3EX3A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-azido-ump, covalent adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex3A00
1IXQA 3EXSA 4K8EA 4IMFA 1WYIA 3B03A 4IPIA 2A7RA 3H53A 5DBUA 1C9DA 2E5CA 3HGOA 2CLOA 4DF0A 1VR6A 1XDMA 1KA9F 5FEZA 4KWWA 5FEWA 4H6KA 3BLIA 3S5ZA 5GVJA 3N14A 4KKXA 1SZEA 2X1TA 4ZMGA 1EWEA 5HR7A 2C3ZA 2FPTA 3FIGA 3PUEA 4L4LA 3T78A 1L6SA 3INPA 3MI3A 1YTEA 2QCEA 2F84A 4HKPA 3W9ZA 3S5OA 1H7WA 3UXAA 3B0VC 1VH7A 4JNMA 3FEMA 4LC8A 1SSGA 3ATZA 3W76A 2C0AA 3G18A 3DAQA 3C3NA 4FNTA 2OZ0A 1VCGA 3M7WA 3TNOA 4A22A 4U28A 4O11A 5HWMA 1K03A 2G97A 3M5YA 2OX1A 2WSYA 4O4VA 3NL2A 4UFJA 2A2IA 1K02A 1K7XA 2A7PA 3M5XA 3F1QA 1P0KA 5LNUA 3JRKA 3USBA 4PA8A 4ADTA 1TQJA 3EX1A 3T44A 1H51A 2QUUA 2FIQA 1UASA 2HMCA 3GR7A 1RQHA 4AEOA 2GJNA 1LDCA 5F1UA 2QUVA 5CG7A 1I4NA 3LTSA 5U4NA 3LI0A 1XCFA 4XWUA 1UB3A 5E93A 3UPWA 3S1VA 4YWIA 1CI1A 2V0TA 3UPBA 4BFAA 1OYCA 3C6CA 4GNJA 5LSMA 3GAKA 3QW3A 3U8GA 5FEXA 2E1DA 1FY6A 2NZLA 3MUXA 1PIIA 1CW2A 3A22A 1WA3A 3NQ8A 3L2IA 5CPMA 4ZQRA 2DZWA 2RH9A 3QMRA 2VOMA 3RLVA 3CPRA 1W3IA 3QM3A 4XTIA 1TYGA 2V30A 5CPNA 5DCDA 1AK5A 4NXKA 1GPWA 3NG3A 1DVJA 2AGKA 1OFOA 2WQPA 4NUWA 5KINA 4GBUA 1LORA 4E2DA 2WV8A 4AXKA 4PL2A 4Z0JA 1OX6A 2CW6A 4Y8FA 3S6DA 4QSHA 1LBFA 1PVNA 1W3NA 2EAWA 3P80A 1W31A 2Z2UA 2EGZA 4LVBA 5LNVA 3CIXA 4PODA 4WOQA 3GNDA 2DZXA 3BW3A 5C6MA 2E6AA 1LRTA 2XN2A 4K7VA 5FF7A 2YW3A 1A53A 2ZQ0A 5D2VA 3LXCA 2QCDA 3KRZA 4P61A 1UBSA 2Y85A 1NFBA 3LHVA 2X30A 5LGZA 4XKYA 1P0NA 4RKAA 3LXAA 4YXGA 1U5JA 1GJPA 2W6RA 4HT3A 3NXFA 1F05A 3HF3A 3QC3A 3W1AA 4EVZA 1XBYA 3IV3A 4K39A 2VEIA 3K30A 2NXHA 4M6PA 4E2BA 1SFJA 3NQ6A 4PC8A 2RDTA 4JIQA 1LLZA 1ME9A 2FB3A 3TAOA 4BI5A 5D05A 4UTWA 4UIOA 3M5ZA 2YSWA 4N9CA 3QQ0A 1TPFA 1X7FA 1XC4A 4R53A 1YDVA 3TQKA 3QYQA 4GUFA 4K37A 1FQ0A 1IIGA 1CX9A 4QISA 4QNEA 2WKJA 1YDNA 2ZZ6A 2CZEA 1V7YA 3RNDA 1DQWA 2Z0IA 1FXQA 3DFQA 4R7JA 5D33A 3DENA 4ML9A 2DZVA 5K7JA 1BWKA 1OFDA 3HJZA 1TCDA 4UMAA 1T0OA 3LCGA 4IMGA 3UXDA 2PCQA 1OK4A 2FDSA 1FWNA 5AYXA 3STCA 5CZTA 2I1OA 2WPBA 2R14A 2CLEA 2QCMA 4XUGA 4Y6GA 4WD0A 3L9CA 2XN1A 1RQBA 4IOTA 4O8RA 1EA0A 2ABBA 2I9EA 2QKFA 3UWZA 1PL9A 3W2LA 1H63A 2A4AA 3SW6A 1MSSA 2VC6A 3ABRA 2GPTA 5G2WA 1R30A 2ZZ4A 2ZRUA 2NUXA 1EPXA 3PUDA 2FLIA 4LV4A 3GVGA 5LNWA 1G4PA 1VQTA 4A3UA 5H2ZA 4O1DA 1HUVA 5L6UA 5DBTA 2GVJA 1E51A 4OT7A 4I9AA 3PB2A 5D02A 1JRBA 2CWNA 1QPRA 3C56A 4S1FA 3S5YA 1LRQA 3PBYA 3TA6A 1QO5A 4PH6A 1QAPA 3UY8A 3A21A 3EX2A 3LB0A 1H7RA 5FI8A 2J6XA 4GWEA 1TRDA 1JCNA 3PB0A 3Q94A 2Y7GA 1TJRA 3P5YA 2J9XA 1KM3A 2CFFA 5CZJA 4RXFA 1J4EA 1ML1A 3STFA 5AHEA 3LTPA 1KFCA 1DOSA 2Y6ZA 4TMBA 3GR8A 2ZRVA 4MJMA 4ZZ9A 4O50A 4FX6M 3OEXA 3M41A 4R34A 3N19B 4XQ6A 2J88A 5DXXA 1OFEA 4Z1CA 3B0UX 4ADUA 2HSAA 1O4UA 1JJKA 3W22A 4JYEA 4JTGA 4MIMA 4CNOA 2YZRA 5HQEA 3I7RA 5EA9A 1XBVA 2W0UA 3TAKA 5F4SA 4M7SA 4UTTA 2BLEA 3AO0A 3NQVA 3OIXA 1JQVA 4UR7A 3EWXA 1DV7A 2BXVA 4WY0A 4AWSA 1DHPA 4JDYA 1OX5A 3W74A 3M43A 4RK8A 5F4XA 1YADA 2JGYA 3W2NA 2FQIA 3ZR4A 5CZSA 1G7VA 4O57A 3DFSA 2EKCA 3TK7A 4M6VA 4LOCA 1QCWA 3CEPA 2YGYA 3E02A 2I14A 5G5IA 4MFDA 3WJSA 2DU2A 1THFD 1P5BA 2WSQA 3S42A 4LVGA 3IIPA 5D2YA 4MYXA 2CLFA 3DZ1A 3LRMA 2VFGA 3UZJA 3Q58A 1AG1O 5I3IA 1L6YA 1QMLA 1HO4A 4UTUA 1SW7A 1KM4A 3G1HA 3SSJA 4AVFA 2C6QA 5BOOA 4HHPA 2V82A 4CQAA 3W7RA 3IIZA 1TIMA 3L5MA 4IQLA 1NF0A 2NWSA 3DFTA 4QQ3A 4FO4A 5HUPA 1QPNA 3QEZA 1G69A 4CQ9A 1SFLA 5FF0A 2JKEA 3TR2A 4W9TA 2RKXA 3NPVA 5D37A 3DKJA 4MLRA 4CCDA 5IM51 2O7QA 4GXMA 1KTNA 4N4QA 4OE7A 2DORA 1GEQA 4UCGA 1M6JA 2G5WA 4GUJA 1RV8A 4JTFA 4O18A 2Z6IA 3OVPA 3G1YA 3W3OA 4CNNA 3GZ3A 1HTIA 4LU0A 4Z1DA 4MOZA 1RZMA 3TC6A 1GG1A 3L65A 3SECA 3RMJA 3W7PA 5AC6A 3HG5A 4ALDA 3ANYA 5F2IA 3HQ1A 4JTSA 4N6EA 2QCFA 4UMBA 1JR1A 4NX0A 3C61A 2QCCA 3W7HA 1ZNNA 1P1XA 2QAPA 2JBMA 3DH7A 5AHFA 2DZUA 1LZOA 3NOEA 4UTTC 3MBFA 3GKAA 4LVAA 4X9SA 4MZ1A 3VFLA 4MY9A 5CKSA 1H1ZA 3BG3A 3G8RA 3GDTA 4QAIA 1GWJA 1Q6RA 4MVAA 3NEVA 5EYWA 4OWGA 3B8DA 1LCOA 3M47A 4UTIA 1F7BA 1HL2A 1X1OA 1GQNA 3TSBA 2DP3A 1VYRA 3G22A 1JCLA 1TPDA 1QWGA 3W7EA 3A5VA 3NM3A 5KZEA 4OHQA 3C0JA 1EUAA 4O16A 3FYOA 1MEHA 3C2VA 3L5LA 5AN7A 2F7FA 3H54A 3I7SA 3GDMA 3DXIA 1YXDA 1EX5A 2CU0A 2ZTJA 2ZRZA 3LOTA 1F5ZA 4MJZA 3EX6A 5K3VA 4UTMA 3LHYA 1HG3A 1N55A 2C1HA 2DZSA 3FYPA 1D3HA 1ZY9A 4JXCA 4MY1A 4DO4A 2VFFA 4ZQNA 5CSSA 3NQMA 4OV9A 1QO2A 3W2MA 1ZALA 4NZJA 3P81A 5AYZA 4WJEA 1WQ5A 4LVFA 3THQA 4HPXA 4GFSA 4CQ8A 4IGHA 1M7OA 4JX6A 1KTCA 1VCVA 2V2CA 1AW1A 1ONRA 3L21A 2X1SA 2ISVA 5EMUA 3KX6A 2B7NA 5AHNA 3HG3A 1AL7A 4ZVJA 3BK0A 4DBEA 4LVDA 3LGEA 3W84A 1D3GA 3W75A 3W83A 1T96A 1TPWA 4JTUA 4OBTA 1DJQA 3R12A 4JS3A 5BMXA 2WO5A 3EEGA 3W1MA 2GJLA 4X3ZA 4AHOA 3KRUA 5DN1A 5A5WA 2RDUA 4CCEA 4K7YA 4BWLC 2E6YA 2QJGA 3ZWSA 1B9BA 1KBIA 3SJ3A 1RR2A 1GTEA 1KM5A 3F03K 4Y9AA 3RU6A 4JIPA 5EPDA 3ZWTA 1L6WA 3L5AA 2RHGA 2ZZ1A 1Z42A 4DF2A 2X16A 1WOAA 3U2OA 4IXXA 1IXPA 3FKKA 1SZGA 3EWYA 1XUUA 3W7CA 2ATMA 3QZEA 1O60A 3W7LA 3TJLA 4ZL1A 4CCCA 3M1ZA 3BO9A 3M9YA 3TMQA 2NX3A 3FFSA 1UCWA 4NX5A 3MP4A 5D09A 3HPZA 3MP5A 1WAUA 3NL6A 5G4EA 