3EX3A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-azido-ump, covalent adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
molecule keywords Orotidine-5'-phosphate decarboxylase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex3A00
4IX0A 2E1DA 4TR9A 1EUAA 3U8GA 2J9YA 3KOFA 1R46A 3S5ZA 1VRDA 3M5YA 5CZTA 1GVQA 3UD6A 3UYCA 1AK5A 5FF2A 5MHBA 4O15A 1OFRA 1IXQA 1TB3A 2WSQA 3GZ3A 3GXPA 3L2IA 1PCKA 3FKRA 1G4SA 5EL1A 4Z0JA 2OZ0A 3NQDA 2EKCA 1FCUA 1LP6A 3W7KA 1LRTA 3BGJA 3FYPA 1EWEA 4O19A 4MLRA 5CGQA 2VEKA 2Z0IA 3A24A 3R12A 2PRHA 4QISA 4H6KA 1ALDA 4FNUA 4GJ1A 1J2WA 1H7OA 4FX7A 4O50A 2UV8G 1BWLA 1F2JA 1M7OA 1FX6A 3IIPA 3OVPA 4MY1A 4ZVJA 1TYGA 1MEIA 4AMAA 3LCWA 4MZ8A 2J24A 4UTMA 3LCGA 2FB3A 5TIMA 4N2YA 1QDSA 3N3MA 2FPTA 2QJHA 3O06A 4AXKA 3TC7A 4KKXA 1YPIA 3EXSA 5D02A 4Y6GA 3QW4B 3PG8A 2LLEA 3G8RA 1LBMA 3VE9A 4HHPA 3D0CA 1SO3A 4MVAA 1KM6A 2I14A 3W2KA 1X1ZA 2H90A 1H62A 3C61A 4RR4A 3NR0A 4P61A 2YFNA 5AC7A 1H5YA 3NXFA 4HSOA 1W37A 5AFDA 1OG0A 1GVRA 3N9RA 4O17A 1PHQA 3LX9A 2QCCA 2C15A 3TR2A 1B4KA 4IMFA 4JICA 3NDOA 5KZEA 3QSRA 4FIRA 4OQVA 3W7CA 5SWUA 1FQ0A 3NQAA 3KHJA 1XBXA 2E6DA 2ZZ7A 4UTTA 3NG3A 2NUXA 1UASA 1ZNNA 7TIMA 4TIMA 3LHYA 5AYXA 1QR7A 3WJWA 1WYIA 3GAKA 4J9JA 4GE8A 1SUXA 4CCDA 3EWXA 3HG4A 3ATYA 1VLWA 2JGYA 3P80A 4LRTA 3HPSA 2I1OA 4WUIA 4BFAA 2WNQA 4UMBA 5T26A 5LNVA 1XDMA 3DHDA 4ORMA 1YTDA 3I65A 1ZALA 1ME9A 1VHNA 2QCDB 3E12A 4FX8A 4YMZA 4WJEA 8TIMA 1ME8A 3B04A 1UBSA 3LV5A 3WJZA 4RXGA 2Y6ZA 2YR1A 2YYUA 2GQAA 4R53A 1RPXA 4H4IA 1KFBA 3NEVA 3NM3A 4O0ZA 4IQLA 3IIVA 3TW7A 5LGZA 5L9FA 5AHLA 3U6WA 4Q32A 4DF1A 3R89A 1A5SA 3QRHA 3ZR4A 1JCMP 3R13A 3DI1A 3MHGA 2NXIA 2V2DA 4RJEA 3RLVA 5D30A 2ZRYA 4WY0A 5CZ0A 2TRSA 3O6CA 3W72A 4L4LA 3USBA 4FNPA 2X16A 5DXXA 1HL2A 5C54A 4NJJA 4N6EA 1P5BA 2NZLA 5K9CA 4K39A 4W9TA 5LNWA 2A7RA 3G0UA 2JBMA 2WSRA 4NJGA 3EWWA 2ZZ3A 3QPZA 1MSSA 3QM3A 1KTCA 4BWLA 3QW3A 1LDCA 1TPWA 3TXVA 3MHFA 5I3FA 3LB0A 5HNRA 1O94A 2QCDA 5LGXA 1TPUA 3PUEA 3S0CA 1KFLA 4CLMA 5HMSA 3GKFA 4FF7A 1DQXA 1GJPA 3DFPA 3N19B 1CW2A 3L65A 4LRSA 1SZGA 3PULA 2TYSA 4N4PA 2Q3OA 2O7QA 1UJPA 3BG5A 3RNDA 1FY6A 4FHAA 3P61A 3GAYA 5F1UA 4JY9A 3SJ3A 2VFHA 2TPSA 2VOMA 3PM6A 4LS1A 2QCNA 1WBJA 3A22A 1VCVA 4HKPA 4ZQPA 2TSYA 1OFBA 2RH9A 