3EX3A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-azido-ump, covalent adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex3A00
2QR6A 3IIPA 4M5PA 4RJEA 1VQTA 4G1KA 2G95A 1I2PA 4UFLA 3M9YA 4FF7A 4LOCA 3NQAA 4JDYA 2QCNA 2ZBTA 2J9XA 2VFIA 4UTTA 3KVKA 1IXNA 5F2LA 4UFMA 2CZ5A 4NUWA 2FDSA 2QDGA 2RKXA 6TIMA 3W7JA 4CCDA 3BV4A 3W7DA 4GUGA 3WK1A 3FA5A 4JGDA 4P2VA 1B9BA 3LHTA 1RV8A 4AHOA 4DO6A 1GTEA 4O4VA 5G1TA 3V1PA 3CC1A 4LVDA 3LTYA 3YPIA 4C1KA 1ME9A 3QMTA 1EB3A 4O1DA 3LHWA 1TTJA 5DCEA 1EUAA 2V30A 4UMBA 1XCFA 3L5LA 4NX5A 4NJHA 3RMJA 2YFOA 2PCQA 3QQ1A 2C14A 1G69A 3W2JA 1G6CA 2C6QA 1S3HA 3NL6A 4O1BA 4GRSA 1UBSA 3L0GA 2VFGA 1BKSA 3G8EA 3GK0A 2VEMA 3LI0A 3OVRA 3S5ZA 5AN7A 3HGOA 3HJZA 3N73A 2OJPA 5FF2A 1TJPA 2XN2A 3NQ7A 3BGJA 1KV5A 4RLIA 1SFJA 3P81A 2GUUA 2B4GA 2QCMA 2ZZ4A 1N8FA 3CEPA 1LYXA 4IMCA 1B4KA 1ONRA 3B4UA 3PWAA 2YDAA 3QW3A 4JIQA 2FLIA 5I3KA 3MWAA 1TPC1 3OA3A 3WJWA 4AHQA 3FEMA 4Q32A 1G4TA 3GAYA 3I7QA 1PS9A 2J6XA 1OFOA 2DZWA 2ALDA 1JCJA 1VCGA 4DO5A 1LBFA 3TU9A 2CLMA 1EEPA 2FB2A 3TMLA 2YFNA 5BMXA 5LGZA 4UTHA 3NEVA 1H7WA 2YSWA 4WD0A 1KM3A 1ME8A 1VYSX 2NV2A 3C2VA 3NPVA 3U8GA 4DF1A 1IF2A 1VZWA 5AHNA 1ZCOA 1VCFA 2YPIA 1G7VA 1S5VA 3W2UA 3W9ZA 4EIVA 4YL2A 4UMAA 1OK6A 2JBMA 5K9CA 2B7NA 4FX7A 2GQAA 1IGSA 1WA3A 3PBYA 4NNCA 1X1OA 4UTTC 2JGQA 3W22A 5HUPA 4KFPA 1MXSA 2CLLA 3IRDA 1HG3A 5CPLA 1VCVA 1LRTA 3BLFA 2HTMA 3HIJA 3M5YA 1FCBA 5HUOA 2D73A 2ISWA 1CI1A 4WY0F 2Q8LA 3OBKA 2CU0A 1PHQA 4M6QA 4MFEA 1TPH1 1DBTA 3WJSA 3W1LA 2FJKA 4N9BA 4Q4KA 1RVGA 2G97A 4OT7A 5HULA 3SJ3A 1XL9A 3AJXA 3PBUA 1ZAHA 3LTPA 3N19B 2H90A 3KHJA 2BXVA 1TQJA 4LVBA 2C18A 2J88A 3S1UA 1TRIA 2JKEA 2GVJA 1FDZA 5C54A 4HPXA 5J5RA 3G1XA 4YMZA 5F1VA 5HQEA 3CLMA 3L67A 3WFAA 1FXQA 4RZ5A 3HBLA 1KA9F 4CCCA 1OF8A 2Z6JA 1L2UA 3HG4A 4XZ9A 1I2QA 1M7PA 3NM1A 2E6DA 4FXRA 4S1FA 1W5NA 1RPXA 3GKFA 5D2YA 5F4XA 3BARA 5DLCA 1SO5A 3BW4A 3SI9A 2GVGA 3O6CA 4AEOA 1XM3A 1W1ZA 1GTHA 3EXTA 3W2MA 1OFQA 3EKZA 2ABAA 4JR5A 1H7NA 2ATMA 1DJNA 1LORA 2Z2UA 4GUHA 3EXRA 1G4EA 3N2MA 3T40A 3THAA 3O16A 3JRKA 5I3GA 4O1AA 4LTSA 2W6RA 1QFEA 2DP3A 3CTLA 3NQCA 4JX4A 2QUTA 3THQA 4JEQA 2FIQA 3IGSA 3L65A 3ABOA 2A6LA 3W6YA 4IX0A 2V9DA 3G1VA 1KFBA 3L0KA 3TIMA 3R8RA 4O28A 2JGYA 1TCDA 4K36A 2TMDA 1A5AA 3GDMA 3QYQA 3W1QA 4ZQNA 1JQVA 2V0TA 2ZRYA 5IM51 3HF3A 2Y70A 3LCLA 4WY0A 4OBTA 2ZZ2A 3STFA 4LVFA 3KOFA 2CLFA 4UTUA 1WX0A 5DBUA 3P61A 2NX9A 1O5KA 3SGZA 1PV8A 4JN6A 5LNSA 5AHFA 3ZR4A 5K7JA 2X16A 2R14A 3GDRA 4MZ1A 3L5MA 3C52A 5K2ZA 5SWUA 4TO8A 3IIXA 1ZHAA 2FTPA 1ME7A 3M44A 3T7VA 2NX1A 2C1HA 1PVNA 4O0KA 3LHVA 2A7PA 2Y6ZA 2ZDRA 5ABTA 1FCQA 5EL1A 1TTIA 3Q37A 4Z1CA 1SW0A 2Y7GA 2QCEA 3LV6A 1R2RA 3RK8A 5FESA 4O17A 3VI2A 4E2DA 1PL9A 3SIZA 4DO4A 1Q6LA 4POCA 4JICA 4KWVA 1TO3A 3IEBA 4HSNA 1H51A 1EP1A 1AL8A 4GBUA 1LBMA 3QC3A 3HO8A 3C4UA 2QDHA 3S1VA 3QPZA 1WAUA 3UY7A 4TU1A 4ADTA 1IIHA 1AMKA 1OX4B 4O57A 4IWWA 4N9CA 3L21A 4O53A 4K38A 3KVMA 3W7NA 1T0OA 2Y7FA 3DAQA 1SW7A 3EB2A 3LCXA 4XTIA 5E1QA 5BOOA 1N55A 1UCWA 2XFWA 2XN1A 2ZYFA 3W86A 1H62A 2V82A 2AGKA 4NVTA 3MYPA 3T4CA 3TH6A 3M6YA 2X1SA 1QCWA 1Z44A 2H6RA 2ZQ0A 4Z0JA 1Q6RA 1JULA 3LBMA 1XDMA 5G4WA 4UR8A 3P82A 1H61A 5F4SA 4DPPA 3UNDA 1D3GA 1C29A 1KFEA 3PC0A 3S9YA 1TYGA 1R2SA 3PY2A 3LBCA 1VJIA 2ZFAA 3EWUA 3KRZA 4LS2A 4WZHA 4JTHA 4IXHA 3GIYA 3N3MA 1FY6A 4HIBA 2DZXA 3C56A 4JY9A 4NJJA 4LWWA 2WJZA 4DXVA 5EPDA 4OQVA 3IIVA 4AMAA 2R91A 3MHUA 1KFCA 4RZ4A 1TV7A 4Y8FA 5TQLA 1H1YA 3PG8A 1K8ZA 3LI1A 1XUZA 3MUXA 5AHIA 1J2WA 3QMRA 1O95A 4EVZA 1AK5A 3DENA 3LCWA 4L4MA 2Q3OA 2NUWA 3QPYA 2E5CA 3T78A 2J9YA 5FF0A 3UPBA 3S6DA 2I9EA 4MIMA 1GJPA 4CQ8A 1J4EA 5LSMA 3DI0A 2TYSA 2ZZ3A 3GDLA 5KZDA 4X2RA 3R89A 3W72A 4MY1A 4B5NA 1S5WA 1VS1A 7TIMA 1LOQA 2Y88A 3L5AA 4I9AA 2FPVA 1FXPA 4QQ3A 3NQ8A 3LHZA 5KZMA 4DBDA 3TAKA 1H7XA 3RU6A 3TC6A 2E68A 5CPMA 1KTNA 3O6YX 4K39A 1PIIA 2VENA 1U83A 4JIPA 1TPFA 3LCIA 1XKYA 3SGUA 4HN4A 3W83A 3WK3A 4A3UA 1ALDA 3UWQA 2ZA2A 2W79A 3DFNA 1BWLA 3C3NA 3P67A 4IPIA 4OHQA 4BK9A 1W3TA 4KKXA 3W1RA 5BW6A 2EHHA 4FX8A 3GNDA 1G4SA 1ZJIA 3G24A 3NOEA 1DQXA 2OT0A 4N9DA 1ICSA 3BG3A 1F7BA 4WX2A 1YXCA 2OZ0A 1EX5A 5KTLA 2J27A 2RDUA 3BG5A 1KLYA 1TPVA 5BRBA 4CCEA 2WKJA 3M43A 5KINA 3BW2A 3IV3A 3TFCA 3CEUA 1SSGA 3DFOA 1KBIA 1ZY9A 4LVAA 1WOAA 2FB3A 3QJAA 3G0XA 4ZQRA 3UYCA 3W70A 3LXAA 3R2GA 3KRSA 3O06A 1H5YA 4Z1DA 3IGXA 4AXKA 1F05A 3NL3A 1NSJA 2CLIA 2V2CA 3LXBA 1W0MA 3KX6A 3G1DA 1TTQA 1UUOA 4WXZA 3TKFA 4UXDA 1JJKA 1TPWA 3G3DA 2A85A 1P0NA 4R33A 2Y7EA 4NJKA 4RZ6A 1VLIA 3FJ6A 3G1AA 3P5ZA 5DN1A 4QITA 4YXGA 1GQNA 3A24A 1JCNA 4UFKA 4GUJA 3M7WA 1OG0A 1AL7A 4R7JA 3W1NA 3FS2A 2OT1A 3TW7A 3NQMA 2I14A 1JCXA 4O10A 1F76A 3CT7A 1TPEA 4PH6A 3W1TA 4FNPA 5G4EA 4A2SA 4UFHA 3DU0A 5BNKA 1IXQA 1X1ZA 2NUYA 1DVJA 3NPUA 4X9SA 4O0ZA 3WK0A 3FJLA 3OG3A 3IVTA 5CKSA 4BI7A 1JCMP 3NQVA 3STEA 2ISSA 3EXSA 1WDWA 1ZNNA 3EX4A 1NVMA 3C61A 3OVPA 3W7HA 3TDFA 3PBVA 4WXYA 2PRHA 2JKAA 3HG3A 3NQGA 4PEKA 4ZQCA 1QO2A 2Y62A 3BGGA 3PBWA 4CLMA 1OFAA 1QPRA 3PVFA 4ADSA 3A9IA 4UTMA 4PA8A 2H3BA 3DZ1A 4NQ1A 3S8HA 1TB3A 2YGYA 