3EX1A

Human orotidyl-5'-monophosphate decarboxylase soaked with 6-cyano-ump, converted to ump
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 98
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex1A00
4ALDA 1I2QA 4OGZA 1CI1A 4X3ZA 3UWYA 4ADTA 1GT8A 3NR0A 2I9EA 4RR4A 3HQ1A 4OQVA 1I2RA 2QJGA 3DU0A 1ZFJA 4JTLA 3SSJA 1X6UA 3TMQA 1R2RA 3O6YX 1SSGA 1SUXA 3RK8A 1FY6A 4A21A 4BK9A 4H3DA 2EHHA 1G4TA 3ABSA 2CZEA 3G1FA 1K03A 1F73A 4Y6GA 2B0MA 2VEMA 3LXCA 3PULA 2Y62A 3O63A 5HWNA 2QUVA 2C13A 3CU2A 5C55A 5D2TA 1GYNA 3CQ0A 1LLZA 4TO8A 3M9YA 1VS1A 3W7RA 3MBFA 4LC6A 4O54A 4PFMA 2NV2A 2P1FA 3W7QA 1R47A 3W85A 3IEBA 2E09A 1TRDA 1F6KA 3R5EA 2ZRWA 1GVSA 1K7XA 1EP3A 3OA3A 4N6EA 1W54A 3TR2A 3H54A 4M19A 3TDFA 3FJLA 3T7VA 1OFQA 4M6PA 3S8HA 1UB3A 3DHFA 3MMTA 1AL7A 2A21A 4KFNA 3ZR4A 3V1PA 3F1QA 3M47A 1KTNA 5D2WA 3VI2A 3IIZA 3NQCA 4JXCA 4NJIA 5F4SA 1V5XA 3MO7A 2VFEA 2V8ZA 4QJ1A 2E5BA 4MJMA 1SQ7A 4QSHA 1YDVA 4AEOA 1AK5A 4K38A 3ZWSA 5K2ZA 4K8HA 1SO5A 5G4WA 1FDZA 2YFNA 2P10A 2HS6A 3PBWA 3DH7A 4HNUA 1KLZA 5GVJA 1ZY9A 5I3HA 4FX6M 4JX5A 2C16A 1O94A 4LRSA 1VRDA 3P8JA 3FKRA 3NQ6A 4MIMA 2A7PA 3ZFHA 1ADOA 1XM3A 1TV8A 3W7CA 3WK1A 3QC3A 4EVZA 2FFCA 3LLDA 5LKYA 1JRBA 3B0UX 3FS2A 4LV4A 5EMUA 1YTDA 4WX2A 5AHLA 4EOUA 1Q6LA 4MZYA 2EKCA 5G4EA 1GVQA 5D2VA 1DOSA 2GOUA 4OHQA 1BWKA 3KVKA 1XDLA 2DU2A 3FIGA 2QCNA 4WXZA 2WO5A 3W22A 2XFWA 3SW6A 3P62A 4KKXA 1N55A 1OFDA 2VEPA 3LCFA 5J5DA 4CNPA 3LI1A 3MUXA 3ELFA 3NQMA 3TC7A 3LI0A 1FCQA 3NQ8A 3ABRA 3KVJA 4DXVA 7TIMA 4JYDA 5AHMA 3CPRA 5AHNA 4WY0B 4NJKA 4UFKA 1CW2A 1RD5A 5CSSA 1G4SA 4BF9A 4O12A 1W31A 4NX5A 2BZNA 3PG8A 4UCGA 3IGUA 1TJRA 3L21A 4JYFA 4PEKA 3SI9A 5LNSA 4TMBA 4R34A 5FEZA 1F2JA 5CPNA 3B05A 2NX3A 5D38A 1I8JA 4G1KA 4HT3A 2OCZA 3FYOA 2YW3A 1NFBA 1D3HA 1B9BA 1H1ZA 1K7EA 1UUOA 1XBVA 5FF7A 4NJJA 1QCWA 3TA6A 1VCVA 4Y9AA 1JVNA 1W5OA 5K4ZA 4OV9A 3O06A 1QMLA 3G8EA 4JGDA 1JUBA 2EF9A 3HMJG 2Y88A 3W88A 1J2WA 3GIYA 4LWWA 1DHPA 1LYXA 3CWNA 3PSWA 1Z41A 2Z0IA 4RLIA 5HINA 4MZ1A 2FTPA 5AC8A 4PODA 4JTTA 2B7QA 3GKAA 3HG4A 3THAA 1KM2A 1OYCA 2E1DA 3IVSA 1TTPA 4BWLA 5HMSA 2X1RA 2NX1A 4WD0A 1XC4A 3TQ0A 1DL3A 3C61A 4XQ6A 3USBA 1EWDA 4WUIA 4MY8A 4Z0SA 4JNMA 3MI6A 2A4AA 4O0KA 1S5WA 4Z1BA 4OV4A 3W1LA 2YYUA 3EWXA 3OG3A 2WV8A 5LNWA 4M6VA 3R89A 3QQ0A 3FJ6A 3LCHA 3L68A 2BSLA 2VKZG 1W0MA 3GLCA 4LVGA 5K4XA 1ZAIA 4O17A 5AC6A 2CLLA 4UTMA 1QPRA 4CNOA 1EUNA 1TB3A 1YXCA 1Q3NA 2YPIA 2QDHA 3LXBA 4O1CA 2ZRXA 3P67A 3S1WA 4U4MA 4JS3A 3W7DA 4JTUA 1PIIA 2V81A 1QPQA 1ME7A 1A50A 5FF4A 2OZ0A 1IIHA 1LZOA 3W83A 2CZFA 3CTLA 2V5LA 2E6YA 1ONRA 3TQKA 2ZZ2A 3BV4A 4WXYA 3RNDA 2YZRA 3O6DA 1DKWA 1Y0EA 3L0GA 2QR6A 8TIMA 5HWJA 2Y6ZA 5C54A 3NQDA 5CPOA 1LBMA 2DORA 3EWBX 2PRLA 1GG1A 3G3MA 4ZQMA 5I3FA 4S2BA 4UFHA 1UJPA 1VGAA 4HPXA 3W7KA 2ALDA 5DBUA 2H8ZA 1ZENA 3DFTA 3KRZA 2FLIA 2GQ9A 1XBZA 1ZALA 3BVJA 2V2CA 1W3TA 4LU0A 4JTGA 4YCOA 4NZJA 1QDSA 3G0SA 1KBIA 1IXQA 3N3MA 5D32A 1O95A 2CLIA 4UTLA 4I7UA 4XTIA 1EP2A 5KMYA 3P5YA 1TQJA 1XCFA 4DO5A 1LP6A 1C8VA 4CCEA 6TIMA 4RJEA 3TXVA 3W2JA 4K36A 2J9YA 2QDGA 3G8RA 4GUGA 4NT0A 1SFJA 4N9CA 1L9WA 5HUPA 3STGA 1UBSA 3QPYA 2ABAA 4Y90A 3P8IA 2V0TA 4K39A 2E77A 4O52A 4Q32A 1FCVA 3MYOA 4UFIA 4XKYB 2V2HA 3MHGA 5AYYA 1SZNA 3DFQA 4C1KA 3W1XA 3GKFA 1OABA 4PTNA 5CZSA 1YPFA 3W7JA 4JTFA 3TIMA 3QMRA 5HNRA 3W7PA 2CFFA 3S5OA 1CX9A 4A3UA 4GRSA 1W5NA 1HG3A 1EP1A 3N9SA 3P5ZA 1TYGA 3CHVA 3HG2A 3MJYA 1ICQA 4MOZA 4RKAA 4IUOA 3OIXA 3HF3A 1LLWA 3GR8A 3W1QA 1TPUA 3NL6A 3S1UA 3NQAA 5CSRA 1X1OA 5F1VA 1WA3A 3TW6A 1JCXA 3E02A 1FXPA 4PCFA 5HULA 2WNQA 1KFJA 1FWSA 2I1OA 4ADSA 1F7BA 3W1NA 4A29A 3QW3A 2Y61A 1QAPA 4MPQA 1GVRA 3PBVA 4MFEA 4K7VA 1QNVA 3LRKA 2GJLA 2GJNA 1PV8A 3TSBA 2E68A 3HOJA 5EA9A 2VFDA 1OX4B 3I6RA 3M5XA 4ORMA 1YTEA 3CLMA 5FF2A 4N9DA 3RMJA 3UQNA 3NPWA 1OFRA 1OFEA 4PA8A 4UTTC 3IGXA 5L6UA 4MLRA 1O5KA 2VFIA 3W9ZA 3EX2A 1RQEA 2ISVA 3E96A 4OU1A 2Q8ZA 3PUOA 1H7RA 4E0CA 3HB9A 4DO6A 3L65A 1ALDA 4RV8A 4NNCA 1LORA 1I2OA 4UTKA 3W70A 4ZQPA 5AOUA 5KTLA 2Z1BA 4UNLA 1SZEA 4HHPA 1GZGA 2QJHA 3H55A 1TPVA 3AO0A 3EWYA 2QCFA 3TNOA 1P1XA 3LV6A 3NYZA 1GWJA 4AF0B 2HMCA 2QKFA 5E0KA 2AAMA 2ISSA 3TKFA 4LRTA 2Y63A 1NEYA 4O8RA 1QOPA 3BW2A 3F03K 4CCCA 3WJZA 4NNAA 3P61A 1TCDA 2JGYA 1FQ0A 3EXRA 4AF0A 1P0NA 2OT0A 1GPWA 3E9AA 4UR7A 3PF3A 3HBLA 3KRUA 2ZRZA 5EPDA 4NUWA 1VYSX 3HGOA 3TCEA 1VR6A 2B7OA 4WY0F 1P0KA 1XUZA 5KZEA 3A5VA 1H50A 2EAWA 1Z42A 2Z2UA 3PWAA 4GUJA 1ZAJA 2Z6IA 4EF8A 5IBXA 3FEMA 5I3GA 4LS0A 3O8AA 3G18A 1UCWA 3BLFA 1VYPX 3T44A 1H60A 3TFCA 4UMCA 4FNUA 4LNYA 1IXNA 2KZHA 3PC0A 1YXDA 4FXRA 2CLHA 2UV8G 1U83A 5AFDA 2FB2A 4AVFA 5KINA 4UTWC 2WSYA 1DVJA 2QF7A 4OBTA 4FHAA 3SR7A 5BOOA 3W7IA 4HNVA 1N7KA 1VLIA 3A9IA 2QCLA 3L5AA 4JTJA 3PY2A 3WK3A 3AJXA 3W7LA 3G1VA 1ICPA 5KZMA 3TSMA 3BGGA 5CPLA 1QR7A 4HNNA 3NG3A 5FEPA 1LBFA 2NUXA 3LHYA 4UTIA 3NQ7A 2ZRUA 2ZZ5A 4O1DA 1IGSA 4GXMA 3PAJA 3DGRA 1VCGA 3SGUA 2C0AA 4EWND 3VNDA 5LSMA 3QFEA 5DBTA 2NZLA 1B3OA 1VJIA 3DBPA 3OVQA 2JBMA 1MSSA 4E2BA 1XXXA 5CPMA 2C3ZA 4XTDA 1QOQA 2QCHA 4FXSA 4I9AA 1WOAA 4OT7A 1LTDA 2YYTA 5CG7A 