3N2XA 4DPQA 3L66A 3TC7A 3W7DA 1PCWA 4JEQA 1OABA 3BW4A 3CIWA 3LHZA 2J24A 1KM2A 3CTLA 5C55A 1QDSA 2YXGA 3PY2A 1L9WA 3L67A 5LNSA 2YYTA 3P7YA 3MI2A 3PSWA 3WJWA 2YW4A 4EF8A 3HG4A 4IPJA 1I45A 6ALDA 5EL1A 3SZ8A 1OX4B 2EPHA 4UUIA 4ICNA 5DY3A 3W1UA 1Z48A 4UTLA 3T7VA 3TIMA 2AAMA 3ABSA 3UWYA 1ZAIA 1J5TA 3NPUA 3CWNA 5CPLA 3I68A 3PVFA 1AMKA 4RZ5A 4A2SA 1FCBA 3HB9A 1TPEA 1M5WA 4YLWA 3S1XA 3S9YA 5DLCA 2YFNA 4UTHA 2C14A 4JDBA 5D32A 1LTDA 1GYNA 1XXXA 3QSRA 4JR5A 3PULA 5EBUA 3TQ0A 1KFJA 4N9EA 3BVJA 2YDAA 2VFDA 2O7SA 3WJZA 4FF7A 1KFKA 4GUGA 1H7OA 3G1XA 3YPIA 5F1VA 1D9EA 3W2UA 1RVGA 3NM1A 1NAL1 3N2MA 1W5NA 4UFIA 2CLMA 1SO3A 4X22A 4K38A 4WXZA 5J5RA 1OFAA 3QSTA 1UUOA 1VLIA 5F2LA 3KAOA 4FXSA 4EF9A 2ZDRA 2QDGA 1F74A 1TSIA 4DO5A 4TMCA 1OYBA 1K8ZA 3B04A 5LKYA 4IUOA 2QDHA 4O1AA 3W88A 1NEYA 1VHNA 1JCYA 3IIXA 4TO8A 1FXPA 3L0NA 4GUHA 4O13A 1VCFA 3GX9A 2QCDB 3HGJA 2A6NA 5CPOA 5E1QA 2PE4A 3C2EA 3HMJG 1JUKA 2C15A 1QPOA 3MYOA 3MHUA 3GLCA 4FNSA 5J5DA 3NZ1A 1WX0A 3AJXA 4OGZA 1S5TA 4WQ6A 3IGUA 1R46A 1QPQA 1DL3A 3LCLA 2QCNA 3LCWA 3G3MA 3OHIA 1BTMA 4GC4A 3OBKA 4DPPA 1W5PA 4Q32A 4ORIA 4KFPA 3LBMA 1W56A 4I7UA 3MMTA 3TFXA 5KTLA 4Q33A 3CT7A 3VE9A 3LBCA 5G2IA 1P4CA 1I2QA 2BX7A 3UNDA 3PG9A 5FESA 5LHFA 3B0PA 3NQ2A 3MHFA 3IRDA 2Y63A 2J9ZA 1S3HA 3N9RA 3NNTA 2VEPA 4HNNA 5AOUA 5IBXC 2Y7DA 1W3TA 1PS9A 1ICQA 3E12A 1MEWA 2HTMA 4JD4A 4O28A 3LV6A 2YFOA 1BEUA 1EWDA 4UFMA 1KFBA 2QCGA 2A21A 4HIBA 2CLHA 2ABAA 3DFOA 1XFBA 3TSMA 5SWUA 3W7QA 3PM6A 3E49A 2VELA 4MLJA 3BPWA 1O95A 3PSVA 3P5ZA 4OV4A 3TW7A 1H7PA 1TTPA 1OX4A 3M0ZA 2TYSA 3THAA 3VKJA 1YXCA 1WBHA 3TXVA 3DI1A 1KV8A 3DHFA 3O6YX 4JTHA 3W6YA 3C2OA 3R89A 1ZJIA 2H8XA 1FCUA 4WY0B 1C29A 2BTMA 3O6CA 4ZQPA 2D73A 3GAYA 2GQAA 1OJXA 1JRCA 3C8FA 2WNZA 1RQEA 3EKZA 4FHAA 4RV8A 1AL8A 1WXJA 1FDYA 2NWRA 3G0UA 1FBAA 2TSYA 1EIXA 4LWWA 3C4UA 2Z6JA 3FA5A 5CGQA 1LBLA 2V9DA 1DBTA 3ZFHA 3MBDA 4IWWA 4HSOA 3G1SA 3LXBA 5TQLA 4RLIA 1XI3A 3TDFA 5D30A 1WV2A 2WNQA 1G4SA 3F4WA 2DJXA 3O06A 3TCEA 2Q8LA 2C18A 1EP3A 4LUIA 3UQNA 2CLLA 1TTQA 3HIJA 3VNDA 3O15A 1OVDA 3SIZA 2WNNA 1A50A 1GYLA 3SR7A 3NPXA 4MZYA 1GVSA 3C52A 4NJGA 1VC4A 4IMDA 3TMLA 5AB3A 2ZRXA 5U7SA 4TX9A 2A0NA 4O54A 4K36A 3RK8A 1OF8A 3PR2A 3P67A 5E0KA 2VENA 3CB8A 2OJPA 2NUWA 4WOZA 4RX0A 1KV5A 2TRSA 3LLFA 3W7IA 1SZFA 4TU1A 3H55A 1OFQA 3DGRA 3N3MA 4MUZA 1FUYA 1QFEA 2EF9A 3NQAA 4M19A 1ADOA 3NO5A 5ABTA 3G1FA 5HWJA 3NQEA 3IVUA 4Z1BA 3CM4A 4RZ6A 2FB2A 2NX9A 3NPWA 3LDVA 3W73A 4PFMA 2W79A 1SUXA 5T26A 1ZFJA 4C1KA 3M5VA 1KW1A 3I7QA 3QMTA 3W1PA 4AMAA 4BWLA 3DBPA 2ZA1A 1LM1A 3P74A 4BF9A 3LLDA 3MYPA 3EWZA 1UJPA 1K8XA 5HULA 4LV9A 4S2CA 1B57A 1SSDA 3NDOA 4DXVA 1NVMA 3PBVA 4GJ1A 2P0OA 4ZQMA 5IBXA 3LCXA 3S1WA 4JICA 3FJ6A 3W1RA 2OT0A 3HPSA 4FX7A 3TE9A 4N9BA 3W7OA 5AYYA 2CLIA 2FTPA 3T4CA 3G1DA 1A5SA 1QOPA 2B7QA 3NA8A 1F2JA 1ZAJA 2GOUA 3WJXA 1A5BA 3G8EA 4UFKA 3WK0A 5G1YA 2QUTA 3L0KA 4IX0A 4AWUA 5DY2A 3NQGA 4ZQCA 3W1NA 4ONVA 1KM0A 1A5CA 4NJJA 1VYPX 2JKAA 2ZCGA 3HO8A 1SO5A 3GDLA 5DCEA 1X8FA 1PCKA 3JR2A 2ALDA 2XFWA 3BLEA 2VEKA 1ME8A 1G4TA 4OQVA 2NUYA 1MO0A 1FWRA 3OVRA 3S8HA 5A8GA 3CEUA 4J9JA 2Y7FA 1TV8A 1O94A 4Z1AA 3T40A 3W1LA 2C16A 3HBLA 1K3UA 1B4KA 4O53A 3W86A 2AQWA 3E96A 5BW6A 2A5HA 3QMSA 1MXSA 3UYCA 4O1BA 1H5YA 4WY0F 3PBUA 5K9DA 2ZRWA 3UWUA 4O1CA 4O19A 2DJLA 1LP6A 3O16A 4DQWA 2DZPA 3IEBA 4A2RA 2QCLA 4A21A 3UWVA 3B4UA 3PWAA 3O63A 1TJPA 1TB3A 1RPXA 3A24A 3C2FA 1Q45A 2CZ5A 4O15A 2PRLA 3NYZA 2P1FA 3P82A 3PF3A 5FEPA 2Y89A 3WK3A 3L68A 5EKYA 3NGJA 4DEFA 3W1TA 5DELA 5AHLA 5K4XA 3PUOA 5TIMA 1DORA 1SU5A 8TIMA 4MZ8A 1DJNA 3TJXA 4K8HA 3MJYA 1LYXA 3EB2A 3F4NA 4QIUA 3NQ7A 3OA3A 3CC1A 3QF0A 1T8XA 2ZA3A 2VFEA 1L2UA 3LHUA 1OYAA 4FNPA 2ZA2A 2E09A 4FIRA 3JS3A 4AF0B 5AHIA 3LCIA 1SPQA 2E5DA 3BG5A 4O12A 4NNBA 4N2YA 2BSLA 3LHWA 4GE8A 3Q2DA 1KFLA 3R5EA 2H3DA 4NNAA 1OFBA 3STGA 4D2JA 5C2XA 2FJKA 1SZNA 4WX2A 3LRKA 4AH7A 4RXGA 1KLYA 4UTWC 3O1NA 3L0GA 2JK2A 4B5NA 2PRMA 2WOQA 2P10A 4A29A 1JUEA 3KRSA 3ELFA 4O0KA 1M7PA 1ZCOA 3WK2A 4P2VA 4KFNA 3W7MA 2HS6A 2RFGA 2IQTA 4I7WA 2Q3RA 4OU1A 3P61A 3BLFA 5D38A 3CLMA 3B05A 3CQ0A 1SO4A 4JN6A 7TIMA 4FX8A 2YX0A 1Q3NA 3BGGA 3EWBX 4POCA 3FOKA 1NF7A 4JYDA 1Z44A 3R8RA 2ZZ3A 1QR7A 4PL1A 1W8SA 3NL5A 1B4EA 1TRIA 4JY9A 4FNQA 4U4MA 4NT0A 2H6RA 1W5QA 1XKYA 2YPIA 1SR9A 5I3KA 4C1LA 4HPJA 3M6YA 2B7PA 4DO6A 4QM1A 4O17A 1FWSA 1IF2A 3LCFA 3QPYA 4N02A 3PG8A 1FDJA 1K7EA 5LZLA 2NV1A 5I3HA 1GVRA 3KVKA 3ABQA 4IJBA 1H60A 3VE7A 4JTTA 1H7NA 2QJHA 1VGAA 3TU9A 1VJIA 1G7UA 3W71A 4AB4A 1KFEA 3M44A 3W2JA 3TV8A 4AAJA 4H3DA 4NJIA 4NJHA 1ZHAA 1WBJA 1YDOA 3A23A 3G1AA 1FX6A 2V5LA 5AC7A 5I3FA 2JKPA 2H3BA 4PCFA 3HOJA 4LY8A 1JUBA 5AC8A 1WDWA 1AW2A 5F2GA 1R2SA 4RR4A 5C54A 2JGQA 3EWUA 3A9IA 1JQXA 2UV8G 1KM6A 1TMHA 4MY8A 5H91A 3NR0A 3TX9A 4XKYB 4GRSA 2LLEA 3EX4A 1JCXA 1N7KA 3EWWA 1W5MA 4MPQA 1K8YA 2Y88A 2BZNA 3R13A 4YL2A 2B4GA 4UC5A 2YYUA 5AHMA 1VPXA 2J27A 3NZRA 1ZAHA 4IMCA 3D0CA 4N6FA 3O6DA 3QFEA 1OHLA 1GTHA 3W72A 4Z08A 2QJIA 3LX9A 3W2KA 3BARA 4NVTA 3N73A 4QITA 1W0MA 1WOBA 5KMYA 2NXGA 2B0MA 4PEKA 1R47A 5K2ZA 