3EX3A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-azido-ump, covalent adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
b'MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
molecule tags Lyase
source organism Homo sapiens
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex3A00
3EWBX 1LRQA 3S1WA 3QH2A 3MBDA 5TIMA 5G2IA 3M5ZA 3W9ZA 4KFPA 3PC0A 6ALDA 3A9IA 1OF8A 3NPUA 3LV5A 3STCA 3GIYA 5FI8A 5F1UA 1SZNA 1Q6QA 3FOKA 1K03A 3HF3A 4DO4A 1G4PA 3GYEA 5CPMA 3NL2A 3HG2A 4M7SA 5C2XA 3P67A 5AHMA 5D04C 4DBEA 2X1TA 4LY8A 5K7JA 4MLJA 1OF6A 1YXYA 1MXSA 2G97A 2QJIA 2TSYA 5HJLA 4Y8FA 1WYIA 3G22A 1K8XA 3NZRA 3P84A 4UR8A 4JIQA 3NM3A 4RV8A 3FJLA 1IGSA 4OWGA 4WJEA 2NX1A 3C2FA 5CZTA 2F7FA 1JR1A 2HTMA 2FB3A 2QUVA 2GQAA 4NXSA 2A21A 2YPIA 3OBKA 2W6RA 3TAKA 1TCDA 3HG3A 4OU1A 4GNJA 4A29A 2J9ZA 2PE4A 5U4NA 3NQGA 4QIUA 2QDGA 3B0PA 4UFLA 2WSYA 3L0NA 3DFSA 2H3DA 1I2NA 4NJHA 3I7RA 1I8JA 3S0CA 3T44A 3O1NA 2FTPA 4UTWA 2J27A 2H8XA 2YDAA 1KBIA 4LV4A 3LRMA 2CLLA 3CT7A 3VCRA 3LV6A 3G1AA 5EPDA 2VFDA 3O63A 3TC6A 4OV9A 3W7PA 4JDYA 2QCNA 1XBXA 4QITA 5TQLA 3KRUA 1JRBA 4IPIA 3C3NA 3TV8A 4JTLA 5A5WA 1SR9A 4FNUA 1LOSA 1T99A 1WAUA 3O8AA 5E0KA 4X3ZA 1DORA 3GXNA 3W1NA 3QQ0A 2EAWA 4GJ1A 5K9XA 4CQ9A 2ZA1A 2EKCA 1A5CA 1VHNA 5LNRA 4PEKA 5FF4A 3ANYA 2V30A 2Y88A 2ZQ0A 4OGZA 3L9CA 4ICNA 3MYPA 1H7XA 1NSJA 4HHPA 4BI7A 2LLEA 5CGQA 1RPXA 5IBXA 1O60A 3LCIA 3CEUA 3DFTA 4WY0B 2A7NA 1XKYA 2ABAA 3IRDA 4I7WA 4NJKA 4UTTC 3L21A 5EBUA 3S8HA 3PF3A 5D2WA 3NYZA 1OX6A 3FYOA 1SSDA 1TQXA 2VFFA 3U6WA 3P60A 4ORMA 3QQ1A 5I3JA 4CCEA 4WXYA 5DY2A 1C29A 1KV5A 3W7MA 1EX5A 1GZGA 4ORIA 3NQDA 3NOEA 3S6DA 4B5NA 2A7RA 2Z6JA 2QCMA 4MVAA 3LCXA 4JS3A 4TR9A 3M0ZA 4NJIA 2FPVA 3W1RA 1G7VA 3GNDA 1QPRA 1BWLA 3NO5A 4NQ1A 4FEZA 1YXCA 2DZSA 3VI2A 2JKEA 4PH6A 3W2MA 4LRTA 2W79A 2WSQA 4UFIA 3KAOA 3W88A 5LSMA 5DLCA 3DFNA 1KM3A 1FWSA 1Z42A 4KWWA 3S5ZA 1TV8A 1EWEA 3W2JA 3RMJA 2JKAA 2HS8A 3UXDA 1SO4A 1RQBA 2BLEA 1OYAA 4FX8A 3DKJA 1ZNNA 3W70A 1TTQA 4JX4A 3BARA 1LP6A 1M7OA 4M5PA 3P74A 4IPJA 5BOOA 4KFOA 4O4VA 4LVFA 3N34A 1P4CA 4UTHA 5MHBA 3LB0A 3HGJA 5TBOA 1FWWA 3LHUA 3LHVA 2J9YA 3Q37A 3QMRA 2PRHA 2FJKA 3PG8A 3PR2A 1ML1A 4A21A 5K9CA 5D09A 5DXYA 3Q2DA 5SWUA 3K30A 3CLMA 3B03A 1LORA 5CZ0A 4O8RA 1LZOA 5I3GA 2RDTA 1FWTA 2DZVA 1F6KA 1ZFJA 3W7HA 5AHFA 4QM1A 1XM3A 1O5KA 3V1PA 1L6SA 2DU2A 5J5DA 2Y6ZA 4P2VA 2E5DA 4O15A 3C2RA 4K37A 2VELA 4ZQNA 4LC8A 1OK4A 1OFRA 3EWZA 4WUIA 2ISWA 5F4WA 5D33A 1NVMA 3TX9A 4MYAA 1QFEA 4IXXA 2BXVA 2QUTA 3THQA 3QRHA 4I7UA 2X1RA 2X30A 1F73A 4LV9A 1LYXA 1MEWA 5F2MA 3PG9A 4R33A 3UXAA 4JD4A 1AW2A 3F4NA 1DJNA 1XC4A 3LHWA 1H7OA 1CW2A 4AHQA 4FNQA 3W1TA 4JIPA 2V2DA 2C0AA 2R8WA 4JTIA 1QMLA 3LCLA 3H53A 3FFSA 3NVTA 3W1MA 1TTPA 1H60A 3OVPA 4WD0A 2E77A 3HB9A 2GVJA 4X9SA 4UTUA 5LGZA 1MZHA 3PSVA 3E12A 4O10A 1ME8A 2CW6A 4DPPA 5AC7A 1N55A 2OMAA 2JK2A 3PULA 4FXRA 2ATMA 5D32A 5LNUA 4A3UA 3ATZA 3CIWA 3LCHA 3W2UA 4N6EA 3ZWTA 2C16A 3TNOA 3BW2A 1LOLA 4GWEA 3B4UA 4O28A 3I6RA 1NF7A 3NQMA 3IV3A 3GX9A 4UMAA 5C55A 4JX6A 4KWVA 1EUAA 1XBZA 4LT9A 3FS2A 4UFJA 2NWRA 5HR7A 3GXPA 3N19B 4UTTA 3QMTA 4IMGA 4Q4KA 5F4XA 1KW1A 1S3HA 1H62A 3S1VA 5I3KA 5AHEA 1S5TA 4HN4A 3S5OA 2YSWA 3NQ7A 2XFWA 4DELA 1AL7A 4QSHA 5A8GA 4DEFA 2V9DA 3FEMA 3QPYA 2WV8A 3WK1A 1R2RA 1YPIA 2VXNA 1FWRA 3UQNA 2QCCA 4UNLA 1X7FA 4FNTA 1QPNA 4DQWA 3OHIA 1WA3A 1TPDA 3TAOA 2W0UA 4CNNA 3W3OA 1JULA 1KFCA 4Y6GA 3PVFA 1FCQA 1QO5A 2YW4A 4Z0JA 2A6LA 1K3UA 2YGYA 3G1FA 3NQ8A 4LU0A 1FCBA 3UNDA 1H7PA 3THAA 3W2LA 3C2EA 4M6QA 2ZZ7A 4Z1AA 2ALDA 1NEYA 1KFLA 5HQEA 3TR2A 3CQ0A 1GJPA 5U7SA 3L5MA 4Z1DA 2XN0A 1T96A 3IVSA 1SSGA 3R12A 4O4WA 4OBTA 4RKAA 3WFAA 5BW6A 4XTIA 4RZ5A 3KRSA 3JS3A 1J2WA 3UWZA 1XCFA 5G4WA 5LNWA 3M41A 5HUOA 5D2VA 1W0MA 1SZEA 4RLIA 3EWXA 4ZZ9A 3W2NA 3BGGA 3W1QA 5DY3A 4O1DA 2EGZA 4LWWA 3MJYA 4UCGA 3G0SA 2A7PA 3PUOA 3HPZA 4LVAA 4BFAA 5DN1A 4ADSA 1JUEA 3CWOX 3C4UA 3MW7A 3GDTA 1GVFA 1OX5A 1ZCOA 2VEKA 3TFXA 4MYXA 3B0VC 1VCFA 1W56A 2WNZA 3NL3A 4LOCA 4Q32A 3HGSA 2VEIA 1ME9A 5F1VA 5BMWA 2E09A 3ABRA 4Z1CA 2X1UA 5AFDA 3TJLA 1KBJA 1LBFA 1WDWA 2DZUA 1DOSA 2Y7FA 5L9FA 1GPWA 2UV8G 2P10A 4Z0SA 3HGRA 4QNEA 4O0KA 4DF0A 1IIGA 1YTEA 1YTDA 2DORA 3H55A 4MZ1A 1F2JA 4N4QA 5D38A 3GDMA 3TU9A 2E68A 3PSWA 1S5VA 1SW3A 3DZ1A 4XTDA 5D03A 4ZVJA 1EPXA 3U8GA 2ZRVA 3P82A 3CIXA 4JGDA 2C1HA 5CKSA 5DXXA 3TW6A 4D2JA 3NG3A 1I45A 3W84A 1QAPA 2NWSA 1IIHA 1WQ5A 1M6JA 1DHPA 3F4WA 1ZHAA 2JBMA 2ZTJA 3IIPA 3G0UA 3M9YA 1RR2A 1PHWA 3STEA 2QJGA 3L65A 4UMCA 3NPVA 1EB3A 1PL9A 2NZLA 1DVJA 4IMCA 4RX0A 3PBYA 2V81A 1VCVA 4HSNA 4PCFA 1P1XA 5LHEA 1VYSX 3F03K 1WBJA 4YXGA 4Q33A 3GDKA 4JNMA 1VJIA 4GUIA 3GVGA 2Y7EA 3TE9A 1OABA 3DU0A 2AGKA 4K7VA 4O57A 1PS9A 2Q3OA 1VYPX 5DCBA 3YPIA 1Z41A 1JJKA 2OCZA 3L5AA 4C1LA 3D0CA 3CC1A 1U5JA 2WSRA 5D05A 2ZZ6A 3VE7A 1TB3A 3IEBA 4ADTA 2C19A 3QW4B 3I7SA 1T8XA 4O50A 1JQXA 5HR6A 2J88A 2TPSA 1Y0EA 3VE9A 2WO5A 2YYTA 2C6QA 3KOFA 1ZJIA 3LERA 2DP3A 3PAJA 4MIMA 2B7QA 2V2HA 5GVJA 3WK2A 4MZYA 4UNKA 4DXVA 4MFEA 1B9BA 1MSSA 5D2TA 3MBFA 2ZRUA 3FKRA 5F2LA 1OYBA 3L5LA 2YX0A 3E02A 