4HPJA 4JTLA 4HNUA 3MHGA 4TIMA 4ZQPA 5KITA 1LRNA 2FFCA 2O7SA 3PB2A 4HHPA 3C2FA 4MYAA 4GUFA 4TR9A 1QPNA 1R2TA 1M6JA 1FWWA 5CZ0A 2VFHA 4PL2A 1X6UA 1QPOA 4JTKA 5EMUA 3GR8A 2YZRA 1KBJA 4NZFA 5HWJA 2EKCA 1CX9A 4Z0SA 2GQ8A 1WBJA 4PFMA 1SSDA 3E49A 1GWJA 2DJLA 4JTIA 2V5BA 3L66A 2JK2A 1ZAIA 2PRLA 4N6EA 4XTDA 3C0JA 4PCFA 1YDNA 2QCFA 5HINA 1TQXA 1JQXA 2PRMA 5F2IA 5LKYA 2E09A 3NAVA 4BI5A 3S5OA 3CPRA 1RZMA 2F84A 4ZZ9A 3KXQA 3TSBA 2BLEA 1A5SA 5DY3A 4Y9AA 4O19A 3NYZA 1K3UA 4H6KA 3HGSA 1G7UA 3EX3A 1TPDA 3LCFA 1YTKA 3W88A 4XUGA 5D04C 4MLJA 1C9DA 4N2YA 5FEPA 4JNMA 3NR0A 2Q8ZA 3TK7A 3S1XA 3W1UA 2DORA 4YCOA 2AAMA 1LDCA 2WO5A 2V5LA 4MUZA 5FF7A 3T55A 3GXTA 1W5PA 1LOLA 1PCKA 4FNSA 4NJGA 3HPXA 4CQ9A 4IMGA 4UMCA 3RNDA 5LNWA 1LRQA 3S0CA 2DZTA 1IXPA 4J9JA 4E0CA 1LOSA 1GZGA 4GXMA 1B4EA 2QAFA 1VC4A 1AW1A 4RXFA 3USBA 3MW7A 5L9FA 1XI3A 3DKJA 2VFEA 3EEGA 5D32A 4BF9A 1OJXA 2ZCGA 1SU5A 5HWNA 4UFJA 3LV5A 3B0VC 2ZA1A 3ELFA 5G2IA 3PS7A 4CQAA 4JTUA 1W3NA 3F03K 4Z08A 1DORA 1I2NA 3W73A 2X2GA 3VFLA 3W84A 3I7SA 1FWSA 1K03A 2TPSA 3C2RA 8TIMA 1FDYA 4ZL1A 3AO0A 3BLIA 4EF8A 3W76A 4HNVA 1XBXA 4H3DA 3QF0A 1OYAA 4UUIA 3LB0A 5D37A 4ORMA 5EA9A 2VEIA 1DL3A 2WNZA 1T99A 3TAOA 3U2OA 1RQEA 1ZALA 1W8SA 1LCOA 2WSYA 4GFSA 4WQ6A 3GLCA 1UB3A 1WBHA 1H7OA 5EY5A 5E93A 1KV8A 2NX3A 3P7YA 3KVLA 2B0MA 4FNQA 4DF2A 3BVJA 1NF0A 1K02A 5U4NA 1H63A 2DZVA 2DJXA 4JS3A 2Z1BA 4Y90A 3STGA 3KFTA 2DZSA 2TSYA 5FF4A 4LNYA 2YYTA 3P80A 3TSDA 5I3HA 2B7QA 3LCGA 2RHGA 3N2XA 2JKPA 3JR2A 5HR7A 3ATZA 4JYEA 3E02A 4MY8A 3PG9A 3A21A 1QOQA 4FX6M 2KZHA 3NA8A 3NVTA 4C1LA 2H8XA 3MI6A 4K37A 4AB4A 2E1DA 1YXDA 2Z6IA 4Y6GA 2E6FA 3LRKA 1OF6A 3C2OA 3N9SA 1N7KA 3W74A 4HKPA 1GVFA 1WYIA 1KLZA 4NZJA 1TIMA 4LV9A 1F74A 3OEXA 3BO9A 1EPXA 1OFDA 2NXHA 2VFFA 4IOTA 4K8HA 3EWWA 4MYXA 3NZ1A 4ZQMA 2Y63A 1G67A 5LNRA 3UXDA 3H53A 4OE7A 2CLEA 1SQ7A 3DGRA 3CIXA 4JTFA 2VXNA 4IMDA 2YX0A 3P5YA 1J5TA 4MZ8A 3NDOA 5IBXA 4QISA 2G5WA 4LVGA 1SZFA 1JUBA 4AF0A 4EWND 3P8IA 4QNEA 3W7QA 4DEFA 1GOXA 4DQWA 2WNQA 4XKYA 1YPIA 4RX0A 1KTBA 2I1OA 4PODA 3Q58A 1GYLA 4JTSA 3W75A 5EYWA 3PAJA 5L6UA 1YYAA 4MJZA 5HMSA 3F4WA 3MI2A 4NX0A 1TJRA 1DKWA 3H54A 1XDLA 3PB0A 4KWWA 1G4PA 4AH7A 1DQWA 5KZEA 3G1SA 4I7UA 3RFAA 1TPB1 3NPXA 1DV7A 3TJLA 1W37A 3I68A 1YTEA 3NQFA 4KFNA 3MHFA 2ZZ1A 2HS8A 3M5ZA 2UV8G 1SZNA 2ZTJA 4WY0B 2TRSA 3UD6A 3A5FA 3G1HA 3NQEA 3O1NA 1QOPA 4JY8A 3OHIA 1LLZA 1QAPA 2IQTA 3L9CA 2NWRA 5F2MA 2P10A 2QCHA 2A4AA 4JD4A 1GYNA 4IMEA 2E77A 4X22A 3LHUA 4XBKA 3F1QA 3STCA 1X7FA 3B0PA 1R46A 4XQ6A 4AVFA 5DXYA 2V2DA 4MKNA 2QF7A 1YDOA 1VRDA 2F7FA 1LBLA 4LUJA 4UTWA 1THFD 3TROA 2QCGA 1UJPA 3B03A 5D03A 1VHNA 3L0NA 1IXOA 5FEXA 1Z48A 1ZAJA 4IXXA 5FI8A 4N9EA 2E5DA 3FFSA 3GDKA 2C15A 4O13A 3CB8A 3W3OA 3WK2A 5HNRA 4NXSA 2QKFA 2ZRWA 3NQ2A 1WOBA 1WQ5A 5LNVA 3B05A 2XN0A 2NWSA 5KSWA 1TTPA 5G2HA 2YW4A 4GJ1A 5G5IA 4QNWA 3LHYA 3NQDA 5MHBA 4K7VA 5D33A 3EX2A 4CNPA 2CW6A 2Z0IA 1XXXA 4YLWA 1L9WA 3EKLA 3QSTA 4XBSA 1ZFJA 1TV8A 1A5CA 3UWZA 4P61A 2NXIA 2FPTA 4JTJA 3BK0A 3NL5A 4A21A 3NXFA 3ZWTA 1NFBA 3R5EA 5D38A 1JUKA 2E5BA 3O05A 3B04A 1YTDA 2CZEA 3WJXA 3FYOA 4TMBA 2OCZA 2J9ZA 4IGHA 5H91A 4LV4A 2C3ZA 4DF0A 2ISVA 3KVJA 3U6WA 4JTGA 1GVOA 3VKJA 1H7PA 1VPXA 1W31A 4OV9A 2DU2A 4FEZA 1XFBA 1JRBA 4LT9A 3BPWA 3G8RA 1FWTA 1JUEA 4DBEA 4NU7A 1PE1A 1OX5A 2P0OA 4JDBA 1B3OA 3WJYA 1MEIA 3BG9A 3M41A 3F4NA 4FNTA 2R8WA 1EIXA 3MBDA 1KTCA 3UZ5A 3UWVA 1UASA 3W07A 4UTWC 1E51A 3TC7A 4M6VA 1LZOA 4IJBA 1OABA 3N34A 1XBZA 1CW2A 5D02A 2WNNA 3G0UA 1L6WA 3P74A 3S42A 5AC7A 4JXCA 1ICQA 1O5XA 2V8ZA 3VNDA 2ZRUA 1MEHA 3V75A 5AHMA 1DJQA 2WV8A 4FIQA 3D0CA 3TE9A 4NJIA 3HPZA 1VGAA 4ZQOA 1YPFA 3NM3A 3W7IA 5AHLA 3W1XA 5HJLA 1BEUA 2QCLA 3C6CA 3IIZA 3M47A 4QJ1A 2EAWA 1Z42A 3M16A 5LHFA 3GB6A 4LRSA 1D3HA 1SUXA 2ZZ5A 2B7PA 3I6RA 1I45A 4QM1A 3O15A 1U5JA 3MO7A 4O16A 3M1ZA 1EA0A 1EP3A 3LTSA 3SW6A 2ZZ7A 2YCEA 1KM2A 3Q2DA 1Q6OA 1EUNA 3S5YA 1W3IA 2C16A 5CPOA 4JYDA 1YDVA 3G1YA 4TX9A 4GE8A 3ATYA 3UXAA 3M5VA 1K8YA 4UTIA 4QIUA 3O63A 3UQNA 1T8XA 3R12A 4O8RA 5FEZA 4RKAA 3GAKA 1QMLA 3NQ6A 3NPWA 2QJHA 3HG2A 4OV4A 3QEZA 3IIOA 2VKZG 1K7FA 5AYYA 1Q3NA 3VE7A 1L6SA 2QJIA 4LU0A 2CLHA 3MP4A 4YWIA 3DXIA 1KFLA 3TUUA 1RD5A 1FWRA 4QAIA 3TR2A 1P5BA 3QH2A 4MFDA 1K7XA 1LTDA 3S5NA 1VYRA 1OX6A 4FB7A 2HMCA 2Q3RA 3GDTA 4O52A 2CLOA 3FIGA 1DOSA 4IQLA 5K4XA 4ICNA 3A22A 4FIRA 1O60A 1M5WA 1H60A 2X1RA 1YADA 2A21A 4MJMA 3DFPA 5D2WA 4N4QA 3PR2A 3W1MA 3HPSA 2ZA3A 1LROA 3ZWSA 3MP3A 3KAOA 4MPQA 2C19A 3UPWA 3A23A 2A6NA 2BTMA 1AW2A 3BLEA 3TSMA 4Y96A 2J24A 1A50A 2A7NA 1F5ZA 2A7RA 5A5WA 1FCUA 2C0AA 4RR4A 1F2JA 2QCDA 4GUIA 5F1UA 5HR6A 4O12A 4FXSA 1EWEA 5K3VA 2RDWA 4PC8A 1NF7A 2A2IA 3E0IA 2DZUA 3RLVA 3VCRA 3IVUA 3ABRA 4HT3A 1JCLA 2NUXA 4LRTA 1MEWA 1S5TA 5K9XA 3ABQA 3GNNA 4UNKA 3QW4B 1OHLA 4LS1A 3B8DA 4UR7A 4M6PA 2WPBA 4YCPA 1YLVA 1SO4A 1QDSA 3MI3A 3W1PA 4FNUA 4AAJA 3NL2A 1VYPX 5F4WA 2G96A 1KW1A 3LXCA 2H3DA 1PCWA 3LDVA 2CLKA 4M19A 3W1AA 5H2ZA 3TCEA 1SW3A 4NT0A 2HSAA 1JR1A 4E38A 3L2IA 1R47A 2BSLA 3G18A 4O50A 3DFTA 5CSSA 2FPYA 4QSHA 5D05A 2DZPA 4EF9A 