5D30A 3W2UA 2DJLA 3IGSA 3KRSA 1WBJA 3H53A 3TW7A 4JY8A 4K8EA 4LW7A 5L9FA 2TMDA 3LRMA 3S0CA 5LNUA 1FUYA 2VEIA 4PL1A 5FF0A 1H7NA 5D37A 1F76A 1NSJA 2TPSA 3L2IA 1WBHA 3MI2A 2WSQA 4KWWA 1DQWA 3L9CA 3YPIA 4MJZA 1IIGA 4RZ6A 1GG0A 2DZVA 4XZ9A 1T0OA 4YL2A 5FESA 2C1HA 5ABTA 4HSOA 1Q6QA 5K7JA 3P81A 3WK0A 1AW5A 1TPC1 1W5PA 3HJZA 3TXZA 2R91A 1XI3A 4UTJA 2GQ8A 4GUFA 3BW3A 1KTBA 1OF8A 2ZRVA 3N34A 4Z1AA 1W5QA 3R12A 1RPXA 1TJPA 5LGZA 2R8WA 1U5JA 1SPQA 3W72A 4UTHA 4ADUA 4FIQA 4M7SA 1WOBA 3D0CA 1ML1A 4DQWA 2Q3RA 4QNWA 2DZTA 3GR7A 4HNTA 5G2HA 1JUKA 4JDYA 4WOZA 3SZ8A 5HR6A 4XBSA 4UFJA 1I2NA 3GAYA 3MP3A 1XBXA 4LS2A 1XKYA 5D2XA 2DZSA 1TO3A 2QUTA 4IMGA 1SU5A 4ZMGA 4O50A 5D04C 2EPHA 5F2GA 5LNRA 2ZA3A 2RDTA 2JK2A 5G2IA 4O57A 1PHQA 1KFKA 3GNDA 4ZQRA 1TTJA 3BG3A 2QUUA 3HIJA 3O05A 5I3IA 4CQ8A 2XN2A 1L6YA 1B4KA 4JTHA 1DORA 3W1PA 5DY2A 2PC4A 5CZ0A 5KSWA 5TQLA 3S5YA 4IXXA 3LCXA 4BI6A 1G7UA 3M5VA 1MEHA 1ZAHA 3C52A 3W84A 4BI7A 4JTSA 3LB0A 4IGHA 1EUAA 4QAIA 1EX5A 2J9XA 2TRSA 1OYAA 2HS8A 3RU6A 1TSIA 4P2VA 1XBYA 4NJGA 1FXQA 3NVTA 4L4LA 1WDWA 3DHDA 2QCDB 3JS3A 4UMAA 2QAPA 5AHIA 5FI8A 5HJLA 5K9CA 4AHQA 4I7WA 1FWNA 3A5FA 3PUEA 1FWTA 1V7YA 1N8FA 3SIZA 1TIMA 3S6DA 2ZDRA 1FBAA 3C2VA 4GE8A 3MHUA 4UTWA 2ISWA 2ZTJA 3Q37A 3W7NA 3DKLA 1A5SA 1VPXA 2RKXA 4ICNA 3DZ1A 3LTSA 1AL8A 1SSDA 1RVGA 1G4PA 4O13A 3W2NA 3OVPA 4AWTA 2NWSA 1M7PA 4MVAA 3LBCA 4DF0A 3W1RA 3BARA 4H6KA 4Y96A 4BI5A 2IQTA 4CCDA 6ALDA 4DEFA 2JKAA 3TH6A 2VFHA 5AC7A 1KM0A 1OX5A 1VLWA 1K8ZA 2G97A 3PM6A 3GYEA 5AYZA 1LCOA 1J4EA 3S5NA 3E49A 3T78A 1VYRA 1ZCOA 3O16A 3NNTA 2QEZA 3HO8A 2X2GA 4DF2A 1R46A 4RXGA 1P5BA 1OFBA 1H5YA 3G1YA 3LXAA 3ANYA 3EKZA 3S9YA 2C14A 3DAQA 3M5YA 4N02A 1GVOA 1FWWA 1G69A 3E12A 3E0IA 4MFDA 2C19A 2ZZ3A 2Y7GA 4IQLA 1K02A 3G0XA 2V82A 5I3KA 3QW4B 3GXNA 2DZPA 3KXQA 5I3JA 2YFOA 3QJAA 3V75A 3T4CA 1VH7A 3SFKA 1XDMA 2Q3OA 3T40A 3TFXA 2H90A 4JYEA 5HR7A 2PRMA 2A7RA 1WYIA 1J5TA 1HO4A 1W56A 1A53A 5F2LA 4O0ZA 3WK2A 4K37A 2GQAA 2V2DA 3EEGA 5TIMA 2ZYFA 4JEQA 2NX9A 3NM3A 5G5IA 1AMKA 3S42A 4HN4A 3RLUA 5DXXA 3W7HA 2C6QA 3P80A 2NV1A 2FDSA 4IX0A 4DPPA 1JQVA 4AH7A 4UTTA 3UY7A 1JCNA 5LHFA 3OBKA 3C3NA 3IIPA 5KITA 1IF2A 4E38A 3M6YA 3SY5A 4O28A 3WFAA 3EX1A 1JJKA 3B03A 4LUJA 3QSRA 2ZZ1A 3GXTA 5DELA 3M44A 3N19B 4XUGA 3KOFA 1KV5A 1SW7A 3W87A 2NXIA 4LY8A 3NQGA 4FNQA 1OX4A 4LTSA 3G1SA 4P61A 2BTMA 3QQ1A 3DFNA 1BKSA 1YDNA 3NA8A 5CZTA 3DFPA 1H7WA 1JCLA 1RV8A 1YYAA 4ZVJA 3W23A 2VEKA 4JIPA 5DCDA 4O14A 3MBDA 1LDCA 2J27A 3IV3A 4L4MA 2CZDA 3JRKA 1LRTA 1JCYA 4WQ6A 3WJSA 4DO4A 3PB2A 1AG1O 4R7JA 3NDOA 3IIOA 1SZFA 3VE9A 3GB6A 3TE9A 4KWVA 3ATZA 1OG0A 3LHZA 1UASA 3LV5A 1WXJA 1TPWA 2RHGA 1SZGA 2VFGA 1HL2A 2DZXA 5AHFA 4JTEA 3LCWA 4FB7A 1G7VA 3DXIA 2G96A 4UTUA 3IVTA 2J24A 3L67A 3W1AA 2H6RA 3LHVA 3C2RA 2GVLA 3B04A 2ATSA 1JRCA 2C18A 4QM1A 4UFMA 2CU0A 3PG9A 4AB4A 2X30A 4H4IA 4WZHA 5KZDA 3FLUA 3Q2DA 4CNNA 2FQIA 1KLYA 3DFOA 3W2LA 1PS9A 3HG5A 4UFLA 1FDJA 3O1NA 1KBJA 3GXPA 4X2RA 3W2MA 4FX7A 3PR2A 3QH2A 4IWWA 2YXGA 4FNSA 3BK0A 1RR2A 3G1HA 4YCPA 3EX6A 4MY9A 3ZS4A 4Q4KA 5D2YA 3S1XA 2OX1A 3BPWA 2PE4A 1DV7A 2YX0A 4EIVA 3LX9A 2E6FA 1EWEA 4MZ8A 4Q33A 5DCBA 1HFBA 4GFSA 4NQ1A 2WOQA 1KM1A 1SO3A 2X16A 3GDMA 3EXTA 3Q58A 3P7YA 2H3DA 2QCMA 5AB3A 2WSRA 1I2PA 3G3DA 1AW2A 3CB8A 1Q6RA 4YXGA 3UWVA 4IMEA 2A1YA 3P84A 1Q45A 1JCJA 4TX9A 3UD6A 5FEWA 1UUMA 4IPJA 4HKPA 1T8XA 2JGQA 2O7SA 1DJQA 2GVJA 1TTQA 4Z0JA 3UWQA 4WOQA 2H3BA 4NX0A 2ZBTA 1MEWA 4AHPA 5HWMA 1KV8A 3LCGA 1JQXA 5CKSA 2RDWA 4ZQNA 1I4NA 2YGYA 4N4PA 3EB2A 5AHEA 4IPIA 2D73A 4MYXA 1TQXA 2BXVA 5DLCA 3STCA 2QCGA 2CZ5A 5U7SA 1NF0A 5F4XA 3QMSA 2B7NA 1F5ZA 1OFOA 3UY8A 3EWZA 3I7RA 3WJWA 1OF6A 1YLVA 3TMLA 1H1YA 3STFA 3UPWA 5F1UA 2Y85A 4UUIA 3PBYA 3HGJA 3P82A 1SW3A 3INPA 2E6AA 2R14A 3NL2A 1MXSA 4IX2A 1H62A 5C2XA 5BNKA 4JTKA 3STEA 5BMXA 4FNPA 4N4QA 1T96A 1FX6A 1SR9A 1GEQA 4IJBA 4JY9A 3VKJA 3MW7A 1QWGA 3PVFA 5HQEA 2X1SA 3HGSA 3B06A 2Y7FA 2FIQA 3W7MA 3OHIA 5G1YA 3N14A 3S1VA 3EKLA 5LGXA 4JIQA 2A2IA 1WAUA 3PS7A 3NQEA 4GUHA 4TU1A 1GTEA 2OMAA 1VZWA 3NQFA 4S2CA 5BRBA 1D3GA 5G1TA 3TC6A 1L2UA 2JKEA 1TPEA 3B4UA 3GDKA 1KTCA 3UWWA 3C56A 4LC8A 2VOMA 1X8FA 3LHTA 5D02A 3T55A 4WJEA 3C6CA 3G1XA 4O15A 1D9EA 1F6PA 4ML9A 3HG3A 5FEXA 2OT1A 3QZEA 4WY0A 3MHFA 4FO4A 1W3NA 2P0OA 1X7FA 2Y89A 2YDAA 2BLEA 2HSAA 3A21A 1GOXA 3UZ5A 5C6MA 2DP3A 4FNRA 1VHNA 1MZHA 5DXYA 2A5HA 2FB3A 3K30A 3FKKA 1KM3A 4O10A 5D03A 1E51A 3C4UA 2HTMA 2PCQA 3M43A 3TQVA 3WJYA 2H8XA 4CQ9A 4JTIA 1W37A 3CIWA 1QPNA 1NAL1 3N9RA 4RX0A 3NL5A 3SECA 3UWUA 2V5BA 3W7GA 4N2YA 2QCCA 3DENA 4UR8A 5H91A 1TRIA 3MP4A 4BR1A 2A6LA 4DF1A 1ME8A 3N2MA 3NPUA 3ABQA 2FPVA 1SW0A 5TBOA 4CQAA 3KHJA 1L6WA 2GVGA 1T99A 1S5VA 2A7NA 1FWRA 3CWOX 1DBTA 3I7SA 1QO5A 3M1ZA 4UMBA 4I7VA 4X22A 4MYAA 2FPTA 3LHWA 3L0KA 1DQXA 3W3OA 5FF3A 5F4WA 3C0JA 4O18A 5BW6A 4IMFA 1LOSA 2QCDA 1VCFA 5BMWA 3MI3A 2W79A 3LTYA 3ATYA 4LV9A 2X1UA 3G1DA 1M5WA 4U28A 1VQTA 1GVFA 4TR9A 4D2JA 2BWGA 3F4NA 4GC4A 5HUOA 4DPQA 4LVFA 4NNBA 3LTPA 3W1UA 3DI1A 1SO4A 1G6CA 3BG5A 1AW1A 2XN1A 1LBLA 1HO1A 4HSNA 4MLJA 5F2MA 3I7QA 