3M44A 3IIXA 4LNYA 3LCFA 3M6YA 1EUNA 3W6YA 4L4MA 1W54A 3PB0A 3ZWSA 1PE1A 3AJXA 3LX9A 5FF0A 3W7QA 1W5OA 1PV8A 5F2GA 1G7UA 1GQNA 3M43A 1V5XA 2CWNA 5G1YA 3GDLA 3O15A 1TSIA 1QWGA 2JGYA 3B06A 3UY8A 3W07A 5C6MA 4POCA 3KVMA 3O6YX 3EX2A 4S2CA 1XFBA 1VGAA 3HPXA 1NF0A 4CQAA 4WY0F 1TIMA 4UFMA 3W7GA 1LRTA 4ZQRA 4AH7A 1JCYA 3UZJA 2BX7A 3GAKA 1O94A 1K8YA 1QOQA 1G69A 3TXVA 1W31A 1OFBA 3F1QA 3SR7A 5K4ZA 2V2CA 2FIQA 1TRDA 1F7BA 3LTYA 2Y61A 4NXKA 4N6FA 1RD5A 3QSTA 2ZZ3A 3WJSA 4MY1A 4O17A 3FLUA 3QW3A 2CLOA 4WY0A 4M19A 2JGQA 5F4SA 3LLFA 4RZ6A 4IXHA 1EEPA 3TA6A 1A5AA 4AHOA 3SSJA 4AXKA 2YR1A 3CM4A 1ICPA 4AMAA 1OYCA 5FEZA 1I2RA 1DQWA 3M16A 2RH9A 2QCEA 2QR6A 1OFEA 2NUWA 5K4XA 3STFA 1H63A 1JUBA 3QEZA 2GQ8A 4DO5A 2G95A 1DQXA 4BF9A 3TIMA 4A2RA 3HGOA 3WK3A 4UTJA 1XI3A 3FYPA 4OV4A 1GVRA 2ZRWA 3M5YA 4PC8A 3LDVA 4GUJA 3DGRA 1VPXA 3C8FA 1M7PA 3S1XA 1AL8A 2Y7DA 1LBLA 1SPQA 3W86A 1TPEA 1R30A 5CPOA 1XBVA 4JX5A 4JDBA 4CCDA 2CLFA 5AYZA 1TPC1 4AF0B 1QPOA 3NAVA 4JICA 1PHQA 2WPBA 3M7WA 3T7VA 3N9RA 5AYXA 1L9WA 2P1FA 3PBUA 1VHCA 4BR1A 4NNAA 2WJZA 2ISSA 1HUVA 2NXGA 3BW3A 1OVDA 2B7OA 3USBA 2J6XA 2VFHA 3UWWA 3L0KA 5CPNA 1LBMA 4KFNA 3SZ8A 5KZEA 2HSAA 1ADOA 3Q58A 1EP1A 3W76A 1D3HA 3TDFA 3W73A 2E6DA 1TMHA 4PL2A 4N9BA 3IGUA 4KKXA 4AF0A 1QR7A 5ABTA 2PC4A 4A22A 3ZS4A 3UWYA 4NT0A 2ZTKA 2C13A 2FQIA 3T55A 5AN7A 3W72A 3NL5A 4OE7A 3WJWA 1JCLA 1BWKA 2A85A 2QCGA 2Y89A 3EX1A 5HINA 3DXIA 3C52A 2WNNA 4R7JA 4TO8A 4UFHA 4N9EA 1OFAA 4AEOA 4ML9A 4U28A 3PB2A 3GB6A 4JTUA 4JEQA 2QUUA 4RZ4A 4XQ6A 4K8HA 4LVBA 2HS6A 3BLFA 3LTPA 4RCXA 3EWWA 1SFLA 4R34A 1SO5A 4JY8A 1JCNA 3IIZA 3NZ1A 2NXIA 4MUZA 2PURA 2DZWA 1B4EA 3UZ5A 4G1KA 1KM1A 2X16A 5EY5A 3LI1A 2DZTA 2X1SA 4NJGA 2Q3RA 5AOUA 4K6AA 4FB7A 1PIIA 3P5YA 2A6NA 4R53A 4QJ1A 4JTSA 2D73A 1BTMA 1GTHA 3C0JA 3G1SA 2XN1A 4LTSA 3UPBA 4N2YA 3H54A 3EX3A 1JCMP 4NZFA 5I3HA 1N7KA 5HWMA 1JUKA 3FA5A 5FEWA 5E93A 3MI2A 5FESA 1G6CA 3M5XA 1KM5A 3G18A 3KVKA 1H61A 1JCXA 5FF3A 1D3GA 1GG1A 5AHLA 4K36A 4LW7A 2YCEA 3S1UA 3SGUA 4OT7A 3O06A 5HNRA 3NQCA 3NGJA 4YWIA 3EXSA 1KFJA 2J24A 3C56A 3EKLA 4ZL1A 4OQVA 1BKSA 3DFOA 3B8DA 1KTCA 3DHFA 1K7EA 3VFLA 1QO2A 2V82A 2E6AA 3W7EA 1KM4A 2ISVA 4IWWA 3KVJA 3EX4A 3ABOA 1AW1A 5LZLA 3GR8A 3G1HA 5CG7A 2TMDA 3ABSA 3LRKA 3G3DA 1ZENA 2H8ZA 3HPSA 2H90A 4UTWC 4UR7A 3QF0A 2WOQA 3FIGA 1P0KA 3TMLA 1DV7A 1HO1A 1TV7A 1E51A 1YXDA 2NUXA 1KLYA 2QCLA 2PRLA 4ALDA 3LRLA 3SGZA 3W75A 1UB3A 1FDYA 2FFCA 1VLIA 1PVNA 2CZEA 4JYDA 4MJMA 1MO0A 1VCGA 3M5VA 2ZDRA 3LI0A 1W5MA 4GBUA 1EA0A 3HQ1A 1W5NA 2B4GA 4IMFA 4CNPA 2A2IA 3W7OA 1A5SA 1Q45A 1F5ZA 4UC5A 2C18A 2QCDA 4YLWA 3P8JA 1A53A 3ABQA 3PY2A 5KTLA 4EVZA 4ZQOA 1Q6OA 3GDRA 3TCEA 1KV8A 4UTMA 4UTIA 2RHGA 3MO7A 4BK9A 1HFBA 3C6CA 5CZSA 5L6UA 1H1ZA 3FJ6A 1VRDA 1TPUA 1Z44A 3HG4A 2OT0A 3R13A 3W2KA 3DH7A 2YZRA 2C14A 2A1YA 4Y90A 2ZRXA 5D02A 3W7LA 3G1XA 4TX9A 2CU0A 2QEZA 3TQKA 4GUFA 1B57A 3UWVA 3OVQA 4O1CA 1KM6A 1TV5A 2F84A 4PTNA 3MP5A 1TREA 4RR4A 2VC6A 4FF7A 1TPVA 1CI1A 1P0NA 4CLMA 3O16A 2DJXA 3LXCA 4MPQA 1VC4A 2XN2A 3HIJA 1W1ZA 4X2RA 4NX5A 2TRSA 4OHQA 4BWLC 3BK0A 1OFQA 5KINA 2KZHA 4NNCA 2DZPA 3EWUA 3VKJA 1W3IA 1IXNA 4LVDA 4PL1A 2GOUA 4O1BA 3R2GA 3OA3A 4AB4A 1YTKA 3OIXA 4E2BA 2QAPA 3SFKA 3MMTA 3NPXA 1XBYA 5DCDA 4XKYB 3HBLA 2Y70A 4CNOA 3CEPA 2EF9A 1ME7A 1WXJA 3WK0A 4AAJA 1FDZA 3PBWA 3KX6A 3INPA 4XBSA 1ZAIA 4GXMA 3MI6A 4GFSA 2GUUA 3HO8A 3L2IA 4MFDA 3SI9A 3W7CA 5H2ZA 1G67A 2ZCGA 3A23A 4IJBA 1LDCA 3E9AA 4LUIA 4U4MA 1YADA 3IVTA 2BSLA 4EF9A 2E6FA 4IMDA 1KA9F 3NR0A 2TYSA 2E5BA 4GE8A 1VYRA 4PA8A 3G8EA 2I9EA 2Z2UA 1RZMA 5J5RA 4RXFA 4O14A 1OFOA 1DBTA 3R89A 3W23A 2RKXA 2WNQA 1A50A 2GPTA 3MYOA 1LTDA 3W22A 4JYEA 1G4TA 2CZ5A 3BLEA 2V0TA 1Q3NA 3RLUA 5KZDA 3UPWA 3W1AA 2Y63A 2OX1A 5BMXA 2Z1BA 3A22A 1WOAA 1K7FA 4O1AA 1FUYA 1U83A 4HT3A 5D30A 1O4UA 2ZZ2A 4HPXA 4Y9AA 4QQ3A 3MWAA 4YCPA 3NQAA 4FHAA 4XWUA 5CZJA 3W83A 4FNRA 1I4NA 2H6RA 1D9EA 3G1VA 3LXAA 4FIQA 3QPZA 2GVGA 2VOMA 4H6KA 5G1TA 3P80A 4Z08A 3O6DA 1GYLA 5DCEA 1TTIA 1C9DA 1ICSA 1I2PA 4AWUA 5K3VA 1KM2A 2QF7A 2VFEA 3C61A 4BWLA 4DF2A 5FF2A 5FEPA 4HNTA 2QKFA 2R14A 3LLDA 3ZR4A 1NAL1 2A5HA 3C2OA 4EF8A 5G2WA 1VR6A 2V8ZA 3TFCA 3MHGA 3DHDA 3TKFA 3R5EA 4QAIA 5AC6A 2VFGA 2H3BA 3W74A 2CFFA 3UWUA 4H3DA 3ZFHA 2V5LA 2VEMA 3KRZA 1HG3A 1DKWA 4K7YA 5FF7A 3A24A 7TIMA 5I3IA 2EPHA 1GYNA 4EIVA 3BVJA 3TW7A 3W7NA 3RNDA 2PRMA 3BG5A 2YFOA 3QFEA 3EB2A 3TC7A 4PODA 1Z48A 2QCHA 3QM3A 5LNVA 2VENA 3BG9A 4AWSA 4LS0A 2CLHA 3DKLA 2R94A 1FXQA 1H51A 4LRSA 3PM6A 4O19A 3QZEA 3W7DA 2NX3A 3EXRA 1H1YA 3L67A 3TSBA 4PFMA 3EEGA 3GR7A 1VLWA 4UUIA 3GZ3A 1YPFA 1SU5A 4E38A 2ZZ5A 3W1PA 4ADUA 1FQ0A 2QJHA 3LHZA 5G5IA 1YDNA 3LCWA 3TUUA 3HOJA 4M6PA 3LHYA 3GAYA 4MKNA 3P62A 4L4LA 4NZJA 5LGXA 3QMSA 3UY7A 4DF1A 3E49A 3CWNA 3MI3A 3T4CA 4GRSA 3KVLA 4HNNA 4WX2A 1AMKA 3BLIA 1ZAHA 2GJLA 5AHIA 3ELFA 1O95A 5AB3A 1A5BA 3MUXA 3CU2A 3ATYA 3TK7A 5IM51 1RVGA 1KM0A 1BEUA 1Q6LA 2Q8LA 4RXGA 4XZ9A 1OK6A 2FLIA 3LGEA 1HTIA 4K8EA 4RJEA 1R2TA 3DENA 4ZQCA 2GJNA 3MP3A 1L6WA 1RV8A 4E0CA 2OJPA 4FX6M 3S5NA 5KZMA 3KXQA 3FKKA 3RU6A 2R91A 4MY8A 3EKZA 4N9CA 