1QNVA 1XL9A 3CU2A 1YXYA 1FDZA 1HO1A 3S1UA 1JVNA 5HINA 3GYEA 3DFNA 2Q8ZA 3MI6A 4LRTA 5BRBA 5EY5A 2V2HA 1W37A 4E0CA 1TV7A 2X1UA 4QNWA 3GDRA 4RCXA 1H50A 3G24A 4DF1A 4XBKA 1LBMA 4YMZA 1B3OA 2Y61A 4UFLA 1GZGA 4G1KA 2QCHA 4Z0SA 3P62A 4KFOA 1KBJA 3NQDA 4UNKA 1O5KA 3LCHA 3ZS4A 1A5AA 2CLKA 2QR6A 3VI2A 4M6QA 3KVJA 3PS7A 1GVFA 2CZDA 1FCQA 1IXOA 3PC0A 4S2BA 3EXRA 3QQ1A 3R2GA 2WSRA 3KHJA 1Q6QA 4O4WA 4NQ1A 2R94A 4WUIA 5HJLA 1VRDA 3HPXA 3G1VA 4H4IA 3KXQA 3STEA 1HFBA 2YR1A 1IXNA 4LW7A 4HNUA 5HWNA 3TH6A 4ADSA 3CHVA 2E68A 1VS1A 3TSDA 5G1TA 1YLVA 4O0ZA 2GQ8A 3P60A 4JTKA 3GKFA 1LROA 5HMSA 2FPVA 5LHEA 4WZHA 1J2WA 6TIMA 1SQ7A 3QW4B 2ZZ2A 5KITA 2KZHA 3V1PA 2R91A 5K9XA 1XUZA 3RLUA 1TTIA 5D2XA 4O14A 4MYAA 1G67A 3P8JA 1O5XA 2C19A 1F73A 5FF3A 1EEPA 5HUOA 3SY5A 5CSRA 3B06A 4N4PA 1ME7A 1G6CA 4FXRA 4LT9A 3NQCA 4WXYA 2QF7A 1C8VA 1LOQA 4FIQA 2B7OA 2J9YA 1FWWA 3TW6A 1YTDA 3GIYA 4NXSA 3W1QA 1EP2A 5LNRA 1T99A 2HS8A 3SGUA 4M5PA 3HGRA 1KLZA 3QH2A 4HN4A 2ISSA 1TPB1 4JTJA 2PURA 2QEZA 1DKWA 1XDLA 4BI6A 2VKZG 1TPVA 4Y90A 2Q3OA 1YPFA 1F76A 1BKSA 1U83A 4LTSA 4LS0A 3W87A 4M7TA 4LUJA 4AHQA 1GOXA 5C5YA 3P8IA 3GNNA 4JTIA 1I2PA 1UUMA 4Y96A 2XN0A 1N8FA 2A85A 1X6UA 2ZYFA 3G3DA 1X1ZA 1W54A 2GQ9A 1R2RA 5D03A 1LLWA 1IIHA 3BGJA 2ZRYA 4DELA 1LOLA 3BV4A 2PC4A 1EP1A 2ZTKA 3LI1A 3DHDA 5BNKA 2WJZA 1I2RA 2E6FA 3NL3A 2GUUA 4CNPA 3DU0A 4IMEA 3IIOA 5F4WA 3MO7A 4NJKA 1AW5A 1KTBA 1LOSA 4JTEA 5G4WA 2CZFA 2X1RA 3PBWA 5K9CA 1SW3A 4X2RA 2QAFA 5K4ZA 3TUUA 5D2TA 2GVLA 4O52A 2BWGA 3S0CA 3LM7A 4HNVA 1H1YA 4FEZA 5MHBA 4UNLA 4E38A 4EIVA 3W7NA 1GVOA 1I8JA 1MZHA 5DCBA 2V8ZA 2E5BA 3TQVA 1PV8A 4UMCA 3KOFA 3W23A 3UZ5A 3DI0A 4TR9A 3W85A 3LTYA 4UR8A 1TREA 1VLWA 2H90A 1LRNA 3IIVA 1JULA 3O8AA 4CLMA 1OFPA 3Q37A 3LV5A 2A6LA 2Y70A 1W5OA 2DZTA 4RJEA 2G96A 3WJYA 4MFEA 4EWND 3LERA 4AWTA 4BR1A 4JX4A 3UWQA 2G95A 3IVSA 1VYSX 3N34A 3O05A 3FLUA 3TFCA 5KSWA 1BWLA 3VCRA 2E6DA 3KVMA 4Q4KA 1VZWA 4FB7A 3W7JA 3E9AA 3DFPA 2FFCA 4N9DA 3G0XA 1ZENA 1EUNA 2X2GA 3GXTA 4DBDA 1S5VA 3SI9A 2V2DA 3W07A 4QJ1A 3RFAA 4LC6A 2ZBTA 1OFRA 3ATYA 2V5BA 3EKLA 1F6KA 3W7GA 4AF0A 1V5XA 1OF6A 2FPYA 2NXIA 2VEMA 3QJAA 4LS2A 4ZQOA 3WK1A 1H62A 1OK6A 1SW0A 3T55A 1TPUA 3QPZA 3EXTA 2Y62A 4TIMA 4HSNA 3RF9A 3W7KA 2ZZ7A 1PHQA 1W1ZA 4FNUA 2OT1A 1DQXA 1QOQA 3UY7A 1I2OA 3GXNA 4RZ4A 2OMAA 4XTDA 1PE1A 1YPIA 3TKFA 1JCJA 2VFIA 2NV2A 4YCOA 5I3JA 3IVTA 1TTJA 2RDWA 5KZMA 3OVQA 3MW7A 5TBOA 2Y7EA 5D2WA 1TV5A 2VFHA 4LS1A 3UWWA 3QRHA 1H61A 2ZZ5A 3OG3A 1R2TA 4O10A 2OCZA 4LRSA 2A7NA 4UTJA 2E77A 4PTNA 4AHPA 1EB3A 1K7FA 3MHGA 2GVGA 1F6PA 2NX1A 3LHTA 5LGXA 1Y0EA 2ZFAA 4I7VA 4L4MA 3P84A 2YCEA 3TXZA 5HNRA 2V81A 3SFKA 4BI7A 3BW2A 3IGXA 1PHWA 4NNCA 3N9SA 4XBSA 5L9FA 4UXDA 3A5FA 3CWOX 1ALDA 1TPC1 1XBZA 2R8WA 4JGDA 1OG0A 3E0IA 4XZ9A 4EOUA 2ISWA 5BMWA 3FKRA 4FNRA 1YTKA 1ICSA 1S5WA 1XBXA 1GT8A 3MWAA 1KM1A 1ICPA 5D04C 2TPSA 1GVQA 1TPH1 5HR6A 3NAVA 5KZDA 3V75A 3MP3A 1GG0A 2VXNA 2NLIA 4JX5A 3I65A 4JYFA 4BK9A 3EX3A 3G0SA 1FWTA 1RD5A 3TROA 3HG2A 5I3GA 1Z41A 3U6WA 3W70A 5CZ0A 1I2NA 3KVLA 4GUIA 5G2HA 4ORMA 1FCVA 3C2RA 1YYAA 2EHHA 5F2MA 1TQXA 1TO3A 2PRHA 2C13A 1Q6LA 1SO6A 2H8ZA 3BG9A 4JY8A 3W1XA 5AFDA 4UTKA 4LNYA 3GK0A 4NZFA 3I6RA 3LRLA 3FJLA 3GXPA 5FF2A 4R33A 3NQFA 1JCMP 3PAJA 4JTLA 1MEIA 4K6AA 4MKNA 3M16A 4IX2A 4KWVA 4NU7A 3S5NA 3UD6A 3FS2A 1H7XA 3SGZA 3GDKA 3O07A 2ATSA 2A1YA 1VHCA 4IXHA 1Q6OA 3ABOA 3DKLA 3WFAA 1G4EA 2Z1BA 3NVTA 1IGSA 5FF4A 3IGSA 2TMDA 3GB6A 5DXYA 4YCPA 1XM3A 1NSJA 3HGSA 4HNTA 4UFHA 3KFTA
chains in the Genus database with same CATH superfamily
4K8EA 4IMFA 2PTDA 4H9VA 5DBUA 3WX7A 1IGWA 1ESWA 3DG3A 1VEOA 3TP4A 4HA0A 2D23A 2POZA 5FEZA 2WBGA 4H6KA 3L12A 1SZEA 3Q45A 4BF7A 4AIOA 4JNYA 5CEWA 4ZB2A 3PUEA 3F7JA 3L4VA 4L4LA 3T08A 3T78A 4EK7A 5HQMA 2IPGA 3VDHA 5JIPA 3Q67A 3W9ZA 3I6TA 3QV9A 1H7WA 2DQXA 1VH7A 1MDRA 1VKFA 1XS2A 1SSGA 2XH4A 1U5HA 4C90A 1VCGA 5MF5A 1IZCA 1BYDA 1IR1A 2NQ5A 2BY3A 4A22A 4U28A 3QV8A 2XVLA 5HWMA 4XKMA 2DT1A 4UFJA 1XFCA 4F9JA 2A7PA 5LNUA 3USBA 4PA8A 3O6AA 1V6XA 2XIBA 2QUUA 3BLKA 3S2NA 1UASA 4CN4A 1ITXA 3II1A 4RPQA 2XIIA 3A13A 5F1UA 2ZX9A 3GXMA 3KOWA 4YVXA 3CGTA 5U4NA 5FSEC 1XCFA 3U5YA 4XD6A 2Y5SA 3UPMA 3QV6A 3QW3A 3U8GA 4AIEA 2E1DA 1FY6A 4Q8QA 4FI4A 1E5JA 1WA3A 4GCAA 2QLYA 2I17A 4ZQRA 4EANA 3KLLA 2P50A 2PGEA 3CPRA 5LXEA 1W3IA 4RDVA 1UA3A 3QM3A 2O0TA 4FLSA 1DVJA 1E71M 3WELA 5KEZA 1E0UA 1OFOA 3URQA 2WQPA 1EGVA 1Q4WA 1LORA 2CXEA 1ISVA 4DYEA 1TIWA 1EJXC 4PMDA 2OSYA 1W1VA 3P80A 2PS2A 2XM1A 2EGZA 4LYRA 3BW3A 3BANA 2E6AA 3B8UA 5FF7A 2CKRA 2QCDA 3LXCA 2Y85A 1CXLA 2X30A 5LGZA 5HNTA 4RKAA 5IHRA 2YZ5A 3VIMA 3HF3A 4Q4SA 4XO6A 2E28A 4M82A 5BU9A 3S9ZA 3IJQA 2VEIA 3K30A 3UG3A 4MDPA 3H23A 2PD9A 2NT1A 3DGBA 1L8PA 1TX0A 3AIEA 1PB0A 2C0HA 3C3UA 2RDTA 3ORWA 5BCAA 3CUHA 1FWCC 1XIGA 3GNPA 5HMEA 2YBTA 4DUOA 1TPFA 4A35A 4R53A 4HB7A 1YDVA 1PZ3A 1QI4A 1KXHA 2VZTA 3P14A 1FQ0A 1M03A 1S38A 2VMFA 2ZZ6A 4W87A 1EDGA 1V7YA 2ZWZA 2F6UA 4NIRA 3CPGA 2Y5EA 4Y8EA 3CIVA 5CBBA 2PCQA 3STCA 1UQYA 1QI0A 1PX3A 3M0MA 2DT0A 2QCMA 3IWPA 3SN1A 2ZXBA 4LCSA 4O8RA 