1LOLA 3NL3A 2VENA 4OE7A 4XKYA 3QRHA 1K8YA 1WQ5A 2FPYA 4A2RA 3KX6A 3Q94A 1O60A 2ZA2A 3KFTA 3M5ZA 2NLIA 4PL2A 4CLMA 1EA0A 3MP5A 4B5NA 1IXOA 4GJ1A 3QSTA 1KW1A 4MUZA 3CEUA 3P74A 1M6JA 3UPBA 3O07A 4FF7A 1OX6A 3UXDA 1A5BA 2E6DA 3CIXA 4NZFA 5T26A 3W6YA 4PC8A 1KA9F 1XUUA 1FDYA 1PL9A 4LOCA 1GYLA 1G67A 4O53A 3QMTA 2ZQ0A 3BLIA 5E1QA 4N9EA 5H2ZA 4TIMA 3NQ2A 4UC5A 2V30A 3FA5A 3R13A 3R8RA 2NXHA 2G95A 3L5LA 4ZL1A 2Q8LA 4R33A 5EKYA 4Z1DA 1LOQA 3W75A 1BTMA 1GJPA 3DI0A 3LRLA 1BWLA 1O4UA 3BW4A 5A8GA 3G0UA 3LBMA 4M7TA 5K9DA 2W0UA 3DKJA 2YW4A 2NUWA 4O16A 3GK0A 5LNVA 3LHUA 4UXDA 4POCA 2CLEA 4YMZA 1R2SA 2GPTA 4NJHA 3LDVA 3TK7A 3B0VC 1W8SA 3NPVA 3M16A 2YCEA 1M7OA 4AXKA 1ME9A 2F7FA 4AMAA 1OFPA 4ORIA 3CC1A 3EXSA 1OYBA 2ABBA 3O6CA 1JULA 1TV7A 5LHEA 3MWAA 3PBUA 1VHCA 4UNKA 4KFOA 4MKNA 4N9BA 1S5TA 1KFCA 1GQNA 3LM7A 3ZWTA 4JX4A 3LCLA 3QEZA 1LRNA 2ZZ7A 1YDOA 2C15A 1B57A 1X1ZA 4GNJA 4PH6A 4XWUA 2R94A 1PE1A 2I14A 3IVUA 1HTIA 3G22A 1O5XA 5DCEA 4A22A 1WX0A 5D09A 2PURA 2Y7DA 4NU7A 4RZ4A 4EF9A 3BG9A 3EX4A 5C5YA 1QFEA 3LCIA 4LVBA 3LERA 5A5WA 4M5PA 4FNTA 4K7YA 3U8GA 3TAOA 1S3HA 2WNNA 2VFFA 1Q6OA 2WNZA 3O15A 4OWGA 1YTKA 1TPH1 5SWUA 4M6QA 1Z44A 4X9SA 5EL1A 4AAJA 2B7PA 2NXGA 4AWSA 3TU9A 1NF7A 2XN0A 5AN7A 4AHOA 4O4VA 1FCBA 2TYSA 1R2TA 3C8FA 2ZZ6A 5J5RA 2NWRA 3W1TA 3W73A 1PCWA 2ZZ4A 1K3UA 3TSDA 3PB0A 1TREA 4LVDA 3VCRA 4GWEA 2RDUA 4DELA 2WJZA 1C29A 4RZ5A 1L6SA 2Y7EA 3EWWA 1ZJIA 2YSWA 5IM51 3GZ3A 1PHWA 1H51A 3RFAA 5K9XA 3VE7A 3WJXA 2ZTKA 5EY5A 2AQWA 4ZQOA 1QPOA 1G4EA 1EPXA 2Z6JA 2PRHA 3NGJA 4UIOA 3THQA 2DZUA 1K8XA 3TX9A 3GVGA 3UNDA 3W07A 2J88A 3SJ3A 4XBKA 3SGZA 3GDLA 2BX7A 4BWLC 2QCEA 1A5AA 4NXKA 1THFD 4QQ3A 3W71A 3NOEA 4LVAA 3IRDA 5F2IA 3TAKA 1H7PA 3A22A 3CEPA 3QF0A 5AYXA 1KM6A 3TUUA 1RQHA 3NZRA 4LUIA 1JR1A 1KM5A 3LGEA 3C2FA 2GUUA 3GNNA 3M0ZA 3U2OA 2AGKA 3DFSA 3TROA 3G24A 2EGZA 2ATMA 1KFEA 3QPZA 1TMHA 1H63A 2J6XA 2WKJA 1TV5A 4JDBA 4NVTA 3B8DA 1EIXA 1I45A 1LRQA 4FEZA 3LLFA 4W9TA 1H61A 3CT7A 3TV8A 1IXPA 2NUYA 1MO0A 5EYWA 3B0PA 1TPFA 3UYCA 4YLWA 2CWNA 3UXAA 4ONVA 3UWZA 5IBXC 5E93A 2ZFAA 1SO6A 3I68A 4ZQCA 1YXYA 3C2EA 3N2XA 3NZ1A 3HPSA 4Y8FA 1W1ZA 5CGQA 4LT9A 3QYQA 2CW6A 1RZMA 4FX8A 2CLMA 4FIRA 3EX3A 1C9DA 3KVLA 3L66A 2J9ZA 3FYPA 1A5CA 3M7WA 4IMCA 1PCKA 1B4EA 1K7FA 2E5DA 3F4WA 4K6AA 3W7OA 3NM1A 1SFLA 1XL9A 3QM3A 1JCMP 2A6NA 5G2WA 3IIVA 3KVMA 3MYPA 2A0NA 3W1MA 5K3VA 1FCUA 3GX9A 5U4NA 4LS1A 3OVRA 1P4CA 3W86A 3A23A 4MY1A 1ICSA 3UZJA 3PUDA 3CM4A 1TPDA 3OEXA 3C2OA 2Y70A 3HPZA 3RLVA 1W5MA 2CLFA 5D05A 3GDTA 4YWIA 1KFLA 4QISA 3L0NA 1OK4A 2B4GA 3GAKA 5D33A 4RCXA 4O1BA 1OK6A 2A85A 3S5ZA 4Z08A 3P60A 3NO5A 3EWUA 1RQBA 4R53A 3BLEA 4ZZ9A 3LOTA 4S1FA 3HGRA 4IMDA 2F84A 1BEUA 3NEVA 4DBDA 1OFAA 2QAFA 3W7EA 2QJIA 3BO9A 3HPXA 4JX6A 4BFAA 3TJLA 1JUEA 4A2SA 4E2DA 4GBUA 2OJPA 4AWUA 4HPJA 5DN1A 2DZWA 2VC6A 2ZRYA 2ZA1A 2DJXA 1LM1A 3NAVA 1ZHAA 4JN6A 3PSVA 4RK8A 4IOTA 2WQPA 3W76A 1DJNA 5MHBA 2YR1A 1KFBA 4JICA 3TJXA 1H7XA 1NVMA 2CLKA 3ABOA 3NQVA 1WV2A 2G5WA 1EEPA 3M41A 1EB3A 3JR2A 3NPXA 4O11A 1F05A 1OJXA 5DY3A 3BGJA 1TTIA 2FJKA 2WPBA 5EBUA 4QIUA 1F74A 4J9JA 4QNEA 5LZLA 4C1LA 1LROA 1OVDA 2CLOA 4QITA 4GUIA 1W3IA 4DBEA 1QO2A 4TMCA 2ZCGA 2X1TA 2LLEA 3KAOA 1YADA 4HIBA 4IXHA 1YPIA 1XFBA 3N73A 4JR5A 4O1AA 2RFGA 1VC4A 3VFLA 1OHLA 1R30A 2E5CA 4O4WA 2VXNA 3L5MA 1H7OA 3R2GA 2VELA 3GDRA 3W2KA 4NXSA 2RH9A 1PVNA 3NXFA 3IIXA 4RXFA 1Z48A 1ZNNA 3G1AA 1HUVA 2V9DA 1KM4A 1MEIA 2W6RA 3A24A 5CZJA 2O7QA 3FFSA 3U6WA 4O19A 3FOKA 1GTHA 4KFPA 3W74A 4JD4A 3RF9A 2TSYA 4N6FA 3I65A 4Z1CA 1TPB1 2JKPA
chains in the Genus database with same CATH superfamily
4ADTA 1S2AA 2O9RA 2I9EA 3HQ1A 1I2RA 2EPOA 4P7QA 3REQA 1ZFJA 3N15A 3TMQA 2DY3A 2PZ0A 1A4MA 2G37A 4ACZB 1J0KA 2NV9A 4B5TA 1HP4A 3G1FA 2RUSA 4Y6GA 2B0MA 2VEMA 4CQCA 5BWAA 3PULA 2Y62A 3O63A 1RP8A 3WQCA 3TZFA 1LJYA 2YJQA 5CEWA 1UD4A 5B7YA 4NZ3A 1GYNA 4TO8A 3M9YA 3W7RA 3EOEA 2NV2A 2GVEA 3W85A 1JZ8A 1TRDA 3H2OA 4QE1A 2ZRWA 3OW1A 3CMGA 3OG2A 3N4FA 3IPWA 4CN6A 3TR2A 4IZGA 4DJDC 2BB0A 3Q4DA 1KRMA 5CCZA 1AL7A 2A21A 3WELA 1KWGA 1XRSA 3VI2A 1MFVA 1V5XA 2VFEA 2V8ZA 1SQ7A 2ANUA 1D8WA 3GG0A 3OIHA 1AK5A 3QTGA 3T0AA 2H9AA 4QJ3B 1SO5A 1XSJA 1FDZA 3DH7A 2PWUA 5I09A 5DT7A 5GVJA 1ZY9A 4HMCA 3LGGA 4FX6M 1VRDA 2D1ZA 4OJYA 1XM3A 4KCWA 4EVZA 2PDCA 3FS2A 1M53A 1FKXA 1Q6LA 1V3HA 1FFQA 4B5VA 3URBA 2GOUA 4OHQA 1E1CB 2PDBA 1XDLA 2DU2A 4WXZA 3OLGA 3ZO9A 3CBWA 3EEZA 1O5QA 3P62A 4ROQA 1V6YA 2VVNA 4D9PA 4X61A 1XLBA 3LI1A 3ELFA 1CT5A 3VZXA 4QJ5B 3KVJA 3KL5A 4DXVA 3O0KA 3LY0A 3CPRA 5AHNA 5D8WA 1EDQA 4GQ0A 5CSSA 3S1GA 5LA0A 1TVPA 1W31A 2BZNA 5IRPA 1WB0A 3E38A 1N8IA 2PGFA 4GIYA 4MWAD 2Y5SA 3SI9A 5LNSA 5FEZA 1C3FA 3B05A 1J12A 5D38A 1C8XA 2QQ6A 1FHVA 3WCZA 4G1KA 3OA5A 3OO2A 1UUOA 5FF7A 4KIEA 5FSDC 1VCVA 1E56A 1JVNA 3WLIA 4Z2LA 3E0LA 1W1B1 2VRQA 2AMXA 1JUBA 2EF9A 2Y88A 3OBEA 1O68A 3ZLGA 4LWWA 4H6EA 3ZT6A 5LIYX 4HTBA 4R88A 3UESA 2QMJA 1DTUA 4PRWA 5AC8A 4PODA 2B7QA 3THAA 5GQBA 1BG4A 4TVUA 3RO8A 4A3QA 5HMSA 2NX1A 1PDYA 4DWSD 1XC4A 4GOAA 3TQ0A 3C61A 2C79A 3USBA 2Z25A 4MY8A 3QGKC 2VOTA 1BVZA 