PHWA 3GVGA 2V2DA 3W7LA 3MJYA 3VKJA 2Z6JA 2FQIA 3PUDA 1ZJIA 1A5SA 2QJHA 5DBUA 4CCEA 1KW1A 4GXMA 1ZAJA 4KFOA 2QJGA 1KLZA 5ABTA 2NUXA 1LROA 1PV8A 3TXZA 1F5ZA 4AWTA 2YW3A 2DZWA 3PF3A 1YDOA 2NX1A 2G95A 1H7NA 3OA3A 4YMZA 3LTYA 4N9EA 3DENA 3TUUA 4O53A 1NF7A 4GRSA 1AL8A 2A85A 4X3ZA 3DAQA 4B5NA 4WY0B 5KZMA 4JR5A 1C8VA 5CPMA 2WO5A 2WQPA 1GVOA 3QYQA 1H1ZA 4JTFA 1F6PA 3I65A 4IQLA 3GNDA 2FPVA 1KLYA 5FI8A 4KWWA 3N19B 5BMXA 4ONVA 4ORMA 4LC8A 3DFSA 4ZMGA 3RK8A 2JGQA 5I3GA 3UY8A 1VLWA 3UNDA 3P60A 4X2RA 3CWNA 4RKAA 1G67A 1O4UA 2EF9A 3NQDA 4PODA 2CZFA 3S1VA 3W22A 5LNVA 2F84A 4JX6A 4M19A 1K02A 1W8SA 3FKKA 4LS2A 5D30A 2EKCA 1DQXA 2RFGA 1NFBA 3N3MA 2QCFA 4O57A 3TXVA 1M6JA 1J4EA 1LRTA 1LZOA 5D02A 3KVKA 4JXCA 5CZJA 2QUUA 1VC4A 3PR2A 1SQ7A 3ZFHA 4N02A 3TKFA 3DXIA 2CLEA 3F4WA 4HNNA 1RV8A 5DXXA 4BFAA 3DZ1A 2G5WA 4Y90A 3M41A 4RZ6A 3LBCA 3B0PA 3SJ3A 1L6SA 1I8JA 1TPUA 5K9XA 3E0IA 2ISSA 3MP4A 5EBUA 1JUEA 3NQAA 2QCLA 1SSGA 3NDOA 3VCRA 4UMAA 4Q33A 3IIVA 2R14A 3LHTA 3GDTA 2PCQA 3JRKA 5BW6A 1XM3A 1FCQA 3OIXA 1LCOA 4QIUA 1F76A 1ZNNA 1R2TA 4MOZA 1QAPA 3NXFA 5DELA 2J24A 3F1QA 1LOQA 2WOQA 1O95A 1A53A 3CT7A 5CKSA 3O63A 1GEQA 3IIOA 4E38A 3CQ0A 2FJKA 1IXNA 2OMAA 4LT9A 4R53A 4FO4A 1KFCA 3KVJA 1C29A 2C19A 1XBZA 4BR1A 2V5LA 3TW7A 2DZUA 3GB6A 4JX4A 3MI3A 4CNPA 2YDAA 4IWWA 4KFNA 1NSJA 4UFIA 1ME7A 2ZQ0A 2XN0A 3EWUA 4BWLC 1J5TA 2E5BA 2PC4A 3NNTA 1PCKA 4AB4A 1O5XA 2FFCA 2B0MA 2J9XA 4JDBA 1YXDA 4ZQRA 2R8WA 3C2RA 4DEFA 3BG5A 2V82A 3T40A 4A22A 3QMSA 4RR4A 5EL1A 3E49A 1OFEA 1OX4B 4DBEA 1KTNA 4K39A 4AHPA 3E9AA 5D2TA 4WOQA 3QJAA 3NGJA 1QCWA 3WJSA 3W76A 3LCGA 3CHVA 1I2RA 1Q6RA 1X6UA 1S5VA 1I4NA 3UWUA 3W7EA 4LUJA 5E1QA 4NU7A 1PE1A 2VEIA 1VHNA 3M5ZA 4O18A 3QC3A 1LRQA 3A9IA 1NAL1 4AWSA 1VHCA 3I68A 4UFLA 5LNRA 4MKNA 1ZALA 4MY1A 1JCNA 3NZRA 3O8AA 4JYDA 1TPEA 4TIMA 2Y89A 1Z41A 3OVRA 3DFQA 1VGAA 2ZRXA 4Z1CA 4MYAA 1FCVA 4DF0A 4NJHA 4PL2A 3I7SA 1PS9A 2AAMA 3L21A 3O15A 4ML9A 3SY5A 5K9DA 3BLFA 3M0ZA 4RXGA 1ZHAA 1YDNA 3W7DA 2VC6A 2WPBA 5IBXC 4O1AA 3UWYA 1SZEA 2TMDA 4S2BA 3GXTA 3NQVA 1VCVA 2C1HA 4QAIA 4XQ6A 2A6NA 2P1FA 4MFEA 1DQWA 3W1QA 4LOCA 4AMAA 2A7NA 2YR1A 2YXGA 3FFSA 3VI2A 2VXNA 3PBVA 1VRDA 3PS7A 2WNZA 4OGZA 3O06A 2X1UA 3HJZA 1OFRA 4O4WA 3W3OA 4IOTA 4WQ6A 1JCXA 1O94A 1TPB1 3O16A 5KZEA 5HINA 1EX5A 1VQTA 2CZDA 3NYZA 3UPWA 1LOLA 3TX9A 5LHFA 2B7OA 3IVSA 3O6DA 3PVFA 4WY0F 5TIMA 1W1ZA 1YXYA 3TFCA 3UQNA 3QZEA 2ZZ4A 3NQEA 4A21A 3Q94A 1RZMA 1WAUA 1K8YA 4UC5A 3AJXA 3M7WA 4GC4A 4WY0A 3G1XA 2NXHA 2BX7A 3GAKA 1V7YA 3TK7A 4MPQA 2EPHA 5KMYA 3T78A 2VFIA 1JVNA 4WXZA 5LNSA 3ATZA 1GTHA 3MWAA 1ZY9A 4LRSA 3RLVA 7TIMA 1EA0A 2VEPA 2Y61A 3LHZA 3BO9A 5D2WA 3W2JA 2GVJA 3W7KA 3R2GA 2RHGA 3NPUA 1KBIA 1VCFA 4OV9A 3PUOA 2ZA2A 1Q6OA 1XUUA 4A2SA 4LWWA 3LM7A 1XBXA 1K7FA 4CQAA 2NUYA 3MHUA 3QRHA 4MLRA 2C18A 4C1KA 1GZGA 3P5ZA 5AC6A 2Q3OA 1KFEA 3B05A 2NXGA 3TAKA 4N4PA 1DJQA 3N9SA 2R94A 2ZRWA 2YGYA 4WXYA 3IVTA 2VEKA 1TPFA 3WK1A 3N73A 1IIGA 2Y70A 4K36A 2QCMA 3I6RA 3QQ0A 4JTTA 4JTJA 4LW7A 3L65A 5C2XA 5U7SA 1YPIA 1KBJA 1TPVA 5HQEA 3FKRA 4AF0A 3NQ6A 3PBWA 3MP3A 4JY8A 3IGUA 5K4ZA 1OYAA 3M5YA 4LV4A 1W5OA 1TB3A 1DJNA 3PSVA 5CSRA 4O8RA 3TW6A 1UASA 4N4QA 4WUIA 4H6KA 4ZQCA 3HO8A 2GVGA 4MLJA 1JUKA 4UFKA 3PBYA 3SIZA 4M7SA 2IQTA 1UBSA 3TNOA 4RZ4A 3W7QA 3RU6A 3G0UA 4HIBA 4GUGA 1GPWA 2EHHA 4Y8FA 3CLMA 1HO1A 4H3DA 3NZ1A 3LLFA 4GNJA 2YX0A 3W83A 1OK4A 3LOTA 2RH9A 2PE4A 3LCXA 3KRZA 3W1UA 3W85A 4YCOA 4I7UA 4LY8A 4ICNA 1I2PA 5AHIA 2V9DA 3G18A 1KM6A 3QH2A 3Q58A 3GR7A 3G1AA 1TV5A 2FB2A 5AYYA 5G1YA 3W2KA 1ML1A 3P82A 1ZFJA 5TBOA 4LNYA 4O0ZA 4CCCA 3JS3A 3VE9A 3N14A 4UNLA 3L0GA 3W7JA 4QISA 3EX6A 3NPWA 3L67A 4PTNA 4P2VA 1GWJA 2H8XA 2E5CA 4DBDA 1FXPA 1SFLA 3DKLA 4CLMA 1PCWA 3W70A 1OX4A 4E2BA 3BLIA 1H63A 4GJ1A 4O52A 1W56A 3C6CA 4JTIA 2ISWA 4JTUA 5AN7A 1XCFA 5FEPA 3P80A 1MEIA 3LCFA 4IMDA 3ABQA 2P0OA 4JX5A 1B3OA 3IIZA 2OJPA 3A22A 4BWLA 2E6FA 2P10A 4RV8A 3G3DA 1V5XA 3HB9A 3UWQA 2DZTA 3BW3A 2NXIA 4ADUA 1QPNA 2YYUA 5FEWA 3S42A 3TMQA 4HKPA 1WX0A 1HL2A 1WBJA 3LHYA 1Z48A 2W0UA 2Y85A 4XWUA 4HSOA 2X1RA 1UB3A 3P74A 1I2OA 5F2LA 5G2IA 1DL3A 3D0CA 3TC7A 2Y88A 1P0NA 1FDZA 3P61A 1TTJA 4MVAA 4AHQA 3MYPA 3KVLA 4NX5A 3A21A 4DF1A 5CPLA 5KITA 3PG8A 5FF4A 2HS6A 4IGHA 1MEWA 1H60A 1TRDA 3S0CA 2AGKA 4GUIA 2PRMA 5CPNA 1W3NA 2DJXA 3M1ZA 4D2JA 1A5AA 2XN1A 3ZS4A 3P84A 2Y7FA 1WQ5A 4JYEA 2WNQA 3NO5A 4K37A 2QCDB 5CG7A 4AEOA 5K7JA 2YZRA 4IX0A 1ONRA 4N2YA 1TRIA 4WZHA 2JBMA 4S2CA 1ICPA 1WYIA 4AHOA 2JKAA 4NNCA 1GYNA 4S1FA 3EWZA 2QCGA 3O6YX 