3VGFA 3PZNA 1H63A 1UR0A 3ALGA 3EMZA 1MSSA 3AHZA 2ZZ4A 1W1B1 1EPXA 3PUDA 1X39A 2GSEA 2PWEA 3PTKA 4LV4A 2IPFA 3GVGA 5BRQA 1EJUC 1KWGA 5H2ZA 3C86A 4OT7A 2F2KA 2YDRA 1PTDA 3QZAA 4I9AA 5A6TC 2FGZA 1JRBA 4B9ZA 3OA5A 2PWGA 1LRQA 1QO5A 4MM1A 1L6GA 2XIJA 3BAKA 1KXQA 3EX2A 3LB0A 3HN3A 1R3WA 1JCNA 1R86A 2GGHA 3FA3A 3Q94A 1TJRA 2J9XA 1KM3A 2VDHA 4CCZA 1U22A 1UR9A 4AVNA 3VMPA 4MJMA 4WKFA 4JIRA 3POCA 3U5UA 4QG6A 2BOGX 3WH9A 2HXTA 2J88A 5DXXA 3EPMA 1FHUA 1PX4A 4ZO8A 4JYEA 1AUSL 2HROA 5J8LA 5F4SA 4ZO6A 2KX9A 3I6EA 2DQWA 2J7CA 1VEPA 3NQVA 3OIXA 1JQVA 2QDEA 4S3DA 1XIBA 2OX4A 2WC4A 1GORA 4WY0A 4HU0A 2J7DA 1DHPA 4U5IA 1EJTC 4ZO7A 3R6IA 3W74A 2HPIA 4RK8A 3MSYA 3CZJA 4ML4A 4PTVA 3CZEA 2FQIA 3ZR4A 3DFSA 4M6VA 4C6PA 4S3BA 3GNOA 2PC8A 2YGYA 5G5IA 4GXWA 1MW0A 4JCMA 1E9ZB 1S1PA 1THFD 2WSQA 5D2YA 1WDSA 3UZJA 3B8TA 1AG1O 1VIZA 2NT0A 5I3IA 1XLFA 1PSCA 2WSKA 3E0VA 3JZUA 3M64A 4C91A 4JEJA 4UTUA 1SW7A 1KM4A 4AVFA 2C6QA 5ECVA 4DYKA 4Q8WA 4HVXA 4S23A 4HHPA 2V82A 4G7FA 4BQ5A 3IIZA 3L5MA 2BODX 1NF0A 2OQYA 4V2XA 5HUPA 4GD0A 3SEPA 1G69A 2X2YA 1F07A 1SFLA 2RAGA 3APTA 2RKXA 3B9OA 3NSNA 5D37A 4CCDA 1BKHA 4GXMA 1GEQA 1M6JA 2G5WA 3CV7A 4GUJA 4JTFA 4O18A 3V4BA 1FWGC 1ISXA 3G1YA 1LF1A 3GHTA 3OVPA 4CNNA 1UP3A 1DWFM 2REQA 4GJIA 1JD9A 3GZ3A 3SGGA 1HTIA 3O0KA 1ZZMA 4Z1DA 3SECA 5A8NA 2QPUA 1GVIA 5CC7A 1TWZA 3ANYA 3GVWA 4N6EA 2QCFA 4NX0A 2QCCA 3W7HA 1P1XA 2JBMA 5AHFA 1GJUA 4MGGA 1NH6A 3AIUA 3FVMA 2QIWA 4M81A 3NOEA 2PGFA 3BURA 3WDPP 4GJJA 4GCXA 5CKSA 5GNZA 1H1ZA 2ZC8A 3G8RA 1WUFA 4QAIA 1GWJA 3NEVA 4Q6JA 4OWGA 1Q6GA 3V5FA 3EDJA 3OZOA 4KIRA 5I6SA 3M47A 5BOFA 1X1OA 3TSBA 3PN8A 2DP3A 1VYRA 3A5VA 1FHLA 1QI3A 3ZIZA 1EUAA 3CWHA 3C2VA 3B97A 3WNKA 4TVUA 3H54A 3I7SA 3SY8A 3IUDA 4C6BA 1BYBA 1EX5A 2J7BA 2ZRZA 3GM8A 1VFMA 1JCTA 3KL0A 5K3VA 1UD3A 1BHGA 2VRJA 1D3HA 1EC7A 1EO5A 1W9XA 4JXCA 1G01A 2X0YA 4DO4A 2VFFA 4LX4A 3NQMA 4TV5A 4OV9A 1QO2A 1ZALA 1VBJA 4NZJA 1RUSA 3IPWA 5AYZA 4Q8TA 4LVFA 3THQA 5LA2A 4JQ3A 1NIUA 1OBAA 1FWFC 3UW6A 1KGWA 1VCVA 1R5YA 4L4OA 1CGXA 4JFUA 1AZ2A 4QDPA 3BK0A 5DFAA 3UCCA 3LGEA 2EG8A 4TTUA 2OLSA 3W84A 2C1IA 3W83A 3M0KA 3ARXA 4OBTA 4JS3A 2PDQA 4OBSA 2ZE0A 2XFRA 5DN1A 4YJ5A 2E6YA 1JAKA 1B9BA 1RR2A 1S1RA 3GTIA 3F03K 2Z7GA 1S39A 3VNKA 4KIEA 3SDOA 2ZZ1A 4YTRA 1TWSA 1P1MA 4IXXA 1MXGA 3FKKA 3DYPA 3EOUA 4PMUA 1BD0A 2BMBA 2VR4A 3VIOA 1HKMA 4US5A 3TJLA 1JFXA 4ZL1A 1GPFA 3BO9A 3M9YA 2NX3A 3FFSA 4NYUA 2OLAA 1WAUA 1FFQA 4DPQA 2JIEA 1NELA 4IIDA 1A5UA 2YXGA 3PJTA 3MI2A 3WJWA 2Z00A 2INZA 4IPJA 1WZMA 1GQJA 1QBBA 1E3XA 3L2LA 4L9YA 3DEQA 3SZ8A 1PIGA 2ZC1A 2HBVA 4UUIA 4ICNA 1C7TA 3E2VA 4UTLA 3HV9A 4CQBA 3TIMA 3UWYA 1J5TA 1JF6A 3QY6A 4UB9A 5E9XA 1RK5A 3I68A 3IARA 4US6A 4MHBA 2ZOXA 3VCCA 2JFEX 5I5RA 1TVNA 2YDQA 5DLCA 1EJVC 3ARPA 3KBWA 4UTHA 1UIOA 2CESA 2J75A 3A4JA 4B2DA 4B4HA 4CQDA 4N9EA 1EZ2A 2HISA 3ZJ7A 1A5NC 2YDAA 1A4LA 1ONXA 4UBPC 3WJZA 4J27A 5AC5A 4LSBA 1NAL1 4DX3A 2CLMA 3QQWA 3KCLA 4K8GA 2Z24A 1MMFA 3KAOA 1POJA 4FXSA 1CBGA 1FFRA 2CYGA 4AD5A 4Q4QA 1AH0A 4GVIA 4DWSB 3NVDA 1GVEA 2Z1XA 4S3FA 4PRTA 2CKSA 5FA5A 5CPOA 1D7FA 1MRQA 3HMJG 1JUKA 1QPOA 5GJNA 1PWMA 3AS1A 2DUAA 5D9PA 1KRCC 2MUCA 1E0WA 4BQ4A 1QPQA 2XIMA 3LCLA 3KOXA 4GC4A 3F4CA 4AYGA 1YEYA 4KFPA 4AC7C 3MMTA 5KTLA 4Q33A 1BYCA 2XTKA 1WDRA 1XIJA 3VE9A 2ACUA 1EZWA 4UR9A 4PUDA 3GTNA 3B0PA 1A5KC 3KZSA 1XIDA 2CCRA 5IBXC 4ACZB 2BGQA 2IXVA 1PYFA 2ZX6A 1MEWA 2HTMA 3E12A 2YFOA 3S46A 1U33A 1NM9A 1JXKA 2I16A 3DFOA 1H3GA 2PDWA 3VCNA 1ITUA 3RG6A 2VELA 1CWYA 4MLJA 1NARA 1O95A 3TW7A 3EA1A 1ZL1A 1OX4A 2Z1WA 3DI1A 4WDWA 3DHFA 2PUZA 1V0MA 1R3YA 3W6YA 1V77A 3C2OA 5A8OA 1F9CA 1MFUA 1KNWA 3SFWA 2QHAA 1UH2A 3WLLA 2GQAA 2UY5A 4B92A 5B80A 2WNZA 3BICA 1WXJA 4LY4A 2TSYA 3NDZA 3K5XA 3GQYA 5CC3A 3WNNA 3G1SA 3QR1A 5TQLA 4AZHA 1FHVA 1RY8A 1G4SA 3TCEA 4LUIA 3AOFA 1TTQA 3HIJA 1H4PA 3CB3A 3OGSA 2WNNA 1GYLA 4KGJA 2E1WA 3N3TA 1FHDA 1MVYA 4IMDA 3TMLA 4PTWA 1KD0A 2ZRXA 2IS7A 4TX9A 4DN1A 2A0NA 3VKKA 4K36A 1F3XA 5ENLA 5E0KA 4L64A 3M0JA 1V3LA 3APGA 1LQAA 2OGJA 1KV5A 3LLFA 1SZFA 4TU1A 3H55A 1OFQA 3N3MA 3NJ3A 5CAHA 2FFIA 1AFSA 1KQZA 2EF9A 4QS6A 1QK2A 2J25A 4AIUA 3NO5A 3G1FA 1BQCA 3NQEA 4Z1BA 3CM4A 2YL5A 3GY1A 1V03A 4KT2A 4JFSA 3ITGA 5HAOA 1EDTA 1K6WA 2FB2A 2NX9A 1XIMA 4ILSA 4P7NA 3W73A 4C6LA 2G3MA 2ON3A 2EPMX 2NLYA 1HJUA 1ZFJA 2PP3A 2ZVIA 2X7VA 4GKLA 3W1PA 1TZ7A 1WCGA 2ZA1A 3WBXA 4TVDA 3PFMA 4FR1A 1UJPA 3QR0A 5HULA 4S2CA 1XG3A 1SSDA 3NDOA 4MWAD 3QVQA 4ZCWA 4KEUA 1DJGA 3MWCA 3S1WA 2PLKA 2FDMA 3RR4A 1V6UA 4FX7A 1KKOA 3R79A 1I0DA 1NWTA 1OGGA 4E8CA 1NP2A 4DWSA 2PI6A 4C6NA 3T4CA 1UBPC 3UJRA 1M7XA 2B7QA 4U10A 3MO4A 4GG9A 1F2JA 4UQEA 1SFTA 2GOUA 3IACA 1W1IE 4LYQA 2V3FA 3TW9A 3ZJKA 3UJEA 1I1XA 2AMXA 5REQA 4AD4A 1T8QA 1JDEA 1B0IA 3UZYA 2VQUA 5BXPA 4ZQCA 3W1NA 3QGVA 3GO2A 1FTXA 1VYPX 2IKJA 3THDA 3ZZ1A 3HO8A 1JZ6A 2YB1A 1J0ZA 4KCTA 3SUTA 5A69A 2VEKA 2NUYA 3MUZ1 1MO0A 3S8HA 1KCZA 4IH3A 1GYMA 3BQ6A 4V28A 1ZQ5A 5CBJA 2WM1A 3MSRA 4I6KA 1JGMA 3W1LA 4JZ5A 2AQWA 4DJFA 5BW6A 2GGEA 4O1BA 1H5YA 1LWHA 4O1CA 4O19A 1XGDA 4OUIA 3R8GA 4QG9A 3B8IA 3P6LA 