2NSXA 4MGGA 4GFIA 5HQMA 3N6JA 2DSWA 4OV4A 2YYUA 4Q4PA 3AS1A 3LCHA 1IZCA 3WBWA 2ONEA 2BSLA 1IZKA 5HMEA 1K9FA 4WR3A 3KRBA 3M7SA 2YIHA 7TAAA 2BVYA 4PSRA 3K4AA 2CLLA 3OBAA 5AC6A 1TB3A 1T6MA 3VPLA 2ZRXA 4JS3A 1XSIA 4IT1A 2V81A 1ZBCA 2WB5A 2Z1VA 1KFWA 1FH7A 1IIHA 1UH2A 2WZTA 3W83A 2CZFA 1XV8A 5DT5A 2O9TA 2QYGA 1US0A 5D9PA 3W4RA 4JQ4A 1TR9A 1ONRA 3TQKA 3BAYA 4WXYA 2XZ9A 3CV7A 4D6HA 3U48A 2WZHA 3O6DA 3SQLA 3WD3A 2P3EA 8TIMA 5HWJA 2Y6ZA 1E0UA 3QLLA 2PRLA 3UNTA 3WDIA 5I3FA 2W61A 4H19A 4UFHA 1UJPA 3W7KA 2ALDA 2GJXB 1ZENA 3KRZA 4HMDA 1VFOA 2GQ9A 4DZIA 4S39A 4LU0A 4JTGA 2GOKA 3EWCA 5HPOA 2WSPA 3OGRA 2VRJA 4KH2A 4XAYA 8A3HA 2PF0A 1KBIA 1OZMA 3N3MA 1RUSA 2XVLA 3H8AA 4UTLA 5MF5A 4XTIA 4XZHA 3H70A 4RNJA 3NJ3A 3P5YA 2OZ3A 2GGEA 1C8VA 2Q01A 4M1BA 4F2TA 4WSKA 3CYVA 3EGJA 5CG0A 3G8RA 4M3PA 5A6SA 2XSXA 3N25A 4C5ZA 4N9CA 1L9WA 4LAUA 1A0EA 3EA2A 1S2TA 1FH9A 3NFUA 4H41A 3P8IA 1EC8A 4H04A 2BY3A 4Y90A 4UOZA 1XF0A 2E77A 4O52A 1QOXA 4Q32A 1EDGA 1FCVA 3MYOA 1SZNA 3DFQA 3AZSA 4QRNA 3FXGA 3KCLA 3W7JA 2F6UA 1A5KC 3CMJA 3TIMA 1JXKA 5AKQA 2CFFA 3AWOA 3S5OA 4A3UA 4C60A 1I60A 4GRSA 3P5ZA 4WSJA 2IKJA 5BXRA 3TYUA 1ICQA 3ZT5A 3QQWA 4Q3MA 1TPUA 3NL6A 3S1UA 3NQAA 5CSRA 2ALRA 1T7LA 2HBVA 1WA3A 1Y5WA 3OYZA 1W1TA 3WLLA 1FXPA 3B3DA 1FWSA 4LYPA 2I1OA 4GI8A 2PMQA 5CQ1A 1XIDA 2YXOA 4HZ7A 1QNVA 4PGLA 4EXBA 2GJNA 5EA9A 4C6BA 2VFDA 3H24A 3WQOA 1IEIA 1CENA 1OX4B 3I6RA 6ENLA 4GC3A 4Q22A 4N9DA 2XH7A 2O4QA 3OGVA 4HJWA 5IDIA 1OFEA 4LAKA 5L6UA 4PCPA 3HZ3A 4PCNA 4R7WA 5I3DA 3GTHA 1XLFA 2FMNA 4Q6JA 3PTDA 3T09A 1RQEA 3E96A 4PB5A 1CXHA 1Q85A 2Q8ZA 4E0CA 1QNSA 2RJGA 3L65A 4NNCA 1ZTVA 3ID7A 3W70A 3MMDA 3IK4A 1OC6A 2QJHA 6TAAA 5JBFA 3VD4A 3A12A 3EWYA 2QCFA 3MS8A 3TNOA 2IPJA 5I2UA 1P1XA 1Z3NA 1GWJA 3NYZA 2ZUVA 1YRRA 4B92A 4H8UA 2QKFA 5E0KA 4PUMA 3HM7A 1QOPA 4ERIA 3AWNA 3TZNA 3WJZA 4WCJA 2F2HA 8CGTA 2OEMA 1R3TA 2QXWA 1TCDA 3EXRA 4PFHA 2OT0A 3UF9A 1GPWA 4UR7A 3PF3A 5BROA 3HMCA 3BCJA 3TCEA 3ANUA 5KZEA 1H50A 2Z2UA 2QPUA 3PWAA 2Z6IA 4FLSA 1ECQA 1EGMA 4DXXA 5XIMA 3W24A 1NDWA 4L1WA 4H6QA 3BLFA 1VYPX 3T44A 4A8LA 3D3FA 4RNFA 3REQB 4IHCA 1ITXA 5KETA 4S3AA 1B90A 1EJSC 3K8KA 1OM0A 5CJ5A 1KO0A 3RR4A 4PMUA 5AFDA 1ECEA 1HGYA 3T6CA 4AVFA 1R6WA 5CLWA 2WSYA 1NDYA 5DFAA 4FHAA 3SR7A 3KBSA 7A3HA 1N7KA 1GVYA 3A9IA 3VKCA 2QCLA 1TWSA 2GJPA 3AJXA 3W7LA 3G1VA 3ZR6A 3AIWA 4C6IA 3BGGA 4M6UA 5CPLA 1QR7A 1YE4A 4C6PA 3AYTA 3NG3A 3NQ7A 2Z1SA 3WNOA 1IGSA 4L6OA 3PAJA 1AJ0A 3R79A 3DGRA 4BKNA 4LH8A 4H01A 5EMMA 3MV11 3EB4A 4AZBA 3ALGA 3MQTA 1I0DA 1WE5A 3LSCA 3OVQA 5HQLA 1JFXA 4J3VA 1XXXA 5IFPA 5CPMA 1K4HA 2ISDA 5CG7A 4LCQA 2VGGA 5D30A 3W2UA 4F48A 3T0BA 4P7RA 1UKPA 3LG3A 5D9MA 1B3YA 4M1RA 5LNUA 2VEIA 4PL1A 4GQQA 2VGFA 3L2IA 2XIIA 4IFOA 1DQWA 4EX4A 4MJZA 1IIGA 5C9RA 2IPWA 2DZVA 1SMDA 1W32A 1B54A 4X9YA 1UR2A 2VEGA 5K7JA 5LA2A 4KGLA 1TPC1 2QVNA 2VZUA 3TXZA 2R91A 4LANA 4GUFA 3CWHA 1XLLA 2ZRVA 3T1GA 3NGFA 4X0VA 1W5QA 2UY2A 5LGZA 3BZJA 4UTHA 3ECQA 3W72A 5C0QA 3CMFA 2DW6A 3SUSA 1ML1A 2EBNA 5G2HA 1JUKA 3TOYA 4ZSTA 4JDYA 3SZ8A 5HR6A 1Q5MA 1TWWA 1A4LA 2WCGA 1B31A 3B97A 3GAYA 5BU6A 1BQGA 1CGXA 5HK4A 3OP2A 3I4EA 2PUZA 1SU5A 4ZMGA 1Q6GA 4O50A 5F2GA 4NZ5A 4B5WA 1U1HA 2JK2A 3P0WA 1QWKA 4JHOA 3OZOA 3DDMA 2I16A 5I3IA 1L6YA 1B4KA 1DORA 1UD8A 2PC4A 5KSWA 5TQLA 4LF2A 3LCXA 1G7UA 4AIUA 3OZYA 3C52A 1IEXA 4Z2GA 4BI7A 2Y8UA 5CC3A 4IGHA 4M24A 4FLRA 2FZDA 3ME3A 1TSIA 4NJGA 1M04A 3NVTA 3G77A 2QAPA 3VNIA 4NYUA 1MUCA 3R7MA 3BJTA 4J35A 1J0YA 5HA7A 3MA8A 3SIZA 1TIMA 3K1GA 2PGRA 1ZP3A 1QBAA 1X6LA 3U5YA 1CECA 1RA0A 1AL8A 3BAWA 1G4PA 3USZA 4CUCA 3B0YA 3AMDA 5EMLA 4L1XA 3K8LA 3W1RA 1XLAA 2VZVA 3UXIA 4BI5A 1IEWA 4CCDA 4PUEA 2VFHA 3TR9A 3MCNA 2FTYA 3A3XA 5I07A 1I6NA 1OX5A 1VLWA 1K8ZA 2QGYA 3S2JA 3U9IA 4HU0A 2H9AB 5AECA 4JQ1A 3K46A 1J4EA 2VX6A 1VYRA 5AVNA 4NI8A 1ZCOA 3O16A 3SN1A 3VK5A 4GY0A 3TYBA 3KBNA 3BLPX 5CZKA 1TVLA 1H5YA 1GQJA 2ADAA 2J4GA 2ZXAA 5AC4A 2FMOA 5GJPA 4HTYA 5I06A 1VFHA 1GVOA 1FWWA 3E0IA 3QHMA 5BRPA 3BCFA 4H2CA 2ZZ3A 4U2YA 3G0XA 2D24A 2QVHA 2V82A 2D0HA 2YXXA 3MMUA 2VI0A 1V3MA 1JZ2A 1PIFA 1IE7C 4PR4A 2Q3OA 1KCZA 1XLIA 5A2BA 1TCMA 2H90A 2XFFA 2I5GA 3WLTA 2PRMA 3RM4A 2A7RA 1J5TA 4GKLA 1W56A 2AL2B 4WKFA 3MSDA 2GQAA 2V2DA 3EEGA 3MU7A 4JEQA 2NX9A 3RAOA 2BG5A 2VCAA 1I9CB 1PYFA 5A69A 2C6QA 3P80A 2V63A 2XVPA 4IX0A 1R9XA 4QLLA 4AH7A 4UTTA 1JCNA 4F4RA 3OBKA 1XCXA 4E38A 3IS4A 3RXZA 3BOFA 2GJRA 2PB1A 1QNPA 3CAWA 2DGAA 2ZX5A 1VFFA 1OCNA 3QSRA 4I6KA 1PYMA 3GXTA 3RDKA 3K1DA 1YQ2A 3N19B 3ZIZA 2W9MA 4U10A 3ZM8A 1UA7A 4FNQA 3AXXA 1RLDA 5E70A 5A6MA 3DFNA 3QV7A 2UWFA 5CZTA 4J27A 3WDHA 4ZVJA 3MBDA 1KQZA 2J7CA 3WNKA 1JCYA 3VNLA 4WQ6A 1EIBA 1AG1O 4R7JA 2FZNA 4WKHA 3FJ4A 3HQPA 1HIZA 1TPWA 1ISWA 1EO5A 3O7UA 1MNSA 1U33A 4JTEA 3M0KA 2G96A 3QV6A 3AIVA 4KWUA 4REQB 2J24A 3L67A 3WLJA 1YMYA 2E7FA 3LHVA 4OOZA 1HJWA 3C2RA 1GOIA 2GVLA 2QUMA 1VBGA 4DNMA 3SCRA 4QM1A 3BQ5A 4UFMA 4NG3A 2XVKA 3FLUA 1ZJHA 1XD0A 4CNNA 5CJNA 2WJDA 1WZLA 1EEXA 1FDJA 2ZXBA 4FOUA 3QH2A 1AQ0A 2YL5A 4FNSA 3BK0A 3SCPA 1RR2A 1WKFA 6REQB 3ZS4A 4QDMA 4LAZA 5D2YA 5C70A 1KBBA 1RY0A 