5HUOA 4UFHA 3UWWA 1LBFA 1KM0A 3LI0A 4OE7A 1H50A 3MI6A 4Z08A 3BW4A 3B4UA 1N55A 1OFOA 4LV9A 3LRMA 4HSNA 5G2HA 2ABBA 4OBTA 3UWVA 3B0VC 1ICQA 2HTMA 2QR6A 1GQNA 2FLIA 3HQ1A 3KX6A 3WJWA 1RQHA 3C3NA 1HUVA 4NXSA 3ABOA 3USBA 3QM3A 3TMLA 1ZCOA 1VS1A 1EWDA 4XUGA 5DY3A 2ALDA 3ABSA 2BXVA 3TIMA 2DP3A 4UR8A 1L6YA 1R30A 4NZFA 4BK9A 3ANYA 3CIWA 3LXBA 2V5BA 1F05A 2Y62A 3LRLA 2ZZ2A 4XTDA 1P4CA 3B06A 4O19A 5DCBA 2C15A 5K9CA 3G1YA 3QPYA 5AYZA 3LERA 4JN6A 3MYOA 3CTLA 1F73A 3L66A 3LGEA 4R34A 4CCDA 1SUXA 3IVUA 3TFXA 5CZ0A 1B57A 1OJXA 3B8DA 5KSWA 2OT0A 4IMEA 2V2HA 2YSWA 4UMCA 3YPIA 1IXPA 3LCIA 3W7NA 1WOBA 2ZDRA 1N8FA 3L5LA 3KAOA 4ZL1A 1W31A 2YFNA 4I7VA 3KOFA 4HNTA 4RK8A 4PA8A 4OT7A 1XI3A 1Z42A 3S6DA 5HWNA 5F2IA 3W7GA 2OX1A 4LVBA 2OT1A 3W7OA 3OVPA 1BEUA 3SW6A 3WJZA 3E02A 1HFBA 1FUYA 5FESA 3IIXA 3INPA 3NPVA 2VOMA 1H51A 3FJ6A 2VFEA 3PY2A 3C4UA 3DKJA 1LRNA 1GG1A 3W1RA 4C1LA 3NOEA 4MZ1A 3MI2A 1XC4A 1GVQA 5D09A 3W72A 2J9YA 3LV5A 4K8HA 2QJIA 5BMWA 1W3TA 5KINA 4FXRA 1JJKA 2RDTA 4Z1BA 3G0XA 3SGZA 5D33A 3TR2A 1DBTA 1G4EA 3NQGA 5AHEA 1M5WA 3E12A 3OEXA 5HULA 2ZFAA 3LCLA 2GQ9A 3QSTA 4NQ1A 3VNDA 4MFDA 5BRBA 1W0MA 4FNUA 1GOXA 3S8HA 3TU9A 1AW5A 2QEZA 1BKSA 2HSAA 3DFPA 3L2IA 2VENA 2J88A 2XN2A 1HTIA 3EXSA 3LI1A 4UTKA 3TDFA 5C6MA 4FNSA 4EIVA 1D9EA 2CLKA 1QWGA 3W23A 3W7IA 2H8ZA 1QPRA 4ZVJA 2Y7GA 3G1SA 1AG1O 1GTEA 5D2VA 4KKXA 1YXCA 1LP6A 4U4MA 3C2VA 5EY5A 3C2FA 5KZDA 1L2UA 1IF2A 1SU5A 3S1WA 5C54A 1SO5A 3NL2A 3W84A 4E2DA 2V8ZA 3W1TA 1ME8A 2I14A 3QMRA 4FX6M 1KA9F 3EX2A 5L6UA 1K03A 2ATMA 3FJLA 1RR2A 4O4VA 1FY6A 1S5TA 4LS1A 5DLCA 2A7RA 5EPDA 3HG4A 1P0KA 3IIPA 1VR6A 3THQA 2V0TA 1B4KA 5HMSA 3VFLA 4ALDA 3HGJA 1FWRA 3M9YA 1K8ZA 4A29A 2TRSA 1SFJA 2A7PA 4AVFA 3CIXA 3W74A 3I7QA 4A3UA 4A2RA 4POCA 2B7PA 4R7JA 1O5KA 3EWBX 4ZQNA 3KRSA 4BF9A 5I3IA 3TCEA 1VYRA 3MBDA 3C56A 2V30A 5D2YA 3NR0A 1H62A 3NPXA 1SR9A 2Y7EA 3V1PA 2YCEA 1OG0A 5FEXA 5K3VA 2E68A 1GYLA 3TSBA 3ZWSA 5FF0A 4I7WA 3M16A 1RPXA 3P8IA 1EUNA 4JTHA 3GNNA 4DXVA 3TQKA 3F03K 4UTTA 2LLEA 3THAA 1QOQA 1KM5A 3N34A 5LZLA 3W1AA 4UTLA 2A1YA 3UZJA 1KFBA 2JKPA 3W75A 5D38A 1Q45A 3O1NA 3PULA 4RZ5A 3OG3A 3S5YA 4JTGA 4RXFA 5C5YA 2NLIA 4LVAA 4FHAA 2ZTKA 3BARA 4MY8A 2Y7DA 5AC7A 2A0NA 4M6QA 5HUPA 4IPIA 5KTLA 1IGSA 3NL3A 3U8GA 2A21A 4FNQA 2WSQA 4DO6A 5H91A 1G4PA 3M5VA 1FCUA 4AWUA 4OHQA 3LBMA 4FIRA 4TR9A 1FX6A 4DPPA 5DN1A 3KVMA 3EXTA 5CZTA 3EKZA 1DHPA 2NV1A 4Y9AA 5G5IA 4H4IA 2JGYA 1EIXA 3PC0A 1E51A 1X7FA 2G97A 1M7PA 3OHIA 3LB0A 2ISVA 5E93A 2QAFA 4PL1A 3A5FA 1OFBA 1SSDA 2ZRZA 3FLUA 1SO3A 4JEQA 5F1VA 1SZFA 2GQ8A 1MO0A 2PRLA 4IX2A 2EGZA 4OWGA 5A5WA 2H3DA 4FB7A 3L9CA 3IGSA 3CPRA 3HGOA 3LTPA 2NWRA 3IV3A 3BK0A 3BPWA 2Y6ZA 3R13A 4RX0A 4O10A 2DU2A 4Q4KA 1H1YA 1P1XA 4LRTA 1NVMA 4YLWA 3TSDA 4GE8A 2YPIA 2ZA1A 1PHQA 4XKYA 1P5BA 1TTIA 3L0KA 5I3FA 3C52A 2YYTA 4M5PA 1TIMA 1QFEA 2B7NA 1F6KA 1OFAA 1F74A 1MSSA 1FWSA 4ADSA 1JRBA 3Q2DA 3LRKA 2DZSA 2GVLA 2H6RA 2R91A 4DO4A 1JCYA 1VH7A 4UTUA 3EX3A 3QQ1A 5H2ZA 2JK2A 1LBMA 5HWJA 3P7YA 1J2WA 3W88A 3W71A 4IPJA 1GT8A 1OVDA 1HG3A 2OZ0A 1L6WA 1OABA 3OBKA 4WJEA 1OYCA 1W37A 3HPXA 4WD0A 2NX3A 2QCNA 1K7XA 2QDHA 4HT3A 3LCWA 3SI9A 3PWAA 3QW4B 5AB3A 3DFOA 1T0OA 1VYPX 3G3MA 4TMBA 4AAJA 3HGRA 4MYXA 3DBPA 2ZBTA 2FTPA 1B4EA 1F7BA 1A5BA 4CQ8A 4DF2A 3RF9A 3PSWA 4FXSA 4MZ8A 2HMCA 4LUIA 4ADTA 4TMCA 2H3BA 1W54A 5LGXA 3FEMA 2QF7A 3ELFA 1S5WA 3NQ7A 1TPWA 3L5AA 3DFNA 4W9TA 3NA8A 2H90A 1A50A 1U5JA 4CNOA 4UTHA 1EP1A 4NT0A 1GVSA 2WV8A 3C2EA 3RFAA 3P81A 1OF8A 4X9SA 3MMTA 1OYBA 4LTSA 4EWND 3TQVA 1YTEA 3QPZA 3N2XA 1LTDA 2J6XA 2B4GA 2G96A 1LLZA 3P5YA 3R89A 2GOUA 3EXRA 1KV5A 3LHVA 1IIHA 1O60A 3G22A 1MEHA 1FDYA 1OHLA 2FIQA 3QF0A 5I3KA 3MW7A 1AK5A 4RJEA 1XKYA 3EX4A 3SECA 3UXAA 1YTDA 3QEZA 5F4XA 3C8FA 5CSSA 1TJPA 1UUMA 3T55A 2FPYA 3RNDA 4O28A 3CEPA 1ZAIA 2QCCA 3NEVA 4XBSA 3TROA 3EEGA 1EB3A 2C3ZA 3IRDA 2GJNA 4JICA 4UTMA 4JGDA 3GR8A 3KHJA 3NQFA 4O12A 1Z44A 3NM1A 1K8XA 4NXKA 4ZZ9A 3ABRA 1WBHA 4I9AA 3SSJA 3PM6A 4O15A 4ZQOA 5DXYA 4TX9A 3TAOA 5I3JA 1RQBA 3TE9A 3NAVA 3STEA 2CLMA 4PC8A 3U6WA 1G7VA 2CLOA 3GX9A 4NVTA 4HNVA 5LSMA 2V2CA 1H5YA 4DQWA 2X1TA 1K3UA 5LNWA 4O1BA 4K8EA 3LV6A 4UFMA 3G0SA 3GIYA 1W5NA 3Q37A 2BWGA 2TSYA 4PH6A 2WJZA 2A2IA 2CU0A 1SW0A 5U4NA 4O13A 5E0KA 4FF7A 1DVJA 4JTSA 1AW2A 4NJKA 1GVFA 4J9JA 3CB8A 2W79A 1CI1A 3W2NA 1JCJA 4XZ9A 3W1MA 1F2JA 3DU0A 1EEPA 2GUUA 4GFSA 4GBUA 4BI5A 4E0CA 5AHMA 4CQ9A 3TC6A 5BOOA 1LOSA 4NJGA 4NZJA 2I9EA 1MXSA 2QUVA 5TQLA 5DY2A 1FWTA 3TQ0A 1TPDA 4UMBA 3M43A 3G1FA 3C0JA 3E96A 3WK3A 3DGRA 2CFFA 3MBFA 1UJPA 4UIOA 4UTWA 3HOJA 4O54A 2GJLA 3A23A 3A24A 3STCA 1YLVA 5A8GA 1WOAA 2TYSA 4WX2A 4PCFA 2BLEA 2ZCGA 4MJZA 2W6RA 3U2OA 1FQ0A 1KFJA 2E6AA 5I3HA 3C61A 4YWIA 3UD6A