1IIGA 3UY8A 3A5VA 3FLUA 5G2WA 4HNTA 2WOQA 3O6DA 4O54A 1MSSA 3DBPA 1OFRA 4XWUA 1Z41A 1Y0EA 3IVSA 3R13A 1RR2A 1KFJA 4IMFA 5I3IA 1KM6A 2ATSA 4I7VA 5TIMA 1KFKA 1HL2A 1HO4A 5F2GA 4JTEA 4MVAA 5K9DA 3W7GA 2NV1A 3TXZA 3EWBX 2QUUA 4LW7A 1GVSA 4KFOA 1PHWA 3W7KA 2QCDB 4O1CA 4UNLA 3QM3A 1ADOA 1WXJA 3E9AA 1FWNA 4JX6A 5AYZA 1K8XA 1OYCA 1H7RA 2H8ZA 3EX6A 2W0UA 3GZ3A 4NNAA 1WV2A 2R94A 2QEZA 3MP5A 1NEYA 4UFIA 1YXYA 3PUEA 1B57A 4A22A 2QAPA 3PSWA 3LOTA 3BW3A 4ZVJA 1TPUA 5C6MA 2QJGA 3CM4A 2QCCA 2Y61A 2P1FA 1RQHA 5HWMA 3ABSA 3TQVA 2HS6A 1H50A 4N4PA 5CGQA 3P60A 4GWEA 2V81A 5AFDA 1GVQA 3HQ1A 4Z1AA 1FX6A 2GVLA 5DCDA 5D09A 4OU1A 3ZFHA 5CSRA 1SFLA 3SZ8A 1FUYA 2RH9A 3OVQA 1GPWA 4A29A 3FOKA 4BFAA 4WUIA 1OFBA 3W7PA 3G22A 4S2CA 4S2BA 5CPNA 2X1UA 3W7LA 5C55A 2Y7DA 3I65A 1V7YA 1P0KA 1W5QA 2E6YA 5D2VA 1QPQA 1NAL1 4L4LA 2ZZ6A 3LERA 3CWOX 3HMJG 2A0NA 3TNOA 4NNBA 3HG5A 1TMHA 1F6KA 4K7YA 4MOZA 3FYPA 3GKAA 3QRHA 3M5XA 1OX4A 3GX9A 3SR7A 1OFEA 1QO5A 4WJEA 3DFSA 4LUIA 3B0UX 3TV8A 4ZMGA 3C8FA 5DXXA 3DHFA 3C2EA 3UWUA 2O7QA 4OWGA 3P84A 3CU2A 2BWGA 5D30A 1F6PA 5AC8A 1HO1A 3QSRA 2Y85A 3UZJA 3W7MA 1SO6A 1HFBA 1I2OA 1KM1A 4X3ZA 5EBUA 3QMSA 4R34A 1V5XA 3FKRA 1D9EA 3SY5A 3NNTA 3W23A 2OX1A 3P62A 4FNRA 1OVDA 3G3MA 3PSVA 2CZFA 1SR9A 3HOJA 2NZLA 4JTTA 4K8EA 1A53A 5CZJA 2FQIA 1QWGA 1A5BA 3TA6A 3DHDA 3TW6A 2VELA 3PUDA 1VHCA 3MJYA 5K4ZA 2YR1A 1TREA 3NO5A 4PTNA 1QR7A 4HNNA 2LLEA 1KM4A 2VEPA 5AOUA 1W54A 2GPTA 4RV8A 3O8AA 1W5MA 1LM1A 4U28A 1FCVA 1MZHA 1W56A 5C2XA 4O4WA 2CWNA 3LCHA 2BZNA 3TJXA 5BMWA 2ZRZA 3KRUA 3TXVA 1EWDA 3T44A 3GVGA 5AC6A 3ZS4A 5DCBA 3W2NA 3W2LA 4FHAA 4Q33A 1Q45A 3W7EA 2ZRXA 1XUUA 3SECA 1KM5A 2A1YA 3INPA 1I2RA 4DPQA 1KM0A 2NLIA 4LY8A 5AB3A 2CFFA 1VLWA 2VOMA 1SZEA 4BWLA 4IUOA 1HUVA 3LRLA 1GG0A 4FO4A 4OGZA 3W7OA 1AW5A 5CZSA 3RF9A 5CZTA 1P4CA 3PF3A 3LGEA 3TMQA 5LNUA 1X8FA 2VFDA 3EWXA 1H1ZA 4UCGA 2ZRVA 4AWSA 1OFPA 4UTJA 2A5HA 5G1YA 3B06A 4EOUA 4AWTA 4LS0A 3JS3A 3CQ0A 3I7RA 3SFKA 2YXGA 2YW3A 5I3JA 1SZGA 5DY2A 3MYOA 3NGJA 3SSJA 3GR7A 1DHPA 4K6AA 4RK8A 4ML9A 1LP6A 2PC4A 2VC6A 4Z1BA 3K30A 2RDTA 3DI1A 3UWWA 1EP2A 4AF0B 3G0SA 3TQKA 4M7TA 5KMYA 3EX1A 3FKKA 4GNJA 5D2XA 4XKYB 1L6YA 3QQ0A 5GVJA 3CWNA 1SPQA 2Y89A 2V2HA 3PM6A 2OMAA 1FDJA 4TMCA 1XBVA 1P1XA 1TRDA 5IBXC 2PURA 5AYXA 1O94A 1XC4A 4O11A 1TV5A 5DBTA 3DH7A 1AG1O 1BWKA 3IGUA 1I4NA 3LLDA 1GT8A 3LRMA 5FEWA 4I7WA 1FQ0A 4ONVA 2QUVA 4IPJA 2GJNA 1O4UA 3W7RA 3ANYA 2X1TA 3M0ZA 2B7OA 1QNVA 3W71A 5CG7A 3W85A 3VE9A 4M7SA 3L68A 3S1WA 4D2JA 1GG1A 4N02A 4UC5A 4MLRA 2E6AA 1TSIA 4JYFA 3MBFA 5C5YA 2WSRA 3W87A 1K7EA 5TBOA 3LLFA 5LGXA 4UTKA 1LLWA 2BX7A 1ZENA 3EWYA 4AWUA 3MMTA 4N6FA 1GEQA 3N9RA 4RCXA 4R53A 3RLUA 3LM7A 2EF9A 2EPHA 3P8JA 2WQPA 3OIXA 2C13A 1RQBA 4A2RA 1I8JA 5LHEA 4RXGA 4BWLC 1FBAA 5AHEA 5LZLA 2PE4A 4BI6A 4BR1A 3TX9A 1XBYA 1ML1A 3G1FA 4GC4A 3HGJA 3LX9A 1VH7A 4CNOA 4DELA 3TQ0A 3E96A 4O15A 3TFXA 3QFEA 4NXKA 4UTLA 1C8VA 4MY9A 1JVNA 5U7SA 4WOQA 1W5OA 5J5DA 2VEKA 3HB9A 4LC6A 3GXPA 4O14A 2YYUA 2NXGA 3CHVA 3UWYA 5E0KA 2ZTKA 3NZRA 1MO0A 2GJLA 3DFQA 1BTMA 1OYBA 3O07A 2CZDA 4LC8A 3N14A 3DKLA 2RFGA 3W2KA 4U4MA 4UIOA 1GVRA 5T26A 5I3FA 4CNNA 3EWZA 4WOZA 1UUMA 5A8GA 2X30A 4E2BA 1R30A 1OK4A 1ICPA 1M7OA 3HGRA 4ALDA 1HTIA 3CIWA 1JCYA 3E12A 1F73A 3W7CA 2ABBA 3PUOA 4IX2A 5D2TA 1VR6A 5FF3A 4AHPA 4JX5A 4W9TA 6ALDA 3QZEA 4H4IA 2GOUA 5DELA 1JRCA 2EGZA 1SO3A 3NG3A 3GXNA 4ADUA 3PULA 4MZYA 2WSQA 4O18A 3H55A 3Q94A 2GQ9A 3GYEA 1Q6QA 1T96A 4HSOA 5EKYA 4PL1A 3WJZA 2AQWA 4ORIA
chains in the Genus database with same CATH superfamily
3IIPA 4M5PA 2ACRA 4QJ3B 4X0VA 1PZ0A 3K46A 2ZBTA 2WZMA 2WKGA 1P6CA 4NUWA 1PWMA 2FDSA 4XD6A 2QDGA 4JIEA 1BPLB 3W7DA 2J13A 1E6PA 1EBGA 4PTMA 3RILA 1XYMA 1GTEA 2VNCA 1RSCA 3CC1A 4LVDA 3LTYA 4LALA 1XIHA 1AODA 3BMXA 1EUAA 1R3RA 2VQTA 2YOCA 1NH6A 4NJHA 3TLLA 3RMJA 4YU1A 3O0KA 3RR1A 1UD3A 1UWIA 5EU9A 4S3JA 3W2JA 1G6CA 1S3HA 2HVMA 3VC6A 3ZVIA 3GK0A 2VEMA 3OVRA 3SCPA 3DOPA 3WNPA 2XH7A 4RLIA 3P81A 4DLFA 2B4GA 3IAQA 4DJED 3AZSA 4M29A 1UWAA 3DERA 3PWAA 4W86A 3QW3A 2PS2A 2YKKA 4WDUA 3VK5A 1TPC1 4HHLA 5B80A 4AHQA 2VVNA 2VD9A 4Q32A 4GNKB 1G4TA 4NY2A 2WLYA 2VR4A 2ALDA 1JCJA 1FWGC 2ZDSA 3B8WA 4AYSA 5BMXA 1UZDA 1W1VA 4IQJA 3VGHA 2OB3A 4GVGA 4BY3A 3H6OA 1UR1A 2ACQA 2NV2A 3NPVA 1R85A 3U57A 4A8NA 4DO7A 4CVUA 1IF2A 1V08A 1V77A 1XC6A 4ATLA 4J2MA 4IIBA 1VCFA 1XLJA 4IHCA 1AMYA 1S5VA 4F66A 4UMAA 1OK6A 5K9CA 3IJ6A 3U0HA 2JGQA 1HKVA 2PEVA 5HUPA 4KFPA 3IRDA 4NYUA 4UQDA 5CPLA 2EPLX 4C1NB 1OD8A 4WY0F 1CI1A 3BC9A 2ZC8A 4RNHA 2PLKA 2F9RA 2OYMA 4WDWA 2BVDA 1T5AA 3T81A 5CAKA 1GKQA 4EANA 2F6XA 3E38A 4MFEA 2FJKA 3RAOA 1CXLA 1PXGA 4Q4KA 2G97A 2PGEA 4OT7A 3SJ3A 3RX4A 4HYRA 3GC2A 3LTPA 4XV0A 4B4FA 3KHJA 2BXVA 1UA7A 3S1UA 4MNLA 3VIOA 4CD8A 1XIMA 1K1DA 2GVJA 2BOFX 2DW6A 3WFAA 2PP0A 2CKSA 3HBLA 1JZ6A 3NM1A 5J8LA 2E6DA 1IEQA 4TOQA 1UC4A 3VNYA 1KRCC 1XLGA 3H2AA 3R0DA 5F4XA 4LCRA 3CL7A 4I90A 1SO5A 3EBVA 1M53A 3EYPA 3CO8A 4Q7NA 5HAOA 3CAWA 3SI9A 4V1YA 2GVGA 3IJIA 4AIBA 4AEOA 4L65A 1QW8A 2ZVIA 3L7RA 1GTHA 3HQNA 5JU6A 3A4JA 3W2MA 1OFQA 