3JRKA 2QAFA 4NNCA 1JCLA 5CG7A 1W54A 5DCBA 2ISSA 3HIJA 1KM1A 1AW5A 5HJLA 4ZQMA 1OX4B 2A21A 1H50A 4X2RA 1OVDA 2CZDA 1HG3A 4ONVA 3L66A 1FDZA 4JYDA 4Q33A 3EWBX 4UNKA 1VZWA 4B5NA 4E38A 5HINA 2OT0A 3W2JA 4O10A 5A8GA 3BW3A 3G8EA 1LOLA 4JS3A 2YW4A 1FDYA 2E6YA 3HB9A 1F6KA 1QCWA 1JUEA 3LRKA 4O52A 2ZTJA 1YTKA 4PEKA 1XBYA 5AC8A 3GXTA 3NQMA 5D05A 1G69A 5EY5A 1ICQA 1JVNA 1KM2A 1QWGA 1UB3A 2D73A 4HNTA 4DO4A 1A5BA 1YDVA 4MZYA 1LLZA 3HBLA 3STCA 5HUPA 4K36A 4E2DA 2FPVA 1OX4A 2HS8A 3W1UA 3HGJA 3EX4A 2VEPA 3I6RA 2QAPA 2BWGA 2ZRWA 2YYTA 3TNOA 4JDYA 4Z0SA 3F1QA 4TO8A 1BTMA 4I9AA 5LSMA 1TPEA 4BI5A 2B7PA 1SR9A 2Y7EA 1GYLA 1TTIA 1JRCA 4O4VA 3B03A 5G4EA 1D3HA 4WY0F 1FWTA 1Y0EA 2JKEA 1LCOA 1RQHA 4R7JA 3QF0A 3IV3A 2QJGA 3DAQA 2ABAA 3P60A 5DCDA 1WV2A 5BMWA 3N73A 4AHPA 1TJRA 3EX1A 3WJYA 5E93A 3W1QA 1EPXA 1D3GA 4NJHA 5FF7A 1VYSX 3W7NA 1V7YA 4X3ZA 2QDGA 2QUTA 5KSWA 3S1VA 5CPLA 2A85A 2XN0A 3C56A 3M43A 1LRQA 4FO4A 3TX9A 4NQ1A 3STEA 2ZZ1A 3W86A 1GZGA 5K4XA 5CPMA 5DXYA 1ADOA 2OCZA 4NJIA 3OIXA 4TU1A 3TSMA 3T7VA 2XFWA 4X9SA 5G2WA 1YTEA 3G18A 5J5DA 2CZFA 1FUYA 1KFKA 4K38A 1LRNA 3W9ZA 2J9XA 3LHZA 1WAUA 3QZEA 2Q8LA 3KFTA 1EA0A 3NVTA 3IRDA 1ICSA 5EYWA 4EIVA 2Y70A 2BXVA 3HG5A 2ZA2A 1H7RA 4N4QA 2Q3RA 4TX9A 4IX2A 5G2IA 1AL7A 5CSSA 1KFCA 3GB6A 4QJ1A 3ABSA 3EEGA 2WJZA 3CQ0A 4WZHA 2Y61A 3UY7A 4YLWA 1TV8A 1DKWA 2HMCA 3QJAA 2VENA 3RU6A 1W3TA 3LI1A 4RZ6A 1ZJIA 1C29A 3FYOA 3TFXA 4OGZA 3L5AA 4M7TA 1Q3NA 2X1UA 1Q45A 2X2GA 1H1ZA 3DZ1A 5I3IA 1FWSA 5GVJA 3SW6A 1QAPA 1WA3A 1DVJA 4O1CA 2QCLA 2V2HA 2RFGA 2J9ZA 1JCYA 1TPDA 1EP2A 4A22A 3MP4A 3CLMA 3O6DA 5DN1A 1D9EA 2AAMA 3MMTA 1G67A 4O53A 1W5NA 1TRIA 3TQVA 3GDMA 3PB0A 4GNJA 1FWRA 5AYYA 1JQXA 1EX5A 3W84A 4DF2A 1TQXA 2QJIA 2NLIA 1TPB1 3FKKA 3W87A 1Z41A 1K7XA 4JYEA 4LS0A 3O8AA 1L6WA 3HGSA 4LNYA 5HWMA 5K4ZA 2JKAA 1JUKA 5F1VA 1ZENA 3W23A 2X1SA 1Z42A 2PRLA 1DHPA 3H55A 2NWSA 5AB3A 3TA6A 3FA5A 1UCWA 1VS1A 2DP3A 1QOPA 1JULA 3P84A 3IGXA 1SO4A 4TMBA 4O1BA 2QDHA 2CFFA 3DGRA 1W5PA 1FCQA 1TO3A 1EWDA 4JTFA 3NL2A 1FCVA 2G5WA 3RMJA 1QPRA 1DJQA 3KRUA 3UWUA 3TUUA 1VYRA 1J4EA 4CQ8A 3P82A 3F4NA 2DZVA 1GQNA 1OYAA 3W85A 1ONRA 2HS6A 3HG3A 1R47A 1WQ5A 3LOTA 1ME7A 2YZRA 4GWEA 5BOOA 2ZA3A 4AEOA 2V5LA 5EA9A 4XTIA 4YCPA 2RDTA 1XUZA 2QKFA 3B8DA 2YCEA 