chains in the Genus database with same CATH superfamily
2ZRVA 1B9BA 3KBMA 4AD0A 4DJFD 2VC7A 3MO7A 3WLIA 1V0NA 2QCEA 4TQTA 2DIJA 1FWWA 1E5JA 1EF3A 2EO7A 4LUTB 4N7QA 1E6SM 3VD3A 2DZBA 3K30A 3NM3A 3LXCA 3SCWA 3M0XA 5DRIA 3P0WA 2YJQA 3DCPA 1KM1A 2C14A 1E9ZB 1GW9A 3OPSA 3TA9A 4YXGA 2FVLA 1G7UA 1ZAHA 2GQAA 4US5A 1H7PA 1TZ9A 1H7XA 1ZCCA 6A3HA 2VFDA 8TIMA 1WZLA 2XIMA 1TWZA 4IUGA 5FF2A 3W4RA 4FNRA 4DJFA 1V4YA 1Y7VA 2JF6A 4X22A 5HXMA 2D73A 4QDPA 3WD4A 4QEEA 1LWJA 4JTQA 3CLWA 3VGHA 2A5HA 4E3VA 1GGOA 3FYYA 1XXXA 1Z9AA 4ERAA 1PL9A 3GNOA 1UWTA 3LQGA 1M03A 2ACRA 2WK2A 1SJCA 1VFOA 4LBSA 3DYPA 4B90A 1EJTC 2QUNA 3XIMA 1QI2A 2ZVRA 2HS8A 1PB0A 4UTIA 3LZ3A 2BSLA 1KGXA 4Q4QA 1MZHA 2Z2UA 3S4TA 1AL7A 3W73A 3W27A 4LF2A 1EYEA 4XIMA 3TSMA 3WK0A 3IJ9A 4A3HA 4PUNA 2YLLA 2OEJA 2EPMX 4UR7A 1WXJA 4B4HA 4AUBA 3SUSA 5ABGA 1DORA 1F3XA 1OZQA 5XIMA 1TX0A 2ICSA 3FYPA 1P0DA 1FHDA 1GHSA 3R0KA 2QCDA 3REQA 5IM51 3DOPA 5D8WA 1BRLA 4N6FA 3HG3A 2VR5A 2VR4A 2NZLA 2WYSA 3TTOA 3CT2A 4IUOA 3O6CA 2XPKA 3R5EA 5FF7A 4JQ4A 3FSTA 3WQDA 3TJXA 4E5TA 1X39A 4QJ1A 4AD2A 4H8HA 1EJXC 2NV2A 3UGRA 1UMYA 2V5DA 2WNWA 2ZUSA 2WAGA 4DYJA 1RXOB 4J2MA 2FZMA 1W1YA 3GKFA 3RMJA 3VABA 4JN8A 3W7HA 1HKMA 2WMKA 4KFPA 4HU0A 2PDFA 4XTIA 4DELA 2VFFA 4UNKA 2F38A 1VZWA 4GH3A 1D3GA 3AXHA 4JIPA 1R46A 2F6XA 3KOXA 5ECVA 2XSXA 1V03A 4FK9A 5I2UA 4RDVA 4CNNA 5AHNA 1XL9A 3FIGA 4QS6A 1QBAA 3TZFA 3WENA 4QG6A 3ZLGA 2ZA3A 2PDXA 4JFVA 4GK8A 1EOKA 3LHUA 4GKLA 1FHVA 1JAEA 1W2VA 2CBUA 3CHEA 1TQJA 2DSZA 3NQCA 4MG4A 4JHZA 1EGVA 1U1UA 2HNHA 1TYGA 4Z1DA 5A8QA 3PK7A 1CYGA 3AWNA 4TX8A 4QSHA 8RUCA 3VZZA 1EOMA 3DIPA 1R0MA 3ZQ9A 1BG9A 2Z6IA 3QV9A 4XB3A 5AHFA 3JR2A 3P62A 5FAGA 3VM5A 4I8YA 2WPGA 3VNIA 4S3GA 4HPJA 2WNNA 4UR9A 2J9ZA 4DPQA 3GXNA 4L4MA 4LEQA 3UZWA 3KCJA 4ZO8A 4GOAA 1C92A 4QCFA 1JQXA 3W53A 1DWAM 4Q6XA 3HQNA 2Z28A 3OA5A 4C60A 1G69A 5D37A 4NJIA 3PZNA 4O1CA 2GUBA 3GUGA 3B03A 4Z0JA 4AF0B 3GC4A 5CJ5A 2Q8LA 3NEHA 1A0DA 2WSRA 1XINA 2DH2A 1ZTVA 4QXIA 1C8QA 2H9AA 3I4EA 3UR2A 1TWSA 3MMDA 4LC6A 3OBAA 4C6FA 3WZ0E 3G8EA 3BGGA 4IFOA 4PFMA 4FZIA 4JTCA 1OC7A 3AICA 4S3CA 4GNKB 1J10A 3G2GA 1AW1A 3CC1A 1DHKA 3QHOA 4UTJA 3QY7A 3E0LA 2ZRUA 2EPNA 3L5MA 4GH1A 1BF2A 1E3ZA 3WBWA 2F7FA 1NOFA 4IMGA 1JCMP 2WSKA 1AODA 1HO4A 1YPFA 1ZP4A 4C6EA 3HG5A 4PB3A 3R94A 1B3WA 3H7UA 3XISA 1XCWA 1VB9A 4R9OA 3WFAA 3NSNA 4Z1AA 3UCCA 4IMCA 2WC3A 3BGJA 5DCEA 3TJIA 3L7RA 1FBAA 1KTBA 4MUZA 1T96A 3B04A 1PX4A 3DHDA 1CLVA 4ACZA 3W1LA 2QW5A 3R8RA 3BCFA 1OFQA 3F4NA 4AWEA 1YDYA 1QTWA 4NZCA 3BJSA 3GW3A 1MRQA 3DFYA 1FKXA 2XFWA 3WQGA 4QITA 1RPKA 4MB5A 1V0MA 3AUJA 3L2LA 4H7VA 1D2KA 3NVTA 3C0LA 2ACSA 2C1IA 3EB2A 1AZ1A 3EMCA 4EP8C 1S2VA 3SB0A 4KIRA 3CZ8A 5C55A 4K6AA 4J3UA 2Z0IA 4W87A 1FXQA 1H0GA 1UW9A 2PRHA 1VCGA 3VU2A 3U9IA 2WMJA 3S9YA 2YIHA 3AMCA 4F66A 1ALDA 3ME3A 4HK6A 3LXAA 3VAVA 1TPH1 3LG3A 4UQCA 3LX9A 1YYAA 2BASA 1XLCA 4DWSA 3VIPA 4CCZA 4IH3A 4M3PA 5BRPA 3N2MA 1JQVA 4AD3A 1ITUA 2ESCA 2WSYA 4TV6A 3W25A 1TE1A 4KGJA 5G2WA 2CESA 3D5HA 4S3KA 5G4WA 9XIAA 4L5ZA 1AH3A 1U5VA 3BH4A 2JE8A 3ZR4A 3VYLA 3IUIA 1OFPA 3AHVA 3HGSA 1XBYA 3L0NA 3W7RA 4F40A 1RVGA 2YKKA 1T8XA 4EF8A 1QHOA 1BHGA 2PZNA 1G1YA 1BWKA 3AS1A 2V81A 3WMBA 3T0TA 1GNXA 2REQA 3ITGA 3CQJA 4MDOA 3SRKA 1TCDA 1JRCA 3I6TA 3AXXA 3CUXA 1KFWA 4KERA 1IXOA 4TV5A 3W2MA 3ZJ8A 6REQA 1T6MA 3MMUA 4O17A 1OX5A 1K4GA 1R7AA 1WKEA 4CD8A 2HBVA 1A4MA 2GK1B 4CVUA 4X0NA 1ZJIA 3S9ZA 1TVLA 4AU0A 1BVZA 1L2QA 3VFCA 4V27A 1VFUA 2OYMA 3FDKA 4J3VA 3I6EA 4HOZA 1TJ0A 3EPOA 4C5YA 4PUJA 4JQ2A 3ITLA 3BLLA 1YNYA 2DZWA 3CUGA 2NX1A 2G95A 4HA0A 2DGAA 4YMZA 3LTYA 4WSHA 2A3CA 3TYDA 4GRSA 1HJQA 2E8YA 2BS9A 1AL8A 3N2CA 3Q65A 3WLTA 3DAQA 3WQ4A 4D6IA 4JR5A 3WLQA 4MMWA 2NQJA 5C70A 3H7VA 3U2EA 3QV7A 2WO5A 2VZUA 1H1ZA 3I65A 4IQLA 5FI8A 3K1GA 3S3GA 1EH9A 1C90A 1FP9A 4GQ0A 3RK8A 4H7CA 2GZXA 3UNDA 4YHGA 5IHRA 4RKAA 5C2CA 1O4UA 3NQDA 4PODA 3FKKA 4LS2A 4DLFA 5D30A 5BXPA 2DIEA 1NFBA 4WGXA 4PUEA 4O57A 2YDRA 3U48A 1M6JA 1JCTA 1XYZA 1LRTA 4ZOCA 4JXCA 2FTWA 3LSCA 1D8WA 4XAPA 3DXIA 3F4WA 4BFAA 1U33A 4JNZA 4Y90A 1ZSXA 3B0PA 2IUZA 5CBIA 2WVVB 1TPUA 4W7VA 3E0IA 1FWJC 1FWFC 2CKSA 1RAKA 5JH1A 3VCRA 5G1MA 4Q33A 1E1CA 2PCQA 3JRKA 3OLIA 4DWSD 3CPGA 3OIXA 1LCOA 4JFWA 1GHRA 4HHLA 3QN3A 3TWAA 4MOZA 1QAPA 2WOQA 3CT7A 3O63A 4O1EA 3EOEA 1G5AA 2HXTA 3Q4DA 