1NDYA 2IXVA 3CK5A 1K77A 4XK2A 4JR5A 1H7NA 1LORA 3VIGA 1G4EA 3N2MA 1GOIA 3LS9A 3SN1A 3U7BA 1EQCA 3JRKA 4WRHA 4O1AA 1QFEA 2DP3A 3CTLA 3NQCA 3KCJA 1BF6A 1TJ0A 2D2HA 2QUTA 1P0BA 3THQA 1UH2A 2FIQA 3IGSA 4K3ZA 4E4PA 4X9YA 4IX0A 3L0KA 3Q65A 1GKRA 1BYAA 4O28A 2IPJA 2PDJA 3ICJA 1R6WA 2TMDA 3GDMA 3GC4A 3NQBA 1NQKA 4ZQNA 1DYSA 2NQHA 1E1CA 4JQ3A 3M0KA 2HEJA 3TONA 1M04A 3P61A 1WE5A 3S5SA 7ODCA 1XD1A 1O5KA 1PV8A 1Q6GA 1B1YA 3H4WA 1E71M 7TAAA 3L5MA 5SWUA 2FTPA 1FHDA 3EKGA 1UKOA 1PAMA 3AQUA 2W67A 1PVNA 4O0KA 3VPLA 2A7PA 2PDIA 2ZDRA 4MNKA 1LLOA 3WN6A 1YNQA 3WQ4A 1ADDA 1SYTA 4H9TA 1U5HA 4D6GA 1XQKA 1E1FA 4POCA 4JICA 1TO3A 3MQTA 3SBFA 1H51A 2R1PA 3DFHA 1AL8A 1EOKA 3V0TA 1W2PA 4UCFA 3S1VA 4RV3A 1XLAA 4DZ5A 1C91A 1BYCA 4O57A 4UNIA 1XV8A 3GR4A 3GTXA 4JKKA 5E9AA 5A8QA 4UTFA 4DXKA 7ENLA 1A5UA 2XN1A 1QRQA 2PA6A 2ZYFA 1XLDA 1RA5A 3U48A 4WF7A 1VF8A 4PYSA 2H6RA 2YLAA 2ZQ0A 3VNLA 1ITXA 1DJGA 2FZDA 4ERAA 2VZUA 4Z0JA 3BAYA 2XISA 1XDMA 4QGCA 4UR8A 3P82A 3SUTA 2QF8A 4IH3A 3VU2A 3MY9A 1KFEA 5E09A 4I9JA 2QS8A 3PY2A 2DQXA 3MKCA 3LBCA 1VJIA 4AC1X 4H8NA 5A6JA 3EWUA 4LS2A 2OX4A 3GIYA 1FY6A 5GJMA 1IEIA 4F4RA 1NWUA 1QHZA 1XYAA 4HIBA 2DZXA 4KCTA 3DG6A 4DLMA 4L6OA 4XSMA 5EPDA 1VFLA 4AD0A 3TR9A 1G1YA 3L2LA 3FAXA 4ACZB 1J2WA 3QMRA 1AK5A 4H04A 4S39A 4UR9A 3WDIA 3LCWA 4GIAA 4L4MA 4MNMA 4LQ1A 2YDSA 4J4KA 2J9YA 2I9EA 1BRLA 4MIMA 4CQ8A 1Q6CA 1JF5A 5EMMA 4W88A 2XIMA 5D4YA 5KZDA 1S46A 2OSXA 4X2RA 3R89A 4HOWA 2EEXA 1XGDA 1LT8A 1VS1A 3FA3A 2NSXA 2Y88A 5A2CA 1P6WA 1RY8A 4K2SA 4EAYA 1W3KA 3BL3A 1VB9A 1H7XA 2D23A 3TC6A 1HT6A 3O6YX 1H09A 4K39A 4QJ4B 3W81A 2DEPA 3PZGA 3SGUA 2FHBA 4MB1A 4TTGA 3E0VA 1CZ1A 3SJNA 3W83A 3SEPA 5CGMA 4F40A 3H7VA 2FYMA 3C3NA 4IPIA 2DGAA 1Q63A 4DYJA 1DIEA 1W3TA 3W1RA 5BW6A 3GNDA 1QW9A 3G24A 1ZJIA 3R58A 2OT0A 3OP2A 3LPPA 3BG3A 1F7BA 1IHIA 4WX2A 1YXCA 5RUBA 2J27A 2RDUA 3BG5A 1KLYA 1Z32X 3BAXA 1L6FA 3VNJA 3BW2A 4IPPA 3TFCA 4NL1A 5FKYA 2UY5A 4BA0A 3B8TA 4NAFB 4MB4A 2P8BA 3QJAA 1EGVA 3R10A 1XLLA 1UD4A 3R2GA 4D71A 2OG9A 3NL3A 1XIDA 2ZIDA 4G7EA 4I6VA 3BZGA 2YDRA 3MV01 4MDOA 3DUGA 3TKFA 1U30A 1JJKA 1BGGA 1KQZA 1TPWA 4XO7A 1P0NA 1C9WA 2V3FA 1K9FA 1Q6DA 4D6CA 2ZXBA 2CBIA 3A24A 3M7WA 1AL7A 1W9XA 1SJDA 3NQMA 4O10A 3AXXA 1Y5WA 1PDZA 3ZZ1A 5BNKA 1X1ZA 2NUYA 3QN3A 4X9SA 2BG5A 1XIFA 5B7ZA 1R7OA 3U5YA 4QJ5B 3GU2A 3EXSA 1WDWA 3EX4A 2FZNA 3B8SA 3QOKA 5FJRA 3SUWA 1P7TB 4JFWA 3WMBA 1I1XA 3PBVA 2PRHA 3NQGA 3QV9A 1D8CA 1QO2A 2J7GA 2Y62A 3BGGA 3VCCA 3PBWA 3OJGA 1QPRA 1JPHA 3A9IA 3NSNA 4DYEA 4PA8A 4HPJA 4JTLA 3TW9A 5A6BA 1V6XA 3UGRA 2FFCA 2O7SA 3PB2A 4TV6A 4MYAA 1TA3B 1XGEA 3TWBA 2QMKA 5T8GA 3N12A 1TUFA 1R2TA 1M6JA 3RRXA 1FWWA 1A47A 2VFHA 1G01A 4V1XA 1W3HA 5EMUA 3MB9A 3GR8A 3CZJA 2DPEA 2GK1A 3EA3A 4YJ5A 3M0LA 1RHCA 4B5UA 3ZLFA 1CX9A 1TJ2A 4Z0SA 2GQ8A 1SSDA 4ATWA 1OADA 2DSUA 1E5NA 3L66A 3W26A 2PRLA 2V67A 4XTDA 3AS2A 4OBRA 4C6PA 4WJXA 2OYKA 1JQXA 4F0KA 1AZ2A 3W02A 1A80A 2E09A 5I78A 2IQ0A 1IWBA 1RZMA 3KXQA 3ARYA 2BLEA 3C2YA 4O19A 4QEHA 4H6KA 3HGSA 1G7UA 2QIIA 3LCFA 1YTKA 2FZBA 4A8IA 2INZA 4XUGA 1YIXA 5HATA 4D6EA 5FEPA 4E2VA 2V68A 3W1UA 2YXXA 3F4CA 3TLQA 3DX5A 4MUZA 3N4FA 4RE2A 3GXTA 1W5PA 3FJ4A 1SVDA 2AGTA 2WVSA 1HKWA 4UMCA 3RNDA 1TFVA 4K1WA 4RPPA 3II1A 2WM1A 2GDUA 1GZGA 4GXMA 1B4EA 3GH5A 4RXFA 5L9FA 3C8NA 2VFEA 1RALA 3EEGA 4B92A 5D32A 1MXGA 4Q4RA 3KW3A 4UFJA 2XGBA 1EBHA 3UR8A 2GSJA 3EPNA 3R43A 3CYJA 4ZXLA 4JTUA 4Z08A 2PDMA 1DORA 1F61A 5JXQA 3PZTA 3QGKC 5ABGA 2TPSA 8TIMA 4GYFA 5FJTA 4ZSTA 5D8WA 4UUIA 5D37A 4ORMA 5EA9A 1TWDA 1T6MA 1E56A 2QVNA 3U2OA 1RQEA 1CTNA 1XHGA 3CO4A 3ES7A 3SQLA 1WBHA 4HOXA 3ZOAA 3P7YA 4KEUA 3UA4A 1K02A 1UJQA 3GVQA 3UA3A 1P1MA 3AIEA 3ZT7A 3E2SA 4MWAD 3N13A 2DZSA 7REQA 3TSDA 5I3HA 3D3FA 3ZQ9A 3AMLA 2JKPA 3ITLA 3E02A 4PMJA 3IK2A 5MF5A 2PZNA 2H8XA 3MI6A 4QQUA 3UVIA 1V0NA 2E1DA 2OO6A 2I5GA 3A64A 2XM1A 3OHMB 1XPGA 1AQ0A 1OF6A 2WANA 3N9SA 1N7KA 4B5XA 4UZUA 1GVFA 1KLZA 2YZ5A 1ITCA 4AD1A 4MYXA 3SB0A 1G67A 3H8AA 1OB0A 3T8QA 4OFCA 3H53A 1SQ7A 2GFTA 2HV5A 5JIWA 2I56A 1N2VA 4PMQA 2R24A 3GHRA 5A6MA 3ZVHA 3S3GA 3GDBA 3GTHA 1VFSA 2G8ZA 3J7HA 3CHCA 1B3ZA 3ZLGA 5GNXA 3P8IA 3W7QA 2XDFA 2WNQA 4XKYA 1KTBA 3OQEA 4PODA 3WQ8A 3Q58A 4DIAA 1EDTA 3ITVA 4GA8A 1YYAA 3MJMA 1VEPA 1G94A 1TJRA 1XDLA 4WK9A 4NASA 2PWDA 3S1GA 4ECLA 1S1RA 1S2CA 1W37A 3NUKA 3GW3A 5IRPA 3NQFA 3NZQA 2Y1HA 3U2EA 4XD3A 3SUVA 2P53A 2HS8A 3M5ZA 2UV8G 4XZMX 2TRSA 4GO9A 3CUGA 4IG2A 2IQTA 4LSBA 1DJXA 4H6RA 2QCHA 4JD4A 1GYNA 4IZGA 1IV8A 4X22A 3OOQA 2V5DA 2J62A 4C65A 1VFUA 5CJMA 4FZIA 4MKVA 4E8DA 3PFMA 4LUJA 4UTWA 3NIYA 3H4GA 2XVKA 1US0A 3OZOA 4HPHA 2ZXAA 1E72M 2BVWA 3AIVA 3GO2A 3M46A 3GUGA 3C5QA 3L2MA 3W3OA 3GSMA 3E2RA 4KPLA 2UY2A 2YB4A 1EXBA 2BXYA 2WC7A 3NQ2A 3QR3A 3CUJA 1WOBA 2PWGA 5KSWA 2NWSA 1RBLA 5G2HA 5G5IA 4QNWA 3OZYA 2QQ6A 3QKZA 3TTOA 2W5FA 5AZ1A 2PGWA 5D33A 2Y5SA 3EX2A 1Q66A 4LCSA 2D20A 2A3AA 5CQ1A 3T09A 4R7OA 3QSTA 2I7GA 4C6BA 1A5CA 3ANVA 2D3NA 2A3CA 3GHSA 1MWOA 2C71A 1WZLA 2AL2A 1PKNA 3FYOA 1OCBA 1DWAM 1RLCL 4EPEC 4AWEA 5H91A 1W8GA 4LV4A 5CBJA 2MNRA 4GMEA 3LYEA 1VPXA 