5L6UA 3VCRA 2CZ5A 2ZDRA 1KW1A 3DFTA 3W2NA 3PUOA 3NQVA 4ZQCA 4K8EA 1M5WA 4MJMA 4DBEA 1H60A 4NNBA 3LERA 3KVKA 1X8FA 3S42A 4HPXA 1LOSA 2ZRZA 1UUOA 5HQEA 4H3DA 1JCXA 2NUYA 3FS2A 4YL2A 4D2JA 1S5TA 3TIMA 4S2BA 3LXAA 1DV7A 2NV2A 3QH2A 4PODA 3WK0A 3F4WA 3EWYA 2VXNA 4LUJA 4GUJA 3ELFA 4HNNA 2QEZA 5IBXA 2G96A 1KV8A 6ALDA 1IF2A 1KM5A 1CI1A 4ML9A 4O13A 4JDBA 2BX7A 5F2LA 1HO1A 4JY8A 3TKFA 3KRSA 5CSRA 5H91A 1H7WA 5G1YA 3IIZA 3C2FA 1R2TA 2DU2A 4JX4A 3TU9A 4UTLA 5D2TA 1ZHAA 1G4EA 4MJZA 3TQKA 1Q6QA 1IGSA 3BG9A 1I45A 3QEZA 2PC4A 3PBWA 4AHQA 2V81A 4ADSA 5FEZA 3B0UX 3DFQA 1YADA 3MWAA 3SFKA 3PS7A 3LXCA 4EVZA 2DZWA 1TRDA 5EBUA 3M0ZA 3PC0A 2DJLA 1N7KA 2QUVA 2CU0A 2PRMA 4IUOA 2F7FA 5K9XA 1F74A 4GRSA 3TSBA 1GT8A 3VFLA 1TQJA 4GC4A 3BLEA 3UWWA 1KFJA 3IGUA 5D37A 3B06A 3C4UA 2V5BA 4FX6M 2VEMA 1SZFA 4GUGA 3S6DA 1TMHA 1PIIA 3PG9A 1G4PA 2FLIA 5I3JA 3BK0A 4XBSA 4IWWA 1WX0A 5F4XA 2Y7GA 3S9YA 4GBUA 5E1QA 3M7WA 3GLCA 4K8HA 3HJZA 4GUIA 2FJKA 4DQWA 3W7JA 2Z2UA 3LTPA 5AC6A 4TMCA 4FIQA 3T4CA 3OHIA 1I4NA 3LDVA 1EB3A 3G1HA 4BK9A 3G3DA 1VGAA 1H61A 1LM1A 3W2LA 5LKYA 3MO7A 3PR2A 1GYNA 4NT0A 2Y88A 3LI0A 1IIGA 4NNAA 3W22A 2BLEA 3BGGA 4U4MA 1NSJA 3THAA 4N9DA 1K8ZA 1XI3A 2ZBTA 3W7EA 2FB2A 5K3VA 2BZNA 1XL9A 1JRBA 2VFDA 4UFMA 3NGJA 3PUDA 2DZTA 1H7NA 2A4AA 3O1NA 5TQLA 4ZZ9A 3M5VA 5AN7A 3UXAA 3N2MA 4YXGA 1WOAA 2Y62A 3TAOA 3KVJA 3NPWA 2VFFA 3W1NA 3ABOA 4BWLC 5C5YA 2R94A 3GDLA 4MZ1A 3EXTA 2VFGA 3NQ8A 2FDSA 5BW6A 3BVJA 3HG2A 1RV8A 3VI2A 3MJYA 1PE1A 2B0MA 4XTDA 2QF7A 3DKLA 1S3HA 4JTLA 1JJKA 3RLUA 3NQGA 4IGHA 2E5DA 3IVUA 3IVTA 3LV6A 4HIBA 5HWJA 4LVDA 1TSIA 3CHVA 4IJBA 4E0CA 3CTLA 4ZMGA 3W7HA 2IQTA 4M7SA 3BV4A 3WFAA 5D2XA 5D32A 4Y90A 1RQEA 3DH7A 2A2IA 2QUUA 2YXGA 2Z6JA 1V5XA 5IBXC 4LU0A 4UTJA 1F73A 2PCQA 1MO0A 1NF0A 4RCXA 4KWWA 2HSAA 1RR2A 3LBMA 3LCFA 4C1LA 2VEIA 4LC6A 4HNUA 4ZQOA 1OK4A 4IXHA 1HFBA 3GKAA 5DBTA 2B7OA 4IOTA 4UNLA 1FDJA 3CWNA 3L9CA 1G4TA 4MFDA 3NQFA 1DORA 1TIMA 2FIQA 4UFJA 4UFHA 6TIMA 3RF9A 2FTPA 2B7QA 4LWWA 2Y7DA 4QSHA 3MYPA 5KZMA 3QMRA 2ZZ2A 3M5XA 3KRZA 3BW4A 1OFQA 4AWSA 2JK2A 2P1FA 3QFEA 1Q6RA 2C13A 4ZQRA 4JNMA 5AHMA 4X22A 4I7VA 3NL3A 4WXYA 1OFDA 1KLZA 5F2GA 2EF9A 4KWVA 4XBKA 3SECA 3ATZA 4LVGA 1PHWA 1KTBA 1W8SA 3SIZA 2ZFAA 4RK8A 2O7SA 1LBFA 5D2WA 4DBDA 