3LU2A 3GE7A 3UWVA 4ZOCA 3O63A 1PDZA 5HPCA 1Q63A 1UC5A 4H9TA 4Y9PA 1Q45A 2CZ5A 2PRLA 1GQIA 1J11A 2VI0A 3PF3A 5FEPA 4DEFA 4H6EA 1E4NA 3LMZA 3MVTA 2X40A 3EKGA 1NTHA 3KTSA 2DFAA 3EB2A 5CPQA 2GK1A 3NQ7A 3VPLA 1X96A 4XZIA 3CC1A 3ZOAA 2VFEA 3LHUA 3LSBA 4FNPA 3S83A 4FIRA 4HZ7A 4AF0B 4NNBA 2D1ZA 4K3ZA 2BSLA 1TVLA 4YHGA 3AXMA 1KFLA 2H3DA 4DJDA 2PDGA 3BMVA 2IPJA 1DE5A 3AYTA 4D2JA 4FALA 3LRKA 3W25A 3MTWA 1KLYA 1HKJA 3D46A 4UOZA 4O0KA 4KBXA 1ZCOA 3WK2A 4P2VA 2XVGA 4QJ3B 3WMCA 3P61A 2PP0A 3EWCA 3CLMA 2XPKA 2PPGA 1H1NA 3CQ0A 4FX8A 4PUNA 5I23A 3ZXWA 3FOKA 4W86A 2HZGA 2OQHA 1QR7A 1W8SA 1B4EA 2D2HA 4FPSA 3WDJA 2VD8A 4JY9A 4U4MA 4NT0A 2AAAA 3MMWA 3OPSA 2A3LA 1VFUA 4PMRA 4HPJA 2B7PA 1A0CA 3B9DA 1FWSA 1C93A 1DQUA 3SADA 4N02A 2O56A 4EE9A 1UROA 4RE3A 1NFPA 5LZLA 4DO7A 3CT2A 1GVRA 3ABQA 4IJBA 2ICSA 4GY0A 2ZUSA 4JTTA 1VGAA 3AMCA 1IV8A 2O4QA 3WQOA 3LPGA 1CGVA 1KFEA 3M44A 1NDZA 2DY3A 4AAJA 4UZSA 4D8LA 1J5SA 1A80A 1BWVA 3TTOA 1IQ8A 3PTDA 1EXBA 3G1AA 1FX6A 5JIWA 5I3FA 3MDUA 4C6EA 2H3BA 3OZPA 4PCFA 3HOJA 4QDMA 2Z29A 2V38A 3TJ4A 5F2GA 4GIYA 1OGBA 4RR4A 3A9IA 2W3ZA 1JZ4A 1K6AA 2ISFA 1KM6A 4MY8A 4HMDA 5H91A 3EYPA 4EACA 1JCXA 4Q3MA 1W5MA 1K8YA 3R13A 1VPXA 1U5VA 1W32A 4N6FA 3BCFA 1NU5A 1GTHA 3WFZA 2OB3A 3W72A 1Q7QA 1RP9A 4WDUA 5DO8A 5C9ZA 3W2KA 3T05A 1OZMA 3WLQA 4ZOEA 2B0MA 4E3VA 3S1UA 2CBVA 4CGTA 3GYEA 3MI6A 1Q2RA 2HVOA 5EY5A 1EC8A 3IJIA 3PHAA 4PMQA 1VJSA 7ODCA 4XO7A 5C9RA 2V3EA 2WVVB 1TV7A 4FMVA 3WF3A 1Y65A 2ESCA 2I57A 2XWEA 2BOFX 4LCRA 2P53A 4U33A 2EBNA 3NZQA 5HQLA 4H6RA 4UFLA 3SCQA 1QW7A 3UCDA 1Q65A 1GZGA 1JD7A 1G1YA 1QHPA 2VYOA 2YL9A 2PDHA 4PRRA 5M1TA 1VBUA 3P62A 1JZ8A 5CGMA 2FVLA 4KF1A 1BXBA 4M3PA 1NDVA 1O5KA 2YA1A 1GKRA 2PLMA 1EHAA 1TFVA 5A6BA 3AYVA 4IT1A 5I06A 3S2LA 1GVFA 4PMYA 4S2BA 4V15A 3BXWA 4AFYA 1S5MA 3RJYA 3KHJA 1Q6QA 2O9RA 3GSMA 2R94A 1UWUA 3LYEA 3BOXA 4H4IA 5DF0A 1LG1A 1IXNA 4LW7A 3WLMA 4HNUA 2OFJA 4GI4A 3CHVA 1E4LA 4LAKA 2EXOA 1VS1A 3TSDA 5EB8A 3P60A 4YWSA 5TD4A 4J35A 3ID7A 2FPVA 4W85A 4WZHA 3UZWA 2PDMA 3APYA 4WRHA 5I00A 4EXBA 2E0PA 2KZHA 2XFYA 5K9XA 1JYNA 4UQ9A 4A8RA 3D47A 3WNOA 4LGXA 2C19A 2YOCA 1A3WA 1P0DA 2BY1A 3TN3A 2PDIA 4Y9NA 3IJDA 1CNVA 2IUZA 2ACSA 2VZOA 1ME7A 4FXRA 5JVLA 3DHPA 1QHOA 3AXHA 4A4AA 1C8VA 2B7OA 3EDFA 3FDGA 1JI1A 1YTDA 3GIYA 4NXSA 4S3CA 3W1QA 4ZO9A 3QY7A 1QXLA 3LLXA 3M7SA 5LNRA 4NP7A 4PUWA 3FX4A 4X2PA 4DVOA 2ISSA 4K1GA 3ENLA 1UR3M 2XGBA 2PDBA 1DYSA 3RITA 4W84A 2QEZA 1EDQA 5GNYA 4BI6A 2VKZG 3TN6A 4HU8A 1TPVA 4RUBA 3T2PA 2HQAA 4MDOA 2QXWA 4LUJA 5C5YA 2MNRA 4TUFA 1X38A 3P8IA 3GXIA 4IQDA 5A8MA 3VOGA 1F8MA 1X1ZA 1GNXA 2GQ9A 2YDSA 2WHJA 4JTAA 3ARYA 1IIHA 3GNXA 1EP1A 2E9MA 2ZTKA 2D20A 2E6FA 1R0MA 3WLKX 3DU0A 1TJ0A 4IMEA 5G4WA 4D8ZA 4LQ1A 2CZFA 1RY0A 3PBWA 4KEZA 1SW3A 2QAFA 4N7QA 1Q8AA 4ZE5A 4M29A 4D9PA 3R0KA 3CYVA 3VGBA 3N4AA 3AHTA 1PV8A 3SN0A 5A94A 4TR9A 3Q65A 1Z89A 4L9XA 4UR8A 4C6IA 4Z17A 3NTYA 4GBDA 4AZCB 4I9JA 3PPFA 1JULA 1KKRA 3LV5A 2A6LA 2J47A 2VCAA 2BY0A 4ES4A 3WJYA 4EWND 1U1HA 4DM1A 2G95A 3SB0A 3T2OA 3AFBA 2CBUA 2VVNA 3KVMA 1XICA 3E9AA 3DFPA 1O1HA 4XZBA 1EUNA 3GXTA 1D7KA 4F48A 2QYGA 3RFAA 4B91A 3GD6A 4ZFMA 3EKLA 1E3ZA 1XLCA 3NZPA 4H8NA 2ZX8A 1V5XA 1OF6A 4E2OA 4XB3A 3WD4A 3JZEA 3QPEA 4LH8A 5C2GA 4ZSTA 3T55A 2XUCA 1A0EA 4ZTYA 1V08A 1P0BA 2Y62A 3LGDA 3XISA 3MUCA 3H22A 3S6OA 3GXNA 1MNZA 2ACRA 1PE1A 4CUCA 1TE6A 2RDWA 3MW7A 2VFHA 4EXQA 3U4FA 3T2QA 3OG3A 3VABA 3IRSA 3CUZA 1PAMA 2A7NA 4UTJA 2WM0A 7CGTA 1X8CA 2WMJA 1D3CA 3T8LA 3R0DA 3WFLA 2NX1A 3MC5A 1JPMA 5LGXA 2ZFAA 4I7VA 1KBLA 3P84A 3W38A 2JF7A 5LIYX 3TXZA 5HNRA 3SFKA 3IGXA 1PHWA 1UR1A 4C5ZA 1XIFA 4XBSA 5L9FA 2MANA 3A5FA 2PWDA 3CWOX 2EPLX 3GG1A 1XRFA 1XBZA 1QNOA 2Y0FA 2J79A 4EOUA 4XIMA 1ICSA 1J0YA 1S5WA 5GQBA 4Z2JA 3PJXA 5A8QA 1WB0A 1TPH1 3DYOA 5BU6A 2FJUB 3UT0A 2XJ7A 1E72M 3V75A 2WCGA 2AL2B 1E6SM 3LMYA 3G0SA 4XVEA 3TROA 3UZXA 2PLCA 3WLNA 4Q8MA 2X42A 4GYFA 2HBXA 1XRTA 1I2NA 4D72A 5G2HA 4HCDA 1FCVA 1IEVA 1XF0A 3C2RA 4J1OA 1YYAA 2EHHA 1TQXA 2PDLA 5FL1A 2PRHA 3HZ3A 5FJJA 1DWGM 1Q6LA 1E9YB 2H8ZA 4FLOA 5AFDA 1REQB 4NZFA 3LRLA 3FJLA 3GXPA 3NQFA 3PAJA 2BHUA 5JUVA 4KWVA 1UWTA 2CHOA 4RW5A 3DC0A 4IXHA 3WFAA 1G4EA 2Z1BA 2TMDA 3GB6A 1NSJA 3HGSA 1JXJA 3KWSA 1IXQA 1H49A 2WC3A 3KZPA 2XGIA 4INFA 4YN5A 2A7RA 1C9DA 2YBVA 3K1GA 2D0GA 2D69A 2XZ9A 4R5EA 3BLIA 4B16A 2C7FA 2C3ZA 2PFHA 3H2CA 1BGAA 4UOQA 3BSGA 3S4TA 2REQB 4WR3A 1L6SA 1LQ0A 1YTEA 3VNJA 1UD8A 2QCEA 1UYQA 1R7OA 4HMNA 3FEMA 4H6QA 1WAWA 4PN2A 1C90A 1S46A 4GH3A 3DAQA 1UD4A 3C3NA 1EH9A 1K03A 3M5YA 4D6GA 4BS0A 4GQRA 2GUBA 4LAUA 4O4VA 1BAGA 1T40A 3E3HA 3MJMA 1K02A 1K7XA 4RNIA 3JRKA 4ADTA 1R6WA 4ROQA 1CEOA 2HMCA 4R7OA 1SM9A 1QW8A 2GJNA 3LI0A 3ZLFA 1OIFA 1SR0A 1UB3A 5E93A 3UPWA 4YWIA 1CI1A 4GNJA 6CGTA 2VGBA 3M07A 1DE6A 4GYKA 3WMBA 4HNOA 4GACA 3L2IA 4FP1A 5CPMA 2ALRA 4H41A 1W3KA 5A6MA 2DZWA 2RH9A 1S2CA 2CPUA 5HJXA 1TYGA 3AYSA 3LS9A 1JPKA 4AXNA 5DCDA 4NXKA 1GPWA 2VDIA 3UGRA 3QC0A 2WV8A 2YCIX 1G94A 4WSJA 1OX6A 2CW6A 5GNXA 1PVNA 3WQPA 1QT1A 3S9IA 1W31A 1P7TA 3WF1A 4DWSC 5HXMA 3JW7A 4PODA 2G37A 1XYFA 3VOIA 