2X09A 1W31A 5HANA 2DU2A 3ARZA 4DWSC 2PDGA 1S2VA 3IUDA 3TWAA 3MZNA 3S2CA 1C92A 2QDEA 1VIWA 1PE1A 4IPLA 4JDBA 3WJYA 3ARPA 3BG9A 3M41A 4FNTA 3SADA 4P7NA 1TCMA 3MBDA 2CXEA 1XLCA 1XLFA 2V3EA 3TC7A 1ZP4A 3TN4A 3BJFA 4M82A 5H8MA 3CWHA 3N34A 4HZ6A 1CW2A 1OIMA 1XQLA 2WNNA 3S42A 1HKIA 3RRAA 4JXCA 1O5XA 2V8ZA 1T7LA 2EG6A 3VNDA 3CMGA 3QR1A 3L4TA 1BXBA 1FFQA 3FDGA 2NQ9A 1IEXA 4NI3A 3A47A 1TELA 4FIQA 1LL6A 1V6WA 4ZQOA 3N1AA 5BROA 2ZICA 5FOOA 3C6CA 3BCJA 2IMRA 1PTDA 4E5TA 3KCLA 2Q71A 3VGFA 1Q2SA 5LHFA 1XYFA 1OBAA 1KRMA 3UJEA 4QR6A 2YCEA 1Q6OA 3TTEA 4H19A 1PPIA 1W3IA 2C16A 1UPPA 4JYDA 4TX9A 2GUBA 2Z1VA 4GE8A 3ATYA 3GG1A 4S3FA 2GVEA 1QUMA 1JDFA 1MI3A 1K8YA 2NLYA 3M0JA 1QMLA 3NQ6A 2HISA 2QJHA 4M1RA 1L0PA 2VC9A 4YVPA 2VEFA 1VD6A 1OGSA 3VE7A 2QJIA 4TV5A 3SCTA 3TR2A 4ZOCA 4MNJA 4EKJA 3FA4A 4GHRA 5A2AA 4A3HA 2ZC1A 2OQYA 4FB7A 2Q3RA 3GDTA 2Z28A 3LPFA 1A0EA 5C2GA 4O52A 3FIGA 2IPWA 1E0WA 3A22A 4PUNA 1NELA 3GIQA 3GXFA 3OZPA 3TOYA 2BBFA 2A21A 2JF6A 1XG3A 2IQDA 2WMJA 3VCNA 2DT0A 4XO6A 5D2WA 3M0MA 3QTGA 3PR2A 4ZO9A 1CXIA 1BSIA 3UVAA 2WZIA 4WDTA 1LROA 4JNZA 3KAOA 4BQ2A 1AH4A 3BLEA 2DVUA 3CTTA 2X8RA 2J24A 5BOFA 3F5KA 4RR4A 3PNZA 1F2JA 4Q8PA 4O12A 5HPCA 4GC3A 3QR0A 3RLVA 4HT3A 1JCLA 4LJ3A 2ZXQA 5K9XA 5FIPA 3IV8A 3GNNA 3QW4B 4HMNA 2I5IA 1KNWA 1Y8BA 3RUBL 3R25A 3U2ZA 3H21A 5C9UA 3NL2A 1VYPX 2W91A 3LXCA 4NIRA 2AKZA 2H3DA 2QDDA 2D69A 3K8MA 3PUGA 4NYYA 3TCEA 3B9NA 2HSAA 4NT0A 1JR1A 4E38A 3UR7A 3AWOA 3WLOA 3UJ2A 4KT2A 4PTDA 1V3HA 5CSSA 4PMDA 1XP3A 3UY8A 1KGXA 3FLUA 4RNJA 4HNTA 3O6DA 1MSSA 4GQRA 3R13A 5C70A 1RR2A 5I3IA 3AIBA 3M0VA 4TUFA 1O6IA 2W63A 4NZ5A 5F2GA 3NEHA 4H2HA 4A6GA 1S5NA 1PTAA 2Z2BA 2NV1A 3TXZA 1GVSA 1XSIA 4BF5A 4KFOA 5JQ9A 3CZ8A 3PANA 4O1CA 1R7AA 1SZRA 4C91A 3KTSA 2FJUB 2QLYA 3COTA 2GQ3A 4IIDA 3R4IA 2GOKA 3GZ3A 1YE4A 4NNAA 1Q6FA 3PJUA 1IEWA 3RG6A 5A8PA 3NWRA 2E67A 3MP5A 1NEYA 3UT0A 4BZYA 4HVXA 4NRSA 1TPUA 1ZZMA 4Q8TA 3E0LA 5HWMA 2HS6A 3WUGA 4UQBA 1DTNA 1H50A 3PJXA 4GWEA 2DZBA 1YPXA 4QROA 3SUUA 5HJYA 2V63A 1JNEA 3MKVA 2GVLA 5DCDA 4MAZA 3ZFHA 4DNHA 3SZ8A 2EBNA 3OVQA 4H6QA 1UD8A 4EWJA 5AC4A 1LG1A 3LY0A 5CPNA 2X1UA 1NJJA 3W25A 2O9PA 2E9BA 1P0KA 3WFLA 1E0VA 4D8LA 3TNOA 1REQA 4NNBA 3H2FA 1TMHA 4DX3A 3T2QA 3QRHA 2YCLB 1J93A 4S3CA 1FP9A 1EZWA 3G2GA 4LUIA 3B0UX 4P7QA 4F2TA 2WHJA 2F61A 1WUEA 2O7QA 5D30A 3W7MA 1SO6A 3S9ZA 1X6NA 4L9ZA 2WSPA 5DANA 5E9XA 2DSZA 4DUVA 1XLMA 3TYUA 4B2DD 3P62A 3PSVA 2CZFA 2VX5A 3S47A 1DPMA 4JTTA 3ARWA 1A53A 4LF2A 5CZJA 1A3XA 3EZ4A 2FQIA 1QWGA 4UQEA 4KRUA 1M65A 2QT3A 4DWSD 4HNCA 3Q45A 3IRSA 3PUDA 3EDDA 3T8LA 1NFPA 3NO5A 1W9VA 5J04A 4YYCA 2GPTA 2PDBA 4RV8A 3Q4DA 3ENLA 1MZHA 1W56A 5H1WA 3UG3A 5LXXA 1TWSA 2DQWA 1F3EA 3KS6A 3D5HA 2A3BA 3KRUA 3EEZA 1EWDA 4QDMA 3WLTA 3GVGA 3AYSA 1XYCA 3W2LA 3W7EA 3F2DA 3SECA 1CLKA 3LPOA 3CAKA 2OSWA 2FTWA 4E8CA 3GNPA 4IUOA 1U33A 4AIEA 1GG0A 1AW5A 3RF9A 3QGAC 1P4CA 1CGTA 3BMWA 3IUHA 3H2OA 5LNUA 3TMQA 4NAEA 2VD8A 4Q6XA 4UTJA 2A5HA 1GHRA 1I0BA 5G1YA 2YL5A 1JXKA 3N2BA 2P8CA 4EK7A 4ZE5A 1XH2A 3I7RA 1SZGA 3CV7A 1JD9A 3NGJA 3SSJA 1Z6KA 4JIHA 3ZIZA 4AZCB 1I6NA 5REQB 2RDTA 3DI1A 1Z89A 3AUOA 4AF0B 3TQKA 4M7TA 5KMYA 3EX1A 3FKKA 8XIAA 3CWNA 2J7EA 3PM6A 2OMAA 1FDJA 4TMCA 1EC9A 2G4JA 3CHDA 2ISDA 1O94A 1ITUA 3LD5A 4GQGA 4YNGA 4C5YA 1BWKA 3KEHA 1I4NA 4I7WA 2QUVA 4DJDA 2E28A 5CXPA 3ANYA 1QNVA 1EH9A 3P2VA 4M56A 5E6YA 3VZZA 1KWGA 4A05A 1RCXB 1X97A 5C7VA 4MLRA 4G5DA 1TSIA 3MBFA 1BVWA 3LLFA 1XS2A 4O0QA 3MMTA 4HU3A 4N6FA 4JFSA 3MCMA 2C8NA 3V5FA 3RLUA 3LM7A 2VCBA 4PCSA 2VL4A 3P8JA 3SCOA 1RQBA 4A2RA 1VJSA 3AISA 3RCYA 1GOWA 1B9ZA 2BVTA 4BR1A 3TX9A 3HGJA 2WCAA 1F3WA 4DELA 3TQ0A 2YJQA 1S2WA 4XZHA 4UTLA 3ISIX 3FY1A 4BQ3A 1ZGDA 3AYTA 4UQ9A 1BFNA 5J5DA 1EKOA 3RN6A 2YYUA 4R27A 1M7JA 2PCEA 1OYBA 4N0RA 3RITA 4I6KA 3O07A 1CXKA 3DKLA 3W2KA 4U4MA 4UIOA 1PYMA 1GNXA 2O9TA 3FNDA 4DWDA 1NOWA 4CNNA 3EWZA 4WOZA 4FF5A 3VOIA 4GYJA 4YTRA 1C3FA 5A8GA 2OEKA 1QASA 4E2BA 3C3UA 3UG4A 2YA2A 3QQWA 1XX1A 1HTIA 4C6IA 3W7CA 3G5EA 2ABBA 3PUOA 1PDYA 3GIPA 4IFKA 5FF3A 4JX5A 6ALDA 1UR3M 4H4IA 2BHZA 2GOUA 4IFRA 5DELA 4DM2A 3IGHX 3UJFA 4IJCA 1P0DA 4O18A 1OZQA 3H55A 3CB3A 3Q94A 5CZKA 8CGTA 1RJPA 1U1UA 3OLEA 4FOJA 1HN1A 3BV7A 4HP5A 1FVPA 4DVOA 5EKYA 1UWQA 4H9VA 2QR6A 4G1KA 3VIIA 5BXPA 2J9XA 1ZP3A 4MWAE 5FJIA 1UR4A 2RKXA 3W7JA 4QG8A 3VNIA 3LHTA 3SCRA 4AHOA 1RP8A 3WH8A 4O4VA 5G1TA 3V1PA 1XRFA 4C1KA 3YPIA 4WGXA 1I60A 1EB3A 4O1DA 2WK2A 1TTJA 3WBWA 4E8GA 2VC7A 4NX5A 4Q8OA 2C14A 1K9TA 2VX4A 2YBTA 3V5CA 1HJXA 2H9AA 1Q5MA 3WEZA 3G8EA 1BKSA 4KH2A 5FF2A 4LYPA 4HTYA 4HTBA 4QXIA 3NQ7A 1E6NA 3BGJA 1A4LA 1SFJA 4DUXA 5MKGB 3R0UA 2QCMA 2ZZ4A 4MAVA 1N8FA 5DO8A 1AH3A 4F9DA 1ZQ5A 1ONRA 2YDAA 5GNZA 4JIQA 1XICA 3FVDA 4UBPC 2BHUA 1W9PA 3U2CA 3N25A 2A79A 3GAYA 3I7QA 1HF6A 3FSUA 1PS9A 3M4HA 1OFOA 1RLDA 4XG1A 4DO5A 1LBFA 3TU9A 3TMLA 3R6IA 5T9CE 4UTHA 1ZBKA 2FGBA 4ZE4A 1O68A 3CZLA 4ZO8A 2RJGA 3DG7A 4DF1A 5AHNA 1ZCOA 1H11A 1G7VA 4MPKA 3MA8A 3W9ZA 4EIVA 3RHGA 4LEFA 2GQAA 4CU6A 2EQDA 4AC7C 3B8IA 3ECQA 1MXSA 2CLLA 4R88A 5C8BB 1LRTA 5HUOA 2ISWA 3FX4A 