1TTPA 2GVLA 4GXMA 1B57A 5K7JA 2DJXA 1TV5A 3W7RA 2EPHA 4PA8A 4BI6A 2H6RA 3L0NA 5CPOA 2ISWA 4CCEA 4QAIA 2CZEA 3T55A 3GDRA 5CKSA 4MY9A 4NVTA 3C2RA 1NF7A 4ALDA 3F03K 4UTUA 3L68A 1LLWA 5D38A 1N8FA 4N02A 3BARA 4O28A 4FNSA 3M1ZA 1TCDA 1I2QA 1VH7A 2Y63A 5HULA 4R33A 1OJXA 4UFIA 4POCA 1OHLA 3W71A 1A5CA 2YFOA 4N9CA 2VKZG 1SPQA 4O1AA 2P0OA 4NXSA 1T96A 4NXKA 2WV8A 2ZRXA 2TMDA 3PAJA 1K8XA 4IPIA 4DPPA 3HF3A 3EKLA 1O5KA 4ZQNA 4UR8A 3C52A 3DXIA 2ZZ5A 1OK6A 2ZA1A 3QSTA 1XBZA 4JTKA 3P8IA 1FXQA 1ZY9A 5KITA 3RFAA 2GUUA 2GVJA 3EWUA 3GR8A 1PV8A 1QMLA 4JTTA 4MYAA 2C3ZA 4UTWA 1G6CA 4K37A 1P0NA 3S1UA 4MOZA 3TV8A 3W74A 4PL1A 3G1SA 2VFIA 4GUFA 3GDKA 3TQ0A 4PCFA 4NU7A 1K7FA 3KVLA 3W7LA 4CQAA 1W5QA 1TPC1 5CPNA 2WOQA 1XM3A 2WPBA 3QQ1A 3W07A 1WBHA 4XUGA 3CPRA 1OFAA 1L6SA 2NV1A 2QCGA 3L0KA 3WJSA 1KTNA 3AJXA 3EKZA 2NUWA 3WJXA 4YCOA 3P7YA 2DZSA 1K02A 2EAWA 1QPOA 3UWZA 1CX9A 1A50A 1FWNA 4UTTC 1SFLA 4AAJA 2ZTKA 2FPYA 3W1MA 2H3DA 4NX5A 3N34A 3VE7A 3HOJA 1S5WA 1K7EA 2DZXA 1OF6A 3LCIA 3PF3A 4P2VA 4A29A 4AHOA 2CWNA 4WX2A 1X7FA 3E96A 1U83A 3T44A 1EP1A 4MUZA 1LTDA 1W5OA 1PCWA 3W1RA 1I2NA 3GYEA 5D04C 3LRMA 3CEUA 4ICNA 3M44A 5I3HA 3W1LA 3IIOA 4FB7A 3SR7A 3GVGA 1PL9A 3EXRA 4XKYB 1OF8A 1DBTA 2YDAA 1VC4A 3W2MA 1JCJA 4DF0A 4CCCA 4QNEA 4YWIA 1C8VA 3YPIA 1ZAJA 3LCLA 4JTIA 2F84A 2NXHA 1IXPA 4DEFA 1VPXA 3WK1A 3ZS4A 2GVGA 3W3OA 1EP3A 3PY2A 3UXDA 4M6VA 1KBIA 4BF9A 1OYCA 5EPDA 2ZQ0A 4OT7A 4N6FA 4OV4A 3V75A 4K7VA 4UXDA 4WOQA 5D03A 3NQEA 1Z44A 3KXQA 3NZRA 4L4MA 5K9DA 4O1DA 2Z1BA 2B4GA 3OA3A 5CZJA 3C2VA 2E5CA 2WNZA 3STFA 3GK0A 2YSWA 3R5EA 3W1PA 3HO8A 2Z6IA 1T99A 1GVFA 1I2PA 1GEQA 3W7OA 3I7QA 3MYOA 4QIUA 5FI8A 2E5BA 2EHHA 3IVSA 1NAL1 4KFNA 1KV5A 4JXCA 2E77A 4XKYA 1MXSA 4Z1CA 3JR2A 1TPFA 1EEPA 1XXXA 4AB4A 4OV9A 4QQ3A 3NQCA 5AOUA 1MEWA 2Y7FA 1RZMA 3TMLA 1QPNA 3W83A 3NPUA 2J27A 4AVFA 3W7GA 2GOUA 3TAKA 3G1DA 3WK2A 3OBKA 1AW1A 2NX9A 1GVOA 1HUVA 2QCEA 1O4UA 1ML1A 4WOZA 2ZRVA 3DU0A 3W1XA 1ZFJA 5D2YA 4DPQA 5G1TA 5FF0A 2DZPA 1AMKA 4DO5A 4JTJA 3UPWA 1THFD 3LCXA 4AH7A 3UPBA 1J5TA 2ATSA 4WXZA 5LNRA 3NPVA 3E0IA 1H7XA 1TTJA 4IMGA 4A3UA 2X30A 1SO6A 1VYPX 3A23A 1F05A 3O07A 1DOSA 1JQVA 4NZFA 4G1KA 1HTIA 2WKJA 4FNTA 2B7NA 1ICPA 2RDWA 4UTHA 1IIHA 3MBDA 2W6RA 1YXCA 4FNQA 1W5MA 4UTIA 5J5RA 