1WX0A 1FBAA 1LLZA 3TSDA 5CSRA 1WBHA 1EP3A 3DAQA 1N8FA 1DJQA 1R47A 5E1QA 4O13A 2CLMA 5HWJA 1JRCA 3M47A 1ONRA 1LLWA 3SY5A 1KLZA 3B04A 1G4EA 3G0XA 3O07A 4GC4A 3GK0A 2ZZ1A 3S5YA 3G1YA 4IQLA 4EWND 3BV4A 4I9AA 3TXZA 4AVFA 3T78A 1OX4A 5C5YA 2NX9A 2C15A 2GVLA 2NV2A 1XUZA 1UBSA 2BWGA 3R8RA 2G96A 3RLVA 1QOPA 1IXOA 1GTEA 5HULA 1J4EA 4FXSA 3P61A 1TPFA 4XUGA 2CZFA 1EIXA 4UFKA 5DBUA 2QCFA 3S42A 1GG0A 3BW4A 1LCOA 3M1ZA 6TIMA 5EA9A 3A21A 2AQWA 4GUGA 1FCVA 2QAFA 4YCOA 1ZY9A 1T0OA 2VFIA 4XBKA 2QDHA 4NUWA 1X1OA 3A5VA 4HKPA 4AHPA 2WQPA 4NU7A 3BPWA 1QNVA 2VEPA 3G1DA 3U2OA 5D37A 1LOQA 4K39A 5C54A 4H4IA 1F6PA 3DFQA 3JR2A 2ZRYA 1KTNA 2CLIA 2ZA3A 3BG3A 1AK5A 3N2XA 2PCQA 2YFNA 4LVGA 4FX7A 4A2SA 4JXCA 3QYQA 5AC8A 3PBVA 3O05A 1FCUA 5D2YA 4ONVA 2ZRZA 5DELA 3EWYA 3L68A 1LROA 4O54A 1GEQA 3HJZA 1XL9A 3E0IA 3DI0A 2HMCA 3RFAA 3UWQA 4N02A 3A5FA 4MLRA 4O18A 3GXTA 1MEHA 4O0ZA 2X2GA 5HUPA 3OG3A 5HMSA 3EX6A 4BI6A 4IMEA 1O5XA 3IGXA 2OT1A 4IOTA 3BGJA 4JY9A 1P5BA 2ZYFA 4EOUA 5AYYA 4Z1BA 1AG1O 5K9DA 1JVNA 2NLIA 2ZA2A 4FNSA 3DI1A 3W7KA 3Q94A 2ZBTA 4MY9A 1FY6A 2VKZG 1L6YA 2OZ0A 3GKFA 4O16A 3V75A 4WOQA 3N14A 3NPWA 4UTKA 4HIBA 2FB2A 2A4AA 1SO6A 1F05A 2B7PA 1R2SA 4JYFA 5EYWA 1R46A 1VH7A 3SECA 3TQVA 1X8FA 5G4EA 4MZ8A 3NQFA 2BZNA 5KSWA 3DBPA 1SUXA 3MP4A 1UCWA 1X1ZA 3W7IA 5K2ZA 5LNSA 1ZAJA 4XKYA 4TMBA 4FIRA 4NNBA 3NEVA 3G24A 1QCWA 2IQTA 3C2VA 4QISA 4YL2A 3IGSA 3LBCA 1ICQA 3BO9A 1SZFA 1TPH1 3W7RA 4JTHA 2NUYA 1KTBA 1KFKA 4YMZA 3MHFA 4P61A 4NJJA 1TJPA 3LCGA 1F76A 3RF9A 2CLKA 1Q6RA 1W3NA 1UUMA 5H91A 1TQJA 5IBXC 2Z0IA 2DJLA 1JCJA 1W37A 3NM1A 1FXPA 1K7XA 2RDWA 1XDLA 1V7YA 3OVRA 1EWDA 3LM7A 1HO4A 3UYCA 2FPYA 4MJZA 4LS2A 3N9SA 3LXBA 3NXFA 4E2DA 1GVOA 4C1KA 5G2HA 1C8VA 3AO0A 2YYUA 3QSRA 5CSSA 4TMCA 3KHJA 3I7QA 1B3OA 8TIMA 4N4PA 1IF2A 2E6YA 3RK8A 1IXPA 3CPRA 3EXTA 3NDOA 4CCCA 2Y7GA 1F74A 4JR5A 3I65A 3W1LA 2CLEA 3L66A 3CHVA 1VZWA 1TO3A 1PCWA 2ATSA 1PCKA 3VNDA 1OHLA 3LHTA 4ZQMA 1G4SA 4S1FA 4LUJA 3CB8A 5EL1A 2NV1A 4JN6A 3CTLA 4UMBA 2O7QA 1YDVA 4O52A 1ZALA 4DPQA 3SW6A 5KMYA 4WZHA 2Y62A 1UUOA 3PUDA 1IXQA 4W9TA 1SW7A 5D2XA 3PUEA 5EKYA 3P81A 1H7WA 3LOTA 2G5WA 2YXGA 3HG5A 1UJPA 1SZGA 5F2IA 1W3TA 1KFEA 1WOBA 1DL3A 3LTSA 1OJXA 3S9YA 1M5WA 1GWJA 4J9JA 3B0UX 2YW3A 1SQ7A 4HNUA 1XXXA 1YYAA 4TU1A 3TSMA 1VQTA 5I3FA 1THFD 3NQVA 1GOXA 4IX0A 2I1OA 4LC6A 2E1DA 1YLVA 2FDSA 4RK8A 1H50A 4UTLA 3NA8A 3HMJG 5LHFA 4JTFA 2CZDA 1OG0A 3GKAA 5LKYA 3W87A 2FPTA 3W7JA 3QC3A 1AW5A 1H7RA 3E96A 1YDOA 4X22A 1L2UA 1SFJA 1XDMA 4NX0A 1FDJA 3KFTA 4JTTA 1GVQA 1QPQA 1W5PA 2C3ZA 2Z6IA 1KFBA 3SIZA 3UD6A 2E5CA 4HNVA 3QJAA 1K02A 3TQ0A 5EMUA 1FX6A 1TTJA 3LBMA 3P8IA 3T40A 4QNWA 5T26A 4UXDA 3O6CA 4FNPA 3W71A 4IGHA 1B4KA 1HL2A 1S5WA 2ABBA 3G8RA 3GNNA 1I2OA 5HWNA 4JTJA 1ALDA 2Y85A 5CPLA 4S2BA 4K38A 1LRNA 1QDSA 3STGA 2EHHA 2ZFAA 4ZMGA 5FEXA 1NFBA 4BI5A 3NL6A 2WKJA 3L0GA 4FO4A 1OX4B 3WJYA 4CQ8A 4DBDA 1JQVA 2P0OA 3MHUA 3GLCA 4NVTA 2A0NA 1OFDA 4ZQPA 2O7SA 3TJXA 1XUUA 2JKPA 3W1UA 1TPB1 3NQEA 1EP2A 5AHNA 3JRKA 4GUHA 3I68A 5DBTA 1SO3A 1H5YA 3NQ6A 1W5QA 4DO6A 4N9DA 1I2QA 3WJZA 1X6UA 3PWAA 1GT8A 4TIMA 2DZXA 3N73A 4WXZA 4HPJA 2I14A 4M7TA 1WV2A 2QCDB 3PS7A 4WQ6A 3G3MA 3OEXA 1RQEA 1TYGA 1J5TA 3IIOA 4JTEA 1LM1A 2GQ9A 3WJXA 3NNTA 4JTKA 4JTGA 2J9XA 4O11A 1RQHA 1TRIA 1SW0A 2RFGA 3W85A 4IX2A 4MOZA 4O53A 1VS1A 4WOZA 1K8ZA 3DFPA 4O12A 5BRBA 2Q8ZA 2AAMA 3IIVA 3TROA 1TPWA 1W8SA 3SJ3A 4HSOA 4IUOA 3TMQA 4LS1A 2B0MA 2BTMA 2ZZ4A 5BNKA 2NXHA 3P5ZA 4AWTA 3N3MA 1GVSA 1UASA 1H7NA 4UIOA 2V5BA 5KITA 2B7NA 1CX9A 1TJRA 1MEIA 3IVUA 4Y96A 1OFPA 3NQ2A 4I7VA 4M6VA 3B05A 1FWNA 3W1XA 2RDUA 3P7YA 3TH6A 3N2MA
chains in the Genus database with same CATH superfamily
3CUZA 3EWBX 3MBDA 3N4FA 2ON3A 4WGHA 4CQCA 1UR4A 4AZIA 4KFPA 4A3RA 5C9UA 4EPDC 2QDEA 1CLXA 3LV5A 5CAKA 3H4WA 3GIYA 2J78A 3OP2A 1W1PA 1Q6QA 3FOKA 1K03A 1E4NA 5C2XA 3P67A 5AHMA 4G1NA 3NSNA 2XIJA 4QJ4B 5LIKX 4DBUA 1OF6A 1XP3A 3UBPC 4E6MA 2WHLA 2QJIA 2A3EA 4GO8A 3S2LA 1WYIA 3TQPA 1ZBCA 3KL0A 1NY1A 1Q4NX 3KCLA 5IOBA 3FJLA 4JFTA 4LAUA 3QOKA 2BHZA 3C2FA 2FH8A 3DOPA 3SM0A 1UD2A 2HTMA 2FB3A 2I17A 1M7XA 1UQYA 4NXSA 2A21A 3OBKA 2W6RA 3TAKA 1TCDA 1HX0A 5A8MA 4KCWA 4QIUA 1HVXA 2QDGA 1JAEA 3B0PA 2AGTA 4LUSB 1V6TA 4NJHA 2RAGA 1I8JA 4CNTA 3S0CA 3D3AA 2D0GA 4XISA 2H8XA 1U1HA 3R1ZA 5ABGA 2CLLA 5EPDA 3G1AA 4I5UA 4GI4A 3TC6A 3W7PA 1DWFM 1NTHA 3KRUA 1R3RA 4IPIA 4GD0A 1CPUA 1T99A 3T2PA 2J74A 2XFFA 2TODA 3GXNA 3MDUA 4MSSA 1O68A 4PUWA 3B8SA 2P3ZA 2YXOA 1TCMA 1UW9A 2EKCA 5ABEA 1V6UA 2W3ZA 5LNRA 2V30A 4MMWA 2PMQA 2IKHA 1KWKA 4EX4A 3MYPA 1H7XA 3ZJ7A 1W1TA 1S5NA 4KF1A 1XD0A 3TA9A 4KEZA 4J2PA 2FZNA 1E1CB 3S9IA 4C5ZA 3HV8A 4UTTC 1O66A 3L21A 3EDFA 4QX4A 3VGHA 1OX6A 3RPTA 1SSDA 4DY1A 4DJED 3U6WA 1KQZA 4OECA 4R85A 4C6CA 3C8NA 1XLJA 1KV5A 3W7MA 4ZSUA 1R3QA 3NQDA 4B5NA 2A7RA 3RRAA 2QCMA 1UWSA 1CECA 3DFHA 1G7VA 1TWIA 3R8HA 4NQ1A 4PUEA 1VIWA 4DUVA 1GJWA 3EEZA 1GKPA 2XSAA 4UFIA 1BYCA 3WQFA 3OJGA 4QS5A 5HOSA 1KBKA 4GOAA 1BG4A 3MPGA 3MS8A 1FWSA 1Z42A 3UR7A 1RH9A 2JKAA 3EMQA 1NDVA 2BLEA 5GJPA 2HWGA 1TTQA 1V3LA 4JX4A 2VDGA 3BARA 