4K7VA 2YW3A 5DMMA 1W3JA 1SMDA 1NFBA 1DIOA 1J6OA 3LXAA 6A3HA 2QDDA 5IFTA 1GJPA 3A4AA 5RUBA 2PGWA 4ZGYA 3QC3A 3W1AA 4EVZA 1XBYA 2O92A 3I3BA 4M6PA 4R9OA 2XSBA 4IP7A 3F2DA 4M6UA 2VJXA 2ZUNA 1TUXA 1LLZA 1HKKA 1HVQA 1F6YA 3M5ZA 4N9CA 2Z27A 1XC4A 5IFPA 4K37A 4M8UA 1IIGA 1CX9A 3ES7A 4QNEA 2WKJA 1YDNA 2XM2A 1JL8A 5ABFA 1DIKA 4E4PA 1FXQA 3DFQA 4RDWA 4AY8A 3N2TA 2Z28A 1FWHC 2QMJA 3W24A 3VXGA 5K7JA 3VKBA 3RLGA 1OFDA 3HJZA 4DXKA 1TCDA 4UMAA 3LCGA 4IMGA 1TZ9A 5AYXA 3PZIA 2RDXA 3OJGA 2H9AB 3UEQA 1MYRA 1AD4A 3DUGA 3L9CA 2XN1A 2GOKA 1XSKA 4IOTA 4FXJA 2CXGA 3W2LA 4F0MA 2A4AA 4JBRA 2GPTA 5G2WA 1R30A 1JPIA 2ZRUA 1XRVA 3H2AA 5LNWA 1G4PA 1VQTA 2X0HA 2AOSA 5I79A 2GVJA 4Q7IA 1W6TA 1H5VA 5DT7A 3WQGA 4RNFA 2JEQA 3C56A 4S1FA 3ANVA 3A4XA 4PH6A 2QVHA 3RIKA 2HWGA 1QAPA 1H7RA 1QATA 2WMIB 4GWEA 1R3TA 3U9IA 4RXFA 1TJ1A 1J4EA 4CVWA 1H41A 2YL8A 1QW9A 4TMBA 1Q6FA 3VDAA 4IUGA 4O50A 5HPOA 5T9CE 3OEXA 3M41A 3AALA 1WKYA 1JJKA 4QBXA 4MIMA 3K13A 2DIKA 3CAQA 3U2EA 3F4DA 3I7RA 4UTTA 3E74A 2OZTA 1QVBA 3TYBA 4UR7A 2FTYA 4JQ2A 1ZJBA 3EWXA 2BXVA 4F0SA 4ERIA 4AWSA 4L61A 1IT0A 1GW9A 1IR2A 2R1NA 1TKKA 3WH5A 5CJ5A 3M43A 3G6MA 4C5YA 1UKQA 8A3HA 4D6CA 4ATLA 5CZSA 1G7VA 4OZOA 3TK7A 1TX2A 1QCWA 4NAEA 3CEPA 1ZBKA 3E02A 1S2WA 1KRMA 3BGAA 2YCKX 2WC7A 3WJSA 1P5BA 1DTUA 3IIPA 3ARQA 4MKVA 2BGNE 5CSUA 4ICCX 3IAPA 3Q58A 3NUKA 3VFCA 1TMQA 1B3VA 1XR2A 3QLLA 1HO4A 4XG1A 3WEMA 3B9AA 1GQKA 3VM5A 4PCTA 2Z1VA 3MCOA 4W9TA 3NPVA 1JZ3A 3DKJA 1KTNA 4UCGA 4PUJA 1RV8A 4MPKA 3CHFA 2VL4A 3TLLA 1V6YA 1JDCA 2BHZA 5JXQA 2UBPC 3W00A 1GG1A 3A4WA 4KMQA 3W7PA 5AC6A 4DJDC 5A6LA 3DFYA 4ALDA 3HQ1A 2B81A 2PBGA 2OWXA 4P7LA 3D6NA 4DIAA 4IMAA 2ZUTA 1O5RA 3QXBA 4HBKA 1UKPA 2CEQA 3ALFA 4X9SA 1J96A 1HL9A 1GJWA 1PDYA 5JBEA 2PDYA 2PDKA 3WLOA 4W8BA 3GDTA 1Q6RA 4MVAA 5D8ZA 2PB1A 2NQLA 5A6KA 2CITA 4R3UA 3TOYA 1K9EA 1F7BA 2ZXDA 1AJ2A 3H4WA 4GXPA 4FK9A 1QWGA 3W7EA 4OHQA 3WMSA 3FYOA 1MEHA 5ABGA 3L5LA 4GNKB 5AN7A 3OIHA 1S3TC 2Y5JA 3CS2A 2F7FA 1BVZA 2VX4A 3RYSA 3DXIA 1NJJA 4S38A 3TTYA 1U30A 3LOTA 1F5ZA 4MJZA 1BVNP 2XHYA 4UTMA 3MUIA 2DZSA 1J0HA 1SZRA 1HJQA 4H9XA 2HK0A 3UXLA 3AI0A 1OZQA 1R3SA 3TTQA 3L4WA 1GK8A 1POKA 4ZR8A 3P81A 3WDIA 2GGGA 3WN6A 4AD2A 4CQ8A 4H7VA 4MUPA 2EG7A 4IGHA 1M7OA 3PZTA 3DN5A 3G6LA 4CKQA 1KTCA 3KDOA 1E6RA 2Q71A 2X1SA 5FCZA 5EMUA 4ZODA 1H0GA 3HG3A 4ZVJA 4V1YA 3RMEA 3R43A 1TPWA 1DJQA 3H7VA 3GR4A 3R12A 4AY7A 4KGLA 1F4HA 3EEGA 3KRUA 2P3EA 2RDUA 4CCEA 4K7YA 5B7ZA 1P0EA 3OQ8A 2OXNA 2QJGA 3H2FA 3SQLA 1R8LA 1Z3NA 1DJYA 5M17A 2BG5A 3HQPA 4AD0A 5BYWA 4JIPA 5EPDA 3L5AA 3ZT5A 4NZ3A 1Z42A 3PZOA 4HTBA 1YNPA 1WOAA 1IXPA 1KO0A 3N6QA 1SZGA 1UD2A 1M9HA 3EWYA 1VPYA 1LUCB 3KTCA 2BS9A 1B3XA 1PJ9A 3QZEA 4DJEA 1X97A 1OC6A 1LT8A 1M53A 4MAZA 3DCPA 2W62A 4JL1A 2WZTA 1UCWA 4NX5A 7REQB 2XU2A 3KS6A 3HPZA 3MP5A 5HMDA 5D09A 3GXDA 4C6JA 3N2XA 4OJYA 1XYZA 4NYYA 3TC7A 1MI3A 4JEQA 1V3KA 2D3NA 2HPMA 3HFYA 2J24A 1UZHA 5DT5A 4YVVA 5CXPA 3CTLA 4GY1A 3RPDA 4EPBC 2DEPA 4Q4MA 1KR1A 1L9WA 5LNSA 2YW4A 3L2MA 4AUBA 3CLWA 5MKGA 4HK5A 1I45A 4J2MA 3O2LA 1OX4B 2YLAA 1CGUA 1ZJHA 4IIFA 3VM7A 2AAMA 3SN4A 2ANUA 2Z26A 4B3KA 3NPUA 4AZGA 1W1PA 3WLPA 1B2YA 5FJOA 1CGYA 3PZ9A 1TPEA 1W1YA 3S1XA 3BV7A 3KUMA 3S2JA 2C14A 4JDBA 1LTDA 4XSLA 3UU0A 4JR5A 3PULA 5EBUA 3R58A 3B9EA 2VFDA 4H7CA 1KFKA 4PUKA 3W2UA 1RVGA 5XIMA 3NM1A 4F0RA 4DB7A 4X22A 1R87A 4K38A 5C9WA 5J5RA 5D9OA 4HOZA 3QSTA 1J2BA 1OINA 4GGHA 4KRUA 4EF9A 4MTVA 1XCXA 4GYPA 2ZDRA 2QDGA 3MDWA 3ZJ8A 2FVMA 1F74A 1TSIA 4DO5A 1E4IA 3FSUA 1OYBA 4I8YA 3VMNA 4IUOA 4O1AA 1NEYA 3F5JA 1FXPA 3T07A 4XX6A 4O13A 2UWFA 1VCFA 2Z2AA 2QCDB 2XIOA 3PWIA 3LA4A 3C2EA 4ZB5A 2J62A 4MB4A 1PTGA 3FNDA 3MHUA 3GLCA 5J5DA 4MNJA 1OY0A 4CNSA 3AJXA 4OGZA 3GUGA 3KL5A 2EPOA 2R1LA 4DNMA 1YKWA 1BTMA 4HK6A 4RE2A 4IL2A 1NWUA 1HKVA 4Q32A 2OU4A 4GZEA 2L5HA 3MV11 4PTXA 3GYCA 1I2QA 3G77A 5FESA 5LHFA 3DHUA 3MHFA 4XD5A 3AIBA 1S3HA 4IF2A 4KWOA 3N9RA 3VUSA 4JIHA 2VEPA 2Y7DA 1W3TA 1LJYA 2F61A 1ICQA 4BY3A 4O28A 3SY1A 3LV6A 3T6CA 1EWDA 2R82A 4UFMA 3GHUA 2QCGA 3L4UA 2YCLB 2ABAA 3TSMA 2VNCA 1BVWA 1JYWA 3E49A 3BPWA 1RSCA 3P5ZA 1H7PA 1TTPA 5AY7A 3M0ZA 2TYSA 1YXCA 3WQVA 1EYEA 1KV8A 3VILA 4J2PA 5JH2A 3R89A 1A5OC 1FCUA 3VIFA 5I77A 1C29A 2BTMA 3HQOA 4ZQPA 9XIAA 2D73A 1OD0A 3MU7A 1IT7A 4C60A 1V3IA 3C8FA 2BBFA 3EKZA 1K9TA 4FHAA 2QUNA 1AL8A 3UA3A 1FDYA 4XD4A 1W3HA 2ODOA 1FBAA 5ABHA 7ENLA 2V9DA 1DBTA 3ZFHA 2DUZA 4G1NA 4HSOA 4TTGA 1LWIA 1CXIA 3SCRA 3U2CA 2VTFA 3ME3A 1XLJA 1OM0A 2EJ1A 1Q4NX 1XYLA 1EP3A 2EG6A 4X0NA 2CLLA 2DSWA 2AMGA 5M03A 1RBAA 1A50A 1J0IA 3NPXA 4MZYA 1GVSA 3C52A 4NJGA 4AZCA 3MT1A 3FAXA 1Q6DA 2WMIA 1SFSA 5GPRA 5U7SA 3OBEA 1WPCA 2ZX5A 2ZVRA 1HT6A 3P67A 3CB8A 4HZ6A 4WOZA 4LYKA 3UP8A 1E6QM 1BGGA 4P7RA 2YXOA 3A64A 3CL8A 4K1WA 3NQAA 3KWXA 5ABTA 3ITYA 3CZGA 5REQB 1B9ZA 1SJAA 4E6MA 1EC9A 2YA0A 3LDVA 4LPCA 4PFMA 4HJWA 4WKAA 1YDYA 2OZ3A 2W79A 4BZYA 1SUXA 3GS6A 5T26A 3UFYA 4M56A 1M41A 4C1KA 1FH7A 1HIZA 1HP5A 4WHBA 3URBA 1VIWA 2G41A 1MNSA 1P43A 3UA4A 2YCJA 3LQLA 4BWLA 1V51A 3T8QA 4J5NA 3TEVA 2JIWA 4LV9A 2FZDA 1EQPA 4DXVA 5EGRA 