3PSWA 4FEZA 1YYAA 4JTEA 3B0VC 3HGOA 4JTSA 3PSVA 4UMCA 1F5ZA 2ZCGA 3W1TA 1ZAIA 3EWZA 4FXRA 4AF0B 5H2ZA 3DFOA 3K30A 4MKNA 3V1PA 1ZCOA 1IXNA 5AHFA 3G24A 5DLCA 3ANYA 3LGEA 3OG3A 4GFSA 2CLOA 4ORIA 1QO2A 4Y8FA 3MHUA 1GPWA 5HWNA 1LZOA 4O12A 2QR6A 3QMTA 1SSGA 3LCHA 1P4CA 4A2RA 2DORA 3P74A 3TE9A 1W3NA 1M7PA 3DFNA 4U28A 3DI0A 2GJNA 4DXVA 3MI2A 4M6PA 3LLFA 1UUMA 1A5AA 5ABTA 3M5ZA 3Q37A 4Y96A 3OVQA 1M6JA 3LM7A 3IGSA 1DL3A 5C2XA 1SW3A 3UWVA 1SU5A 1F7BA 4AWTA 3TROA 3I68A 3GNNA 3KAOA 3GX9A 3TJLA 3QQ0A 3QPYA 1VCFA 1BKSA 4AWUA 3QMSA 2VFEA 1LORA 3RK8A 4A2SA 2CLMA 4LY8A 4HSNA 1Q6OA 3G1FA 2H3BA 1LYXA 3B0PA 4HT3A 5FEWA 4FXSA 1OX5A 3L5MA 3LRLA 2FFCA 3S1XA 2YPIA 3LHVA 4MPQA 2CLIA 4AF0A 1KM4A 4JX6A 3TCEA 3N9SA 4XZ9A 4R34A 3BPWA 1B3OA 5F2IA 1P0KA 3MI3A 1AG1O 2GQ9A 1GTHA 5EKYA 2OJPA 1SO5A 3PBVA 1K03A 5LNUA 5AHEA 3R8RA 3INPA 1O95A 3NO5A 2FQIA 1SZNA 2I9EA 4O54A 1NEYA 5AHIA 4S2CA 1ZAHA 3L21A 4MIMA 1WXJA 4IXXA 3LTSA 3AO0A 5F4WA 2H8ZA 4I7UA 2QCHA 3P67A 3FJ6A 2ZZ6A 4KFPA 4UC5A 4K7YA 1VCGA 3HPXA 1TPH1 3G1YA 3W88A 1TJPA 1H51A 5D2VA 1R2RA 3C6CA 3GR7A 5I3GA 3SGZA 2WSYA 3UNDA 3UZJA 3KVMA 3CEPA 4LOCA 4NX0A 5DBUA 3W6YA 5HUOA 3ABQA 3DKJA 1I2OA 4A21A 2A6NA 3W7DA 3VKJA 4CNNA 1LROA 4JIPA 2GJLA 4OWGA 4O57A 1OYBA 2JKPA 1X1OA 3TFCA 2XN2A 1O5XA 3E49A 1W3IA 4S1FA 1OFPA 3G0SA 3NQ7A 4FNRA 1NVMA 3A21A 3EX6A 3W73A 2J6XA 2QCMA 1KA9F 2V30A 3BLFA 1G7UA 1BEUA 5U4NA 5FEXA 1PVNA 5DY2A 1QNVA 2A0NA 5CZSA 2ISVA 2R14A 2AGKA 3DFSA 5HR6A 3ABRA 3T40A 4I7WA 2A7NA 1MEHA 1W31A 3QC3A 3H53A 3Q2DA 1U5JA 1W1ZA 2V9DA 1YXDA 3CIXA 1TTQA 4O11A 2NWRA 1R2SA 2E68A 2WO5A 3DENA 2J88A 3EX2A 3N14A 5E0KA 4DELA 2RDUA 2X1RA 3UWQA 3W1AA 4RZ4A 2W0UA 1I8JA 3DHFA 5BRBA 1IXOA 4QNWA 1YDNA 4EWND 3MI6A 3NQ2A 1TV7A 3C3NA 5A5WA 2NXGA 4UIOA 4LTSA 3HPZA 1NFBA 4RLIA 5KTLA 2WNNA 4LVFA 4JTHA 5BMXA 3CC1A 3LTYA 3LXBA 1XC4A 2Q8ZA 2NX1A 3VNDA 3NL6A 1MZHA 4WD0A 2A7PA 1GWJA 3SZ8A 3TXZA 3C8FA 3CM4A 1XKYA 4Q4KA 1H1YA 3S5OA 5LZLA 3GIYA 2AQWA 3G1VA 5EMUA 3B05A 1R30A 5LHFA 4OE7A 4N9EA 1AL8A 1AW2A 1B9BA 2H8XA 3A9IA 1Z48A 1RVGA 4PFMA 3BW2A 2DZUA 2ZRUA 2P10A 2C14A 3L0GA 1P1XA 2RKXA 1DQWA 1SW0A 2OT1A 3H54A 4MFEA 2BTMA 2ZZ4A 2VC6A 2R8WA 1XDLA 4IPJA 2NX3A 3BLIA 4CNOA 1Q6LA 3IEBA 3IIXA 2VELA 3P5ZA 3Q58A 5KZDA 3MP3A 5BNKA 3ZWSA 