4GIRA 2Y5EA 1EJTC 2GOKA 2G3MA 1E71M 5BOOA 3VK5A 4O4VA 3RCNA 4GNKB 3N34A 1CLKA 1UJQA 1P4CA 4UTHA 1EH9A 3LA4A 2QIIA 2XDFA 5TBOA 3Q37A 3QMRA 1F3TA 4A21A 2PDKA 3EZ4A 4Q7IA 1QATA 2CBUA 4X2PA 3B03A 1D7KA 3WNMA 1LZOA 5I3GA 2V3FA 3WDJA 1FWTA 3M46A 1VAHA 2DZVA 1JZ3A 3WEMA 1XM3A 1O5KA 3V1PA 5J5DA 3E1F1 4UQ9A 2E5DA 2YLLA 2HXTA 3C2RA 3AS3A 4ZQNA 3W00A 3GG0A 1R9YA 1FWCC 3VKKA 2PDIA 3TONA 3THCA 1LYXA 3MSDA 1EC7A 3PG9A 4R33A 3UXAA 2X40A 1TA3A 3F4NA 2DDXA 1H7OA 4U5IA 1OG6A 5LXXA 1XRFA 2WJDA 4JTIA 4F40A 1BXNA 1FWBC 1GZ1A 3LCLA 3S46A 3AIQA 3OVPA 1H09A 3PSVA 4HJWA 4L65A 4V28A 2CW6A 4S3JA 5AC7A 1ZU8A 1XSIA 4PMXA 5AVHA 2ATMA 5D32A 3F2BA 5LNUA 4A3UA 4PB3A 3ATZA 3K2GA 4NF7A 3H8AA 3U0HA 4WRHA 2C16A 2VWSA 2OWWA 4YTSA 2AL2A 4HZMA 2BDQA 2D23A 1ONEA 2J47A 2VX5A 4US5A 4HCLA 1XBZA 4LT9A 3FS2A 1TVPA 2NWRA 1LUCA 1OBAA 5HR7A 4H41A 1HKWA 1KW1A 3SGGA 1H62A 4J3XA 4HHHA 3S2MA 1C8QA 4DELA 3POHA 5HMDA 1E0VA 1FKWA 3FEMA 3QPYA 4C6QA 3WK1A 3UQNA 4Y9PA 4L61A 2FKPA 2PU1A 3WD1A 1WA3A 3KBMA 3HQPA 3KCOA 1J6OA 4JZ5A 3A3XA 1XLKA 3W3OA 4GK8A 4KRUA 4Y6GA 1IT7A 3PVFA 3U7BA 2Y2WA 3AXMA 3U4AA 2A3LA 3EMZA 3NQ8A 3AIWA 4KQNA 3CMJA 1H7PA 4E3VA 4CVUA 2YDRA 1KFLA 3AXKA 3L5MA 4UOQA 3WFAA 4RKAA 5BW6A 4XTIA 3EMCA 3F5LA 4RZ5A 3JS3A 2DFAA 1J2WA 1XCFA 1ESWA 3CUHA 5HUOA 1A5OC 3MJYA 4UCGA 3FAXA 2A7PA 3VM7A 1NQ6A 3CWOX 1BVWA 4NZ1A 4HMDA 4IIBA 3B0VC 2WNZA 1DJZA 3NL3A 1R9XA 3CZKA 2VEIA 3ARYA 4ERAA 1E43A 2E09A 3CZGA 3ABRA 4JTDA 1KBJA 1LBFA 2DZUA 1DOSA 2P10A 3SCNA 2OG9A 1GOMA 3WD3A 3LZ3A 3PTKA 3L7RA 4O0KA 1IIGA 1PAMA 1YTEA 1YTDA 1SJCA 3COTA 5T8GA 3GDMA 3PSWA 1RLCL 3RPDA 1G01A 1W1IE 3KM8A 1S5VA 3DZ1A 5D03A 1WDDA 4LYPA 3R11A 2ZRVA 3IRSA 5AYBA 5LA2A 5DXXA 3TW6A 3DYMA 3WQDA 4AU0A 2V5KA 3MMUA 3AROA 2WZMA 1WQ5A 1ZS2A 1XDJA 1MQQA 5G4HC 3LGDA 2FTYA 1ZHAA 2JBMA 2ZTJA 2WM0A 3IIPA 3L4UA 4F2UA 3HA1A 3M9YA 3PFRA 1PHWA 3ZJKA 5HNNA 3VIIA 4CCZA 2WQDA 3KTXA 4EP8C 3PBYA 3ZT7A 4LQ1A 2EPMX 4HSNA 4PCFA 3TN3A 2HVNA 1WBJA 1DJWA 4YXGA 3CTTA 3GVGA 3BH4A 1E0UA 1L8PA 2AGKA 1BPLB 3DU0A 4K1WA 3KLLA 1XINA 3YPIA 1Z41A 2Z00A 1JJKA 2WCSA 2J7BA 4C1LA 4G8TA 1EOMA 3D0CA 1U5JA 2WSRA 3VE7A 3IEBA 3KP0A 6A3HA 1A80A 1NARA 1UHVA 2J88A 1Y0EA 3VE9A 4GJIA 4NZ3A 3KOFA 1ZJIA 4JL2A 3RU8X 3LERA 3ARWA 3SAZA 2V63A 1RXOB 2B7QA 5M3WA 3GWQA 5GVJA 3T81A 1WPCA 1MSSA 3FKRA 1AH3A 3M0IA 1T5AA 2YX0A 4GIEA 4NIRA 1AODA 1PE1A 3LX9A 3W7QA 1BRLB 5F2GA 1MUMA 2HVOA 4OVXA 3C86A 3M43A 5FSEC 3B9AA 3VMNA 3ISIX 3IUDA 5HNTA 3GDLA 1TSIA 1QWGA 2JGYA 4S3KA 2V5JA 5C6MA 3WLPA 4B16A 4WSHA 1VGAA 4CQAA 2O92A 1XLAA 2J7HA 3BUVA 2PWUA 4MADA 4AH7A 3UZJA 1O94A 1WB0A 2DSKA 1K8YA 4C6BA 1JD7A 1OFBA 3F1QA 1IQ8A 2CHNA 1QHZA 3UA4A 1F7BA 4NXKA 1NH6A 4MY1A 3FLUA 3PZVA 4KWSA 1C8YA 1UKTA 2GSJA 3ZLGA 4AEFA 5F4SA 3LLFA 4DB7A 4RZ6A 4IXHA 5DT7A 5DX7A 1JYVA 4AHOA 2W67A 1ZQ5A 1GQLA 1DQWA 1B54A 5LA0A 2NSXA 4H9MA 2C8NA 4AFYA 4DO5A 2G95A 1DQXA 4I90A 2VR5A 3KZPA 4ATLA 1D8CA 3HGOA 4JL1A 4CUCA 1P6CA 2FHBA 5D8WA 2DVUA 4XG1A 4PC8A 2EXOA 2RDXA 5E9AA 9CGTA 3S1XA 1Z32X 3EKGA 4ZXOA 4I3GA 3W86A 2Q02A 1R30A 4LX4A 5CPOA 4CCDA 2CLFA 3FYYA 3W38A 3PZNA 2PZ0A 2CBJA 3DHUA 4KCTA 3N9RA 1JZ7A 4ROPA 1VHCA 3PBUA 4E8CA 4Q22A 5HNUA 4DJFD 2ISSA 4AZ6A 1OVDA 3ZVHA 2B7OA 4D6FA 2QHAA 1P7TB 3UWWA 2GGEA 3L0KA 2E9LA 1LT7A 2J8GA 2GDVA 3SZ8A 1ADOA 5C8BB 2E6DA 4B3LA 4PL2A 4YTQA 4AX7A 4J27A 4KETA 1TJ2A 2X42A 3DESA 3W53A 3UWYA 4OUEA 4TXEA 4HMEA 1IR2A 4QSFA 1BWKA 2Y89A 2A3AA 3C52A 1E15A 3IAQA 1QNSA 4J2MA 4ML9A 3NOYA 3PBGA 5BOFA 2WBGA 1RCXB 1XQLA 3NXLA 4K8HA 2REQA 4JAWA 1GQJA 1XISA 3TTYA 1BXCA 2EJAA 1JIBA 3EWWA 1F3WA 1SO5A 1JCNA 2HJPA 3ITYA 2DZWA 4KRTA 5I02A 3SCVA 1JL8A 4G1KA 4N42A 3AXIA 2DZTA 2X1SA 3PZGA 4NJGA 1UIOA 1US2A 2W62A 5I23A 4R53A 3BSHA 4QJ1A 2D73A 3BZJA 4HNCA 4HA4A 2EBNA 4GH1A 2CPUA 2XN1A 4B91A 1QWKA 1M01A 1JCMP 3RO8A 5G1MA 4B3KA 2JFEX 1NM9A 4GIYA 1KXTA 3PTQA 3UXKA 1JUKA 3H2OA 3H4GA 3HMCA 4AVOA 5E93A 3WLIA 1G6CA 4H6EA 3ARZA 1KD0A 3KVKA 3H23A 2O4MA 2WVSA 1R5YA 1D3GA 1MFUA 4TV5A 3S1UA 3SGUA 3M0YA 4OT7A 2QUMA 1H4PA 3AYTA 3BAXA 4XIMA 1P0EA 3NGJA 4YWIA 3EXSA 2PDCA 1HJXA 2IPFA 2FHCA 4XZIA 1QO2A 1FH8A 4FF5A 3B3DA 2G3IA 1NELA 3TLQA 1VFOA 4GCAA 3M0VA 3G1HA 1XLHA 2TMDA 2AAAA 2BOFX 3G3DA 1ZENA 3VILA 4FOJA 1E5JA 3FY1A 2WOQA 4DZIA 3FIGA 1RSCA 5C9WA 2G4JA 3EGJA 1XIEA 4PCTA 2FFCA 2FYMA 1PVNA 3IPWA 3PPCA 4JYDA 1KRBC 3GVWA 3AUJA 1MO0A 3QZ6A 4D71A 2ZDRA 1V93A 1SFTA 1W5MA 1EA0A 3HQ1A 3BC9A 4NSBA 2B4GA 4IMFA 1R3YA 2YOCA 2C18A 1GUVA 1XSJA 3CPUA 5EMJA 5BXTA 3VC5A 4PTWA 3PY2A 4PB4A 1HP5A 5KTLA 1EF3A 3IJ8A 1KV8A 4UTMA 4UTIA 3D46A 2RHGA 4BK9A 5CZSA 5L6UA 1TMQA 2I57A 2P88A 3FJ6A 1BGAA 1Z44A 1J93A 3DH7A 1UP0A 2ZIDA 1Y5WA 3KLKA 2C14A 2A1YA 1NU5A 1ODZA 4FLQA 3RGTA 3DEQA 2O9RA 5D02A 5C9RA 1CYGA 4XK2A 3TQKA 2BP1A 1B57A 4XZLX 2VC7A 2V3EA 1TV5A 3GH4A 2A79A 2XG9A 1UG6A 1US3A 3O3RA 2VJXA 1TPVA 3NYDA 2TRSA 3E0LA 2J25A 1EO5A 3WL1A 2HBXA 3CBWA 3THDA 2QAPA 3VKCA 3NPXA 5DCDA 4XKYB 3BURA 3CEPA 2EF9A 3PBWA 3KX6A 4GXMA 1S39A 5HK4A 3W7CA 1KCLA 5JXQA 2YLAA 1LDCA 4R88A 2E6FA 4IMDA 3NR0A 3HFTA 1XH2A 3SIMA 3M0HA 1XRTA 4CD8A 3WQOA 1CGYA 5J5RA 4JPGA 