4F0MA 2Y5EA 3CV6A 3MDUA 2YX0A 2OELA 5DCBA 3KLKA 4RPQA 3DC0A 4NQ1A 3AIEA 5BOFA 3MKVA 2KAUC 3F4DA 1CEOA 3GDMA 5A6AA 1W1A1 5AB3A 3H7VA 2CYGA 1JCJA 3UD6A 1UUMA 4Q7NA 5ABFB 3QXBA 2JGQA 2O7SA 4Z0JA 2VWTA 4DHGA 3V0SA 2H3BA 4CD6A 3QZAA 4H2HA 3WFLA 1RK6A 1JQXA 2X09A 2CIPA 4ZQNA 2YGYA 1JPIA 3EB2A 3MKKA 1XH1A 1LL7A 1TQXA 4BF7A 1E0XA 2BXVA 1E73M 4QS5A 3D47A 3I10A 3STCA 3SRKA 1TV3A 3WF1A 1QI4A 2VHLA 2VJXA 4RW5A 1D8CA 1NF0A 3NQBA 1VFSA 4IGNA 1UIPA 2J77A 3TMLA 2WANA 1EHAA 2ZUMA 2Y85A 3S2LA 4UUIA 3WDRA 3INPA 5FJJA 2E6AA 3NL2A 4F66A 5C2XA 4JTKA 1ZS2A 3UW6A 4R7OA 3RILA 4NRSA 4O0QA 4FNPA 3JZEA 1BXCA 1L8PA 1EHNA 5CBIA 3DCPA 2FDMA 1R3WA 3NTYA 4C91A 2Y7FA 5CAKA 3VC5A 3IJLA 4HZ6A 1C8YA 1NQ6A 3EKLA 3HTWA 3VA8A 5LGXA 4JIQA 3QR1A 1R5YA 3UZYA 3NQEA 1W8GA 2ZWYA 1M3UA 3SCUA 4S2CA 3TC6A 2GDUA 1VAHA 3WMCA 3QLDA 1O66A 3IAPA 1D9EA 3HG3A 1VENA 4FS9A 2R1MA 4CQDA 5FEXA 1ZZMA 3WD2A 4GO8A 2YDAA 1JEZA 4GQRA 1UC4A 5KZ6A 3E2QA 1QUMA 3A21A 3PWIA 3WUEA 4Q4SA 1MZHA 2FB3A 3K30A 1KM3A 4O10A 1WKEA 4UQBA 3AICA 1QXLA 2R1KA 3XISA 4JTIA 3CIWA 2X0YA 1QPNA 3N9RA 3WL0A 1QHZA 5EMJA 3UWUA 3AUOA 4V1YA 2QCCA 2A3LA 3DENA 4DF1A 1ME8A 1F8IA 3N2OA 1MRAA 7CGTA 2FPVA 1SW0A 4PTDA 4H8HA 2GVGA 1UR1A 1S5VA 3S2CA 1FWRA 3BL3A 1ODZA 1DBTA 4AQLA 4UMBA 4I7VA 4X22A 4R9OA 4WF7A 1XYAA 2BASA 3AYRA 4O18A 1W9BM 4AZ6A 3AXKA 1Q6DA 1LOSA 3VOGA 2QCDA 1VCFA 3LTYA 3ATYA 3CYJA 3G1DA 1J0IA 3GFYA 5I7GA 2BWGA 3F4NA 3VC6A 4EK7A 2V5JA 4DAFA 4DPQA 3EBVA 4P5UA 2PSNA 3L23A 2HXTA 3OLEA 3DI1A 4JEJA 1SO4A 2DVTA 1O5RA 4ZB2A 3F2CA 4MLJA 2R9RA 4J7RA 3I7QA 3PPGA 4MB4A 3QV9A 3Q94A 1O60A 2ZA2A 3KFTA 3M5ZA 4CLMA 1CNVA 5A6BD 4JKLA 1QU4A 4B5NA 4GJ1A 3SAZA 3CZGA 1KW1A 1AUSL 1UWTA 1T40A 1JZ4A 2DUAA 2CZVA 3UCDA 4UQAA 3TLLA 1TWIA 2INFA 3UXDA 3V3WA 3VYLA 4JKMA 4G6CA 4INFA 4KW2A 4QAWA 2HPIA 1EBGA 3VMNA 3VOJA 1J0JA 4Q7IA 1GYLA 4O53A 3R11A 1HW6A 3HFYA 2ZQ0A 5H2ZA 5I78A 2PDHA 2NXHA 2G95A 4WDWA 4BS0A 3U7BA 1PSCA 3QY8A 4C6DA 2YA2A 1BWLA 3PZQA 2ZIDA 3B9EA 4CNUA 1XPYA 4DM2A 5LNVA 3LHUA 1Z8AA 1DJGA 1K70A 4MTVA 4POCA 1R2SA 2RGLA 1JYNA 2GGHA 4L64A 1A3WA 1MW2A 3AMKA 4TTGA 4NJHA 1XIJA 3R8HA 2XIQA 1ME9A 2F7FA 3M0LA 3CC1A 5DF0A 3AXHA 1DJIA 5LHEA 3PBUA 4UNKA 4KFOA 1R86A 1AODA 1KFCA 4YVXA 4IMAA 2I9UA 3AIQA 3VILA 1BVNP 4JX4A 4QSFA 4ECLA 1EZ2A 1XQKA 5T9CE 1MZRA 2OODA 2V3EA 3PNUA 4GNJA 2R94A 1HTIA 3UFYA 1FP8A 1RCXB 3PK7A 1XFCA 4JCLA 5D09A 1Q6CA 3L4YA 4NU7A 4RZ4A 4EF9A 3BG9A 3NUKA 1QFEA 4LVBA 6REQA 4PMZA 4XIMA 1FFRA 4B91A 1JZ3A 2PGWA 5FIPA 3TAOA 4TV5A 1VFMA 1QNQA 2WNNA 1DIKA 1Q6OA 4DAIA 2X05A 4OWGA 4IUGA 1Z44A 5JUVA 2NXGA 2PLMA 3ARYA 3TU9A 2CBIA 4GYPA 4AHOA 1R2TA 3MC5A 3V0TA 1K3UA 1TREA 3VCRA 2EXOA 4GJJA 4GWEA 4UBPC 3RYSA 1S5MA 2WJZA 3EMZA 3T9PA 2OLSA 2OEJA 3L4XA 1H51A 4E2VA 5K9XA 4IQJA 4J3ZA 4URIA 3AU2A 4QLJA 3WJXA 2YCJA 2ZTKA 5CPTA 2XVGA 1G4EA 1EPXA 2QF8A 1J93A 4GVGA 1K8XA 3GVGA 3RM9A 4IJCA 3SJ3A 4JBRA 3IV8A 2BX7A 4Q8PA 4QQ3A 3B8SA 3SUUA 4C90A 2FH6A 5F2IA 4FPSA 3F4VA 3EAUA 4MSSA 3QF0A 4ZO9A 2WMIA 2DZBA 4GIEA 1RQHA 2PU0A 3H2AA 4EKJA 3CH0A 4P7OA 4WDTA 2GUUA 3H22A 4GYJA 4HZ8A 4RE4A 2ISFA 5CSYA 3VDCA 3G24A 4ATWA 1UWUA 3UWEA 3B8IA 1S2VA 1XYCA 4ENLA 5JBDA 4M82A 1I45A 3BGAA 1LRQA 4FEZA 1L6FA 4FAMA 2NQHA 2GWNA 5AZ0A 1FVPA 4UZSA 1WO2A 3UXAA 2NQ9A 4JIEA 2QPSA 3MO4A 2IUZA 4ZQCA 4QEEA 3PANA 5CGQA 1WAWA 3QYQA 1CLVA 4ICCX 1YDYA 1RZMA 3DHPA 3G1RA 3UPMA 4Z17A 1XG3A 4W93A 1E3ZA 4IMCA 3S2MA 1LWJA 3DECA 3NM1A 1SFLA 1JCMP 4MAVA 4ZTYA 3E0WA 2A0NA 3NZPA 3AHTA 4AD5A 5IOBA 2D3NA 2Z26A 3W86A 4HPGA 4DWSC 1JYWA 2DT1A 4GCXA 4CQBA 3UZJA 3PUDA 1XIGA 2WBGA 2BXYA 2GVYA 3HPZA 3FDGA 4A3HA 2B4GA 5D33A 2XSAA 2A85A 3MUIA 3NSXA 4Z08A 5I23A 4R9XA 1RQBA 2DT3A 2VP8A 3CXOA 1OD8A 3E0VA 4IMDA 1XIFA 1BEUA 3VGGA 4B2DD 4DBDA 3UGRA 3LS9A 3V36A 1G5AA 4JX6A 3V16A 4E2DA 2OJPA 3KTXA 2BODX 4AWUA 5DN1A 2DZWA 2VC6A 5AYBA 3NAVA 1AA1B 4GNKB 4JN6A 1GGOA 4AZHA 2A3AA 3UXKA 1JZ5A 3W76A 5T8GA 5AY7A 3QHOA 4B16A 3MY9A 2CLKA 3ABOA 1XG4A 2DZAA 1HKVA 1WV2A 1YNQA 3M41A 2XINA 1EB3A 3KUMA 4FK9A 3PZUA 3JR2A 4XISA 3U57A 3AISA 3GH5A 3MDWA 1DIEA 1E43A 5DY3A 5DMNA 4V28A 4X0NA 1P0EA 4J9JA 1XGEA 4KIRA 5LZLA 4C1LA 1OVDA 2G3MA 2CLOA 1W3IA 1Z7AA 3AHZA 4TMCA 2LLEA 4HIBA 5CGMA 2W3ZA 2UY5A 2WLYA 4LUSA 3TWAA 2DT2A 4JR5A 3PPCA 2QS8A 4O1AA 2RFGA 1VC4A 1FWFC 4PBGA 1OHLA 1XWYA 2WWCA 4R27A 1TZZA 4D6GA 4O4WA 4LBRA 3QFWA 4AY1A 2VELA 4TX8A 3NDZA 1PX4A 3EA3A 3GDRA 4GXWA 3WNLA 1HKKA 1KGXA 1Z48A 3KW3A 4KGJA 4W5ZA 2W6RA 3PJXA 4US5D 1CB7B 2O7QA 3OPSA 5EGRA 3U6WA 4LAMA 3IACA 4KFPA 4JD4A 2CHOA 2OOFA 2JKPA 2ZVRA 4OGZA 1CI1A 4X3ZA 4RR4A 2QJGA 3SSJA 4JTLA 1KKRA 1SUXA 4H3DA 1XR2A 1KXTA 2EHHA 1E15A 1G4TA 2CZEA 5XINA 1CDGA 1MW0A 3GTFA 4E6MA 3LXCA 1V3LA 3GUGA 2QUVA 3QBUA 2CXEA 3GTNA 4W8LA 3CQ0A 1ENUA 2YCLA 3OVGA 1D2KA 4FALA 1OADA 3FJNA 3WH5A 1XLEA 1TZ9A 4U5IA 3IEBA 4DBSA 4HPHA 4LFYA 1GVSA 3KZSA 2OWXA 3EDDA 1XLCA 4AC7C 3TDFA 4AXNA 3FJLA 2FVLA 3S8HA 4LYKA 2VM8A 2FYMA 3WN6A 4JFVA 5J04A 3SURA 5DMMA 4DJFD 3F1QA 1KTNA 4HCDA 5D2WA 3ZSTA 4EACA 1IEQA 3GBEA 1LT8A 4JXCA 3WL1A 3WMLA 3MO7A 2CHNA 4QJ1A 3M0VA 3R43A 3F4CA 3KS6A 