1K1DA 2Y2WA 1M01A 1KFCA 4FO4A 1C29A 1M1BA 4CNTA 4BR1A 4C1NB 4E8GA 1UIPA 4IWWA 4G56A 4KFNA 1E6NA 1NSJA 4UFIA 1GKRA 1CTNA 1ME7A 2XN0A 2ZQ0A 4IIHA 1J5TA 2PC4A 2OWXA 3BZJA 1O5XA 1JZ5A 4L4OA 3WH7A 2QV5A 2Y8KA 3QMSA 3AHYA 4PTWA 3K4WA 2VNCA 4BEQA 1C3FA 3RO8A 4K39A 4MB3A 1Q2RA 5D2TA 4WOQA 3W76A 3ZLFA 5A6JA 1I2RA 1UBPC 1Q6RA 2QVNA 1A0EA 1NY1A 3W7EA 3GXDA 3DUGA 1PE1A 1VHNA 4FMVA 3QC3A 1LRQA 5DT7A 3V7PA 1FWCC 1VHCA 3WQ5A 1E0TA 5CLWA 1ZALA 1JCNA 1BQCA 4NAEB 3KBVA 3VIFA 3SGGA 2ZRXA 4Z1CA 2ZKMX 5DO8A 3IACA 1XLBA 3I7SA 3SCPA 1MUWA 2AAMA 1JAKA 3BLFA 5AKQA 1QASA 1TMQA 1E4MM 3QKZA 3W7DA 2VC6A 3UVAA 2VZTA 3IJ8A 4W5ZA 2VX7A 3VIGA 1DJZA 1WCGA 2QGYA 3NQVA 1VCVA 2C1HA 3FJ4A 4E4UA 1F4AA 1K4HA 4XQ6A 2J75A 3KWSA 4L4PA 2CXEA 2D20A 1Y65A 4RE4A 3A3WA 1YMYA 5DFAA 2VXNA 3PBVA 1VRDA 3PS7A 2WNZA 3O06A 4GX9A 1PWLA 3WG6A 2CCRA 1F8MA 3HJZA 1OFRA 4O4WA 4UQBA 5M5DA 1PKNA 1TA3A 2E1WA 3O16A 5HINA 3TR9A 2QXWA 4ZSTA 1VQTA 3VKKA 1IV8A 4Z2LA 4IG2A 5CLTA 3PVFA 3UT0A 4A21A 3ZR6A 3Q94A 3DHPA 4UC5A 3AJXA 2R24A 4GC4A 4JBRA 3CASA 3VNLA 4IF2A 4KQNA 3GAKA 2XUCA 4X61A 1JPKA 3RM4A 5LNSA 4LRSA 5AVNA 4M56A 2HV5A 1IWPA 1MFVA 2DT0A 2VEPA 3WFZA 2Y61A 1QVBA 3AYVA 3BO9A 5D2WA 4J27A 4G8TA 3W7KA 2WCSA 4MWAA 4MDPA 3NPUA 4GGHA 3S47A 3PUOA 3QHNA 4A2SA 5CJMA 4LWWA 4YVVA 2P8BA 4MLRA 1B3YA 4XG1A 4PRWA 3S2LA 1KFEA 1JZ7A 3NZGA 4GQBA 1TR1A 2OQLA 3CL6A 2ZRWA 4US6A 4WXYA 3IVTA 3V0SA 3GM8A 4DBUA 5E0FA 2NSOA 2VJXA 2XGZA 3THCA 3I6RA 3QQ0A 4MNMA 5C2XA 5U7SA 3VOIA 1JDFA 1KBJA 5AZ0A 5CC7A 3OLEA 2Z1XA 1OYAA 1TB3A 3EOUA 2OYLA 3WF1A 4H6KA 7XIMA 3CAQA 4DJDD 3AZSA 3SM0A 2WKLA 1E6XM 2EHHA 2AQOA 4Q4RA 4RNIA 1OADA 3TOPA 3LLFA 4GNJA 1OK4A 4BZYA 4JQ1A 2PE4A 3LCXA 3D3FA 5CJNA 4NZ4A 4YCOA 3TP4A 4LY8A 5XINA 4OOZA 3AU6A 1XX1A 1I2PA 3UJ2A 5AHIA 1C91A 1KM6A 4JTAA 3Q58A 2PWUA 2EEXA 4IL0A 1D7FA 3LM3A 3GSMA 1ML1A 3QV6A 1ZFJA 5IDZA 2WZTA 4YVPA 5BXTA 2OLAA 3JS3A 4M81A 4HYRA 5E6ZA 3N14A 5IFTA 4UNLA 3W7JA 4QISA 4YTRA 1EC9A 1K9DA 4PTNA 4GI4A 4P2VA 2H8XA 3B9OA 5EBAA 3DKLA 1CDGA 1LG2A 3AWOA 1UIOA 3W70A 4HZ8A 3GVVA 2BGSA 4GCXA 2PEVA 2ISWA 3II1A 2AL1A 4Y9PA 4Z17A 1OM0A 3RCYA 4RNHA 1B3OA 2A79A 4Z2KA 2E6FA 2P10A 4JOMA 3T42A 1QPNA 3S42A 1WX0A 3FXYA 2J25A 1Z48A 2X1RA 1CWYA 4HZ6A 4WR3A 1GK8A 1DL3A 5LIYX 4IQJA 1P0NA 4GIYA 1U22A 3P61A 1TTJA 1KGWA 4ZBCA 1Q6DA 4AHQA 4H9MA 4C7FA 3A21A 2FZNA 1YQ2A 5KITA 3PG8A 3AMDA 1MEWA 1H60A 2IPGA 3S0CA 1SJAA 3MSRA 4H2CA 5CPNA 2INFA 2DJXA 2XN1A 3ZS4A 3P84A 1WQ5A 1HP5A 4JYEA 5I3DA 1W9UA 3H22A 4K37A 5I03A 4H9TA 2YZRA 4Z2GA 5LIKX 3T9PA 1WYIA 2JKAA 3MVIA 3EWZA 2QCGA 5A8MA 5HUOA 2QPSA 2W27A 4UFHA 5GNXA 1KM0A 4OE7A 3N4AA 1UD4A 3BW4A 1GVEA 2VVNA 4B5XA 2XFYA 4LV9A 1OFOA 1V08A 1HL9A 5G2HA 2ABBA 1M41A 3UWVA 3K5XA 2QR6A 2HEJA 2FLIA 3WJWA 3KZPA 4E6MA 4NXSA 2WMFA 3M0IA 4P8XA 5J04A 1VS1A 1EWDA 4XUGA 5DY3A 4PGLA 1L6YA 4ZE5A 1Z6KA 3NSMA 1E40A 1UH3A 1F05A 3NVDA 4XTDA 3CMFA 2VGGA 3B06A 1J0KA 1XLGA 5DCBA 2C15A 5K9CA 5BCAA 4W86A 3QPYA 5AYZA 3LERA 1PIGA 4JN6A 3MYOA 1Z69A 4MJ2A 2AQVA 3L66A 3A3HA 3LGEA 3AYTA 4QS5A 4CCDA 1CB7B 2CNCA 1SUXA 3TFXA 1B57A 3CH9A 3UBPC 5JU6A 3RN6A 1BD0A 3GG0A 1OGGA 4UMCA 4P7LA 1IXPA 3LCIA 3AS0A 1E43A 4L1WA 3KAOA 4C6CA 2Q6ZA 4ZL1A 4QJ5B 1R3QA 4I7VA 3NSXA 3RCMA 1MUMA 2XGIA 2OB3A 1M9HA 4HMEA 5I79A 1Z42A 3GFZA 3W7GA 1KR0A 1DEDA 3MKKA 5CZKA 1HXJA 1TG7A 1BEUA 4PCNA 5A2BA 2JQXA 3SW6A 2RUSA 4Y2WA 1UH2A 3E02A 5LA2A 2Y4SA 3GG1A 4DI8A 3FJ6A 4PMOA 1LRNA 3GHRA 3LA4A 3NOEA 4MZ1A 2OG9A 1XC4A 4PUKA 1GVQA 1XIHA 3OBEA 4N42A 4CEUC 1XF0A 4D1JA 3CJPA 4BA0A 2Y5JA 4U2YA 4FXRA 5KINA 1JJKA 5A2AA 4QJ4B 4Z1BA 3GNRA 4A3YA 1XIDA 3TR2A 1DBTA 5AHEA 3ARPA 1E72M 5D9MA 3OEXA 4ZFMA 1XV8A 3B8SA 4L56A 4PSPA 4PB5A 2PI6A 3QSTA 1E4IA 2DVTA 5JBEA 4FNUA 1GOXA 4OZOA 2QEZA 4PMNA 2WXDM 3DFPA 3EXSA 3LI1A 3BLPX 3MC5A 2CLKA 3TNBA 1S2AA 2XIIA 3EOSA 3ARQA 1QPRA 3BV7A 2Y7GA 3NGFA 1AG1O 1R3WA 4XAYA 1V6WA 4AISA 5KZDA 2EKGA 1ITQA 1IF2A 5C54A 1SO5A 3W84A 4E2DA 4W84A 3W1TA 1J18A 4D8ZA 2J7DA 4I5RA 1HT6A 3EX2A 2ATMA 1JF5A 3TTEA 4A05A 3B97A 2GSJA 1Q6CA 1OGBA 1UC4A 3IIPA 1XGZA 2V0TA 5HMSA 3VFLA 1TCMA 1K8ZA 3UNTA 1T5AA 2TRSA 2Y8VA 2CHRA 1XQLA 3BAXA 3I7QA 4A3UA 1NARA 4WKHA 2B7PA 4POCA 4MWAB 4ZQNA 4MNLA 1SZRA 3MBDA 5D2YA 1TA3B 3V5FA 2HBXA 3BLOA 2GWNA 1UQYA 4GY0A 3V1PA 5FEXA 2BVYA 4QG9A 5K3VA 1XRSA 4JIEA 1JZ2A 1CEOA 2VC5A 1J8VA 2O9OA 1EUNA 3GNNA 3M6DA 4FLRA 3LY0A 5LZLA 3W1AA 5D38A 5ABHA 3ARRA 2ISFA 3OG3A 3P3BA 2DT2A 4JTGA 1JDEA 3P14A 4RXFA 3URNA 5C5YA 2NLIA 4FHAA 4JAWA 3BARA 3A4JA 4M6QA 5HUPA 3WH8A 2CIPA 2A21A 3VKCA 