4Z1DA 1X6UA 4PL2A 4O18A 5U7SA 1T0OA 5D33A 4BR1A 1QPQA 4UCGA 4O14A 4Y9AA 4RKAA 1VJIA 3CT7A 3M47A 2V82A 1GVSA 3NYZA 2C18A 3C2OA 3NL5A 3PB2A 1VR6A 3LHTA 2QCFA 4OBTA 1FBAA 3CB8A 4C1KA 3HGRA 1XBVA 1N55A 3HQ1A 2CLFA 1GTEA 1KLYA 2ZYFA 3TW6A 3O15A 3W75A 1JCNA 2C0AA 1VQTA 3B4UA 4OU1A 2A6LA 3TK7A 4QM1A 3C2EA 3MW7A 1SFJA 1XUUA 3TJXA 3FLUA 4GUHA 3STGA 5D09A 3M16A 3CWOX 1YDOA 4HNVA 3KX6A 4RV8A 1YXYA 1OX6A 3LHWA 3G1AA 4PTNA 4RXFA 3G3MA 3M6YA 4O0KA 1H7PA 1OFOA 4CNPA 4UTKA 3I7SA 1S5VA 3SSJA 3O05A 3SY5A 3EX3A 4JN6A 3O63A 3G1XA 3PVFA 1G7VA 4M6QA 5KINA 5F2MA 3T78A 2CLLA 3OVRA 3W7IA 4LV9A 4LT9A 4MLJA 2YW3A 3A5FA 4JYFA 3TDFA 2C1HA 3W7QA 2JGQA 3R2GA 3NM1A 1GOXA 3U2OA 3G0XA 5HR7A 3M9YA 3P8JA 1L6YA 5DELA 1XCFA 3P5YA 2PE4A 4OHQA 4Z1AA 2XN1A 3TH6A 4JIQA 1K3UA 1TREA 3FJLA 3NOEA 1KFEA 1O60A 2W79A 1A53A 3MP5A 4UTWC 5KMYA 5G2HA 1OABA 4JTUA 4MYXA 1SW7A 5FESA 1H63A 3O6YX 1EUNA 2G95A 4ZL1A 4HN4A 4IMDA 3W76A 5DY3A 4K6AA 1KBJA 1W0MA 3C0JA 2C6QA 1L2UA 2WQPA 2E6AA 3PBYA 4CQ9A 2HTMA 3DBPA 1FXPA 1GG1A 4LW7A 1B4EA 2ATMA 5TBOA 3SGUA 3S5NA 1WDWA 3ZFHA 4EF8A 3L67A 3UZ5A 3S8HA 4E2BA 4RX0A 4LV4A 2EGZA 4XQ6A 2V0TA 3N2XA 2YGYA 3E02A 3W70A 2Y89A 3PBUA 2RHGA 2GQ8A 4UFLA 3BG3A 2BSLA 3Q94A 5AYZA 2G97A 2KZHA 1QO5A 1EIXA 4JX5A 2V8ZA 1SZEA 4RZ5A 3GDTA 1L9WA 3ZWTA 2OMAA 5I3KA 3NAVA 2YX0A 1VLIA 3JS3A 4Z1BA 2PURA 3OEXA 5F4SA 1XFBA 1PS9A 5AHNA 1RD5A 1WOBA 2OX1A 4KFOA 4ADUA 4MY8A 3TSDA 3NNTA 1SSDA 2ABBA 4XWUA 3HMJG 1E51A 3WK3A 4LVBA 3CU2A 3FOKA 5LHEA 4EOUA 4NZJA 4N9BA 3FEMA 1QOQA 4NUWA 4ADTA 1FCBA 1YPFA 3O16A 3S5YA 1K8YA 3NZ1A 3FIGA 5C55A 3FFSA 3E9AA 5FF3A 2CLKA 2E6FA 3SI9A 4UR7A 1I2RA 4DO6A 3NA8A 4QITA 3W7PA 4PC8A 4JD4A 5IM51 2Y85A 1DJNA 3A5VA 3LLDA 3TMQA 4O16A 3PWAA 5FEPA 1SQ7A 1KM3A 1GG0A 1RQBA 2CLEA 1T8XA 3NPXA 4UUIA 3NQ6A 3EB2A 1JUBA 2ALDA 1LOQA 1TPVA 1KM0A 4JEQA 4LUIA 4JTGA 4PH6A 2A1YA 3P81A 3TC6A 1FWWA 1F76A 4M19A 1OFEA 5DCEA 2C19A 2C16A 1JR1A 4JGDA 3GNDA 3MUXA 4Z08A 4IMCA 1BWKA 4LVAA 4M5PA 5G5IA 1YLVA 4O8RA 4HPJA 2V2CA 2E09A 5C6MA 5LNSA 3S1WA 1VHCA 3P62A 3GXNA 2CLHA 3LHUA 2A5HA 3W7MA 4WQ6A 3UWYA 4EF9A 2GPTA 3LBCA 4WY0B 4O4WA 4IMEA 1C9DA 5G4WA 3UQNA 3UY8A 3BO9A 3CIWA 1HO4A 1F6PA 3G22A 3MBFA 4NJKA 3W2UA 1LBLA 4JR5A 3L5LA 4UFKA 4BI7A 3THQA 2CW6A 1QFEA 2R91A 4UMAA 4LC8A 3QYQA 5K2ZA 2X1TA 1W56A 3I7RA 5FF4A 4LS2A 3M41A