4QSHA 3WLPA 2V38A 3GY1A 5K2ZA 4K8HA 3EPMA 4I8YA 3W27A 3TQPA 3APYA 2C0HA 2NVCA 3CPUA 3IUDA 1KLZA 5E6YA 1MW3A 2GQ3A 4AD2A 4U3CA 5I3HA 3RHGA 3FKRA 2R1NA 2A7PA 1M41A 2E8YA 3ZFHA 1JDCA 2HPMA 1TV8A 4KRUA 3QC3A 1BLIA 3LLDA 2MANA 3DHUA 1PTDA 4DJFA 4EAMA 1YTDA 4WX2A 4EOUA 1GOQA 3GM8A 4C1NA 1VIZA 4MZYA 4PUDA 4TUFA 2EKCA 1PZ0A 1GVQA 5D2VA 1JI1A 2GGJA 4PCSA 1B2YA 4GACA 3KVKA 2QCNA 4QFUA 4Q7BA 3G6MA 4CGTA 3CTTA 4KKXA 1N55A 1OFDA 1RAKA 3PZ9A 2B31A 4XO6A 3PP7A 1VFUA 2VDGA 3TC7A 3VOFA 1FCQA 2J7HA 4S3EA 1UZ4A 3RR1A 4IIBA 4CN4A 1UWAA 1RH9A 1E1CA 1VIWA 3RJYA 9RUBA 4LUTB 1Q6EA 1ZGDA 1NFGA 1QK2A 3IGUA 1TJRA 1EDTA 3GXMA 4AEEA 2GYIA 4YTUA 5A8PA 4GH1A 4JYFA 2BHZA 2PODA 4PEKA 3VABA 1LQ2A 3MKCA 2NX3A 1Q2RA 2BY1A 1HKIA 3FYOA 1NFBA 1D3HA 1B9BA 3RN6A 2J8TA 4NJJA 4FLOA 1H0IA 3C86A 1XD1A 2X8RA 3SGGA 3G8EA 1GNXA 4ZOCA 3W88A 1J2WA 2VVSA 3WSUA 3WH7A 4WIWA 2Z0IA 4ZOEA 4RLIA 5HINA 3U0HA 3TTEA 4TVDA 2Z7KA 1Q7ZA 2E1DA 3IVSA 1TTPA 4S3DA 3LPPA 2QJNA 3WQFA 4BWLA 4P8VA 1DL3A 4LNCA 4L80A 4Z0SA 3BMVA 4C7FA 4YHGA 4O0KA 1OT2A 3H7UA 1P1MA 1EJVC 1W3KA 1UD3A 4XZNX 6A3HA 5LNWA 4M6VA 3GVQA 4HYVA 2PAJA 1V51A 3RPDA 4HP5A 2PBOA 3LD5A 1W0MA 3ES8A 5K4XA 1IQ8A 3CT2A 1ZAIA 2PDJA 4O17A 3FGCB 4UTMA 1BF6A 1EUNA 4O8AA 1ZP4A 1Q3NA 3SQMA 2YPIA 2DV0A 3Q65A 5CC6A 4LEQA 4C6EA 3GG7A 4H00A 4U4MA 3W7DA 4QTGA 4DUXA 2XIJA 5A2CA 1E1FA 3TCSA 2J78A 2E9BA 5FF4A 1LZOA 1K8CA 2V5LA 2OOGA 1QW8A 4DI8A 4L65A 2DPEA 2ZZ2A 2YCIX 2HE8A 3RNDA 2ZC8A 3F5LA 2YZRA 5M3WA 4WHBA 1DKWA 4F3HA 5JH2A 1V0LA 3L0GA 3GU9A 2Z7GA 2W62A 5C54A 3NQDA 5CPOA 1BD0A 1LBMA 1BF2A 2DORA 5IFTA 1W3HA 4S2BA 1VGAA 3UCCA 3DFTA 4EXAA 2DT0A 1UKTA 3WQ5A 1XBZA 3FNDA 1YIXA 2VX7A 4YCOA 4NZJA 1QDSA 2QUNA 2JALA 3WBXA 3GRIA 4Q8TA 1P43A 1J5SA 1A5NC 5KMYA 1TQJA 4DO5A 3T42A 4ZCWA 3IJQA 3W2JA 3DESA 4Q8VA 1RLCL 4A35A 1NP0A 1GJUA 4MB1A 1P6CA 1PUDA 3DYOA 1YKWA 1SFJA 3TN3A 1UD5A 3QPYA 3GH7A 1UR4A 4LBUA 3BAXA 4XKYB 1OCJA 3MHGA 1LQAA 4PTNA 3HA1A 4GJIA 3IJ9A 3VNMA 1KR1A 3VIIA 4MHBA 1YPFA 4JZ5A 4JTFA 3OB8A 3A64A 3JU2A 3UZWA 3IRSA 1EXBA 4EPDC 1CX9A 1WDRA 1SR0A 1W5NA 1HG3A 2WWDA 3HG2A 3WZ0E 3GFZA 3S6OA 3MJYA 4CU6A 4HA4A 2CESA 4L5ZA 4RKAA 1LLWA 3GR8A 3N13A 3RM8A 2I17A 1JCXA 4J5NA 4MNMA 2WNQA 3W1NA 4A29A 3QW3A 1CGYA 1QAPA 2QW5A 3PZMA 4MPQA 4AISA 5EB8A 4QX4A 4MFEA 3VIFA 3RCNA 4UQDA 2E8ZA 3KDNA 2GJLA 1W1VA 4GY1A 1PV8A 3CJPA 3HOJA 1OIMA 4AWEA 5A1AA 2VGIA 1AH3A 2ACSA 5FF2A 1DWAM 2JEPA 3RMJA 3PN8A 3CUIA 1M68A 4PA8A 3GHRA 1O5KA 3QC0A 2VFIA 3W9ZA 2D22A 3VU2A 2ISVA 4WEVX 1FOBA 1H7RA 1IZJA 1XYLA 3QHNA 1WNOA 3OGSA 3W00A 2Z1BA 4UNLA 1SZEA 4CD4A 1GZGA 3LUTA 1ZBWA 1TPVA 4GVIA 4GYKA 3LV6A 5ENLA 4GG9A 4KRZA 2OWCA 4MB3A 4GI9A 3VXGA 4ZOAA 1UH3A 3VUPA 3N4EA 1WDPA 4L9YA 4LRTA 4XO7A 2Y63A 4O8RA 1TZ7A 4HU3A 4JTAA 1GKRA 3QGAC 3P61A 4CCZA 3DOPA 3E9AA 1CCWB 1REQA 3GC4A 2B7OA 3K4WA 3WLMA 3A5VA 1QTWA 4TTUA 4EF8A 2PBGA 5IBXA 1ADDA 2A3HA 4D6IA 2WZEA 4XAPA 4FOJA 3O8AA 1J11A 3G18A 1UCWA 1RCOB 4FNUA 3VKBA 4UQ9A 2YA1A 3M0MA 2CLHA 3FXYA 2UV8G 1K6WA 1U83A 4J3XA 4S3GA 3CUGA 3NSNA 5FJOA 1GQIA 4I6VA 5H6HA 3BOXA 3TWBA 1ODUA 3B4YA 2QF7A 3M64A 3W7IA 1VLIA 4I9TA 3L5AA 3QOMA 3WK3A 1ICPA 1EZWA 1RHCA 3CZKA 1E6ZA 3BE7A 1U5HA 5FEPA 1LBFA 2NUXA 3LHYA 4UTIA 2ZDSA 4JNYA 2WW5A 4S23A 3ARVA 4JIHA 3W29A 5T9BG 3UG4A 2Y8KA 2SFPA 1E71M 2JBMA 4E2BA 1DXIA 5D9NA 1N8WA 3GVVA 2QCHA 2PP3A 2GJXA 4OT7A 2YYTA 2YCKX 4MKSA 3AFBA 3IGSA 3KRSA 5CBJA 4K8EA 1POJA 4P7NA 4OVXA 3LRMA 3S0CA 1UUQA 5FL0A 3MJMA 1QI2A 1NSJA 2TPSA 2EEXA 3WNMA 2A79A 4D8LA 3ZYZA 4KWWA 1P0BA 1VEMA 3YPIA 5FAGA 1PKYA 3T4WA 4W85A 4NAEA 4HSOA 1FWEC 1TX0A 1U1JA 4DX3A 3WK0A 1JCTA 3ALFA 3HJZA 4G56A 2OYKA 5EMKA 1S3TC 3IK2A 2PDWA 4R5EA 1JAKA 3N34A 2P8BA 5FACA 4Z1AA 3R12A 1TJPA 4NAEB 1EJXC 2Q02A 4ADUA 4ZE5A 4DQWA 3SJNA 1NDVA 3GXIA 1ZJBA 3K13A 1XLGA 1CTNA 3R0KA 3VCNA 1I2NA 4BCEA 3CHCA 1WUEA 3MP3A 3GG8A 3TEVA 2W4XA 4LS2A 4DJFC 2PDMA 3LK6A 2QUTA 4IMGA 1P6WA 3OHMB 3B8VA 5A6LA 2BXZA 1K9TA 2ZA3A 1P0DA 5G2IA 4O57A 3EOUA 4W5UA 1RVKA 4RE2A 5GJMA 3C0SA 4MB5A 3HIJA 3O05A 3GYCA 3CPGA 5AVHA 3O6AA 2WCAA 2HISA 2JIEA 4H8NA 5CZ0A 4XKMA 4BI6A 4QCEA 1W9VA 4JTSA 1EUAA 4QAIA 1EX5A 3BWWA 1OYAA 3RU6A 4P2VA 1DHKA 1WDWA 2QCDB 3JS3A 5AHIA 1ELSA 4NSBA 2F38A 2Q6ZA 3A5FA 3H2MA 3SUWA 2HJPA 1N8FA 2CERA 3W7NA 2JF7A 4GK8A 1A5SA 3LGDA 1VPXA 2RKXA 3BJFA 3LTSA 1SSDA 3VIMA 3OVPA 5HJYA 1M7PA 3FK4A 3LBCA 4DF0A 3BUVA 3AS0A 1DQUA 4Y96A 4DVOA 3U5UA 2QHAA 6ALDA 2JKAA 3TH6A 1HKJA 4NHVA 4X63A 1W6TA 4N7QA 3EPNA 4OOUA 3UJFA 5CGTA 1V7AA 3GYEA 1LCOA 1CYGA 4I90A 2R6OA 3T78A 3B9DA 3VOCA 1F4AA 3SDOA 3URAA 5FOOA 3XIMA 5ABHA 3VX1A 1R46A 3CZEA 2XDFA 3LXAA 5A95A 2OEKA 4GISA 2CITA 1MMFA 1Q66A 4N02A 2XU2A 2EKGA 4UR9A 4XAFA 2WC4A 1K02A 4QE4A 1QHPA 1W1PA 3QW4B 3WBEA 2QIIA 2D2OA 3SN0A 2DZPA 2YFOA 3T4CA 1ISVA 1H5VA 3SFKA 1OY0A 1XDMA 2CBVA 3T40A 3TFXA 2QJJA 2V5CA 2EJAA 4LAOA 3U2EA 2FGBA 2PLKA 1HO4A 5REQB 1CBGA 1FWDC 1A53A 1JIBA 5F2LA 4HK6A 2OKTA 3WH6A 5G5IA 1NTHA 2EPLX 1QATA 4HN4A 3S42A 3RGTA 3I6EA 4KMQA 3PJUA 1NELA 2DSVA 1JQVA 4EAYA 4ZO6A 1E0TA 3IIPA 1IF2A 2GGGA 1BPLB 3HFTA 3M6YA 2J74A 3SY5A 2OQHA 