1EFZA 2Q8LA 3VIMA 4QRNA 3OBKA 2NV9A 2VDHA 2CU0A 2X0HA 2WHKA 1QNOA 4YTQA 4M6QA 1TPH1 3QOMA 1DBTA 3WJSA 2XIIA 3WSUA 3W1LA 1B5TA 4QHRA 3T0AA 4PULA 5HULA 1XL9A 1Z9AA 4EPDC 1B31A 4Z2JA 4Y9MA 3PBUA 3R94A 1A3WA 3N19B 4LVBA 2X40A 3GG7A 4D1IA 5J5RA 3BAJA 1MDRA 1ONEA 2OTDA 3L67A 1VENA 3JU2A 4PUDA 4CCCA 1OF8A 2Z6JA 1I2QA 1M7PA 4F0HA 1DIKA 1W5NA 4RDWA 2JFEX 4NF7A 5D2YA 2PU0A 3KDOA 4Z2IA 5I07A 3K4AA 2AKMA 5CPTA 1B90A 3EDJA 1PTGA 3PPGA 1XM3A 1W1ZA 4AG0A 3HM7A 3OW1A 4IT1A 1BXCA 4LUSA 5ABEA 4GY7A 1E0TA 2ATMA 1DJNA 1NFGA 3KE0A 3H4XA 4Z1YA 1I0DA 1QNSA 2Y5EA 1FWCC 4J7RA 3NDYA 5LIYX 2JEPA 2VQUA 4LTSA 1WDDA 2VWTA 3WNLA 4HZMA 2QJNA 1F8MA 2A6LA 2PU1A 3KDNA 2V9DA 3G1VA 1H49A 3TIMA 2GJXA 3K1DA 3WH7A 2JGYA 5AVHA 1TCDA 4K36A 2BY1A 3ONBA 1YKWA 4F79A 4GINA 3HF3A 4YPJA 3H22A 4WY0A 4OBTA 2ZZ2A 3UEQA 1A5KC 1NDZA 5DBUA 1O1HA 2NX9A 4L9XA 4OKDA 5A6TC 3VFCA 1V02E 3OQ8A 4JN6A 3MS8A 4V2XA 1F3TA 2WCGA 4AVNA 3VA8A 1KR1A 4AZGA 2PWUA 3GDRA 3ZR6A 3C52A 1V0KA 3W01A 2PTXA 2WXDM 4DYKA 5CJ5A 3VGGA 1VFFA 4E3VA 3ZMRA 2X1IA 2BOGX 2Y6ZA 5ABTA 2D0GA 3ONCA 1BVZA 4JKMA 1FCQA 3Q37A 1UOKA 4XD5A 2ZADA 3GQYA 3KS5A 4E2DA 3SFWA 3SIZA 7PTDA 4N7QA 2HXUA 1U1HA 3IEBA 2W61A 1LT7A 2ALRA 3S9IA 4DM1A 3C4UA 4PMVA 5M1TA 4I3GA 4RNIA 3U9IA 4JHZA 4PRTA 5I6SA 3WLPA 2X0YA 1OX4B 3L21A 4K38A 4FA3A 3W7NA 4TXEA 4L80A 5I5RA 1GQJA 5I06A 5CBIA 3LCXA 5E1QA 1N55A 1QI0A 4B2DA 4F0MA 1VBRA 4GZJA 3GC5A 3TH6A 5AZ0A 1QCWA 1Z44A 1MUMA 2IW0A 2OR2A 4U31A 3LBMA 4GQBA 3WH5A 1H61A 1J5SA 3F2BA 4HZ8A 3UNDA 1D3GA 2ZVRA 3HQOA 1WZMA 1X6LA 5HNUA 3N4EA 1HVXA 3PC0A 3RCNA 2ZFAA 2JEQA 3KRZA 4WZHA 3BCFA 3EGJA 4Q7IA 4JY9A 3MMUA 2WSKA 2I16A 6XIAA 3FJNA 3IIVA 2R91A 3MHUA 3WUEA 4GH3A 4BJHA 4RZ4A 4Y8FA 3ZSTA 2BGQA 1E6SM 1H1YA 1K8ZA 4DZHA 3K1GA 1TZZA 4E4FA 3F4VA 3VKKA 3AIRA 1Z69A 4M8UA 3DENA 2DZAA 1IT7A 1K6WA 3TYEA 3UPBA 2EPNA 4NZCA 1YMYA 1YRRA 2PDKA 2D3LA 2TYSA 2ZZ3A 1J12A 3QV7A 5EMLA 4MY1A 5HBFA 1CGYA 4B5NA 1UZHA 1S5WA 5LA0A 1LOQA 1TWIA 3L5AA 5BOEA 2FPVA 3PZVA 4HN8A 4QQ3A 3NQ8A 3LHZA 2PSNA 1XSKA 5ABFB 1TE1A 4RNFA 2OELA 3AXHA 2VENA 1U83A 1JYNA 1TPFA 5C9WA 1DJHA 5JVLA 4HOZA 4GIYA 2XIOA 5BYWA 2KX9A 3H2NA 3UWQA 4CD4A 4A4AA 2W79A 1BWLA 3P67A 4OHQA 2WMGA 4FX8A 4ILSA 4AX6A 4FP1A 3OIHA 1A5OC 4N9DA 1ICSA 3QPEA 3PTDA 1TPVA 4CCEA 4HK7A 1WXYA 3CEUA 1SSGA 4C6MA 1GVYA 2NVAA 3G0XA 3AXMA 4R85A 3LXAA 9XIMA 3KRSA 5BZAA 2CLIA 4C7DA 3LXBA 3R79A 4I9MA 1W0MA 3BAKA 4P8WA 3KX6A 3G1DA 1TTQA 4WXZA 4MTVA 1WUFA 5ECUA 1KCXA 3GBDA 4HHHA 3G3DA 5A1AA 5E70A 4L5ZA 2XUCA 4PBEA 3AXIA 4G1NA 2FMNA 3R1ZA 4INFA 4YXGA 1GQNA 2XH0A 4LYRA 4UFKA 1OG0A 1JZ8A 3W1NA 3K8KA 3S2MA 3FS2A 4K68A 2OT1A 3CT7A 1YEYA 4PH6A 3W1TA 3WENA 1KBBA 3TYZA 1Q85A 2QULA 1E15A 3DU0A 3AMCA 5G4HC 3PZ9A 3WK0A 4HPNA 2HRWA 4B5SA 1JCMP 1BD0A 1ESWA 3IJLA 2VC5A 4PTWA 3OVPA 1QATA 3W7HA 2ZXDA 3AIWA 4WXYA 1EOMA 3KBNA 1W1YA 4ZQCA 1EJTC 2I57A 4BEUA 4GCAA 3V36A 4KS0A 2EJ1A 4ADSA 2H3BA 3S8HA 2QJJA 2YGYA 3MHGA 1S2AA 4TIMA 1YX1A 4NP7A 4V28A 3HN3A 3P0XA 4TR9A 3M07A 1K9EA 3UESA 2OXNA 3XINA 3DHUA 1S2TA 2YZRA 1KBJA 1TX0A 1C8XA 1F4AA 5FCZA 4JAWA 2J8TA 4JHOA 4D72A 4BHYA 4HGXA 4N6EA 1S2UA 5HINA 3MMWA 1QK0A 5HDRA 1ADSA 1TQXA 1T41A 1HJVA 5LKYA 4NZ1A 3NAVA 1K70A 3ZJ7A 3BMVA 1BSLA 4QLKA 1A5SA 1V79A 2F8QA 4GJIA 3CLWA 1CENA 1FWEC 4MKSA 2HJPA 5D04C 4L1XA 4MLJA 4JTCA 4N2YA 2Q8ZA 4P7LA 3ES8A 3TK7A 2DORA 1UWUA 2QXWA 2AAMA 4CQBA 3B9OA 2V5LA 5FF7A 1NIUA 3OVGA 3T0TA 1LWIA 1NWTA 1LRQA 1W91A 5CLTA 3CZEA 3VIFA 4J9JA 1LOSA 2QAFA 3N6QA 1CGWA 4H9XA 1V93A 4W7UA 3FYYA 1H1NA 5HWNA 3UPMA 3ITCA 3S83A 3MUY1 1MZRA 3B0VC 3WH9A 3M0YA 2IKGA 3PS7A 4WDXA 1MUCA 3MDUA 1DWHM 1XH0A 1FWSA 4LGXA 3S6OA 3C2RA 1J18A 2WVVA 3BLIA 1KB3A 4IFOA 1M03A 2PTYA 4HNVA 3L4ZA 4H3DA 5C0QA 1OYAA 4GYKA 2IPFA 4LBUA 2C0HA 2VEIA 2XFRA 3E2QA 3V0SA 3TAOA 3IUIA 4GFSA 4HQVA 4WQ6A 2W4XA 4A3YA 1KKOA 2NQJA 2CZVA 1R9YA 1JAEA 4ZB2A 4FNQA 4DF2A 3BVJA 5U4NA 3HURA 3WLKX 5A6KA 2DJXA 1A49A 3WYZA 3M0XA 5EMKA 4WSKA 3TA9A 3KFTA 3HPFA 5FF4A 2YYTA 3P80A 2XG9A 3LCGA 4OECA 2YLLA 4Y9PA 2OSYA 4JYEA 3NA8A 4C1LA 3AI0A 4J2PA 4AB4A 4PGLA 4CU8A 3T0CA 4B4HA 4I5UA 2Y8UA 4Y6GA 1FH9A 4W84A 4F8XA 4HKPA 1UH3A 3HPAA 3ZJKA 4YHEA 3BO9A 1LF1A 4IOTA 4K8HA 2X7VA 2AMXA 3UXLA 4RW5A 2V5CA 2WYSA 2XHYA 3DFYA 4PUJA 1E4MM 1F8IA 3TTYA 2VXNA 2VGBA 1J5TA 1ZSXA 4NI8A 4QISA 4OIFA 1GVEA 2YCIX 4CUCA 1UWTA 4WGHA 1MYRA 1JUBA 1XYZA 4EWND 4QNEA 2GJRA 1GOXA 4DQWA 3GU9A 1KCLA 2EPOA 3P93A 4ZA0A 2ODOA 5L6UA 4MJZA 3NYDA 4NX0A 1G4PA 4AH7A 3ABXA 1DQWA 4UWMA 4LY4A 4QBXA 4UOJA 5KZEA 5AVNA 3LSBA 4I7UA 3NPXA 4MB3A 2PLJA 1LL7A 4DI8A 4Z2LA 1NDWA 3TP4A 1UW9A 2ZE3A 2O9RA 4D6FA 1UP0A 3G1HA 3O1NA 4JY8A 2AAAA 3L9CA 5I7GA 2NWRA 5F2MA 2P10A 3OYZA 1BQCA 2YL6A 4IMEA 1QI4A 2J66A 2WC4A 4QLJA 4DN1A 4MWAB 3UR5A 1X7FA 1BYBA 3B0PA 1IYXA 1MFVA 5DXYA 5DEZA 2WVUA 2QF7A 1YDOA 1OY0A 3WELA 3TROA 2QW5A 3WF1A 3OPSA 4S3BA 5D03A 4PRRA 1FWAC 1VHNA 5G1MA 1M3UA 1FFRA 3WQ5A 3H70A 5FI8A 4N9EA 4KETA 4BS0A 4L9YA 3CH0A 2WMIB 2OWCA 1JZ3A 5DFAA 3WK2A 5HNRA 3UG5A 3QLDA 2QKFA 4NXSA 1LWHA 5LNVA 3B05A 1TTPA 2V3GA 5I0DA 2VT0A 4GPNA 4FR1A 1VFHA 3F4DA 