4DO6A 3GFXA 5TD4A 1E6ZA 1KCLA 1FCUA 3RPTA 4OHQA 1OEPA 3LBMA 3MANA 3S46A 4G5DA 4GYJA 2J47A 4KEMA 1V02E 5CZTA 4NL1A 3IJDA 4WEVX 2JGYA 1J0YA 1REQA 2YL8A 3H21A 4QROA 3LB0A 1TZ7A 2QAFA 4LYPA 2OOFA 1YKWA 2ZC8A 4DB7A 4RUBA 3FLUA 1QNQA 4JEQA 1KKRA 1SZFA 2NQLA 3OYZA 1KD0A 2PRLA 3VPLA 1G9HA 2EGZA 4OWGA 4FB7A 3IGSA 3CPRA 3HGOA 2NWRA 1CXFA 2BDQA 3W6LA 4PFHA 2Y6ZA 2YL5A 1J2BA 2XTKA 4O10A 4Q4KA 1B3ZA 1P1XA 4LRTA 1NVMA 2PDJA 1PHQA 1P5BA 3AIRA 5I3FA 2PP3A 1HJWA 2SFPA 1TIMA 4JQAA 4Y8EA 3QR0A 4QDWA 3W29A 1UP3A 1IZJA 1FWSA 4NSBA 3P93A 1TX2A 2R91A 1NDVA 2PGFA 4ZB5A 3B9NA 1VD6A 3IAPA 3W88A 1OVDA 4KS0A 5BWAA 4WJEA 1MZRA 4DBSA 2HISA 2QPXA 2G4FA 3HV9A 1EYWA 5BWFA 8CGTA 2WM1A 5CEWA 2WZIA 1XIIA 3KWXA 2ZBTA 4LYQA 2YXOA 3AXMA 2VD9A 4E2OA 2YCJA 3D3AA 2OPJA 4HOXA 1XLDA 3AROA 3LEPA 4QGCA 3WELA 5RUBA 2H3BA 4M1RA 1W54A 3AIBA 3QTGA 1S5WA 3NQ7A 4B5VA 3APYA 1A50A 3WDPP 1Q7QA 4UTHA 1CNVA 2WV8A 1ISZA 2PDCA 4NG3A 4BQ2A 5CC3A 2DV0A 4LTSA 4P7QA 1YTEA 3QPZA 2W67A 3N2XA 1LTDA 1LLZA 3R89A 2GOUA 3EXRA 1KCXA 1KV5A 1O60A 3QF0A 1E6QM 5I3KA 4ERGA 2I5QA 1AK5A 4RJEA 1XKYA 3EX4A 1FVPA 2VDGA 4FF5A 5F4XA 1EX1A 1LWIA 2GYIA 1ZAIA 2QCCA 4HNLA 5E6YA 4RV3A 2NV9A 4JICA 4ES4A 5TNVA 3WEMA 3KHJA 3NQFA 3MV01 4Y7EA 4A8RA 5I07A 1K6AA 2WMIA 3AXKA 3B4YA 5I3JA 4PC8A 3U6WA 5IXEA 2WVUA 1G7VA 3ANUA 3B40A 4HNVA 3R10A 4DQWA 2X1TA 1V8EA 3TYZA 3PHAA 1YX1A 4O1BA 4QLJA 1TFVA 1E15A 1OB0A 2TSYA 2WJZA 2GDUA 4HA3A 2O9PA 1MW3A 3MWCA 3B9DA 3RLHA 3ZVIA 1VBJA 1EXBA 4NJKA 4J9JA 5LXXA 1CI1A 7A3HA 3W1MA 1F2JA 3PAOA 5I7GA 3D46A 3VMOA 2FZDA 1EEPA 4DJEC 1WXZA 2ZWYA 5AHMA 4E8CA 3SJNA 2X8RA 5A3HA 3LPGA 1RBLA 2WJDA 5TQLA 2XH2A 1TPDA 4UMBA 1UP0A 3E96A 3WK3A 1F3WA 2CFFA 4AX6A 1UJPA 3HOJA 1CCWB 3A24A 3R0UA 1YLVA 1WOAA 3VD9A 1LLOA 2TYSA 3MVTA 2W6RA 3U2OA 2XIJA 2AL2A 3VIHA 3S5SA 3H2EA 1M7OA 1E0WA 4QNWA 2HE8A 2YDSA 4TVUA 3CAWA 4GVGA 4JFSA 1XHGA 2DEPA 3CQKA 1SW7A 4LS0A 3AYRA 1OINA 1XBVA 2DZXA 3M5XA 4KT2A 1DOSA 3V4BA 3PTMA 2HXUA 1S3TC 1WZKA 1LYXA 3HIJA 1KNWA 2ZTJA 4L1GA 3UG5A 1FWHC 1FWIC 2UV8G 4DAFA 2AQWA 4LUYA 2PWFA 1VYSX 4K68A 1KRCC 4Q32A 2PLMA 1SJBA 4BS0A 3G24A 4ML4A 2ISDA 3T4CA 3A13A 4W85A 3DHUA 3NTYA 4N0RA 3W7MA 1KQZA 1L0PA 3F4CA 2YDQA 2QIIA 1KM2A 2DVUA 4CEXC 4LAMA 4W89A 3TH6A 1X1NA 3EZ4A 4ILSA 5D32A 3GTFA 1AMYA 4RNJA 2WZHA 4W8BA 4QX4A 2XH4A 5DMLA 3U2ZA 2VI0A 3ABZA 3QFEA 1E1EA 3DHFA 2F6UA 1SO4A 3M64A 1K8CA 3W7PA 4ZTXA 4AD4A 2HE5A 2J27A 3HN3A 4M51A 3WH6A 4PMDA 1KFLA 1MQPA 1NJJA 2ZZ1A 5D9NA 1NDYA 3WNOA 3M7SA 1TWIA 2DORA 4C1NA 4KWVA 1PKLA 4MZYA 3FOKA 4HCDA 5HK4A 1KFKA 3NYDA 1JF6A 1ZB5A 1OBAA 4OV4A 3CQHA 1UWSA 3RGTA 1VEMA 2GQ3A 5TAOA 3UWZA 2WMIB 3STFA 2FPTA 4GWEA 4HN4A 3WMCA 4DNMA 1FWAC 4NRRA 1Q7MA 4CNSA 4R27A 1R9YA 1QO2A 2E8ZA 1UG6A 2DDXA 1KRBC 1HVQA 3GYEA 4DHGA 4XD3A 5K4XA 5C9XA 3TN4A 3WNKA 1SO6A 3H53A 1R7OA 3QMTA 4CN4A 4AXKA 2WM0A 3ALGA 2YXXA 2BTMA 1Y0EA 4MHBA 3BAKA 3LMZA 3PJXA 1Z3NA 1ZBKA 1W1B1 1JXJA 3GXPA 3MUZ1 4GUJA 3W2UA 4U31A 1VRXA 3DFTA 2ZXBA 3VGGA 3THUA 5EFFA 2CLIA 4DRSA 4LSBA 5AOUA 1Q4WA 1KTCA 4CVWA 1SW3A 2BBFA 5MHBA 1X7IA 2XISA 2QVHA 1DV7A 1B30A 3U4FA 3VE7A 1XH2A 5EYWA 1LF1A 1L6GA 4PTDA 3VX0A 1FWBC 1A80A 3KUMA 3SZ8A 6XIMA 1WDWA 4UOJA 3RJYA 3BG3A 2OO6A 3W07A 4AD1A 2NWSA 3ONBA 5B80A 3SSZA 1XG3A 3OGRA 3C0SA 1F61A 3W7CA 5F2MA 5JBFA 3GDMA 1IEVA 4GI6A 1S46A 1G4SA 3GU2A 1YDVA 4O50A 2P76A 4AZ5A 1HKIA 3VGFA 3WL1A 4Z2IA 3N2TA 3KOYA 3WUBA 2XGBA 5LNUA 3UR5A 4FIQA 2JIEA 1GQIA 1DKWA 4XO6A 4UFJA 2BY1A 1UR2A 2ZZ6A 5D2XA 1UCWA 3J7HA 4DAIA 1TTPA 4YTQA 4ENLA 3U3HA 4QBXA 4E2VA 1V6XA 3SO7A 3DGBA 3M44A 1ME9A 2E9MA 2WKJA 3AALA 1W5PA 4EF9A 3LPPA 2XH7A 1HKJA 1PTAA 4KBXA 3F5LA 5BRQA 4WDXA 2G4JA 1PKMA 3KS6A 4EX4A 3L23A 3PB0A 4FOUA 4C6OA 3BZGA 4BQ3A 2VELA 2X1SA 3PFRA 2VEMA 1I75A 3UZ5A 3S5ZA 4O14A 3DFHA 1MDLA 1YNQA 2O4MA 4Q4PA 5HANA 3VIOA 4B3LA 4NUWA 3WLLA 3PJWA 3HG2A 1XSKA 2E25A 3CM4A 4KCVA 4CU7A 3GH4A 4HTYA 2ZRYA 2DUXA 1BGAA 3S1UA 5GVJA 1XP3A 1VLIA 2G3JA 1TREA 1H41A 4P61A 3A4WA 4OBRA 5F1UA 3UXDA 3HF3A 3GZ3A 1M7JA 4LQ1A 3O0KA 1JUBA 4ZQPA 3WBAA 2OEMA 2J7EA 4QHRA 3VZYA 5I23A 1W9DM 3NQ2A 3L4YA 1MVYA 4REQA 5A6SA 4H7ZA 2E9BA 2Y24A 3I7RA 2VZVA 4NP7A 1JYVA 5T9BG 3GWQA 5FA5A 2QMJA 3QKEA 4MY9A 3SCOA 4GPNA 2JEQA 4G1KA 3MU7A 3HPSA 1H7OA 1VJIA 2PZ0A 3AIUA 3MP5A 3GHTA 4GUFA 4HPNA 1ENUA 4DO5A 1SPQA 2OZ8A 5A6AA 2QKFA 1T8QA 4UUIA 3EOOA 4GQRA 4GISA 3R6IA 4R7OA 3PN8A 4UTFA 4QE5A 3W1XA 5C9UA 2B7QA 3MUXA 4DXXA 4HHPA 1MQRA 1LM1A 3ITTA 1GOMA 1EDQA 2PODA 5HAOA 2AOSA 3H6OA 5EB8A 5FJTA 2AGTA 3PUGA 4NNAA 1O7AA 