1A49A 4B9YA 2E67A 2X09A 2WNQA 1A50A 3ID7A 7REQA 1G4TA 1RK6A 4E3TA 3NVDA 1T40A 1IZJA 2EG7A 3N3TA 3W1AA 2MUCA 5IDZA 2RGMA 1HQTA 3SCRA 3URQA 1T8QA 4D6HA 1XIIA 3G5EA 4HZ7A 2ZUSA 4HPXA 4RNHA 4Q4QA 2FZMA 2DSUA 3GXFA 3VKAA 5CZJA 4QP0A 1Z7AA 4JEJA 4JOMA 5FJUA 4IT1A 2X0SA 1MRQA 2J66A 1UMLA 2VOMA 4V33A 4H6KA 3P80A 2GUYA 1GQIA 1TTIA 1VB9A 1ICSA 4WCJA 4AWUA 2WZIA 2QF7A 1M1BA 4QBXA 5FF2A 4G7EA 3FDGA 2VUYA 1NAL1 3CQIA 4PTDA 3SY8A 3PBMA 5FJJA 4C90A 1VR6A 4DUOA 3TFCA 3GBDA 2CNCA 3DHDA 3LMZA 3OGRA 2H3BA 4FOUA 3W74A 3ZO9A 1REQA 4WSKA 1QNOA 3ES7A 1HG3A 5FF7A 7TIMA 1HJUA 5I3IA 2WJFA 1GYNA 3ZSTA 4H01A 2CYGA 4HZ6A 3OYXA 5I00A 2VQTA 3BG5A 3NZPA 3PJTA 2OGJA 4L9ZA 4Z2HA 1O7AA 4S38A 4ZXLA 2WMHA 3SUWA 4FZIA 4LRSA 6PTDA 3QZEA 3WEOA 3H2FA 1H1YA 4PFMA 3EEGA 3GR7A 1VLWA 2QDDA 3O0KA 4Q4RA 4UUIA 4L64A 3GZ3A 1YPFA 4E38A 5AKQA 3SUTA 2GVEA 2HBVA 1YDNA 4JNZA 3HOJA 4M6PA 5CG0A 4MKNA 1OWQA 2CERA 1HJWA 3UY7A 4M81A 4US6A 3E49A 3V4BA 4GRSA 2GJLA 4HOZA 4DBSA 3BDKA 5JUVA 3L23A 3CU2A 1DQUA 3CAKA 4DWSA 4GH3A 2VCCA 1ZBWA 1RVGA 4QFUA 3OLEA 4AY7A 2XGIA 1Q6LA 3F4CA 2P5NA 2DQWA 2HNEA 3FVDA 3LGEA 1HTIA 4FXFA 4RJEA 2PWHA 1P7TA 2GJNA 5A8NA 3U9IA 4PMOA 1RV8A 1UC5A 3QR1A 2OJPA 2QYGA 4YVPA 3SUVA 3KXQA 3M0MA 2PBGA 3I3DA 2QQ6A 3WIJA 2ZUMA 3PAOA 3A4WA 2X1IA 3DX5A 4QEHA 4CU8A 1EBHA 2PDPA 1N8FA 3DAQA 5E1QA 1PWMA 3IWPA 1JRCA 4EKJA 3QLLA 5BXPA 2E28A 3CHCA 4MDOA 3ZLFA 5B7YA 3S5YA 4EWND 1VPYA 2QULA 4AVFA 1Z9AA 1VEPA 1XUZA 4Z2LA 4P7QA 3RLVA 1R7AA 4GC3A 1GTEA 5I3DA 4LUTA 2VRQA 4FXSA 3VC6A 3LENA 4XUGA 1DJHA 2FMNA 4RZBA 5DBUA 3NEHA 3S42A 2P76A 1GG0A 4MF4A 1LCOA 2VVNA 6TIMA 1RJQA 2QW5A 3BJFA 3WNOA 3B40A 1OGBA 3UETA 4YCOA 5C2CA 2VFIA 3HJEA 3PHAA 2QDHA 2HEJA 1WZMA 1RLDA 3AYVA 5TF0A 1EDQA 3B8WA 4HKPA 4AHPA 4NU7A 4WIWA 2X0YA 4HQVA 3P2VA 3U2OA 2DH2A 3R0KA 4FMVA 3VINA 1Q6FA 4NRSA 3ZYZA 3TJIA 1AK5A 5I24A 3VDGA 3T2OA 3BZGA 3FEQA 5D2YA 4M82A 2YKKA 1PTAA 2D2OA 3HJZA 3GG7A 1XL9A 3SRHA 4M1RA 1R6WA 3PK7A 3RFAA 4GI6A 2P8BA 1FP8A 4O18A 3PPHA 1MEHA 3VOIA 4OIFA 1AFSA 1CGXA 2IUZA 4AC7C 4IMEA 4PR4A 2ZYFA 3IGHX 5AYYA 5IXEA 1KRCC 1AG1O 3DC8A 4FNSA 1TR1A 4GQQA 4J4KA 3UZYA 1ITCA 4ZCWA 4WOQA 3N14A 2A4AA 4CD6A 2B7PA 4FR6A 1K9EA 3TYDA 1IV8A 2V68A 1X8FA 4MZ8A 1SUXA 3VOCA 1X1ZA 4C7FA 5K2ZA 5LNSA 4EXQA 4NNBA 3MWCA 3NEVA 2IQTA 3MC5A 4F8XA 5CC6A 1MW0A 3GTFA 3KDNA 1ZSXA 2OTDA 5EBAA 1E9LA 1SZFA 2PDHA 3SCSA 2YCKX 3BCFA 2NUYA 2WC4A 4F2BA 1KFKA 4ZODA 4YMZA 2WNWA 4H7VA 2ZWZA 5CC3A 1W3NA 4Z17A 1UUMA 5CBBA 3A4AA 4N0RA 1FXPA 4WDWA 1J2BA 4W5UA 3TYUA 1HO4A 4NYUA 5EFFA 1KCXA 2FPYA 1GVOA 2VM8A 5M17A 1RA0A 5CSSA 4TMCA 1KGUA 1IF2A 3NSMA 1Q6GA 4CCCA 3I65A 3W1LA 2CLEA 1E4LA 2G41A 2I9UA 1TO3A 1PCKA 4HHLA 3P3BA 4RW5A 2NV1A 2E40A 4O52A 1ZALA 3ZVHB 4DPQA 3HU7A 3SW6A 4HK5A 4IIFA 3L4VA 1TVNA 1E0WA 2WMIA 1PKMA 2IQDA 4E4PA 3PZUA 3PUEA 1MW3A 2YXGA 1XV8A 1OCBA 3HG5A 1KFEA 1WOBA 4F66A 2GYIA 2W9MA 3ARVA 3LTSA 1CXEA 1OJXA 2ZUWA 1M5WA 1X6LA 4X0VA 1XJBA 2BY1A 3QOMA 2WBKA 4AD0A 1XXXA 1PX3A 1VQTA 2P50A 2Y5JA 5EMMA 4LC6A 2FDSA 4DM1A 3I10A 2WSKA 4DWSB 1Y5XA 1ZP4A 1P0BA 5LHFA 4OZOA 1DXEA 3M7SA 4X22A 1ZJBA 1XDMA 1OADA 4XD6A 1BVZA 4NX0A 4JTTA 1GVQA 4KH2A 3FX4A 3SIZA 4HNVA 3AS2A 3QJAA 1K02A 3SN4A 4W4QA 1KC7A 3G77A 2ISDA 3D5HA 3AC0A 3T40A 3CUIA 3N25A 4QNWA 3BMWA 3PWGA 2F9RA 3W71A 1HL2A 3KBWA 2WKGA 2E9BA 1CXLA 3WFZA 4JTJA 5F7UA 1ALDA 1ZBKA 5CPLA 1QDSA 3STGA 4LYQA 4PRWA 4FXJA 3DIPA 5AYIA 1B9ZA 3S6TA 4BI5A 2WKJA 2NQHA 3L0GA 2OZ3A 4FO4A 1OX4B 3H7VA 5E6YA 1JQVA 2VI0A 4H9UA 4ZQPA 1RBLA 1OFDA 3WDRA 4OTKA 2DUZA 4TUFA 3TJXA 4EPBC 2UZ9A 5FIPA 4KIEA 3F5KA 1EP2A 3JRKA 1SO3A 1WKYA 1H5YA 4GX8A 3VZXA 1JF5A 2PEVA 5BZAA 1GT8A 4TIMA 3FW6A 3KCJA 4B2DA 1W3HA 1EGVA 1ECQA 3GHUA 3TYEA 4IZGA 2ONEA 1NOUA 4GQBA 3W82A 2PDWA 3QGVA 1QOXA 1RK5A 1NDZA 4J3ZA 1YEYA 1GGOA 1LM1A 3Q4DA 5BU6A 3NNTA 4JTGA 2REQB 2WCAA 1CENA 1ISYA 2V3DA 4IX2A 4CKQA 4F0HA 3N13A 3AQUA 2YCLB 1VS1A 2ZADA 1K8ZA 2GZXA 4AISA 2Y4SA 4WDTA 4X0NA 1TPWA 1W8SA 4RPPA 1M41A 4DNHA 4PRTA 4B5UA 1MI3A 3A12A 1I6NA 2ACQA 2ZZ4A 4WKAA 1P6WA 1XD1A 4QCFA 4H7ZA 4R9XA 2VNCA 3P0WA 1GVIA 2CBIA 5EMKA 4JKMA 1H7NA 1UPPA 4IF2A 2B7NA 2XFRA 2OXNA 1TJRA 2V3GA 3CZ8A 3MKCA 4JFSA 4A8NA 2NVAA 1B3WA 3CYJA 1ITXA 4BZYA 4MWAE 3T42A 1V3JA 1DE5A 1OT1A 3V7PA 1FWNA 5HQLA 3W1XA 3WLNA 3N2MA 3AS1A 1JF6A 1QK2A 2JQXA 3APTA 3HM7A 1UR3M 2HISA 5G2IA 5C0QA 3L12A 3W9ZA 1IZKA 3PC0A 4PUNA 3STCA 1ENUA 3EB3A 5FI8A 1K8CA 1V51A 1V03A 3HG2A 1H49A 4MHBA 2XSBA 2DGAA 1W17A 1K9FA 3ARPA 5D04C 4GYJA 2ZVRA 4LY8A 1XYBA 5K7JA 3GFYA 4W5ZA 2G97A 2TSYA 3BLOA 1R85A 3G22A 3DFYA 1KCKA 1H5VA 3NM3A 5LIYX 3RILA 3GDBA 1IGSA 4Q8VA 4OWGA 4WJEA 1OT2A 2IPGA 3HV9A 2F7FA 5GJMA 1JR1A 4C1NB 4GX9A 1E6SM 2GQAA 2AL1A 2YPIA 1IYXA 3BL3A 3E74A 5CZKA 2J9ZA 1U2YA 3NQGA 3UGVA 4BHYA 1GOIA 3OQ8A 4UFLA 4I5XA 4YVVA 3DFSA 3OOQA 1QW7A 2PDJA 1LWJA 4K1GA 4Y8EA 1RJRA 3SQSA 1S5MA 3MV01 4XVEA 4M24A 2YDAA 4IL2A 3LRMA 4XVDA 3LV6A 3O63A 1QPKA 3WQ4A 2ZE0A 2AQOA 4QITA 5TQLA 2NSOA 1UR8A 3C3NA 3T8LA 4V2XA 2F2KA 4FNUA 2UWFA 1MW1A 4YYFA 1GOKA 3KE0A 3O8AA 2Z4GA 4GCXA 3LZ5A 1NWRA 5E0KA 4X3ZA 3VIGA 3W1NA 2Q8XA 