1NVMA 1PZ2A 4JICA 3OTRA 2AGTA 2OT0A 1BG4A 1LL7A 3IJ6A 1UJQA 5AYYA 5I0DA 5AVNA 3VNMA 2EJAA 4QXIA 3VZZA 1A5SA 1QOPA 2AQVA 3VOHA 4IJCA 2QMKA 3N29A 1ZAJA 2V68A 4AMCA 5JH1A 1VAHA 1XGZA 3C0QA 3G8EA 4UFKA 5G1YA 5IHSA 1PZ1A 1JZ2A 5DY2A 1DEDA 1JEZA 4NJJA 2OGYA 5C8BB 2JKAA 3EB3A 2P8BA 4CNTA 2OOGA 3TCSA 4DUVA 2XFWA 3B8VA 1ZP3A 3VA8A 1UH4A 3HQNA 1J93A 3T0AA 1KGUA 3OVRA 4GHRA 3GFXA 3AMKA 5A8GA 4J9JA 4AISA 4HA3A 1O94A 2NQJA 3AXKA 3BLOA 3NSMA 1XISA 5PTDA 1HKWA 1V93A 3QR3A 1B4KA 4NZ4A 2DUXA 4F0KA 3PANA 4UQDA 4WY0F 3CZ8A 3VGEA 3O16A 2DZPA 1WZKA 4K68A 4A21A 3PWAA 3RAOA 1US0A 1EYWA 1ZJAA 1RPXA 3HPFA 2EPKX 3C5QA 3NYZA 1SYTA 2P1FA 3P82A 1OC7A 1NOFA 3F5KA 2Y89A 4H7ZA 3C0SA 3ITXA 1RLDA 1UWAA 5FOOA 1DORA 1SU5A 4GNVA 3PP7A 4K8HA 1E0XA 4QIUA 3OA3A 3O7UA 2ZA3A 2ASHA 4G2DA 2J4GA 4WSHA 2A3HA 3WY1A 2AKZA 4LEQA 4O12A 3M4HA 3OP2A 2VC9A 4U5KA 1KGXA 2V5JA 1ZS2A 4GLEA 2ZICA 2FGLA 3Q2DA 3R5EA 1CB7B 4NNAA 3WLJA 1PX8A 4YTUA 3OO2A 4ACZA 5DMLA 3STGA 1SZNA 4WX2A 5BXTA 1ISZA 2G50A 4RXGA 3E2RA 1TWWA 3SCWA 2VZSA 4M0XA 3UR5A 3L0GA 4LB3A 2PRMA 4D1IA 1CYGA 1UP0A 1OG6A 2W5FA 4WGXA 3LPFA 3E0LA 4TQTA 2RFGA 2WZEA 3BOLA 3RM4A 3WF0A 2IQTA 3PZUA 3QTGA 3GFZA 1W9UA 1SO4A 2NVDA 3V3WA 3BGGA 1UQZA 3EWBX 4GPNA 3HA1A 1Z44A 2ZZ3A 2J78A 4PL1A 3ARWA 2PWFA 4MADA 1GCYA 4UNIA 1I9CB 3SURA 2GWNA 1SR9A 5I3KA 4C1LA 3VIPA 4O17A 4MB1A 4ZOBA 1JG9A 2NQZA 2WNWA 3PG8A 1GZ1A 1CXHA 4XZWA 2QULA 3WQDA 3KVKA 1KCLA 4PCSA 1H7NA 4OVXA 1DJXA 1G7UA 1QI2A 3BJFA 4NAFA 3M0VA 4LUTB 1WBJA 1YDOA 2V63A 2V5LA 5AC7A 5HA7A 2JKPA 5JU6A 4GA8A 4S3GA 2Q01A 1Q5MA 3AXIA 2VQTA 1VP5A 3QFWA 2GYIA 2JGQA 1JQXA 4NZ5A 3U48A 2DVXA 1DHKA 2D24A 3BZJA 3NR0A 4GRSA 1N7KA 3GH4A 1B3YA 2BZNA 4YL2A 2B4GA 4UC5A 1ZAHA 4IMCA 4GGBA 4EXAA 2UY4A 3OYXA 2WSPA 3OLDA 1DPMA 2HVNA 3POHA 1CTNA 3DESA 3TR9A 4QITA 3N73A 1W0MA 1WOBA 5KMYA 1DJHA 4JFVA 1BG9A 3NQBA 2NXGA 5K2ZA 2VCBA 1XL9A 3UVIA 1HO1A 1O68A 4GK8A 2XH0A 2Q8ZA 3COTA 1HGYA 4QE1A 3FXYA 3MVIA 1GGOA 4QNWA 4X0VA 3TC3A 3PK7A 4WJ8A 3CUJA 3G24A 4Z2GA 3EOOA 2NVCA 3VX0A 4L4PA 1LBMA 4YMZA 2Y61A 2DZBA 4AX7A 3VNIA 3BMWA 3ONCA 1MFVA 1PYMA 4H9YA 2E9LA 2A79A 3RHGA 4FAMA 2YBUA 4OKDA 4F0HA 1HL8A 3VD5A 2CLKA 2OZ8A 1C92A 1W1A1 3KVJA 3PS7A 5EFDA 3GUWA 3OLEA 3PC0A 1IXOA 3EXRA 1K4GA 3R2GA 2WSRA 3VNYA 4DXXA 4E5TA 4PMNA 3HPXA 2PDJA 3G1VA 5DMYA 3STEA 2YR1A 1C8YA 1V3HA 2E68A 1J8VA 1Y8BA 3FHQA 1W2PA 3GKFA 3AYRA 2YCLA 4DM2A 4AZBA 1J2WA 6TIMA 4F66A 1PEZA 4GY7A 5HATA 1Z6KA 1GKPA 2VUYA 1BSIA 1YHTA 1FVPA 5KITA 2WXDM 4AQLA 2R91A 3ZR6A 3VVGA 1XUZA 3RLUA 3J7HA 5D2XA 1XLHA 2E67A 3BAWA 3P8JA 3O0FA 3ZMRA 3ONBA 4XBJA 1F73A 4NL1A 3CMJA 2GSJA 5HUOA 3SRFA 4IICA 3IK4A 3VAVA 1WUEA 2R24A 3B06A 1G6CA 4LT9A 1OCJA 5TNVA 1AD1A 3TTSA 4XK2A 1LOQA 3TWBA 1QUMA 3CASA 5LXXA 1NQ6A 5FIPA 1EKOA 1EP2A 3PJUA 3KP0A 1R3QA 4HHLA 3KBMA 3SSZA 4BHYA 4HN4A 5T9BG 1RJPA 1TPB1 1MW1A 1R7AA 1W1TA 3B0XA 3WNMA 4JTJA 4RPPA 4QP0A 3WUBA 6PTDA 1FA2A 3MUY1 2QUMA 1Q7MA 3B3DA 5T8GA 1CLVA 1NFGA 4D6EA 3GH7A 2WJDA 1UPPA 1M65A 1V79A 1OADA 1YPFA 1K8CA 3AS3A 4ZOAA 3W87A 2PDFA 5ABEA 1GOXA 3GNNA 5IOBA 3EOLA 5CQ1A 2R1KA 3KBJA 4QHRA 3WSUA 4A3YA 3JUGA 4Y96A 2XN0A 4E8DA 1N8FA 3WL1A 2A85A 2QJMA 1QASA 4LUTA 1X6UA 3TWAA 1E6NA 2ZYFA 2ZDSA 1CB2A 4NAFB 1CENA 5D03A 4EP8C 3BV4A 2R1PA 4XVDA 2WJZA 5CGTA 1IEWA 2GUUA 4HJFA 2CETA 2QGYA 3WQFA 5F4WA 4NJKA 2WYSA 1LOSA 1A3HA 3MKVA 3U7BA 3REQB 3QY8A 2X1RA 5K9CA 4BEQA 3T81A 5K4ZA 5D2TA 1GQLA 2A3EA 3S0CA 4FEZA 1L6FA 4E38A 4PBFA 3W7NA 3MB9A 1GVOA 3WLRA 3U7VA 4JKLA 2V8ZA 2ADAA 2F6KA 4GZIA 4I5RA 5CC6A 1ECQA 5BOEA 3LTYA 3VKDA 4IISA 1TREA 1VLWA 1CLKA 1E73M 2H90A 1HKIA 2GGJA 2W27A 3IIVA 4AEEA 1E6XM 5CC5A 4HA4A 4CLMA 1OFPA 1FWEC 3Q37A 2DZTA 2BP1A 4IP4A 4JX4A 3WD0A 4GI9A 3WH7A 3E0FA 3S2CA 3QBUA 3TFCA 3VCRA 1FWAC 2E6DA 8XIMA 1EQCA 3DECA 3OQEA 4H1ZA 3W7JA 4N9DA 3G0XA 5A3HA 1XH1A 3WNLA 1RVKA 2BY2A 2V2DA 2NSXA 4QJ1A 1GZJA 4LC6A 2VC7A 4JAWA 3ATYA 3ECQA 3W7GA 4FS9A 4RV3A 2NXIA 3R8HA 1NQKA 1XX1A 1ZSXA 1H62A 1SW0A 5D8WA 1T6MA 3BL3A 2CBJA 3RF9A 1G9HA 3LSCA 4FNUA 2OT1A 1DQXA 2Q6ZA 2VR2A 4GVGA 4S3AA 4RZ4A 5JBFA 2VFIA 3N2OA 5I3JA 1TTJA 5KZMA 3VDBA 2VHLA 4LS1A 4DHGA 1H61A 4O10A 3H8AA 2OCZA 4H9ZA 3AZSA 1QNSA 4ZEPA 1ADDA 3C8NA 4IPLA 4JPGA 4N42A 3UWEA 5C70A 1FKWA 2YCEA 4PB3A 3WDHA 1YW1A 3EDDA 4XIAA 4DAFA 1TPC1 4P7OA 3ISIX 1OG0A 3E0IA 4XZ9A 3FKRA 1W9PA 1YTKA 5A6SA 2E8YA 2XVPA 2Z25A 3EWDA 3FGCA 3OLIA 1ICPA 2GVYA 3ZVHB 2TPSA 1GVQA 3ARSA 2HCVA 5GJPA 4IQEA 3R7MA 4KESA 1A3XA 5KZDA 3NIYA 1VRXA 5FACA 1GG0A 2NLIA 3I65A 4Q8VA 3EX3A 4PR4A 1RD5A 4QG8A 3VO0A 5A2BA 4HCHA 2Z4GA 3W70A 4Z2LA 4ORMA 4Z42C 3OYZA 2C13A 2OELA 4GKTA 4D71A 3SQSA 4UTKA 4EX4A 1GEHA 4GH1A 2DSKA 2E7FA 4M1BA 5FF2A 1KXTA 3BSMA 4MF4A 4G56A 5HDRA 4NZCA 2VRKA 1KBKA 4K6AA 3RO8A 1ONEA 4F8XA 3FS2A 3FCPA 2ATSA 2HEJA 1R3RA 2OWCA 1VHCA 3WLHA 4JHOA 1IGSA 4QE4A 1BXNA 4YCPA 4R27A 5I7GA 4UFHA 4REQA 3EXSA 1WYIA 3B03A 1XSJA 4PYSA 3SUSA 3H53A 3NGFA 3R25A 3HGOA 4DF0A 1XDMA 5LYRA 4KWWA 5FEWA 3S5ZA 2G4JA 1SMAA 7XIMA 2V3GA 5LIKX 2FPTA 2E9BA 2OG9A 3FVDA 4Z1YA 4ZB0A 1TE1A 1KB3A 3MI3A 4LAMA 4HKPA 3S5OA 