2Z4GA 2ZOXA 4O11A 3SGUA 2E09A 3G1DA 3KOZA 1TKKA 5FAJA 4HPGA 5E70A 2E6YA 4DIAA 2Y0FA 5IFPA 2NX9A 1QPOA 2VFGA 1S2WA 6TIMA 3FS2A 4V2XA 3LCHA 1HJVA 2CERA 2BMBA 1CX9A 1RD5A 3A5VA 2OGYA 1OIMA 1Z32X 1KXHA 1Q3NA 2AMXA 1ONEA 2RKXA 2WBGA 2WHMA 4PMZA 3MDWA 4PRRA 1VKFA 2GL5A 2HZGA 3H2FA 3PUEA 5CC6A 4FX7A 4LEFA 1KM3A 1S3HA 2Y1HA 2EJAA 5FJPA 1WO2A 4U5IA 4TU1A 2WCAA 1QNVA 2OKOA 1MRAA 4UTWC 1IEQA 3UG4A 2W3ZA 1OWQA 5G4EA 1JULA 4P8WA 3IJ6A 5C9WA 1Q6QA 3OODA 2GDVA 3M47A 4IJCA 2ANUA 4LF1A 1QHZA 3WX7A 1QATA 4JIHA 3ZOAA 3ARSA 2CLPA 4QTGA 3OJGA 1NM9A 1AH0A 3EWYA 4I5UA 1B3XA 3U2CA 2W4XA 3WJXA 1UMLA 3SFKA 1FHLA 1X98A 4ZO9A 4GNVA 1VBUA 1VPXA 4M6PA 3AUOA 4IMAA 4D8LA 3NQMA 3KRUA 4PB4A 1WA3A 1V6UA 4FS9A 5J5DA 4IJBA 1NOUA 1R9XA 4TVDA 2C1GA 3W7LA 4U3AA 2ZC1A 1NELA 4NI8A 1FP8A 2Z6JA 3IJIA 3VZXA 1XLAA 3SY1A 3TQPA 3T6CA 3IWPA 3QR3A 5FKYA 2E67A 3QHMA 5ABTA 1LROA 4D6JA 2YW3A 4K3ZA 3H2OA 3BGAA 4M80A 2J7GA 1BYBA 3ZXWA 1H7NA 1UROA 4DLMA 3OA3A 1RK6A 4NYYA 1UKOA 3DENA 2PU1A 2HPMA 1OD0A 4X3ZA 1WNOA 5CPMA 2WQPA 3VNZA 4J3SA 5BOFA 4KWWA 4ORMA 4LC8A 2J78A 3DFSA 2VEFA 4WSKA 4IG2B 3VILA 2GDQA 1G67A 3H4XA 3W22A 5LNVA 2XFFA 2F84A 4JX6A 1W8SA 1Z8AA 3WQFA 3TXVA 3EA3A 3K1DA 5CGTA 2ZXAA 4LX4A 3TYEA 3KVKA 1Y8BA 4ZA0A 4H04A 4AD5A 1M04A 2QUUA 3PJTA 1VC4A 1SQ7A 4N02A 4C6PA 4U33A 3TZNA 1PTGA 3M07A 4X9YA 3M41A 4F0RA 1NWSA 4G2DA 1TUFA 3N6HA 2VX6A 5K9XA 1PJ9A 3AAMA 1UJQA 3GVWA 1S2CA 1JUEA 3UA4A 1SSGA 2PTDA 5CCZA 1BRLB 1P1MA 4UMAA 1T7LA 4RPQA 3IIVA 5E09A 1UKPA 1E56A 4ZTYA 4F0LA 3GDTA 2VM8A 1VIZA 2VOTA 1XIBA 1FCQA 5CXPA 1NWTA 3T4WA 1F76A 3KTXA 5DELA 1ZU8A 3F1QA 1LOQA 1O95A 3U57A 3S1GA 1GEQA 4BQ4A 5CPSA 4HN8A 4CN1A 2FJKA 1N8WA 4UOZA 4R53A 2X1IA 3VOFA 1W91A 4AZHA 1K9FA 4M0XA 1JDAA 1FH8A 3TW7A 2IPWA 4F8XA 4ZGYA 2YBVA 2CC0A 2E28A 3CK5A 2FFCA 4JDBA 3DC8A 1YXDA 2BXZA 4ZQRA 1ZBVA 3C2RA 1B0IA 1QU4A 5AC4A 3T40A 1BWVA 3E49A 1BXNA 5MKGA 1OFEA 1OX4B 4AVNA 3OOQA 1EHAA 4YTUA 1UWUA 3BCDA 3LPFA 4XAZA 4O8AA 3CHVA 5I02A 2EJ1A 4LUJA 4MJ4A 1XPGA 1E9YB 4O18A 3OZYA 1NAL1 4AEFA 4AWSA 1R3YA 1P7TA 4BQ5A 1HF6A 4UFLA 5LNRA 5HQMA 3O8AA 3CXOA 1E5NA 2HJPA 1XDJA 1TPEA 1I1WA 3ABXA 5GPRA 3M0MA 5T9CE 4TIMA 1OGSA 3E0WA 2Y89A 1XIFA 3DFQA 4Q8WA 3ARUA 2BGQA 1FCVA 1XYMA 4NJHA 4FXJA 3VDHA 1PS9A 1UZHA 1VBHA 3WDJA 3PBMA 4JEJA 4ML9A 3EDKA 3LSBA 5K9DA 3B9EA 4RXGA 2WBKA 4I90A 1U30A 2WPBA 1NIUA 4L6OA 2C91A 2TMDA 3VMPA 4S2BA 2DVXA 3LD5A 4QAIA 3RR4A 3FNDA 1QNRA 2A6NA 1YW1A 3ITXA 4GYPA 4LAKA 4MFEA 3UGVA 2XU2A 3GU1A 3FFSA 2HDJA 4I9JA 4ZXLA 3VI2A 1UKQA 3FHQA 2L5HA 4AXNA 3CUFA 1IE7C 1QWKA 1GOIA 2X1UA 5C9ZA 1JPMA 4WQ6A 1DP0A 3EYPA 2BOFX 3T09A 3UG8A 1UYQA 2W9MA 3TX9A 4WY0F 2EQDA 2A3HA 3TFCA 3RYSA 3NQEA 2FH6A 4LANA 2XWEA 4YIWA 1K8YA 2DY3A 1UP2A 2Z7KA 3M7WA 1XS2A 2Y5SA 4PMJA 2BX7A 3W00A 3W01A 3TK7A 4MPQA 3T08A 3ZT5A 1DE6A 1JVNA 1VBRA 3ATZA 3MWAA 4C6IA 1E0UA 1JIBA 2NSXA 5A8OA 5ABEA 2QZRA 3W2JA 2GVJA 1RLDA 2ACUA 2RHGA 1FH9A 4OV9A 2XM2A 1Q6OA 1XBXA 3H12A 2C18A 4C1KA 3VK5A 3P5ZA 2Q3OA 1KCZA 3T8QA 3TAKA 1XR2A 1DJQA 4OIFA 1ISYA 2O0TA 5PTDA 4DUWA 1XFCA 2QCMA 4RZBA 4JTTA 4ZOEA 1PKYA 3L65A 1YPIA 1TPVA 5HQEA 2HRWA 3MP3A 3GTIA 4KEVA 3IGUA 1K77A 5K4ZA 2Q01A 1W5OA 1MNSA 2G37A 4N4QA 4WUIA 2YL6A 3HO8A 2GVGA 1UQZA 1JUKA 4UFKA 3SIZA 4M7SA 3QQWA 2IQTA 3APTA 3QLLA 3MUY1 5H8PA 3RU6A 2FMOA 3G0UA 4D6DA 3USZA 2VC9A 4Y8FA 2R1MA 4IFKA 5BZAA 4PMYA 2PTZA 3W83A 2ZX8A 3VA8A 3TN5A 1CPUA 1GJWA 3KLKA 4I7UA 3SCVA 3PTDA 1VFLA 1E3XA 1C93A 2FB2A 2X0HA 5EFDA 3DERA 3P82A 5CC5A 1YE4A 1EPVA 4LNYA 1Y5VA 4O0ZA 1JPIA 3VKAA 5HMDA 2ZADA 3AZTA 1WDPA 1BG4A 3SUVA 1UD2A 4J5NA 1SFLA 1KXQA 5EGRA 1OX4A 4E2BA 1B3VA 4GJJA 4JTIA 4JTUA 1VFMA 2POZA 3P2VA 3VD4A 1FWEC 3P80A 3LCFA 4IMDA 3LGDA 3IIZA 5BU9A 3DYMA 4JFTA 4NAEA 2EXOA 3UWQA 3N17A 2NXIA 4KWOA 3GYCA 5FEWA 1OCNA 4PR4A 2WWCA 5DEZA 4HSOA 3P74A 1I2OA 5G2IA 4M8UA 3TC7A 4ACZB 2NT0A 2Y88A 2PDQA 1FDZA 4GIAA 4UB9A 4MVAA 3W02A 1LG1A 4NX5A 1GQJA 4PMRA 3WFLA 4DF1A 2VRQA 2XZ7A 4IGHA 4NAFA 2RJGA 3H70A 5GJNA 4ATLA 3QBUA 2J77A 1QT1A 1R38A 1JZ3A 4R3UA 1R9ZA 2PRMA 3ITVA 2FZBA 2J7CA 3OG2A 4C5ZA 4EKJA 1R6WA 1NTHA 2YOCA 2IS7A 3FAWA 2Y7FA 2VURA 3NO5A 5CG7A 1EJWC 1LWHA 1AJZA 2TAAA 4IX0A 4N2YA 4WZHA 4S2CA 1ICPA 1QI0A 3PZUA 4DZAA 2WVVA 4LPCA 3UWWA 1LBFA 3LI0A 3SRHA 4Z08A 1H50A 2XVKA 2D2OA 1C9WA 4C65A 3S2JA 3OVGA 4HSNA 4XZLX 4OBTA 4I6KA 3L4TA 4X63A 1ICQA 2HTMA 4UQAA 2YA1A 2VZOA 1JD9A 1GQNA 2PWGA 4LXFA 4AEEA 3CNYA 4Q6JA 1RQHA 3VIIA 3U0HA 3ABOA 1LUCA 3PZMA 1ZCOA 1J96A 1PX3A 5E9AA 2HK0A 2ALDA 2BXVA 1NFGA 2DP3A 1XLIA 