1F07A 3AIEA 5K9XA 2ZA1A 2D2GA 4BQ4A 5AVNA 5HATA 2PDMA 3MSGA 2Z7KA 2Y88A 4OGZA 3T0AA 1RY8A 3ZM8A 3U3HA 3CV7A 4GY0A 5EFDA 2LLEA 4ZO7A 1RPXA 4LXFA 1O60A 1EEXA 2WMJA 4HSHA 4YNGA 3ITOA 2ABAA 3IRDA 4I7WA 4KEUA 5EBUA 5FJOA 4X63A 1R3SA 4DZ5A 4WK9A 1Q5MA 2FHFA 3QQ1A 3A4XA 4CCEA 3FHQA 1C29A 4S3AA 1EX5A 3TN5A 2FGZA 1LQ2A 4INFA 3NOEA 2GDUA 4LGXA 3ITTA 4JS3A 4TR9A 4U2YA 2QNEA 3VKDA 3GNDA 2DZSA 3SQMA 2JKEA 3VI2A 4IFRA 1AQMA 3KBNA 5BXSA 1XLGA 1IWAA 3DFNA 3S5ZA 1BHGA 4D1JA 4W8LA 2OO6A 3N6JA 2HS8A 1WNOA 3DKJA 1QXLA 2ADAA 5DMLA 1YQ2A 4M5PA 3P74A 4KFOA 4LVFA 5GJNA 3VUPA 5MHBA 1OC5A 4IGNA 3HGJA 4R9OA 4GKLA 1WDSA 3LHUA 1S2VA 3OBEA 4I8YA 1A0EA 4IP7A 2FJKA 3U2ZA 4FLRA 2GJXB 2WYSA 3Q2DA 1E4MM 3K30A 4JQAA 3CLWA 3CV2A 1LORA 5CZ0A 1IGWA 1O1HA 1RAKA 1F4AA 5AHFA 5DT5A 4QM1A 1L6SA 3DHPA 2DU2A 3PUGA 1KB3A 2NT0A 2ANUA 1OFRA 4DUWA 4HBKA 4LYKA 1W1A1 3RCMA 3TX9A 4MYAA 3WQWA 3QRHA 5DMMA 3I6EA 2X1RA 1F73A 1MEWA 3SB0A 3RIKA 1AW2A 4UOZA 2JEPA 1CW2A 4AHQA 4FNQA 2YDQA 2V2DA 1VFMA 3JZUA 2C0AA 2R8WA 4BKNA 1RP9A 1E1CA 1Q2RA 1TTPA 2XFYA 4WD0A 3HB9A 4R3UA 1DXFA 2Q01A 4LB3A 1MZHA 1WUEA 4HU3A 3E12A 1VFSA 3QPEA 3ZJ8A 4DPPA 1N55A 1UZHA 2OMAA 3GD6A 1QI0A 3SURA 4YTRA 1JZ4A 3W2UA 4IL0A 5C2GA 3IJIA 3BW2A 4KWOA 1J01A 1LOLA 4FI4A 2DUAA 3I6RA 1NF7A 3OZMA 4LANA 3IV3A 5J8LA 4AW7A 1F6YA 3GX9A 3B8TA 4JX6A 1Q85A 1HJSA 3ZR6A 4A4AA 5ECVA 1HF6A 1GCYA 3MUCA 4IMGA 4Q4KA 3D3FA 3BGAA 3KS5A 3MQTA 4TVUA 1Z69A 1E6XM 1MFVA 5AHEA 4HN4A 3S5OA 3NQ7A 2XFWA 2WMGA 5A8GA 4QJ3B 4M51A 2DVXA 4ENLA 1M03A 5I7GA 2WK2A 1YPIA 1EF2A 1FWRA 2QCCA 4UNLA 1X7FA 2GK1B 1TPDA 3KL3A 1JULA 1CB7B 2YW4A 4Z0JA 2YGYA 1MXGA 3ARXA 3C2EA 3LQLA 4M6QA 1A5UA 3OU8A 4QLJA 1TZ9A 5A8OA 1NEYA 3CQ0A 4JKKA 1GJPA 5U7SA 5FACA 3VD4A 1SSGA 1V3KA 1HGYA 1KRAC 2GGIA 1MWOA 1PTGA 3UWZA 1XIJA 3AZSA 3H21A 3KS6A 1W0MA 3W2NA 3BGGA 2WKLA 5DY3A 4O1DA 1UH4A 5A6BA 3HURA 4LWWA 3TTQA 4JQ1A 3G0SA 4P7LA 3WH7A 4ADSA 2EG6A 1JUEA 3RCYA 5E70A 3MW7A 5FA5A 3WUGA 1GVFA 5EGRA 4MYXA 1MNSA 1W56A 4P8VA 4LOCA 5T9BG 4Q32A 3HGSA 1QBBA 4GABA 1C7SA 3LMYA 2X1UA 1RA5A 2Y7FA 3WO8A 5L9FA 1GPWA 9XIAA 2VX4A 4NHVA 1UR1A 1WO2A 5EU9A 2YDSA 4QNEA 2DORA 4MZ1A 1F2JA 4N4QA 4C6MA 5D38A 2PDUA 2E68A 2J7EA 3CPGA 4BQ2A 4UZSA 1TV4A 1SW3A 2DZBA 1IWBA 4ZFMA 3U8GA 4JGDA 4D2JA 2I5GA 3WL0A 1A5LC 1LF1A 1UWUA 1QAPA 2CLPA 1IIHA 3DG7A 3G0UA 2I5IA 3AHYA 3STEA 2QIWA 2AL2B 2QJGA 1EIBA 3UG8A 1J96A 2ASHA 2DSVA 4NZCA 1EB3A 3IJDA 4AD2A 1O6IA 1DVJA 2UY5A 3MY9A 2V81A 1EJXC 4B5XA 1TX0A 3WELA 1P1XA 3LU2A 3DERA 4Y7EA 5HPCA 1DYSA 3GVRA 1XLEA 4JNMA 1VJIA 2PI6A 3CH9A 4GUIA 1E55A 4KGJA 4DJFA 4W86A 4O57A 4GKTA 3BOFA 1PS9A 4W84A 4L4OA 2Q3OA 5DCBA 2E0PA 3TTEA 6XIAA 3QVQA 1HGWA 4M6UA 5D05A 3TJ4A 1KCZA 1Q13A 3SN1A 1T8XA 3F7JA 1SFSA 5DEZA 5HR6A 4ICCX 2TPSA 2YYTA 4Z2IA 2C6QA 3KOZA 2OGYA 3T8QA 4DN1A 4P7NA 1PUDA 4MIMA 2V2HA 2B81A 4LAKA 4NL1A 4MFEA 1B9BA 1J5SA 3L5LA 5LA1A 1UROA 3K8KA 3E02A 4LNYA 3IIXA 3UT0A 2PZNA 4A8LA 2PLJA 1SGJA 4YU1A 4YPJA 1W54A 5BRPA 3BLLA 2UBPC 5I09A 2UY3A 1W5OA 1TE6A 2HRWA 1TE1A 2VGGA 1UZ1A 4GISA 4ZFCA 1E9ZB 2BS9A 5CLWA 3O15A 3WDHA 2EO7A 3W07A 4IFOA 2HZGA 4POCA 3NUKA 5BCAA 4EAMA 4PMYA 3HPXA 1Y7VA 1TIMA 2YZ5A 4CD4A 1V77A 4Q7BA 3W7GA 1PIGA 1JCYA 4PMDA 3SO7A 5HDRA 3TXVA 1VENA 4Q4OA 2V2CA 2FIQA 3VX1A 4PB5A 2ZZ3A 4O17A 3P14A 2NQLA 4PYSA 1V3IA 4WY0A 4ZE5A 1B90A 2G3NA 4M19A 1JFXA 3URNA 5FJTA 3AYRA 1ADSA 1ZGDA 4AXKA 4GY7A 2ACUA 3CM4A 1OYCA 1I2RA 3F2CA 4HCHA 1XIFA 2GSEA 3M16A 1PZ0A 4R27A 2QCEA 2QR6A 2NUWA 3WBAA 2BB0A 1JUBA 1P0DA 3N29A 2GGHA 2GQ8A 4RV3A 1GYMA 3TIMA 4GY1A 4A2RA 1XSKA 1NWSA 3FYPA 3LLXA 1BYDA 1WXZA 2GUBA 3M5YA 1CNVA 3LDVA 3GNPA 2XIQA 4J28A 2R9RA 1LBLA 1SPQA 4XSLA 1TPEA 3CZJA 1R7OA 4WJ8A 1UIPA 5AYZA 3LY0A 3A13A 3WD2A 1TPC1 1UPMB 3NAVA 2GWNA 3M7WA 3KRBA 2G0WA 4BR1A 1HUVA 3MSYA 4W87A 2PAJA 2VFHA 3WUEA 1UZDA 5CPNA 3LD5A 5I07A 5KZEA 4HOXA 2R82A 3VU2A 3W73A 3W76A 1UD3A 4YJ5A 1TMHA 4D6CA 4KKXA 1QR7A 4ZOCA 3NDYA 5ABTA 2WZTA 4A22A 4LUTB 2ZTKA 4MB5A 6XIMA 3EWDA 3T55A 1UWRA 2Z28A 3UA3A 5HINA 3LS9A 3DXIA 2WNNA 4R7JA 4U33A 3K4AA 1V02A 2AMXA 3UR8A 3K8LA 4U28A 1VRXA 1YKWA 4JEQA 2QJJA 5A8PA 2OKTA 2WWCA 2HS6A 2EKGA 3BLFA 3LTPA 1XYMA 4QG9A 4JY8A 3WQ6A 3NZ1A 4MUZA 1I75A 3RR1A 5FCZA 1B4EA 1GONA 5EY5A 1SR0A 3KWXA 2Q3RA 4K6AA 4FB7A 1PIIA 2A6NA 1BTMA 4XZNX 1J0HA 3G1SA 4LTSA 4ECLA 3VDHA 4N2YA 1XS2A 3E0VA 3U5YA 4W8BA 3ANVA 4NZFA 3PNUA 5I3HA 1N7KA 3UXLA 3FA5A 1DTNA 1OQFA 2XIIA 3MI2A 5JBEA 3M5XA 4PCSA 1CZ1A 1M3UA 1QNRA 1EFZA 5M03A 4K36A 4E8GA 5DRCA 5BU9A 2WZEA 1BFNA 3O06A 3S9ZA 2E8YA 3MO4A 2FFIA 4XSMA 2BGNE 2ZE3A 4IM4A 2HK1A 4I5RA 3W27A 3GTXA 3VMPA 4J1OA 2J24A 3C56A 4ZL1A 2FJUB 3B8DA 1KTCA 4S3GA 2VCBA 1AZ2A 4HA0A 3T0DA 2ISVA 3GTIA 4IWWA 1TKKA 3W37A 3ABOA 4PUMA 3E5PA 1ONWA 4Z42C 3ABSA 5E09A 3W4RA 3LRKA 4L1GA 4DJEA 3HPSA 2H90A 4Q8TA 4UTWC 3E5BA 4IP5A 1YBQB 4BJHA 4CU7A 1DV7A 1HO1A 4GMEA 1YMYA 4F48A 3FAWA 1OC7A 2D24A 4ALDA 3LRLA 4J3UA 3SGZA 4LAOA 3VNYA 1UB3A 3TP4A 3KL5A 1VLIA 1QUMA 4MJMA 2POTA 2Z1VA 1YBQA 4YS1A 3M5VA 1WDRA 2F2HA 1KXQA 4PGLA 4NY2A 4GBUA 1FWFC 1V0LA 1W1B1 2A2IA 3WEZA 2GSHA 2W63A 4PTVA 1AZ1A 