3QZ6A 3EX1A 1QT1A 4IIFA 3TTYA 2ZZ1A 5DELA 3M44A 3N9KA 3W87A 1KV5A 1SW7A 4HHLA 4HVXA 3G1SA 2BTMA 3E5PA 1P6BA 1H7WA 1RV8A 1QI5A 2DIKA 2VEKA 4KT2A 2W91A 2BY0A 5JVLA 4L4MA 1MRQA 2VTFA 1LRTA 2YDRA 4DUWA 3QV8A 1XRVA 1W91A 3WJSA 4DO4A 3PB2A 1JDDA 3NDOA 4I5UA 2V67A 4E4FA 1OG0A 1UASA 1E9IA 4WGHA 2P5NA 2RHGA 4GVHA 3TJIA 4NZ4A 1W1IE 4IM4A 1V77A 5AHFA 3LCWA 4UTUA 1VJZA 3QKEA 3U4AA 2VR5A 3W1AA 4JTQA 2ATSA 1US3A 1NDZA 3PG9A 2X30A 4WZHA 3Q2DA 2PWGA 2FQIA 4KWOA 1GYMA 1A47A 1VP5A 3HG5A 3VDBA 4ZB5A 2G3IA 1CPUA 1X8CA 3GXPA 2GL5A 2D3LA 4XVDA 2J75A 3PR2A 1BGGA 4IWWA 4EP8C 4IIDA 3O2LA 3S1XA 4PRRA 1XH2A 3A4XA 1RJPA 5I00A 2OU4A 1LL6A 3BPWA 1H1NA 1A5UA 2E6FA 5JBEA 1PX3A 1HFBA 4GFSA 2ZVIA 3QTPA 1KM1A 2X16A 1NP2A 1V08A 1LQ0A 5GPRA 3P7YA 2WSRA 1I2PA 2VMFA 2PTDA 4MNLA 4YXGA 1KD0A 1UIOA 2PTYA 4RDWA 2ZUUA 1E70M 4AG0A 5FEWA 1QPKA 4IPJA 1GZJA 1DJQA 2GVJA 2EPMX 4NX0A 1MEWA 4IL0A 5HWMA 1DJXA 5H1WA 1W9DM 4FR6A 4K8GA 2RDWA 4DJED 5I03A 3WLNA 5BOEA 3KDOA 1US2A 4S3JA 4OUEA 1WZKA 3S3GA 1YHTA 4XB3A 2QCGA 1TJ1A 3CL8A 1NH6A 1Y7VA 5F4XA 4G8TA 5CPQA 3EWZA 3PBGA 3COTA 1OF6A 1OCQA 5FJRA 3UPWA 4D6FA 3LZ5A 5F1UA 3PBYA 2VUNA 4I3GA 1SM9A 1TX2A 1WKYA 1XIBA 3M4HA 5BNKA 3SRDA 3CHDA 4FZIA 5E5CA 5FSEC 3RUBL 1CWYA 3ZJKA 1G94A 4AU0A 3VKJA 1QWGA 2X1SA 3VINA 3B06A 2FIQA 5G1YA 1V6UA 3N14A 1S5NA 2G0WA 3S1VA 3KBJA 3CNYA 2E9MA 2PGEA 2W27A 2OMAA 5LIUX 1VZWA 2OX4A 3W81A 1D3GA 5G1TA 4ZFCA 5E6ZA 3MCOA 4Q8OA 3WQGA 1PKNA 4W7UA 3WO8A 4PCTA 1MFUA 1YNPA 3G1XA 1NJJA 4HOZA 4ML9A 3W02A 1QJWA 9CGTA 1WDQA 3KM8A 2OT1A 3QZEA 4FO4A 1W3NA 1OGGA 3L4WA 3V5OA 3DFYA 5EBAA 3PFRA 3N3TA 3BTNA 3RU8X 2HSAA 4NRRA 5C6MA 3PZNA 4FNRA 4HPNA 5D03A 3KL3A 3C4UA 2J7BA 3WJYA 4YPJA 2PTZA 2FVMA 4RX0A 4AD4A 1GJWA 2OGYA 1Q6FA 2V5BA 4RDVA 4N2YA 3ERPA 2HK1A 5H91A 4BR1A 3HURA 3N2MA 3ABQA 2YL6A 4XD6A 3QGVA 1XRTA 5TBOA 4CQAA 1L6WA 2A7NA 4G9PA 1VB9A 3I7SA 1P7TB 2FPTA 3L0KA 4BHYA 1F6YA 5BW6A 5MKGB 4IMFA 5BMWA 3MI3A 4RE0A 3EDEA 2W79A 4LV9A 1O6IA 3EOOA 4U28A 5DRCA 1GVFA 4TR9A 4GC4A 5HUOA 3U4FA 4MKVA 4LVFA 4GGHA 4C6KA 3LTPA 3DYPA 4F40A 4F9JA 1SJAA 1XIMA 2G50A 2PWFA 2FZBA 3CQKA 4XSMA 1G6CA 3BG5A 4C6NA 2XN1A 4EXQA 4TOQA 4QBXA 1LBLA 4HSNA 3AS2A 1CGVA 1LOLA 1V0KA 2IKIA 3NL3A 2VENA 1GOKA 5AZ1A 2WKGA 1WQ5A 2FPYA 4A2RA 3KX6A 2PLCA 1XGZA 2ZUWA 2RAGA 2XISA 3H23A 3CEUA 3UPBA 1JD7A 4FF7A 2EJ1A 1MVYA 4BQ3A 1A5BA 4NZCA 4DRSA 2C8NA 4PC8A 1KA9F 1QW7A 1PL9A 1E4MM 2PS2A 4LOCA 5EMYA 3FAWA 4M51A 4E8CA 4Z2KA 4UC5A 3R13A 4R85A 3R8RA 1GW9A 3OOQA 3L5LA 2E67A 2Q8LA 2EG6A 4M29A 4R33A 2XFRA 4Z1DA 1LOQA 3R25A 3CB3A 1GJPA 3GHSA 1B5TA 2PD5A 3LRLA 2AGTA 1FP9A 3G0UA 2ZX8A 3VD5A 1M9HA 1WXYA 3LBMA 5K9DA 2NQJA 2W0UA 1GUVA 1M65A 2YW4A 1BYCA 3GK0A 5LIXX 5H8MA 1FWHC 2CLEA 4YMZA 1UWRA 4S3BA 2F6XA 2HEJA 3B0VC 1HP5A 2YCEA 4AXKA 3ITGA 3EOLA 2DQXA 3O6CA 2WHMA 1HVQA 1JULA 3ARPA 3LM3A 3SO7A 2VNCA 3C5QA 4MKNA 1GQNA 3LM7A 2HDJA 3SCVA 2HZGA 3QEZA 1S2WA 2ZZ7A 2QNEA 4HA1A 4MDOA 1PE1A 3IVUA 3GSMA 3M46A 3N6QA 3PHAA 3M0JA 3LCIA 4C7DA 1BWVA 3LERA 5A5WA 1K9EA 1KWKA 1RJRA 2PDFA 4HNOA 4EPBC 1ZJAA 2WNZA 3O15A 1YTKA 4YYFA 3BZGA 5EL1A 4MJ2A 4AAJA 4AWSA 4ES4A 4QR6A 2XN0A 1FCBA 2ZZ6A 5J5RA 3VZYA 3W1TA 1UR0A 2ZZ4A 3TSDA 2ON3A 3PB0A 2PDKA 3HJEA 4LVDA 5JIPA 5M2FX 4DELA 2GK1B 3CZ8A 4RZ5A 2P88A 2ZUTA 3AHYA 5IM51 4LB3A 2OVLA 4WDUA 3EOSA 4F0RA 3KS5A 1WUFA 4ATDA 2YB1A 5EY5A 4C6JA 4DNHA 2AQWA 1QPOA 2Z6JA 3NGJA 4XZMX 3UNDA 2J88A 2OG9A 1C90A 2A3CA 3GDLA 4BWLC 1VD6A 1OB0A 3VIJA 1UMLA 1THFD 3W71A 3UETA 4LYRA 1BRLA 3E2RA 2NLYA 4D8ZA 3TAKA 3F5JA 2Y8VA 1QI0A 1HJSA 1KM6A 1OWQA 3P93A 1FKWA 1NWTA 1JPMA 3KEHA 1AZ1A 1TUXA 2OB3A 1RPKA 2OR2A 2QV5A 3ABXA 4PMDA 2AGKA 3DFSA 5M17A 1PB0A 1B3VA 2ATMA 4QCFA 3QPZA 1TMHA 3M6DA 1HZYA 1JD9A 3VDAA 3B8DA 5TAOA 2JIWA 1O1ZA 1MQQA 3OZMA 3WUBA 3CT7A 1IXPA 1MO0A 4NILA 5EYWA 1LLOA 4LXFA 4W86A 2G4JA 2P0IA 3WF4A 5E93A 2ZFAA 3S5SA 2Z1WA 4HHMA 3AHVA 1OCBA 4J1OA 1TE6A 4KBXA 1C9DA 2J9ZA 4GINA 1K7FA 3F4WA 4K6AA 3W7OA 5ABGA 1VEOA 4Z2JA 5G2WA 2DVUA 2YLAA 1QK0A 4W8AA 3ARQA 3W1MA 1PJ9A 2DH3A 5K3VA 3WENA 4HZMA 2WHKA 4EE9A 3IJ7A 1EJWC 4LS1A 3OVRA 1XLHA 1HJVA 3A23A 1S38A 2Z24A 4TQTA 3CM4A 4JKKA 2ZE0A 3RLVA 4YWIA 1KFLA 4QISA 2GSHA 3TP4A 3L0NA 1OK4A 3RRAA 4RCXA 4B3ZA 1OK6A 4IG2B 4LCRA 2OTDA 4KESA 4ZEPA 4S1FA 3EKGA 2F84A 4C6LA 3BDKA 3MSGA 4RDZA 6PTDA 1OFAA 2QAFA 3W7EA 3BO9A 3ICJA 4YYCA 3RCYA 5BXSA 4BEUA 3TJLA 4GBUA 1KGWA 2GGIA 3AU6A 2WVSA 5C2CA 2NVDA 2JF6A 5BCAA 1R87A 4HPJA 1GVIA 2ZRYA 2DJXA 4AUBA 1J2BA 1UYQA 4RK8A 4IOTA 2WQPA 3QPEA 2OQYA 3CZJA 4DI9A 1DJNA 1GVEA 2HNHA 2AQVA 4PUKA 2YR1A 1H0GA 4JICA 1UKSA 3W37A 3FSUA 1EEPA 1V8EA 1OEPA 3V5CA 4CN1A 1EF2A 4O11A 5FJIA 3RCMA 4B5SA 3ZVHA 3ARTA 4QIUA 4MWAA 1F74A 3TYAA 3VAVA 1LG2A 3V18A 1NFPA 2PDUA 1DIDA 3EPOA 2GDVA 4DBEA 1QO2A 2ZCGA 3ZZ1A 3W0KA 1PBGA 2J79A 4IL2A 1IWPA 3WD0A 1YADA 4IXHA 4Q8WA 2PDQA 3KZPA 3VNJA 3W53A 4JHZA 3VFLA 1T5AA 4ZXOA 3LENA 4JQ3A 4ZSUA 2VX4A 3R94A 3W2KA 4NXSA 4GYPC 3NXFA 1ZNNA 4PTXA 3KP0A 3QKZA 4ZB0A 1XIHA 1KM4A 2X1IA 1Y65A 3A24A 5CZJA 4O19A 4J3TA 3PPHA 2JFEX 4A4AA 1UBPC 1FHLA 4KETA 4N6FA 3I65A 4Z1CA 1TPB1 