1A5MC 1V3MA 5AYBA 4BK9A 3SEPA 3LRLA 1P4CA 5I06A 1OY0A 3GNPA 4L9XA 4ZENA 3WQ8A 3C0QA 2YBTA 2JF7A 2VQTA 1H11A 1BVWA 1F73A 3F4DA 4R34A 2J7FA 3IVUA 1OJXA 1WZAA 5I5RA 3PNZA 2OT0A 2F6KA 3CMGA 2PC8A 3N9KA 3YPIA 1PXGA 3W7NA 1N8FA 1XD1A 3L5LA 4K1GA 2BY2A 4F0HA 2ALRA 2NT1A 3C5QA 4RK8A 4PA8A 4XD5A 4YVXA 4H9YA 1W3JA 1S5MA 5F2IA 1EGMA 3HA1A 3QR1A 3OVPA 3EDJA 1F6YA 3SCTA 5A95A 1GZ1A 4J2PA 4IPLA 1HFBA 5FESA 2Z1VA 3T0AA 5EU9A 3INPA 2VOMA 3UG3A 1IT7A 2VFEA 3PY2A 3C4UA 3KTSA 1GG1A 3W1RA 4C1LA 3MI2A 4NYUA 1H2JA 1KO0A 2WZEA 4WKAA 5D09A 1HJSA 2NQ5A 1QOXA 5C8BB 1RP8A 1ESWA 1W1TA 2AKZA 1BPLB 4UQ9A 2YZ5A 5BXRA 2PWHA 3ZJ6A 3LENA 2V68A 3H2CA 2ZE3A 2GK1A 1P43A 4ACYA 5HULA 3COTA 2ZFAA 4H6EA 2PDMA 2PP1A 3LCLA 1F07A 2GQ9A 4WDTA 4NQ1A 2ZUNA 4MFDA 1W6TA 5CPQA 1WXYA 1CIUA 1Q6FA 6REQB 3TU9A 5GJPA 1AW5A 2AKMA 2UY2A 2HSAA 3VC6A 2XN2A 1HTIA 3QY8A 3DBNA 1WP6A 5C6MA 1E71M 4FNSA 4PCPA 2E4TA 3W23A 1EQPA 4E3TA 3F2BA 2IPFA 5D2VA 4PCSA 1YXCA 1DXEA 1QUMA 3QY6A 4U10A 1CGUA 2DW7A 1G01A 3WIJA 5DMYA 4Q8NA 5LIUX 4IPPA 2WJEA 3WL0A 1WUEA 3S6TA 1TJ2A 5CBBA 1XLMA 2FVMA 2VTFA 2X0SA 1ME8A 3QMRA 3SCNA 4FX6M 4EXQA 1ZL1A 3WBYA 1IWAA 5L6UA 3M0LA 3T05A 1DJHA 5DLCA 2C79A 3HG4A 1P0KA 2D3LA 1UH4A 3QZ6A 4ALDA 3AMKA 4A3QA 4F0MA 3CIXA 2R9RA 4RE3A 1DJYA 1O5KA 3KRSA 4BF9A 5M03A 1W3LA 3LYEA 5I3IA 1VYRA 4Q8MA 5H8UA 2Z26A 2V30A 1H62A 4AY8A 1OG0A 1GYLA 3TSBA 4FLOA 4JTRA 1V77A 4I7WA 3M16A 3K4AA 1TJ1A 3TQKA 1PPIA 2LLEA 3V16A 2J74A 1QOQA 3NURA 1KM5A 1ZLPA 3WLMA 3CHCA 4V1YA 3UZJA 1KFBA 1K9EA 4A8LA 4A4AA 2PDWA 3O1NA 1NDWA 3UEQA 3S5YA 4PUMA 3A4XA 5J8LA 3GC5A 3K8MA 3CAVA 3H26A 4MY8A 2Y7DA 5ECUA 2A0NA 3CV7A 4IPIA 1BFNA 5KTLA 1IGSA 4FNQA 3WMSA 1G4PA 3UESA 5IDIA 4FIRA 3RITA 4TR9A 3DC0A 3KM8A 4DPPA 5DN1A 3EB3A 3HM7A 3EKZA 4GHRA 2NV1A 4H4IA 2F61A 3PC0A 4ZB2A 1E51A 1X7FA 3VOHA 1M7PA 3GUWA 2IXUA 6ENLA 5EMMA 1EZWA 1QHPA 5F1VA 3URBA 2GQ8A 3ARXA 1MO0A 2PDKA 1PDYA 2WMHA 3L9CA 1CENA 3LLXA 4MAZA 4MF4A 4JIRA 4ERIA 1FWGC 2PD5A 1WKFA 4JIIX 1HX0A 2DU2A 1H1YA 4ROQA 3CMJA 1V3KA 4YLWA 2CBIA 3RHGA 4XKYA 3EDDA 3C52A 1RLCL 4M29A 2AL2B 2YYTA 4M5PA 1AVAA 1GONA 3W6MA 1OFAA 2YCKX 3N29A 1F74A 3WEZA 2WHKA 5M17A 2X05A 1XSJA 4WRHA 1VH7A 3B8WA 5HMFA 5H2ZA 1LBMA 2J8GA 3P7YA 3R1ZA 2NQ9A 3RR1A 3IRSA 3CHFA 3W71A 4IPJA 2OZ0A 1EKOA 1L6WA 1W1IE 1ADDA 1KR1A 1W9BM 2R1KA 3OBKA 4F48A 4PBEA 4GY1A 3H7RA 4BF5A 2NX3A 4FOJA 1S39A 1H3GA 1J0IA 2QCNA 2QDHA 4HT3A 2Z29A 3LCWA 4JKKA 3PWAA 3EWDA 3BOLA 3QW4B 4PMVA 5AB3A 2D0GA 3DFOA 1VFFA 3G3MA 1Q6GA 4AAJA 1EXPA 1O1ZA 3DBPA 3UJEA 1A5BA 1J12A 3IJQA 3PSWA 2PGEA 3N3TA 1XG4A 4XSMA 1P6WA 1NP2A 4LUIA 4TMCA 4OFCA 1LL4A 4RW3A 3FEMA 1TPWA 3O3RA 3L5AA 3CUZA 3DFNA 4W9TA 2FHBA 4NY2A 4A3RA 1K70A 3KLLA 3IUHA 2H90A 1IEWA 4JTDA 5DF0A 3V36A 3IJLA 1BLIA 4MKSA 1KB3A 3EA2A 1D7KA 3WLHA 2VGIA 3G22A 3DN5A 5A2CA 2NLYA 1OHLA 4PYSA 3MW7A 3WMLA 2X7VA 1S2UA 3UXAA 2PSNA 3QEZA 5CSSA 1S2TA 4B2DA 2YCIX 3ZSTA 5JIWA 4CGTA 3GBEA 3AOFA 4X60A 3NEVA 4XBSA 1V3HA 3F7JA 2PBGA 1ZUAX 1EB3A 2C3ZA 2GJNA 1W3HA 1MQQA 1LUCB 3S6OA 4L6DA 4JZ5A 4O12A 1Z44A 3ABRA 4PZVA 4TX9A 3TAOA 3VC5A 1RQBA 3C8NA 4QE4A 9RUBA 2OODA 5AC5A 3N6JA 3VOJA 1JFHA 3LV6A 3G0SA 4TTUA 4W4QA 3IV8A 2BWGA 3RM8A 2F2HA 4PH6A 1SM9A 5JXQA 2V5JA 5M2FX 3OQ8A 1A4LA 1TV2A 1EA9C 4FF7A 1DVJA 1V6TA 2D0HA 4QDMA 1AW2A 1RJQA 4Q8OA 1GVFA 3KDOA 3WEOA 1ONWA 3MQTA 1KBLA 3W2NA 1J5SA 1JCJA 3PZ9A 3PFMA 2GUUA 4HJWA 4DVOA 4BI5A 4E0CA 2HVNA 2E9LA 1DPMA 2EPKX 2D3NA 5BOOA 4PRTA 5A6TC 3VUSA 4NJGA 4NZJA 1ODUA 2PGWA 2D24A 7REQB 4AX7A 4GMEA 3TQ0A 3M43A 2CITA 2WKGA 3C0JA 1F8IA 2KAUC 3DGRA 1ELSA 1Q8AA 4UIOA 3OLDA 2GJLA 2BHUA 1YHTA 4D6FA 3RIKA 4PCFA 4RDWA 2BLEA 2ZCGA 1B5TA 1CXEA 1Q65A 1FQ0A 1KFJA 2E6AA 5I3HA 2VP8A 4BEUA 4UCFA 4YWIA 2CXGA 3L12A 1H7WA 1AMKA 3BW2A 4S3BA 3UP8A 1M3UA 4GUHA 2YFOA 3AO0A 2ZUTA 4R33A 3EWXA 3AU2A 1TV8A 2DSWA 2PLCA 5D04C 3EKLA 3IGHX 5DBTA 4MUPA 2Y63A 3JUGA 1US0A 3MHGA 4CNUA 3SADA 3MHFA 2WC7A 4AIUA 1B31A 1QDSA 2DUZA 2Z1KA 2DZVA 5H8MA 3FA4A 3HTWA 1IT8A 3BQ6A 4O16A 4AC1X 3B8UA 3HPAA 4GZEA 2CWNA 3RLGA 4HP5A 1A5KC 1ECEA 1WAWA 4AH7A 1XRTA 2QULA 3JZUA 3TLLA 1RQEA 4KWUA 4JS3A 1EP3A 4DUXA 7ENLA 4GYKA 4B5WA 3EX1A 2ASHA 2QYGA 3M46A 1M53A 3O07A 4AQLA 4XZWA 1WDSA 1XSIA 2DZPA 3H54A 2P8CA 5L9FA 3KCOA 3SN1A 1KCKA 3ZWTA 3PTQA 2PTYA 2VDIA 2BXYA 4LYRA 2D2GA 2C13A 1XLKA 4PUUA 2ZUMA 4FNTA 4F9DA 3VDBA 4HNUA 4AIOA 2X7WA 3W9ZA 1GOOA 2HPIA 3ZLHA 3KBJA 5DT5A 2GUYA 1XUZA 3SRDA 3UJRA 1XYBA 6ALDA 3HBLA 2OSWA 5EKYA 1E9IA 3STGA 1Y5WA 4EPBC 3L68A 1VBGA 1PIIA 3E2RA 1QI5A 3H55A 1TQXA 