3P8JA 5A6LA 3VAVA 1PKYA 3ABQA 2VUNA 1UH2A 1ISWA 4XO6A 1UC4A 2BASA 1Q6OA 2PGRA 4Q8MA 3N9KA 4XZMX 1POKA 1UP2A 3G2GA 3AAMA 2X41A 3AJ7A 4YIWA 3SCWA 3H26A 1UKOA 1TV2A 3R13A 3W2KA 3VTRA 3CV6A 3T0CA 2E3ZA 1N82A 2RUSA 4NZ5A 1CXIA 1XW8A 3W7LA 3C0SA 4F0KA 2QEZA 4GUFA 3UWVA 3QY6A 2D2JA 1KM6A 2YL9A 4PTNA 3BLPX 4PUKA 4A6GA 1B1YA 3CZLA 2VC6A 4UCFA 4I6VA 1BRLA 3O16A 1ZUAX 4MPQA 1VC4A 2XN2A 4X2RA 4NX5A 3BCJA 1TELA 4BWLC 1OFQA 5KINA 1OC6A 3OBAA 4NNCA 1W9BM 3V5OA 3CL7A 2YA2A 2ODOA 3OZYA 3EPOA 3UVAA 4D72A 1FDZA 5FKYA 1S2UA 4GZIA 2Y0FA 4JNYA 4GFSA 1OZMA 3VDBA 3CQHA 3HO8A 2C79A 1G67A 1C8XA 3URAA 3NO1A 3HN3A 1OD0A 4U4MA 1LL6A 2TYSA 4AZCA 4L6HA 3BICA 3QC0A 3G8EA 4GHRA 1FWIC 2Z2UA 4NRRA 3BAWA 2WCGA 4O14A 5GQBA 1J79A 3W23A 2RKXA 4ZOAA 4PBFA 1G1YA 3W22A 4DLMA 2CZ5A 2ZX8A 3BLEA 3TEVA 3RLUA 3AUOA 1NDYA 1DIOA 2OU4A 3FJ4A 2ICSA 3ZQ9A 2Y63A 2OX1A 4LEFA 3SFWA 1YDYA 3CB3A 4IG2A 4YTTA 4REQB 4X60A 1K7FA 5EMLA 1BYAA 3QXBA 1O4UA 2ZZ2A 4Y9AA 4QQ3A 1A3XA 2V69A 3W29A 2PS2A 4N7QA 4C6OA 1U22A 4IIDA 3W83A 4FNRA 3NFUA 3WMSA 4F0LA 2H6RA 3FA4A 3CIVA 1OCJA 1XF0A 2GVGA 2VRKA 3WLMA 4Q8NA 4KW2A 1UWAA 2GLKA 1I2PA 1EDGA 1KM2A 3QGKC 1JZ6A 3VNIA 3C61A 4DF2A 1S2CA 4HNTA 4WR3A 2IQ0A 1HW6A 4KIRA 3UERA 3MUY1 3C2OA 3LPFA 4CD5A 4ZTXA 4E2VA 2O55A 3MHGA 4QAIA 5AC6A 2VFGA 4KCUA 4UQEA 2JALA 3UWUA 1CTNA 2QPSA 1CGWA 1DKWA 3OO2A 3UNTA 1VFLA 1ZCCA 1K6AA 2PP0A 3BVJA 1Q6EA 4JHOA 3CK5A 3LBOA 3CJPA 3BJTA 1IWPA 3EB2A 3TC7A 1KR1A 4PODA 3HPAA 2QCHA 1JD9A 2Y24A 3WFLA 4F0SA 4AWSA 3BG9A 2DT1A 1CBGA 1M68A 4R7OA 1FXQA 2XPKA 3R4IA 4PMQA 4KGLA 2ZKMX 3WH9A 2NX3A 2ZC8A 4LBSA 1GW9A 2IXUA 3TSBA 3LNMA 3U57A 4O1FA 1C90A 3M4HA 3W1PA 1BLIA 4KRZA 1JZ8A 5G5IA 3TUUA 3GAYA 5A6KA 4NZJA 4L4LA 3BJSA 8XIAA 5HJXA 3CWNA 3MMWA 4H9ZA 3T4CA 3MTWA 3V18A 5HPOA 3KVLA 4HNNA 4WX2A 1AMKA 3M07A 4ZE4A 5JIWA 1ZAHA 2IMRA 5AB3A 3MMDA 4OUIA 3CUFA 3ATYA 4M29A 4EE9A 1BSLA 3V0TA 1BEUA 4ILSA 3JU2A 4GQRA 1FP9A 4K8EA 3QQWA 4AYGA 4ZQCA 4MWAB 4E0CA 3S5NA 3WLSA 3FKKA 2R91A 2ZXAA 3WLTA 5CH9A 4N9CA 4CU6A 1FBAA 2VR2A 5CSRA 1OY0A 2VOTA 1DJQA 1R47A 2CLMA 3POCA 2XHYA 3WLRA 3CL8A 1YE4A 5JQ9A 1LLWA 3LPGA 2O56A 3SY5A 3B04A 2I56A 3G0XA 4GC4A 4AZBA 3OB8A 1A5KC 3V5FA 1BGGA 2ZZ1A 3BV4A 3GUGA 3TXZA 5IHRA 1OX4A 1BWVA 2NX9A 5D4YA 2G96A 1WCGA 2WVTA 1IXOA 1MMFA 3MUIA 2OX4A 2OR2A 3DUGA 2OPJA 1UR2A 4I6KA 2DIEA 2QPXA 1EPVA 4GGBA 2OFJA 2FVLA 3P61A 5A3HA 1TPFA 1XR2A 1X97A 1EJWC 4UFKA 3T6CA 1RBOB 4BQ5A 1A0DA 1UZ4A 1M9HA 4GUGA 4GG9A 2QAFA 1MRAA 2QT3A 1B3ZA 3WBYA 3V5CA 4XBKA 3VIFA 4ZENA 1Q66A 3ABZA 3A5VA 4AD1A 3SY1A 2VEPA 2W66A 3CNYA 4BY3A 4GVFA 3LM3A 4REQA 1PBGA 4H4IA 3JR2A 2ZRYA 2PGFA 3BG3A 3N2XA 4LAMA 2RJHA 3ITLA 3G6LA 3QYQA 3PBVA 3O05A 3MVTA 2VZVA 4ONVA 5DELA 3GIPA 1NWTA 3L68A 3FVMA 1XIDA 3QYSA 4Q4PA 4MLRA 1B3VA 3DYPA 4MNLA 3GXTA 3RO6A 5HUPA 3E2QA 1IEXA 1ZJAA 5HMSA 1FWHC 2ACSA 3IGXA 4IOTA 4Y9OA 3OODA 3BCDA 1P5BA 4UWMA 4W85A 2VP8A 5CSUA 3EDEA 1KBLA 2ZA2A 3DI1A 3GW0A 7ODCA 1EL3A 1HZYA 2VKZG 3ZOAA 3WMLA 1L6YA 2OZ0A 3N2OA 1GOWA 3BWWA 3BQ6A 1QHOA 2FB2A 3S3GA 3VOFA 1R2SA 4BCEA 5EYWA 3UGRA 1R46A 4PMZA 3SECA 3TQVA 1PB0A 2XVNA 5G4EA 4B5WA 5KSWA 3DBPA 1W9XA 2X7WA 2WHMA 4MDPA 3K4DA 5E0FA 1LUCB 1X39A 2WXDM 4FIRA 6CGTA 1QCWA 1DJYA 1GHRA 3DYOA 3BO9A 1TPH1 3W7RA 3CHDA 2YBTA 3VGDA 1KTBA 4H8HA 4X61A 3F2DA 3UPMA 1TJPA 3GY1A 2WHJA 2VD8A 1EC8A 3OVRA 1DWIM 3LM7A 3UZZA 4F4RA 4G5DA 1GW1A 5JMUA 4LS2A 1HKVA 4TTGA 4C1KA 4IG2B 1C8VA 1R3VA 4GBDA 1H0GA 4N4PA 3RK8A 1JZ2A 3NDOA 3V36A 3II1A 2YCLA 4JR5A 3AIRA 1VZWA 5E5CA 3VABA 1VIZA 4ZQMA 3CB8A 1TR9A 2O7QA 1YDVA 4U10A 2D3NA 2X0HA 2Y62A 4B2DD 1UUOA 2XISA 3LPPA 3PUDA 5D2XA 1JDEA 2CIPA 4ZB2A 3GQYA 1UMYA 4QXIA 1DL3A 1XLFA 4AIOA 5JIPA 1DIEA 4UQDA 1A0CA 1LQ0A 1M53A 3B0UX 4H8NA 2YW3A 4NKCA 4HNUA 4BA0A 3SCPA 2EPOA 3TSMA 3BSMA 2ACRA 4AD5A 1DJGA 1Q63A 1YLVA 4UTLA 4B92A 4CVWA 1ZB5A 1HP4A 1G94A 4JTFA 4M8UA 2CZDA 3IJ9A 5LKYA 3WDIA 3BV7A 1H7RA 1L2UA 2VC9A 1KFBA 2WWDA 1XH0A 1U1UA 5EMUA 2EPLX 1TTJA 3P8IA 3LBMA 1JYWA 4YWSA 4Q8OA 4LUYA 3GNNA 3N2TA 2GQ3A 5HWNA 4H19A 4QDWA 1US0A 4GZEA 2J4GA 4L1XA 4JFUA 3TNBA 2EHHA 3PPFA 2C71A 2CETA 3GXMA 3NL6A 2YL6A 3U2CA 3WH8A 4CQ8A 3BXWA 4R5EA 2FGBA 3GLCA 2ZX9A 4NVTA 2XM2A 1E73M 4MGGA 4FK9A 1XUUA 4AZGA 4DJDD 2JKPA 3W1UA 5DBTA 1IHIA 4NILA 1HL9A 3NQ6A 2KAUC 4DO6A 4QTGA 4N9DA 4JTRA 3WJZA 3EBVA 1X6UA 2YBVA 1UWIA 2QV4A 1TG7A 4LPCA 4IIEA 3NGFA 4BF5A 4HPJA 2DW6A 4M7TA 1WV2A 2VMFA 4DNMA 4IIHA 3PS7A 4WQ6A 4ES4A 1QASA 1RQEA 4WDUA 1J5TA 3T0BA 4JTEA 4ROQA 3GXDA 3UCQA 1NOFA 2OWCA 4JTKA 5A69A 1UQZA 4OOUA 2VGIA 1TRIA 2PGWA 1GORA 2PF0A 1CIUA 4O53A 4IPLA 1N8IA 3DFPA 5BRBA 3XINA 4HJFA 2AAMA 4E8DA 4HSOA 4NG3A 4IUOA 1ZJHA 2NV9A 4LS1A 4BQ3A 2BTMA 1ISXA 4XZBA 1FHDA 4L4PA 4G6CA 1DE6A 4D8LA 4F9JA 5KITA 4WHBA 1OFPA 2P3EA 2ZC1A 1Q8AA 3B05A 3BE7A 4PMVA 4IJRA 1K1DA 3VNKA 3V1HA 2RDUA 5M1TA 1IEQA 1V7AA 3S1WA 5TIMA 3VZZA 4AX6A 1GVYA 3A9IA 3EOUA 1OF8A 2XVLA 3UFYA 4R7WA 1HNYA 5F1UA 4GFIA 1SZNA 1QHPA 3HF3A 3TN6A 1G4PA 3O6AA 1HJQA 3GYEA 5A6AA 3V35A 4KEMA 2OSYA 3RPMA 4M7SA 4CN4A 1E4IA 1V6VA 4PRRA 3LK6A 4DBEA 3N2CA 2X1TA 2WSPA 4B90A 4Y8FA 