chains in the Genus database with same CATH superfamily
3DIPA 1EUAA 3U8GA 3E5PA 2J9YA 4HSHA 2E7FA 4G8TA 3POCA 3ISIX 3ARUA 2IMRA 1UWTA 3JW7A 1E73M 3S5ZA 3WLTA 1XLCA 2VVNA 3UD6A 5FF2A 5MHBA 4O15A 2WCGA 3AXHA 3GZ3A 3DOPA 1G4SA 1IEXA 2EKCA 3BCJA 1LRTA 3BGJA 1EWEA 4O19A 4J2MA 4WHBA 4QISA 1I60A 4GJ1A 3BAXA 1OC7A 5LIXX 1H7OA 1YBQA 2P0IA 5H8UA 4FA3A 3BH4A 4PR4A 1PEZA 4GZEA 1FX6A 3KDOA 1FFQA 1E6PA 2J24A 4IIDA 4ZBCA 3A4AA 3GHTA 3L4UA 3CUHA 3N3MA 2FPTA 4BQ3A 3BSMA 3RCYA 4A6GA 3TC7A 3EBVA 4KKXA 5D02A 4A05A 1AQHA 1PO9A 1QBBA 3QKEA 3MSRA 3VE9A 4RE3A 3B8VA 3D0CA 1EJVC 4ROQA 5I03A 3WQCA 2X0SA 3R4IA 3I6TA 4NAEB 2H90A 3WUEA 1H62A 3C61A 4P61A 4C6DA 1HVQA 4HSOA 2ZX5A 1CXIA 1W37A 1JDAA 1ITUA 3NZPA 2QCCA 1VAHA 1ISZA 3TR2A 1DIDA 1T7LA 5KZEA 2DZAA 2BY3A 4FIRA 5SWUA 3NQAA 5CSUA 2WWCA 2J7BA 2E6DA 2NUXA 4TIMA 5FJPA 3CHDA 4HHMA 3GAKA 4LEFA 4GE8A 3PPCA 1DJIA 4K3ZA 2I1OA 4WUIA 3MVIA 2WNQA 1RH9A 1UPPA 1XDMA 3MWCA 3BQ6A 3V0SA 1YTDA 5CBIA 1VHNA 4Q8UA 3VKKA 4AD2A 1EJUC 2DFAA 3UXIA 3N1AA 1DYSA 3WJZA 2Y6ZA 4XB3A 3VIOA 4H4IA 4PRWA 4S3BA 5I77A 3PZVA 4AZGA 3K1DA 3AHXA 5LGZA 5A6MA 2OGJA 3CZKA 3N29A 3RLHA 5L9FA 5AHLA 1GHSA 3R89A 4RPPA 1A5SA 3QRHA 4HGXA 4F9DA 4S23A 5IOBA 3R13A 2NXIA 4JTAA 1F07A 4RJEA 1RK5A 4ZXOA 3MQTA 2XYLA 1OB0A 1FRBA 3GH4A 3USBA 3KBSA 4FNPA 5DXXA 4AX7A 4CU6A 4IG2B 2NZLA 5I5RA 3OOQA 3SUVA 1D2KA 4K39A 1DWHM 1KCKA 5LNWA 3VNKA 3OYXA 5A8QA 3VFCA 4MG4A 1QATA 3QM3A 1DXFA 1XLHA 3H6OA 2FGZA 4J3UA 2QCDA 5A6KA 4PEEA 5KETA 5LGXA 1KFLA 1PDZA 1VKFA 4CLMA 3E5BA 1J0YA 3BJSA 7PTDA 3GKFA 3DFPA 2EJAA 3CT2A 5KZ6A 4LRSA 3EB4A 3GVVA 1SZGA 4P7NA 5LA2A 1YQ2A 3H4XA 3SM0A 2Q3OA 4JPGA 1UJPA 3RNDA 4FHAA 2ZUTA 3TLQA 3OGSA 2WVSA 2HRWA 3WBXA 2WC4A 3A22A 5A8OA 1VCVA 1V3MA 3LN3A 3TA9A 1R6WA 4B3KA 3HIJA 1AW5A 3ZJ8A 1QW8A 1OX4B 4X2RA 5BRPA 1OVDA 4HBKA 4CNUA 4F2TA 1F61A 4B5NA 4E38A 5HINA 2OT0A 3AI0A 4O10A 1ZJHA 4XO7A 4JS3A 1VENA 3QR3A 2YW4A 1F6KA 4O52A 1WE5A 2ZTJA 5AC8A 3GXTA 4LAMA 3FYYA 1Y5VA 2YOCA 2CZVA 1WUEA 1G69A 5EY5A 4HCLA 5CLWA 1DE5A 2D73A 2J75A 3GG8A 4HNTA 1A5BA 1YDVA 4BCEA 4MZYA 1LLZA 3HBLA 3LK6A 3STCA 4CN4A 4GOAA 2HS8A 4MWAB 3EX4A 4Z17A 2VEPA 4H9XA 3ITYA 2QAPA 2ZRWA 4J3XA 2R1NA 2OZTA 2WZEA 1GVIA 2XISA 