1UWQA 4XIAA 2CLHA 3WYZA 4Z2HA 4HU8A 3KXQA 2C0AA 2ZX7A 2GJXA 4TO8A 1BAGA 3W2LA 3PBGA 1XH1A 5FEZA 1JEZA 3CZLA 1EJSC 1R47A 3AISA 4K7YA 2ZZ5A 3M6YA 3KOWA 3GDKA 1I2QA 1XYFA 2QLYA 3MZ2A 2X2YA 3SCSA 2YW4A 1OK6A 2VGBA 4WSJA 1EPXA 3LLDA 4RLIA 1SZGA 2Z2BA 4EOUA 3MSGA 3IEBA 1KV8A 5HNUA 3GH5A 3R8HA 4ZFCA 3EKGA 3JU2A 4IQEA 2X42A 1ICSA 4EAMA 1BWLA 1YRRA 1UR9A 3WK2A 4Q8PA 1W3IA 3WDQA 1WDDA 4MIMA 4WJ8A 4WOZA 5HWMA 3UVIA 3WJYA 3LHWA 3QOKA 1GOKA 1XISA 3MMWA 2QUTA 1XDMA 3KL0A 4ECLA 3R25A 3O05A 4UTTC 4OBSA 2DSUA 1JZ4A 4DWSC 2OO0A 5HNRA 1GQLA 1TUXA 3AS3A 1UD6A 1WE5A 1JDCA 3PG9A 4LBRA 4H8NA 4Y9MA 4NILA 1XFBA 3I10A 2C0HA 5DRCA 3WNMA 4QEHA 4U28A 1EIBA 2OLHA 1QK0A 3E3HA 3EPNA 3ITOA 5CSUA 3MCNA 1UKTA 4HPXA 3ZO9A 8A3HA 3G1VA 3SCUA 3QW3A 1LL6A 2QCHA 3FV9A 2EBNA 1THFD 1IXQA 3SUTA 1A47A 3GKAA 3IUDA 1E4NA 2IKGA 4K7VA 3MCMA 1XDLA 5LKYA 3LDVA 3PB2A 1XIGA 1RH9A 2D22A 2VFHA 4P7OA 3DH7A 1QBBA 4DUOA 2O7SA 1Q2SA 1MW1A 4P5UA 3R7MA 3TTYA 4GFIA 4NHVA 4XAGA 3TJ4A 1TV7A 2XH0A 4OU1A 5FJOA 2F2KA 2E1DA 3EWWA 1AQFA 4NJJA 4D71A 1EJVC 1VIWA 3ARTA 1DYSA 1UR8A 1JNEA 5HQLA 5IBXA 4MKVA 1S1RA 1V51A 2GGEA 4AC7C 1QOPA 2QNEA 3WLPA 1YADA 4YJ5A 4LVDA 5D4YA 4DI9A 2R82A 4Q22A 3EDEA 1F4HA 4KW2A 3CZJA 4JNMA 3T0DA 1XYAA 1QMLA 1OCBA 4PEKA 4QQ3A 1FKWA 1XLHA 3BG9A 5HR6A 3BVJA 3W1PA 3L4UA 3WF2A 3ES7A 4XKMA 1CGWA 1XLEA 2KZHA 1TJRA 2DT3A 4Q8UA 3UU0A 1ADOA 1JR1A 4AZCB 1E6RA 2GSHA 2OCZA 1QI4A 4AY1A 1ZQ5A 4XBKA 1QO5A 2A6LA 4A8NA 3CAKA 3F4VA 3HFYA 2WC4A 1X1OA 3FW6A 4NI3A 2XIOA 4B5SA 3WDIA 4C6QA 2IKJA 3I3BA 3UYCA 3PAJA 3BJFA 2XSAA 1BTMA 4H00A 3VD5A 2CYGA 3DI1A 2P3ZA 3WY1A 2Q09A 4WKFA 1ZGDA 3ZVHB 3R79A 4Q3MA 4FEZA 4HYVA 3S1XA 3PPCA 2PWDA 4Z0SA 1UUOA 2GSEA 2JALA 4IISA 1U5HA 7CGTA 3ITCA 1PVNA 4K1WA 4LVGA 4ZQMA 2PURA 4AZ6A 3FJNA 3V1HA 5IOBA 3IGXA 2DIKA 1GZJA 3URAA 3FYOA 2CZEA 1R85A 1R3VA 2E0PA 1WPCA 2DH3A 4J1OA 1EWEA 4YYCA 1D8CA 1GORA 3BAYA 1B54A 1CGXA 1Q66A 2XWDA 4Y6GA 1TMHA 5D8ZA 1A3XA 1DIOA 1UR0A 3UPBA 3FVMA 1C8XA 1UR1A 4M6VA 4IIDA 1ZENA 1J79A 3CQIA 1AFSA 2Q71A 4BI7A 3LBOA 3GDLA 3M0HA 4D6GA 4GD0A 4S39A 1JGMA 4JD4A 3TV8A 2GGHA 2Q8ZA 3T44A 4J3XA 2EAWA 4BI6A 1F9CA 4LCQA 3CV1A 1FDJA 1JYXA 4K38A 1NEYA 2FHCA 2OGJA 3DESA 3WDRA 1UPPA 1V0LA 1A5UA 4IMFA 4LB4A 4M24A 4RDZA 1LDCA 1NH6A 1C9DA 4J3WA 4B5UA 2X2GA 4PTXA 4GYPC 2I1OA 3H2AA 4B9YA 2MUCA 2AMGA 1PYFA 3FGCA 4C6MA 3FDGA 1BTCA 5XIAA 3ICJA 3DYOA 3AI0A 1OCJA 4HOWA 2C16A 4I5XA 3GK0A 1TPC1 3CZKA 4AYSA 4IM4A 3N13A 3GVGA 2V2DA 3VVGA 4IZGA 2WHJA 4CD7A 5AYIA 3VKJA 2FQIA 1ISWA 4A6GA 1A5SA 7REQA 4FLSA 2FKPA 4J3TA 5FJUA 3OO2A 2WANA 2OX4A 4OUIA 3B8VA 3PPFA 3ARVA 1US2A 2QJGA 1KLZA 2Z24A 4MWAE 3CWHA 1PV8A 1X97A 4DZHA 4AWTA 4V15A 1D3CA 1IEXA 2FYMA 4Q7NA 4N9EA 4MGGA 3TUUA 1DTNA 4O53A 2QDEA 1ZZMA 2QJJA 2A85A 4ROPA 3VGBA 1UR3M 1XQKA 4B5NA 5KZMA 1P6CA 2V5CA 3EAUA 3RX4A 3QYQA 4JTFA 2VX4A 3LU2A 1W32A 1F6PA 3HZ3A 2EG6A 3GNDA 1KWGA 1KLYA 3SN4A 4XD6A 3EBVA 3N19B 2UZ9A 2V3FA 4ONVA 5AECA 4MM1A 3WQEA 1L8NA 1MXDA 1AD1A 4ZMGA 2JGQA 5I3GA 1VLWA 3BSHA 4QRNA 4JCMA 4X2RA 1UD8A 3CWNA 1KC7A 2EF9A 4HK5A 5I6SA 1E1FA 4M19A 1K02A 1VFSA 1DXIA 5H6HA 2EKCA 1DQXA 4H6RA 2RFGA 2QCFA 2FZ8A 1LZOA 1AD4A 1E6PA 4S3JA 3ZIZA 3NIYA 2XYLA 5CZJA 4MB4A 3PR2A 3TKFA 2CLEA 4HNNA 1RV8A 5DXXA 4X2PA 3RUBL 2G5WA 4RZ6A 3LBCA 4ICMA 4AVOA 1BQGA 3KS5A 3MP4A 5CG0A 5EBUA 3BAJA 4R9XA 4HPHA 3NQAA 1SR0A 4GXPA 2OZ3A 1R3SA 2R14A 2VHLA 1T40A 2PTWA 2WW5A 3UERA 3F2DA 1ZNNA 3PZTA 4XVDA 3H4WA 2G41A 1JI2A 1A53A 1E73M 3BL3A 4NF7A 3IIOA 4E38A 1X6LA 3MKCA 3CQ0A 4HMCA 1IXNA 2OMAA 2YB4A 4LT9A 2Q8XA 3MB9A 2GGIA 4U5KA 4IFRA 3EB4A 3GBDA 1ZS2A 3ERPA 1B2YA 2V5LA 3MPGA 2D0FA 3RRXA 4JX4A 4CNPA 3QPEA 4AZGA 4L7ZA 2Z25A 4Q8VA 2G3FA 2P50A 4KRTA 2ZUWA 3NNTA 4GACA 5E0CA 2B0MA 2OELA 1XGEA 1OIFA 3BG5A 2V82A 2PLKA 4Z2JA 1Q6EA 1XW8A 4DBEA 4L64A 4AHPA 3E9AA 1OC6A 3QJAA 3NGJA 3T0CA 1QCWA 3VDGA 2A3BA 3LCGA 3MT1A 1NQ6A 3VDAA 5D9PA 1X6UA 1TELA 1S5VA 1R3TA 3UWUA 1E0XA 4NU7A 3OLGA 6CGTA 2HNEA 4B2DD 3Q45A 2BVTA 3HPFA 2WQDA 4TUFA 3MCOA 4MY1A 3NZRA 3WQ6A 1K6WA 4JYDA 3WLRA 2QPUA 3WBXA 4WHBA 1Z41A 4MYAA 1WB0A 1R5YA 4IP7A 4PL2A 4H1ZA 3RCNA 3O15A 2VX5A 3N2BA 2Q02A 4TOQA 3M0ZA 2QJNA 1UA3A 4O1AA 4ZOBA 1SZEA 4JKMA 4GY7A 4M1BA 3NQBA 4XV0A 3WSUA 4Y9OA 2VD8A 3AHZA 2G3MA 1VF8A 3W1QA 2YR1A 3W0KA 2O4QA 2XZ9A 2PDLA 5JVLA 3AZRA 1NOWA 3K8LA 4DM1A 2OSYA 3A6OA 4AZ7A 1HL8A 3GQYA 3W3OA 4IOTA 1Q7ZA 1O66A 5KZEA 5I78A 1EX5A 3PPHA 1LQAA 2CZDA 3NYZA 1A5OC 1LOLA 3AIVA 3U4AA 5LHFA 1EC8A 4DZ5A 3O6DA 4YWSA 3QZEA 2ZZ4A 1RZMA 4C7GA 1WAUA 4W8AA 4P