4DZAA 2DSWA 3QY8A 4ENLA 1EF2A 4YLWA 6CGTA 1L9WA 4XBSA 1ZFJA 1TV8A 3UWZA 2PGFA 4J40A 5FJOA 2FPTA 1UWSA 3FHQA 1IZKA 2Y5JA 4C6EA 2HQAA 3GHUA 1NFBA 5D38A 3O05A 3B04A 1EHNA 5CCZA 2CCRA 3URNA 3V4BA 2C3ZA 2ISVA 4JTGA 1GVOA 1CB2A 1H7PA 3AROA 3EDEA 3CPUA 3N2CA 4S23A 3NZGA 1EDQA 4OV9A 1FWFC 3W00A 5FSDC 4KWSA 3KL3A 3FXYA 4LT9A 4U10A 1PBGA 2EXOA 2PWFA 4DBEA 2XJ7A 4JN8A 2QZRA 3GBEA 1J6PA 1UMLA 2Q02A 4HA0A 1MEIA 4Q7BA 2W92A 3F4NA 4JEJA 3OZMA 1WKYA 3UZ5A 2XINA 3UWVA 1UASA 3W07A 4UTWC 1LZOA 2G41A 3MCOA 3CQJA 3IPWA 5KZ6A 4HCLA 3L4VA 2IUZA 5I2UA 1QVBA 4AU0A 3WQFA 1O12A 2BY3A 2A3LA 2ZRUA 3OA5A 4H9YA 4KERA 5AHMA 4GKLA 3EMQA 2EJAA 3TE9A 1VGAA 1YPFA 3NM3A 3JZUA 1UP2A 3HV9A 3BLPX 2VGIA 5AHLA 2OO0A 3WDQA 1KCZA 5HJLA 1BEUA 1O7AA 4XISA 3IIZA 3M47A 4Q8UA 4QJ1A 7CGTA 1Z42A 2REQB 3I6RA 4PB3A 1EC8A 1I45A 4O16A 3EOLA 1EP3A 2FVLA 1HNYA 5A6BD 4XVEA 2Z1XA 1EUNA 1Z8AA 1W9BM 4LYQA 3BUVA 2HVOA 3MPGA 4OOZA 4FLQA 2GWNA 3M5VA 3LGGA 3CV2A 1A0DA 2XVLA 1QHOA 3O63A 3UQNA 3THCA 3R12A 5FEZA 1E6QM 3QEZA 1XKJA 4LX4A 4DBSA 1L6SA 4LU0A 2CLHA 3MP4A 3TUUA 1V6TA 4QAIA 1ZB5A 1P5BA 5B7YA 3O3RA 3S5NA 3KLKA 3MCNA 3FN9A 4RL3A 4QDPA 2DV0A 3H24A 3LM3A 4IQLA 3REQA 3CQKA 1E6RA 4W7WA 1ENUA 4C1NA 4FIRA 2XSBA 1O60A 2X1RA 2R82A 3UZWA 4N4QA 4JPGA 4PFHA 3W1MA 1Y7VA 3KL0A 2OODA 3HPSA 2ZA3A 3MP3A 2HE5A 4TQTA 4G2DA 1AW2A 1JEZA 5LIKX 3VD3A 4PSRA 4Y96A 1A50A 4XUYA 1UKQA 1VBHA 2F2KA 5A5WA 2ZX7A 2WLZA 5HR6A 4FXSA 1EWEA 2CHRA 3AWNA 4PUUA 4US5D 5K3VA 5TF0A 1OQFA 4PC8A 4FLOA 1XINA 3E0IA 2DZUA 4CEXC 3ABRA 4LRTA 2NUXA 4EPBC 3WEOA 3V5OA 4W8BA 1OWQA 1OHLA 4GI6A 1EZ2A 4X2PA 1J79A 2WB5A 2WMFA 1QDSA 3W1PA 4AAJA 1KXVA 1AJZA 2E9LA 2G96A 1J6OA 1WDRA 1PCWA 4M19A 3WQ6A 3W1AA 3RPDA 5IDIA 1R47A 3C0LA 1WO2A 1VEOA 2PI6A 3REQB 1IIGA 1KO0A 3A5VA 2WHMA 2WOQA 4AD5A 2PWHA 1Z41A 1IZCA 1QBAA 4KIEA 3KBJA 4H7CA 4BKNA 1KFJA 1TMLA 1Q2RA 1KM6A 2QPXA 4AZ5A 4GD0A 1JI2A 1H4PA 1R86A 1KFKA 3VDHA 3HTWA 3TN5A 4LUTB 1GVIA 1S5MA 3GHTA 1V03A 2INFA 4CD6A 3U3HA 3EWBX 5DRCA 4FI4A 3SQMA 4C6FA 4UNLA 1HL9A 3VOFA 3AIUA 3ERPA 1ITQA 2OKTA 5CLWA 4RE3A 3LZ3A 2W0UA 2F2HA 3RLGA 1WV2A 2QEZA 1CCWB 1XF0A 3KWXA 3FSTA 1DIDA 3AS1A 3URBA 3PSWA 3IJQA 4HYWA 1E0XA 2F6UA 4D8ZA 5C6MA 2FH8A 3CM4A 2Y61A 2P1FA 3TJIA 1RQHA 3ABSA 4N4PA 5CGQA 3P60A 3HQ1A 3AZTA 2NT0A 1FX6A 5CSRA 3WLNA 1GPWA 4A29A 3FOKA 2YDQA 3VKDA 3W38A 1V7YA 4BCEA 6XIMA 5IXEA 1QPQA 4L4LA 3CWOX 4HK6A 3HG5A 1ELSA 1OCQA 1F6KA 4K7YA 3SRDA 2YL8A 5HNTA 4PMRA 1SGJA 1QO5A 4WJEA 1E3ZA 3TV8A 2WPGA 1MQQA 3DHFA 3C2EA 4UB9A 3UWUA 2BXZA 3VZYA 3CU2A 2Y85A 4TX6A 3V18A 4X3ZA 4CD5A 4Q4SA 5A3HA 1V5XA 4KESA 1TWWA 4QX4A 5DMMA 3UYIA 3FKRA 2OX1A 3G3MA 4LB4A 5PTDA 1SR9A 2NZLA 1XFCA 4M3PA 2O92A 4Z17A 4RDZA 1A5BA 3TA6A 3DHDA 4F0LA 3T2PA 2BV9A 1VHCA 5XIAA 2J79A 2YR1A 4GVFA 1QR7A 4HNNA 2LLEA 1KM4A 4X0NA 3UCCA 2VEPA 1W54A 3GVWA 2JQXA 3O8AA 4U28A 5C2XA 3DYOA 4ACZA 3LCHA 3HU7A 2NSOA 2BZNA 2ZRZA 3VD5A 3BSGA 3WD2A 3T44A 2OFJA 5AC6A 3ZS4A 4B3KA 3WD4A 2ZRXA 2FFIA 3INPA 4DPQA 1XYLA 4LAOA 4LY8A 2CFFA 1VLWA 4M51A 2VOMA 4FO4A 3W7OA 5CZSA 5CZTA 4FOKA 3LNPA 4H8VA 1EXPA 1M01A 2FZMA 3PF3A 3LGEA 4PBFA 3NSXA 2J77A 1CPUA 3B06A 1LJYA 1UIPA 4Z2KA 2X41A 4LS0A 4HA4A 4IQEA 3SFKA 1AQMA 2YXGA 4UQAA 3KM8A 5DY2A 3PPFA 4DZIA 3BGAA 2PC4A 3BOLA 1EP2A 2XFYA 3CZGA 5D2XA 2QHAA 3TN3A 5AYXA 1XC4A 3O2LA 1TV5A 3MSDA 5DBTA 5A6LA 1AG1O 4C90A 3IGUA 3STPA 4ONVA 4KWUA 4DJFC 3W7RA 2ZUTA 1WDQA 3BANA 4WR3A 3AHYA 1L8PA 3W71A 3W85A 2RAGA 1SM9A 3EOOA 4KWOA 4NAFA 2ZUUA 3S1WA 2ZX9A 3AHTA 1EPVA 1UR8A 2POTA 1FWDC 3RCMA 4WCJA 1K7EA 4H8HA 5HNNA 4DWSB 2BX7A 3N15A 1ZENA 4AWUA 1JZ2A 2DIKA 4AD3A 3BLLA 4L7ZA 3N9RA 4RCXA 1ZPTA 4R53A 1OINA 3JW7A 1CXEA 3OIXA 1UH4A 2C13A 1WDPA 1I8JA 1QBBA 2FKPA 1ZJBA 2XZ9A 4RXGA 3UG8A 1E9LA 5AHEA 1J0JA 5LZLA 1CDGA 3AMKA 1JNDA 3FVMA 3SN4A 1XBYA 4W87A 8A3HA 3MV11 1BTCA 5I09A 5U7SA 1WDSA 4O14A 3CHVA 3UWYA 3NZRA 3CNYA 2YBVA 1P7TA 1GKPA 3SY8A 2L5HA 1GVRA 9XIAA 5HK4A 5T26A 2VHLA 1TX2A 1XISA 1R30A 3QZAA 1P6BA 1LL4A 1OK4A 4MGGA 5LIUX 2PMQA 3N29A 3L4YA 1F73A 2BS9A 4KMQA 4Q8NA 4LAKA 4IX2A 5HQMA 1TA3A 3TYCA 1RA0A 2CBVA 3GXNA 3KHDA 4DJDC 1HVQA 1X38A 2XM2A 3FDKA 3QHOA 3GWQA 5C9XA 3K13A 4HD5A 4LH8A 3V1HA 4CNTA 4D8AA 4PMYA 4F3HA 2FMOA 4PL1A 3WJZA 3VIPA 2VCCA 1RH9A 1R3VA 4PN2A 5CJNA 2FHCA 2Y8VA 2G95A 1I2PA 2PGRA 2QVHA 4BQ4A 3NQAA 4KQNA 3L4WA 2VFIA 2HE8A 4UTTA 4GQQA 5F2LA 3B8VA 3WNNA 2CZ5A 4U2ZA 3RO6A 3TYAA 4NSBA 1OEPA 5FAJA 4GUGA 3WK1A 1UKSA 4BF7A 2BFGA 2BY0A 3SIMA 1TR1A 3PZNA 4P2VA 1B9BA 1XLHA 1QPKA 4DO6A 1JAKA 3VTRA 4FR6A 3W24A 3QMTA 5DCEA 3G6MA 4UMBA 4Z42C 1XCFA 4EP8C 2YFOA 2PCQA 3QQ1A 4JN7A 4GI4A 1A4MA 1G69A 2C6QA 3N6JA 4O1BA 2DSKA 3L0GA 4B5VA 3KOXA 4LEQA 3S5ZA 2DFAA 3HJZA 4AZIA 1UUQA 2DUZA 1TJPA 5HJXA 1RK5A 2XN2A 1KV5A 2YBUA 3PN8A 4B9ZA 3CEPA 1LYXA 2V6AA 4IMCA 1MUWA 2PDCA 5FA5A 1HP4A 1N82A 1W32A 5IHSA 3VD9A 3ARUA 1GJWA 4O1FA 4AZHA 3MWAA 3OA3A 3WJWA 4JIRA 3B3DA 2WMKA 3B9AA 5D8ZA 1W17A 3KL5A 2J6XA 1Q6EA 3TYDA 4XZWA 2DZWA 1VCGA 3THDA 1EEPA 2FB2A 2YFNA 4DAFA 5LGZA 5C7HA 2ISFA 3NEVA 2ON3A 1H7WA 2YSWA 2R1MA 4WD0A 1KM3A 4LCQA 