5FSDC 3NZRA 1DHKA 3P84A 4AD4A 4UR8A 4S3FA 2HK0A 2BY0A 4W89A 3PJUA 3TOPA 2BBFA 4OU1A 4GNJA 2PE4A 2ZX7A 4C6EA 2Y1HA 4FALA 4QROA 1LQAA 1BD0A 2WSYA 2H3DA 1QJWA 6ENLA 1I2NA 4YYCA 3T44A 2OLHA 3O1NA 2OYMA 1S2AA 1XYZA 4QLKA 2J27A 3ZJ6A 1KBIA 2XSXA 3VCRA 4H1ZA 4U2ZA 2VFDA 1XPGA 1E6ZA 3K4WA 5REQB 2A3CA 3TV8A 4JTLA 3KOWA 1J0IA 5A5WA 1SR9A 1HIZA 1Q7ZA 4IQDA 1NQKA 1KBBA 2OEMA 1NDWA 1Z6KA 3L4ZA 4GJ1A 2EAWA 4L80A 2ZICA 2CEQA 3WMCA 3UG5A 8CGTA 1VHNA 3A64A 4PEKA 5H6HA 3ANYA 4E4FA 1XGZA 3GHTA 4ICNA 7XIMA 5CC5A 1NSJA 4HHPA 2NQJA 1XHGA 4BI7A 3KOXA 1KKOA 3LCIA 5C71A 3CMGA 1ZPTA 3H2NA 1EJ7L 3ECQA 3SRFA 1FVPA 5ABFB 1XKYA 5KZ6A 3VO0A 3VIHA 3S8HA 3W28A 3PF3A 4IISA 1KXVA 2VFFA 1MDRA 4JQ3A 1BQGA 8XIMA 4MAZA 5DY2A 3H4XA 1GZGA 4ORIA 5A6JA 3S6DA 3LCXA 4H7CA 4DRSA 4NJIA 4LYRA 3ALFA 3W1RA 4GJJA 1QPRA 1BWLA 3NO5A 4ZO8A 4PH6A 3W2MA 2W79A 2BG5A 2WSQA 4IIGA 3ICJA 4CEUC 4QE4A 5DLCA 1KM3A 3A9BA 5FJRA 2CXGA 1E1EA 3W2JA 3UXDA 3GNOA 1SO4A 3DG3A 1B3YA 3W70A 1Q7MA 5DANA 3WF3A 4D8AA 1QK0A 1ZBVA 1M7OA 4WF7A 1MZRA 1W3LA 1B5TA 2VVSA 1VF8A 1YHTA 4LCSA 1FWWA 4B5VA 4QE5A 5JH2A 1PDZA 3PG8A 2VYOA 3PR2A 1O5RA 1HN1A 5DXYA 1F8MA 3CLMA 3BTNA 4O8RA 4WLCA 5XIMA 2BY2A 4HCDA 1V6WA 2QF8A 1Y5VA 3UJEA 5I79A 4DUXA 2Y6ZA 4P2VA 1SVDA 1Y65A 1TWSA 1WDQA 1KFWA 1XICA 3KDOA 2VELA 3EWZA 1S2WA 5F4WA 5D33A 1NVMA 1SJAA 2GJPA 1QFEA 3WLJA 3THQA 2X30A 4LV9A 4D9PA 4ZBCA 1J0ZA 5F2MA 3K1DA 3A6OA 1CGVA 1DJNA 1I0DA 3LHWA 2OOGA 3EA3A 4JIPA 3WNPA 1MNZA 3TTOA 4MKSA 4RDVA 1EBGA 5D8ZA 3BAJA 1QTWA 2J8FA 4AZ5A 1BVNP 4M3PA 1QMLA 1H11A 3H53A 2CHOA 3FFSA 3NVTA 3W1MA 1H60A 4E4UA 4TVDA 4X9SA 1UP3A 7A3HA 5DQPA 3FDKA 4HTYA 3S47A 4D6DA 2JK2A 5HBFA 2HNHA 4FXRA 2FZBA 4FR1A 3L4WA 1Q4WA 4RE0A 3MVIA 3VNZA 3OHMB 2YJQA 3LCHA 4F0RA 4N6EA 3ZWTA 1QT1A 1AQHA 5HAOA 4RUBA 4DXXA 3RYSA 3LN3A 3B4UA 1EXPA 3NQMA 3VVGA 1PKNA 1XGDA 3THUA 4IPNB 5C55A 2E1WA 1XGEA 1EUAA 4QR6A 4XUYA 2E25A 4AIUA 2G50A 3N19B 5CSYA 1S1PA 4UTTA 3SCUA 2INZA 2XIBA 2FZDA 1BSIA 5I3KA 1XLDA 2Z25A 1DXIA 1AL7A 1XLIA 3SCTA 4DEFA 1C92A 2BVWA 2WV8A 2OYLA 5PTDA 4FNTA 3HQNA 1BXBA 4DQWA 3TAOA 1CXHA 3AIVA 3CO8A 1Q2SA 1KFCA 3E2SA 1FCQA 3B9EA 1QO5A 2FGLA 1CLVA 4P8XA 2A6LA 3G1FA 1I1XA 3IAPA 1FCBA 3GM8A 3UNDA 3THAA 3RG6A 3F4DA 2ZZ7A 5IRPA 5HQEA 2EEXA 3FGCB 2HE8A 4UOJA 2XN0A 1T96A 4O4WA 2WC3A 3KRSA 3UR5A 5EB8A 1B2YA 3DN5A 5G4WA 5LNWA 3M64A 4RLIA 1DWAM 1SZEA 3EWXA 4JN7A 4ZZ9A 3WLOA 3W1QA 3E0FA 1E6QM 3HPZA 4LVAA 5DN1A 4IUGA 1XIMA 7CGTA 1AMYA 5KEZA 3TFXA 3WENA 1VCFA 3QKEA 5I78A 2ZUTA 1ME9A 1YPXA 1L2QA 1EZWA 3B9DA 3PZIA 1WAWA 4Z1CA 3TJLA 3VOJA 1MQRA 5CJNA 3M0XA 4Z0SA 3HGRA 4QGCA 1YX1A 1JDDA 3I4EA 3K8MA 4MNJA 2PB1A 2J77A 4URIA 4DF0A 5CQ1A 1K4GA 3H55A 1U30A 3FSUA 2XH7A 1E9IA 4ZVJA 1EPXA 4ATWA 4PBGA 5E0CA 4I9TA 2C1HA 3VGFA 1DEDA 2YL5A 3H12A 1A3WA 1I45A 4RNIA 1XX1A 3W84A 2L5HA 4IQEA 4F9DA 1M6JA 3F4WA 4LY4A 4WSJA 5AZ1A 2IXVA 3WLHA 4M80A 3ZT6A 1OGGA 2XU2A 1FRBA 1UUQA 5DMNA 4C6JA 4CGTA 2DEPA 4UNIA 1EKOA 3VIOA 4IMCA 4B15A 4D6EA 1KO0A 1VCVA 1IEWA 1VYSX 3RXZA 4Q33A 4I9JA 3TE9A 1OABA 4K7VA 4DM2A 5MKGB 2E9MA 1EJUC 3LNPA 1VYPX 3DECA 2JF7A 2ISFA 4C60A 2C19A 1UD6A 1A3HA 1TUXA 4O50A 4U3CA 4Y9MA 3CASA 1VKFA 1QW8A 1F8IA 4KMQA 2DQXA 5ENLA 3PZQA 4UNKA 4DXVA 5XIAA 2HXUA 2G37A 3O0FA 3ONCA 3OGSA 2O4QA 3M44A 2NQ5A 4G7FA 3LCFA 1TUFA 3M6YA 1EUNA 2G8ZA 4L4MA 3PB0A 3ZWSA 1SYTA 3AJXA 5FF0A 3IK2A 2V38A 4MB4A 1TWWA 3AIUA 1E1FA 4LFYA 1G7UA 1KGWA 2CWNA 5GNZA 3K1GA 1GJUA 1HJVA 3O6YX 4C6PA 1XFBA 5D9MA 1NF0A 2NQZA 4PMJA 4UFMA 2Q71A 5CEWA 1QI3A 1YNPA 5IFTA 2BX7A 3DG6A 5FJIA 3GFZA 2AQVA 3GAKA 3OTRA 1QOQA 1UR9A 2PU0A 3B4YA 2DSWA 5K4ZA 3LTYA 2BODX 2Y61A 1J18A 4N6FA 1VJZA 3KTSA 4KWUA 2PSNA 3CO4A 4OBSA 2IPWA 3E38A 5E9XA 2JGQA 4XO7A 1EEPA 3TA6A 3SSJA 2YR1A 3XIMA 4Z2JA 2R1KA 1RVKA 1ICPA 2GL5A 4AMAA 5FEZA 3GNRA 1O1ZA 2ZDSA 3MKKA 2RH9A 1OFEA 3OW1A 3AU6A 3STFA 3ONBA 3QEZA 4BF9A 1JEZA 3FA3A 1QBAA 3WK3A 1H3GA 2BVTA 1FWAC 1AH4A 1XI3A 2DV0A 2ZRWA 1E0TA 4GUJA 3DGRA 4FP1A 2Y7DA 4UQBA 2WAGA 3NTYA 3MV11 3B9OA 4JX5A 4JDBA 3STPA 4HA1A 3ZR5A 2PTYA 3TW9A 3G1RA 1QPOA 1PHQA 2WPBA 2HE5A 3T7VA 1L9WA 4NNAA 3BW3A 4PN2A 6REQA 2W61A 3CHFA 3KTCA 2J6XA 3EYPA 2XWDA 2HSAA 1TVLA 3Q58A 3O2LA 1EP1A 1D3HA 3TDFA 4W7WA 1ELSA 3CWHA 4HHMA 1W2VA 4AF0A 1H0IA 4IJCA 5E6ZA 4C6DA 3BSGA 3ZS4A 4NT0A 3IJ6A 1JPDX 2C13A 4EAYA 3W72A 3NL5A 4OE7A 1XIHA 3WJWA 2QCGA 3EX1A 4UFHA 1YNQA 4PULA 2B31A 4JTUA 5LIXX 3E6EA 3VKBA 3AXXA 4LVBA 4RCXA 3VDCA 4R34A 4UTFA 1V79A 1C3FA 4BS0A 3IIZA 3AMKA 2NXIA 3L2MA 1N8WA 2GFTA 3UZ5A 1C7TA 1KM1A 1RUSA 3LI1A 2WMFA 3R43A 4Z2KA 3DC0A 3UZXA 1XYLA 4TX6A 4JTSA 3UESA 3C0JA 3R58A 3R8GA 1IEIA 1WE5A 1FA2A 1V4YA 2Y8KA 1XLCA 2O9TA 2R1NA 3B97A 2ESCA 4IICA 5HWMA 1W2PA 3JW7A 2GJXA 5FEWA 4F79A 1VFTA 3NDZA 5FESA 3KW3A 2D3LA 4A05A 1JCXA 5FF3A 4ZB5A 4LW7A 2YCEA 4UQCA 2F6XA 3TLLA 3GC4A 4PCPA 5HNRA 3WLKX 1AUSL 5HMFA 4GQ0A 4AD3A 1J9YA 4HK7A 3HFYA 1BKSA 3N1AA 1K7EA 3VFLA 3GHSA 2V82A 2E6AA 1QI2A 5HMEA 3W7EA 1KM4A 3EX4A 1WZKA 1AW1A 5LZLA 3GR8A 3RRXA 1E72M 5CG7A 4MJ2A 3RN6A 4DWSD 2H8ZA 3TR9A 4UR7A 4H6RA 3TYCA 3D47A 4ZSTA 4HU0A 3TMLA 2F6UA 3C0QA 1E51A