2WJEA 1CDGA 3VDGA 4JNMA 4LC8A 1OIMA 3G18A 4FNTA 4HK7A 2OZ0A 3AIVA 3TNOA 1W8GA 4RDYA 3N9KA 4O11A 2G97A 2W92A 2ONEA 4WLCA 4TX6A 5C71A 3NL2A 3M5XA 3RCNA 3F1QA 1A5LC 3T44A 5I2UA 4J3VA 3GR7A 4JKKA 3WH6A 1RQHA 2E25A 1XIHA 2ZIDA 5CG7A 3T42A 3U2ZA 3BSHA 3V0SA 1V6TA 1UWSA 4XWUA 1D8CA 4X9YA 3UPBA 4BFAA 5LSMA 3C6CA 3E6EA 2EO7A 3MUXA 1PIIA 1CW2A 3A22A 3DBNA 1ZBVA 2G3IA 3RLVA 2VOMA 1JFHA 4MWAC 1ZU8A 1HJWA 3M0LA 3KCOA 1M04A 2D2JA 1IZKA 4XTIA 2V30A 1OC5A 3V7PA 2O55A 3MS8A 2ACQA 3NG3A 3URAA 1DWJM 1VFTA 4GBUA 4S3KA 3NDYA 4AXKA 2IKGA 3T0DA 3RX4A 4TX8A 4Y8FA 3S6DA 1LBFA 2J8TA 2EAWA 1PKNA 2PBOA 5E0FA 2J13A 1HGWA 1GONA 3UGVA 4WOQA 3GNDA 3FJ4A 3ITVA 5C6MA 1O12A 4EPEC 1LRTA 2XN2A 1DTNA 1HP4A 1A53A 4NRRA 4P61A 3LHVA 3W37A 3VMOA 1P0NA 3VD3A 3VGGA 5H8MA 2IKIA 4YXGA 1U5JA 4HT3A 4C7FA 3NXFA 4JIIX 2PLJA 3IV3A 4K39A 1WXYA 1L2QA 4WDTA 2WCSA 2GJXB 4B5UA 1SFJA 4D1JA 4MNLA 3NQ6A 5EU9A 4PC8A 2H9AA 4JIQA 3ITCA 1ME9A 1O1ZA 3TAOA 5D05A 4BI5A 3N12A 4UTWA 4IPNB 3TZNA 7PTDA 4NZ1A 4WIWA 4YTSA 3QYQA 3GRIA 4GUFA 1IYXA 1ZPTA 3VC6A 4QISA 4US5D 3QYSA 1SJBA 3CUXA 2ZUVA 4AEFA 5LA0A 1N82A 5D33A 3DENA 4ML9A 2DZVA 3NYDA 3VIIA 4BA0A 1BWKA 3AROA 2VGFA 1HW6A 1EX1A 1OK4A 4EAYA 4XZNX 1UOKA 5CZTA 2F38A 5FKYA 2I1OA 2WPBA 2IPWA 2CLEA 4GQQA 3CHDA 4H04A 4WD0A 2D0FA 5LIWX 3IJ7A 3FDKA 1EA0A 3MUAA 2I9EA 3UWZA 1L0PA 4BQ2A 3GG8A 3SW6A 1EF2A 5C2CA 1ZBWA 3FJNA 2FLIA 2XWDA 4PCNA 4O1DA 1HUVA 5DBTA 1E51A 4HPGA 2WLYA 4Z2HA 3F2BA 4H01A 5DANA 5KZ6A 3PB2A 5D02A 4KPLA 2Q8XA 5A6JA 1QPRA 3TA9A 1WZLA 3TA6A 4ZXLA 5C9UA 1S2VA 1RP8A 1Q6CA 2J6XA 2Y7GA 2G3FA 5CZJA 3WL0A 1ML1A 5CLTA 1KFCA 4WCJA 1DOSA 3TTEA 2ZRVA 2OOFA 4ZZ9A 2VEGA 4XQ6A 3N2BA 2PTZA 3STPA 5AC4A 2HSAA 1AA1B 3W22A 4JTGA 2Y2WA 3CH0A 5HQEA 1XBVA 2W0UA 3AMLA 3TAKA 2C91A 3SM0A 1ISWA 1XHGA 2A3BA 3ITOA 1DV7A 3H24A 5BWAA 4ENLA 4JQAA 2VUNA 2DSZA 1OX5A 4AIBA 5F4XA 3UG5A 3AWNA 4YS1A 2EKCA 1JGIA 1UH3A 2ZUWA 2I14A 4WK9A 5AYBA 1VFFA 3ZSSA 1DJWA 3GDBA 3QV7A 2WQDA 4GISA 2CHNA 2HXUA 1EOKA 4LVGA 3PJWA 2CLFA 3V0UA 3GWQA 3KE0A 1E55A 1U1UA 1L6YA 1QMLA 4DBSA 2WVVA 3SCOA 1AMYA 1TWDA 3KBVA 3PPCA 4HPHA 4M51A 4CQAA 3L7RA 2C71A 1RA0A 2GFTA 2R1MA 2NWSA 2V69A 3DFTA 4QQ3A 1EL3A 2WZIA 2YXXA 1HVXA 3QEZA 3R4IA 4CQ9A 5FF0A 3ARTA 2JKEA 1BSLA 1V0NA 4MLRA 5IM51 5E6YA 1BPLB 1YIXA 3ARRA 5BXSA 4QEHA 4YIWA 2O7QA 1N8IA 4N4QA 4OE7A 1V02E 2QNEA 2DORA 4NASA 1U1JA 3V18A 2Z6IA 4IHCA 4MNMA 2BXZA 2VD9A 4HOWA 1VBHA 3M6DA 3ZYZA 1UMYA 4LU0A 3CUFA 4H19A 2V6AA 1RZMA 3TC6A 3TN5A 3AICA 3BWWA 3EGJA 1UZ1A 2XZ7A 5I07A 3GU2A 3SCNA 3UNTA 2J7EA 5H8PA 4JTSA 4UMBA 1JR1A 3NEHA 3C61A 4QX4A 1E4MM 4G9PA 4Q7BA 1ZNNA 3DH7A 1PZ0A 2PWUA 1REQA 1NWRA 3VIKA 3EPNA 4UTTC 3M0HA 3MBFA 3NURA 4MZ1A 4L1WA 3VFLA 3WKZA 2RJGA 3IAQA 4WVXA 3BG3A 1SJDA 1VENA 1V4YA 4GQGA 3B8DA 5CG0A 2QZRA 4XV0A 4LAZA 3GHSA 1LCOA 1GW1A 1FH9A 4GIAA 2XFFA 1IZJA 1XLAA 3NM3A 5KZEA 3QHOA 3EA2A 1ZGDA 1RCOB 1CPUA 4RNJA 4MB3A 5A95A 1Z32X 1JNEA 1F3TA 1GOKA 3GDMA 1DXIA 3D3AA 5A2CA 2CBIA 2ZTJA 4NRSA 2QW5A 3EX6A 2XDFA 4PCPA 1N55A 2C1HA 1PWLA 3IJ9A 2DT3A 1AZ1A 5DEZA 4ZSUA 4MY1A 1B90A 3C0LA 1PTAA 4CU6A 3W2MA 2G8ZA 1BYAA 4WJEA 1K77A 2WAGA 3KOYA 2J6VA 4JTDA 3ABZA 2FTWA 4HPXA 1EPVA 3VDCA 2DDXA 4JX6A 2VX6A 1H11A 3EBVA 2IXUA 1AW1A 1ONRA 3L21A 3VIHA 4IQJA 4GINA 5AHNA 1AL7A 2PP1A 8RUCA 3C2YA 4LVDA 4AY1A 4C7GA 1X1NA 1D3GA 2FYMA 1T96A 3CH9A 4JTUA 4R7WA 3D5HA 3W27A 2PODA 3U4AA 3NOYA 1Q13A 4XZLX 2PAJA 5A5WA 4D6DA 1UPMB 4DRSA 3ZWSA 1KBIA 3SJ3A 2GK1B 1KM5A 3RU6A 4PB5A 3WBWA 3ZWTA 1AQHA 3EB4A 1AQ0A 3OGRA 2X16A 4CD8A 5I03A 3U2OA 4ICMA 1MW3A 4FZIA 3CAKA 3MSDA 4XZHA 1XUUA 2ATMA 3RDKA 2P88A 1O60A 3W7LA 1Q66A 2ZKMX 5T91A 3M1ZA 3VUPA 7TAAA 4PMJA 4TVCA 4WF7A 3TYUA 3LBOA 3WNPA 4KQNA 3W7DA 2JEPA 3WENA 4I3GA 3KLKA 3CIWA 3LHZA 3R0UA 1KM2A 3ZLHA 5C55A 1QDSA 2YA2A 3DYMA 3HTWA 3PY2A 2YYTA 2GZXA 3PSWA 3HG4A 3FXGA 1RLCL 6ALDA 1Z69A 5EL1A 2EPHA 5DRCA 5DY3A 2BDQA 1Z48A 2X09A 3T7VA 2FZNA 3ABSA 5LIXX 1ZAIA 2IKHA 1WP6A 2QQ6A 3PVFA 3UXIA 1AMKA 3T1GA 4RZ5A 1FCBA 1E1CA 3HB9A 2INEA 1M5WA 3S9YA 2V5DA 1UA7A 1AQMA 2W63A 1XXXA 1J10A 2QVNA 2VZVA 1X7IA 5FD0A 1KFJA 2VR5A 3BVJA 2O7SA 3IK2A 4AZIA 3AS0A 4FF7A 4GUGA 1XC6A 1UKTA 3G1XA 3YPIA 4J3TA 2GUYA 3S5SA 2DIEA 5F1VA 1D9EA 4Y7EA 3DG7A 2CERA 4J3XA 1W5NA 4UFIA 3QN3A 4MNKA 4KEMA 3W29A 4WXZA 2Y24A 4O1FA 3M0IA 3T4WA 1FWDC 4JN8A 3BUVA 4IPPA 3F2CA 3H2MA 2Q02A 3K4WA 3QHMA 3RILA 5EMYA 1K8ZA 3B04A 4C6DA 2BGSA 5LKYA 3FYYA 5XIAA 2QDHA 4C6MA 3IIXA 4H8VA 2EPNA 3NCOA 3L0NA 1NOWA 3HGJA 4OOUA 1YBQB 2A6NA 1E1FA 3L4YA 3EEZA 3MY9A 2OYKA 2C15A 4IL0A 3MYOA 3FEQA 3R11A 3NZ1A 3N4FA 2V67A 1JAEA 3LPOA 1W9DM 4WQ6A 1KRAC 4HYVA 3IGUA 3E38A 1R46A 1YNQA 4A3RA 3HFTA 3OZYA 2QCNA 3LCWA 3OHIA 4E4UA 3OBKA 1DJZA 1VFSA 1W5PA 4ORIA 3TFXA 5J04A 3CT7A 3TYCA 2V3DA 3BOFA 3VC5A 5G2IA 3RR1A 3GNRA 4F0LA 2BX7A 3UNDA 3VIJA 1Y5VA 3W53A 4UCFA 4DJFD 3NQ2A 3IRDA 2OQLA 1W9VA 3BJTA 4L80A 3NNTA 4HNNA 4HZ8A 4BCEA 4JD4A 1LL6A 2GJPA 1BEUA 2VDGA 1KFBA 1EEXA 1P48A 1DP0A 3TJIA 2CLHA 4FOKA 1I0BA 4KWSA 4H2HA 3RLHA 3W7QA 3PM6A 3NZGA 3PSVA 4QJ4B 4H2CA 3BE7A 7REQA 2PZNA 2J7HA 4LBUA