3ORWA 4GO8A 4NHVA 1ME8A 4YVXA 3WBXA 4ZTYA 3GVRA 1UA3A 3C2VA 3GUWA 1C90A 2CBUA 3U8GA 3ZJ8A 1VZWA 3KWSA 2YPIA 3W2UA 4ICMA 3NDZA 3WLIA 4JFUA 4D6JA 3PK7A 2B7NA 3E5PA 9CGTA 3PBYA 1NP2A 1X1OA 4NNCA 3W22A 5BU9A 1VCVA 4AFYA 3EB4A 4QSFA 1PWLA 4CN1A 3HIJA 3M5YA 1FCBA 3N6HA 2D73A 3S4TA 1NM9A 1W1TA 5GPRA 2QYGA 1JZ4A 4US5A 4JFVA 4N9BA 1US3A 2D2GA 2P0IA 1RVGA 4RE4A 4K1GA 3RDKA 2ZWYA 1ZAHA 2Y24A 4AZ6A 3VMOA 4US6A 2H90A 1TQJA 4MDPA 2J88A 3BQ5A 1TRIA 2BOEX 5C54A 1JYWA 4ES4A 4GGBA 3G1XA 4YMZA 4PMXA 1G5AA 5F1VA 5HQEA 3CLMA 3WH6A 4RZ5A 5KETA 1KA9F 3CAVA 3HG4A 4XZ9A 4S1FA 4GX8A 5TD4A 3GKFA 2FVKA 5BXTA 2XH2A 1J2BA 3VAVA 1LUCB 1IR1A 3OO2A 2F6KA 2CESA 1DHKA 3VDGA 1L6GA 1TJ1A 1IEVA 3H7UA 1YW1A 3EKZA 2HZGA 4HA1A 2PLMA 4GUHA 2J25A 2I5QA 3N2OA 2RJHA 3THAA 9RUBA 3KOZA 3VUSA 4WKFA 2FTYA 1FHLA 3OYXA 3ZYZA 3MU7A 3WQCA 4TVCA 3KP0A 4A8RA 1LQ0A 4DRSA 4JEQA 4XAFA 3L65A 1QXLA 3ABOA 3OGVA 4PB5A 1KFBA 4XX6A 2W62A 3CT2A 4DJFD 1MFUA 4OBSA 4W89A 1V3MA 1A5NC 1CNVA 1A5AA 3QYQA 4H6EA 3W1QA 1ZBCA 2ZRYA 4H9ZA 2Y70A 3LCLA 2FZ9A 1JFXA 3KOFA 3N2TA 1I9CB 4W4QA 3KZSA 2PD9A 1PX4A 3SGZA 2YXOA 4NZ3A 2D22A 4GZ7A 3A4XA 2HCVA 5AHFA 4FALA 3KBSA 1MRAA 4CQDA 4MZ1A 4XB3A 1V6VA 5K2ZA 4TO8A 1ZHAA 5DQPA 4AMCA 1ME7A 3M44A 3PBGA 2NX1A 1DWIM 5EMYA 4ZTXA 2PDFA 2CHNA 2YIHA 1V3IA 5EL1A 2GL5A 3POCA 1SW0A 3HA1A 1W3JA 4XZIA 1R87A 2RGMA 1C8QA 3JZEA 4S3GA 3RK8A 1E6ZA 4O17A 5FESA 3UZZA 2GJPA 4J5NA 4OZOA 3VI2A 4DO4A 1Q6LA 3N04A 4E2OA 2BGSA 3MWCA 3WFZA 1UD6A 1WB0A 1EP1A 5I79A 3VM5A 4C6CA 4GBUA 3HO8A 1XJBA 4PUEA 2PAJA 1WAUA 3A4WA 7XIMA 3UY7A 3WLRA 3LENA 4O53A 3KVMA 3L12A 4ROQA 3DAQA 3EB2A 3RM4A 1XLBA 1PIGA 2XVGA 4ACYA 3RO8A 3T07A 4YTTA 1H62A 2AGKA 5FJPA 4WKHA 3VYLA 3CYVA 3T4CA 2JF7A 3M6YA 2X1SA 3WLJA 1Q6RA 2Q09A 1JULA 5G4WA 1XIBA 4U33A 4DJDD 1EJVC 3AHVA 3E3HA 4DPPA 3RM8A 3GXDA 1C29A 1M41A 5IDZA 2B31A 3S9YA 1TYGA 4E6MA 5JIPA 1R3TA 1EL3A 1DE5A 3TYBA 4U3CA 1NWRA 2PTZA 4JTHA 4IXHA 2HK0A 1PKYA 2ZUWA 3N3TA 1RAKA 3EMZA 3NZPA 3URAA 4OOUA 4LWWA 2PD5A 4OQVA 5D9MA 1YBQB 4YS1A 2WBGA 4AMAA 3M64A 3GH7A 1WKFA 4OUIA 4D9PA 1G9HA 5TQLA 1OIFA 3LI1A 1XUZA 4EXAA 5AHIA 3CMJA 3PBMA 1O95A 1EQPA 3AJ7A 3T9PA 4D6IA 1D7FA 2GWGA 1OC6A 2NUWA 3QPYA 5FF0A 4KCWA 1XLIA 3S6DA 1EGZA 5LSMA 5CC3A 2PDLA 3AOFA 3DI0A 1PSCA 1VBGA 2FGZA 3PJWA 2HNEA 4H83A 1R0MA 4BQ5A 3APYA 4HYVA 4XBJA 3XISA 1W1IE 4I9AA 1NWSA 4NKCA 2DW7A 1UQYA 3LPGA 1FKXA 3TAKA 3CV1A 3RU6A 5CPMA 1KTNA 1HL8A 1SJBA 1BHGA 3UR2A 4URIA 2PDWA 1XKYA 3VM7A 4J28A 5XINA 3EAUA 4H7ZA 4A3UA 1ALDA 1W1A1 1XSJA 3BZJA 4H7VA 1BQGA 1BWVA 1XH1A 2ZA2A 3ALFA 4F0SA 4BK9A 1QI2A 1IZJA 4AEFA 1V3JA 1E9YB 2PFHA 1QNRA 2EHHA 2E40A 1DQXA 5GJPA 3UNTA 3ARQA 2TODA 5KTLA 3G1RA 5BRBA 2QV5A 3M43A 4L1WA 3IV3A 3HZ3A 4ZODA 1ZY9A 1JPKA 4LVAA 3GE7A 3UYCA 1M7XA 3N17A 4LBRA 4ZOEA 2VMFA 3IGXA 4AXKA 1F05A 1W6TA 5H8PA 4KIRA 3N18A 4UXDA 4O8AA 1AH0A 4R33A 4U3AA 1HXJA 2VWSA 4FOUA 4RZ6A 2VX7A 3FJ6A 3DESA 3G1AA 4CKQA 3P5ZA 5DN1A 1QNQA 2Z4GA 3N11A 4QITA 3WLSA 3VUPA 5EFFA 4GUJA 1WXZA 1JG9A 2X42A 3R11A 2Y0FA 3TW7A 5C71A 1F76A 5G4EA 4LAUA 4QS6A 1IXQA 1DVJA 1XWYA 4O0ZA 2Z27A 5CKSA 1UP3A 4BI7A 3NQVA 2ISSA 1ZNNA 2X7WA 1NVMA 3C61A 1EJXC 5M3WA 4AQLA 1AD1A 3TDFA 1RBAA 3GD6A 2QUNA 1PX3A 3HG3A 3AHXA 1KQYA 4PUMA 1VFMA 2J75A 2E1WA 3S2JA 3AIQA 4Q4QA 1UHVA 4J3TA 2CC0A 3TZFA 1E73M 4NQ1A 3E74A 4HNUA 4YHGA 4ATDA 3UW6A 4ZQPA 3WL0A 4HNLA 2OQHA 1E4LA 3IJDA 3AMDA 1QPNA 2RGLA 1GJUA 1Q65A 5ABHA 5CZ0A 3CH9A 1QPOA 4L61A 3BQ6A 3DC8A 3PWIA 3VDBA 1XDJA 1HW6A 2A3EA 4HU4A 3TJ4A 1XIJA 1EHAA 2DJLA 4WLCA 3DGBA 4JTIA 3USZA 3NTYA 3C0JA 4ZB0A 3QZ6A 3APTA 4U2YA 2DT3A 4HHMA 1KFWA 5F2IA 1RUSA 1DWJM 3S5OA 5LXEA 4EAMA 2F84A 4ZZ9A 3TSBA 5DY3A 4Y9AA 1K3UA 3MUAA 1Q13A 4E3TA 3W88A 3KBVA 1DIOA 4ZXOA 3SCSA 4BEQA 1C9DA 4WIWA 4JNMA 3VX0A 3NR0A 4GVIA 5BU6A 3S1XA 5M03A 2WO5A 4B5WA 2GDQA 4LBSA 1RD6A 4JQ1A 4C6KA 1LOLA 4FNSA 4NJGA 2C1GA 3WY1A 4CQ9A 5BXRA 4IMGA 3QYSA 4IP7A 5LNWA 4H00A 3QHMA 5D9OA 4E0CA 1UZ4A 1UBPC 2V38A 1VC4A 3USBA 3HMCA 3WD0A 1J0KA 4PTVA 2WBKA 3RJYA 1EO5A 1JD7A 1KGWA 4BF9A 1OJXA 2YCLA 3O6AA 1GGOA 4JQ4A 1W9UA 3EA1A 2QPUA 3LV5A 2ZUSA 2ZA1A 1PB0A 2XVPA 4IQDA 4CQAA 5CSUA 1W3NA 3F03K 3W73A 1I2NA 5JBDA 2X2GA 3W84A 3BH4A 3I7SA 3WLMA 3SSZA 1FDYA 4ZL1A 4V27A 2IKIA 4AY8A 1E4IA 1XBXA 3QF0A 4JKLA 3WLQA 1EJRC 4IIHA 4MUPA 1DL3A 1ZALA 1K4HA 2X05A 1LCOA 2Z25A 2WSYA 4FMVA 1EJSC 2XH4A 1IR2A 1KGUA 2DH2A 3GLCA 1UB3A 1UROA 2XGZA 1H7OA 5EY5A 2Z2AA 1KV8A 2DY3A 2NX3A 4GACA 3TTSA 4LAZA 3PZIA 5EGRA 2B0MA 3S46A 1CXFA 3ARSA 1XRVA 4C7GA 4KCUA 1E43A 1H41A 5BWFA 1H63A 2DZVA 2WJFA 4JS3A 5HOSA 1ISYA 4LNYA 1MW1A 5A6AA 2RHGA 2D0HA 3AICA 1EIBA 3N2XA 3GFZA 3JR2A 5HR7A 3ATZA 4DNMA 4MY8A 3NCOA 2R6OA 3PG9A 3BLKA 2P50A 4FX6M 4D1JA 2AL1A 5CPSA 3IS4A 3VD4A 2E6FA 4JL1A 1ONWA 2PP1A 3W74A 4IM4A 4V33A 4KCVA 4NZJA 1F74A 2OWXA 4QS5A 3OEXA 3RIKA 1EPXA 1JL8A 4ZQMA 4WKAA 2Y63A 2WZEA 1GORA 3UXDA 4OE7A 2CLEA 3DGRA 3CIXA 5BWAA 4JTFA 4R9OA 5I24A 1ZBWA 2ZX5A 4IMDA 1G0CA 2YX0A 3P5YA 1NTHA 3MSYA 1VKFA 4MZ8A 2GGHA 1GQKA 3LUTA 3ZSSA 4AZCA 2P3ZA 5REQA 3OGSA 4ZFCA 3DIPA 4Q4MA 1SZFA <