4C5YA 2O4MA 3GC5A 4ALDA 4GA8A 4OTKA 4BY3A 2J7DA 4OQVA 1M01A 1X6UA 4DUVA 5H8PA 4MJ4A 1X7IA 1R2RA 1IEVA 3O6YX 3RK8A 2P50A 1V6XA 3ARWA 3T2OA 1PIGA 4GY7A 1F73A 4LUYA 3DUGA 4ZXLA 3B40A 4M80A 1QNRA 2C13A 2Y5JA 5C55A 3CL7A 1EYWA 5D2TA 2DSUA 5BU9A 3FVMA 1VBJA 3TN6A 3BLOA 1DWFM 4KRTA 4PFMA 2P1FA 4HMNA 1R47A 4MWAB 4V1XA 3I6TA 2VC7A 3V4BA 1SGJA 3H2EA 3EYPA 1ZQ5A 3BURA 3R5EA 3UG5A 4U3AA 1BTCA 1EP3A 1ZLPA 2OKOA 4N6EA 1W54A 3UA4A 3BAKA 4M19A 2WSKA 3T7VA 4M6PA 4KCVA 3IWPA 1UB3A 4AC1X 1N2VA 1LL4A 3MMTA 4N42A 1Q4NX 4KFNA 3V1PA 1O1HA 3M47A 4CU8A 4CVWA 4PMYA 3IIZA 1DWGM 4NJIA 5F4SA 3WDPP 2E5BA 4MJMA 2PDXA 1VBRA 1YDVA 9XIMA 2VZSA 4K38A 3ZWSA 2YDSA 5G4WA 2P10A 2UY4A 3AOFA 4K68A 1SYTA 4HNUA 3AHXA 2PLJA 1Y5XA 2POZA 4JX5A 1GQKA 2C16A 4LRSA 3P8JA 1FWIC 3LQGA 3NQ6A 3F2BA 1TIWA 3CL6A 4ICMA 1KRCC 2PF8A 3KL0A 3UVIA 4PSPA 3LPOA 3W7CA 3WK1A 2FFCA 5LA1A 1JRBA 1GZ1A 4AD1A 5EMUA 2J47A 5AHLA 4XZIA 3UR7A 5G4EA 2HWGA 2VQTA 2WVUA 4PB3A 1ONEA 1B0IA 2WO5A 3W22A 2XFWA 3SW6A 3SY8A 3BLKA 2WMKA 2VEPA 5J5DA 4AW7A 3NQMA 2R1PA 1KKOA 3LI0A 3NQ8A 4IIHA 3EMQA 1KB3A 3IJDA 4WY0B 1H2JA 4NJKA 3BXWA 1RD5A 2CXGA 1G4SA 3PJWA 4BF9A 4NX5A 4O1EA 1XCWA 4IP5A 3GZAA 3O3RA 3L21A 2PD9A 2XGBA 2PDGA 4TVCA 5FD0A 1ZBVA 4R34A 3SSZA 3VDGA 4KERA 2IXUA 5I02A 1I8JA 4V15A 4HT3A 1I75A 2OCZA 2YW3A 1K7EA 1XBVA 3TA6A 4Y9AA 1GPFA 4OV9A 3HMJG 3GIYA 4CEUC 3SADA 1BHGA 1DHPA 3CWNA 3PSWA 3VNZA 2YKKA 1KNWA 2VRKA 4MZ1A 2FTPA 1B1YA 2JQXA 4IPNB 3GKAA 3HG4A 1KM2A 1ESWA 2CPUA 1OYCA 3SY1A 4XG1A 4OKDA 4AVNA 1J01A 3E0FA 2J7FA 1EPVA 4XQ6A 4WUIA 4JNMA 1U22A 3TW9A 3LMYA 3MVIA 1S5WA 4Z1BA 4RE3A 5C9UA 1ISXA 1PWMA 3R89A 3QQ0A 2IKHA 1H11A 3LNPA 3SCQA 2X7VA 3WX7A 4XD5A 4LVGA 4M8UA 3PJTA 2VEFA 2VC5A 1KCXA 2P8CA 2OWWA 1QPRA 4CNOA 3N2TA 1QI3A 2Q71A 1HF6A 2QDHA 4L56A 1IT7A 4O1CA 2OFJA 3OLDA 2G8ZA 4MNJA 4JTUA 3RX3A 3CUHA 4B4FA 2IPFA 1QPQA 2IMRA 1F61A 2OZ0A 2D2JA 3VMPA 3GG1A 7PTDA 3BQ6A 3CTLA 3RO6A 3LZ3A 3BMWA 3GDBA 4PYSA 1A0CA 1TMQA 3SM0A 3N29A 3BV4A 2OLAA 4LSBA 1Y0EA 2FHCA 1A49A 1LT7A 3EWBX 3G3MA 3KBVA 2ZX6A 5CH9A 3ARZA 2FLIA 4KCUA 4CD7A 3W38A 1DJHA 3PTQA 3BVJA 3ONBA 1J10A 3NO3A 1C92A 2Z2AA 1UQZA 2W66A 3G0SA 1S39A 5D32A 4LUSB 1IHIA 1UR3M 4OIFA 3G6LA 2W5FA 1A5MC 1EP2A 4TXEA 4XK2A 1LP6A 4MWAE 5JH1A 4QEHA 4RJEA 4K36A 2J9YA 2QDGA 4H83A 2WMGA 3NZGA 5A3HA 5B7ZA 3STGA 3WKZA 4US5A 1EJ7L 2V0TA 3T81A 3BC9A 4K39A 5I5RA 4Z2HA 4HCLA 5LXEA 1K9DA 2ZKMX 2V2HA 5AYYA 4C1KA 3GKFA 1OABA 4QXIA 3AIBA 3D5HA 5CZSA 1XW8A 2MUCA 3KE0A 2WC3A 3QMRA 3N18A 1G9HA 1E4IA 3S47A 3CV1A 4RDYA 3N9SA 1EP1A 3BAJA 1GW1A 4Y7EA 5DX7A 3V7PA 4IPLA 4ILSA 2NW0A 5EU9A 5I6SA 4N0RA 4MOZA 4IUOA 6XIAA 3OIXA 2YDQA 3W1QA 1X1OA 5ECUA 3C8NA 3TW6A 3E02A 3THUA 2ICSA 3SRFA 1JDAA 5HULA 3DC8A 4Z2IA 1KFJA 3WUGA 3R8GA 4PMVA 1OINA 4AZ5A 1ZU8A 1GVRA 1OZQA 3R10A 2VGBA 4MPKA 8XIMA 5RUBA 4H9TA 5A2AA 1K4GA 2E68A 1UR8A 1MWOA 4J2PA 1EKOA 3M5XA 3CGTA 4ORMA 1TVNA 3UQNA 4WJXA 4ASTA 1UROA 5A8QA 2JEQA 1V79A 1I0BA 1XQLA 5FAJA 1ZBKA 2CNCA 3IARA 3K4DA 3KLLA 3GIQA 3GNXA 3TYEA 3PUOA 3HQOA 4DO6A 3ITLA 1ALDA 1UWSA 3CQHA 1FHUA 3GHUA 1I2OA 4UTKA 4ZQPA 2Z00A 2HNEA 4ZGYA 2VWSA 5KTLA 4H8VA 3H55A 1E0WA 4DIAA 4GLEA 3AO0A 1VF8A 4MM1A 4AF0B 3AIRA 5FA5A 2ISSA 3ORWA 2XIMA 1X98A 2CBUA 3F03K 4CCCA 1JGMA 1AD4A 2NQZA 2IXVA 4LEFA 4NNAA 1KCKA 2JGYA 3MANA 1TWDA 1R85A 2PFHA 1AQFA 4QGCA 1U1UA 4F8XA 3HBLA 1SFTA 3KRUA 5EPDA 1VYSX 3A3HA 1VR6A 4TV6A 4I5RA 4WY0F 2EAWA 1Z42A 5E9XA 3THCA 1ZAJA 2X7WA 1JPKA 1K77A 1MQPA 2GK1A 4WSHA 2MNRA 2G41A 1H60A 3TFCA 4UMCA 3WBAA 2IW0A 2KZHA 3PC0A 4A8RA 1UP0A 1YXDA 4FXRA 2VX5A 1BFNA 5KINA 4E2OA 1FWGC 1DVJA 3VOIA 4OBTA 1VKFA 5I24A 3WEOA 3CQJA 5BOOA 1E5JA 1B3ZA 4GI4A 4HHHA 3T8LA 4JTJA 3PY2A 4PUUA 2BNJA 3R0UA 5KZMA 5HNTA 1QNOA 3K2GA 2PP1A 1BXBA 1YNYA 1F3XA 2W63A 3VM7A 4D6DA 5I0DA 2ZZ5A 1B30A 4ZO7A 2WQDA 4HYWA 2HVNA 3B0XA 4D6EA 4MUPA 4HGXA 3BH4A 5GJNA 4EWND 4NKCA 2CKRA 1XLMA 3QFEA 1VJIA 2DIEA 1IWBA 3P2VA 3ITYA 4FXSA 3M0YA 1ZSXA 2AKZA 3E1F1 1EA9C 1J6PA 1WBJA 3CHFA 3H53A 1PKLA 4JY8A 4ACYA 2WVVB 5L9FA 4HYRA 5F7UA 1FUYA 1TKKA 5FF0A 3S9ZA 3CAQA 1EQPA 1H7NA 2BY2A 5D37A 1F76A 1IYXA 2VURA 3UA3A 1J96A 4GQBA 4BQ5A 3L9CA 4DUOA 4RZ6A 1GG0A 3H26A 4L6DA 3VD7A 5FESA 3WFZA 3HN3A 1JI2A 5ABTA 1Q6QA 4L9ZA 2KX9A 3P81A 1J18A 4BF5A 3TN4A 5A8MA 1JZ7A 2OPJA 2GFTA 3RPMA 2GQ8A 3H7RA 3BW3A 2PWEA 1KTBA 2BHUA 3A13A 2PWHA 4KEZA 1RPXA 2INZA 1U5JA 4M7SA 2VYOA 1CXIA 3D0CA 2Q3RA 4QNWA 2DZTA 4MWAC 3GR7A 3H12A 4HNTA 3VGBA 3BLLA 4UQCA 1V02E 3DIPA 4XBSA 1A5LC 4UQEA 1RP9A 2D0FA 1XKYA 3MTWA 5D2XA 2DZSA 1TO3A 4PMXA 4L7ZA 2EPHA 5ECVA 3PFMA 3TYZA 3TONA 1E6QM 1PHQA 4KWSA 3FCPA 3VIOA 2GSJA 2VQUA 3BG3A 2QUUA 3F5KA 2ZWZA 4CQ8A 4JTHA 4AIEA 4DYJA 4BQ2A 4W84A 1GEHA 4NF7A 1MEHA 3W84A 3SQSA 3LB0A 2XGZA 1GHRA 3DBNA 3NCOA 5TD4A 2TRSA 2HS8A 1S2UA 4NAFB 4WKAA 5ABEA 4L4LA 2Z4GA 3NZQA 4UMAA 4JIIX 1OQFA 5HJLA 5FI8A 4AHQA 4I7WA 5E9AA 1HL8A 3ITXA 3S6DA 1FBAA 4J28A 3Q37A 4DZHA 3DKLA 4ICNA 3DZ1A 4HBKA 1RVGA 4O13A 3W2NA 3DFHA 3IUHA 4AWTA 3S6TA 3CQIA 3P3BA 2PTWA 3BARA 1HJQA 1DYSA 3CHEA 3D46A 3UYIA 2ZXDA 3T05A 3VM5A 5G1MA 2PEVA 3EDKA