1IE7C 2WLZA 4KRZA 3WDJA 1GZJA 3F2BA 1JRCA 1UYQA 1RBOB 1D3HA 3ZVHB 1FWTA 4R7JA 3WD3A 1PKNA 4ENLA 3H7UA 3WF2A 4H6RA 1V0MA 1E1CB 1XLFA 1FWCC 3WQGA 3VKCA 1ZJAA 3WJYA 4H41A 4IIGA 1LF1A 3VDHA 1EPXA 4NJHA 4EX4A 5FF7A 1VYSX 5DMNA 3N2TA 4GBDA 1V7YA 1J6OA 3VDAA 2QUTA 2D2GA 3H8AA 1QPKA 1RY0A 4R88A 5DXYA 3QY8A 1J10A 3OIXA 3TSMA 4QG8A 1LG1A 3EA1A 3R10A 2XFWA 5EMJA 5A2AA 5E0CA 2O56A 1AD1A 2G8ZA 1LRNA 3W9ZA 4FLRA 3LHZA 1XIHA 1KKRA 1EA0A 2G37A 1YE4A 5C9XA 3NVTA 5EYWA 4EIVA 1EJXC 5BXTA 2Q02A 2ZA2A 5BXRA 1XIFA 2XH2A 4TX9A 4F8XA 4PCTA 3OP2A 2ISDA 4YLWA 1EA9C 1TV8A 1RCOB 2QDDA 2VENA 4XSLA 2ZXBA 1J96A 1UZDA 3FYOA 3HA1A 3L5AA 1P0DA 2X1UA 1Q45A 2X2GA 3DZ1A 2QMJA 5GVJA 1GJUA 3SW6A 3W24A 1K6WA 3O9NA 4FXFA 4OZOA 1DVJA 2QCLA 2RFGA 1R8LA 1C93A 3PUGA 3MP4A 4J2PA 2BOGX 4P7QA 3T0AA 4PMZA 4PYSA 1OZMA 5FSEC 3BOLA 2CNCA 1Q2RA 4O53A 1W5NA 3SQMA 3PB0A 4GO8A 1FH8A 1FWRA 4YPJA 1JQXA 3MMUA 1EX5A 1CGWA 3OBAA 2NLIA 1TPB1 1E0XA 2IKJA 2DVTA 4JYEA 1OGSA 3IUHA 3ARTA 3O8AA 1ODUA 3HGSA 2A3HA 4DO7A 4RL3A 1ZENA 3W23A 4B5XA 4I9JA 1IZJA 2NWSA 5AB3A 2PDPA 1EHAA 3VOFA 3FA5A 1VS1A 1JULA 4TMBA 4O1BA 2QDHA 1W5PA 1K8CA 1FCQA 3E1F1 1EWDA 4GZIA 2BGNE 1RVKA 2HK1A 2GDQA 4M80A 3P0XA 3MB9A 3N4AA 3RMJA 3V5OA 1KXQA 1DJQA 3ZLGA 3UWUA 1VYRA 2HK0A 2YXOA 5LIUX 4C6FA 6TAAA 1GQNA 1ONRA 1E9LA 3RJXA 1IYXA 3HG3A 3MMDA 2Y5JA 3PJWA 2YZRA 1EO7A 5BOOA 4AEOA 1F3WA 2OGYA 5EA9A 2CYGA 4IPPA 3MUAA 4DJDD 3DFTA 4LAOA 3WMLA 3PUOA 8CGTA 4HCHA 1KWGA 2J7EA 1M5WA 3N04A 2OLAA 1X8FA 2V3DA 4QQUA 4HPXA 3KM8A 1OCJA 2NUYA 4UQEA 1EQCA 4PB3A 3JU2A 4D6IA 1T5AA 3LXAA 1X96A 3ITTA 5BYWA 3RM9A 3QH2A 3GDBA 3EWYA 3ELFA 3PNUA 3HURA 1C90A 1RJPA 1XRTA 3SGGA 6ALDA 1KM5A 1CI1A 8XIMA 2DQWA 5F2LA 5GNZA 4EE9A 3N6HA 2XVGA 2W67A 3WDRA 3C2FA 1R2TA 2DU2A 1ZS2A 4JX4A 1ZHAA 1G4EA 3P0WA 4MJZA 3EB3A 1JZ5A 2AL2B 3AAMA 4I90A 3WLJA 3QEZA 1A5NC 5FEZA 4LF2A 2WVVA 4O8AA 1XV8A 3DFQA 1YADA 1RY8A 1H4PA 3IJIA 3SFKA 1LL4A 4EVZA 1ZBWA 2PTDA 4S3CA 3SO7A 4A3RA 1QI3A 2IPWA 3E74A 1R86A 1UKQA 2CXGA 2QUVA 1A49A 1HGYA 3H4GA 3ME3A 2F7FA 4GI6A 3TSBA 1GT8A 2GQ3A 3BLEA 1GCYA 3MY9A 4DJDA 3CQJA 3H2OA 1JYVA 1V02A 1CIUA 4M29A 3T07A 1TVPA 4QJ5B 1HJQA 2FLIA 3BK0A 3KWXA 3WQPA 1WX0A 4TX8A 1N82A 4J4KA 3BUVA 3S9YA 4LYKA 3TOYA 5E1QA 4A8LA 1HJXA 4K8HA 3TQPA 4G1NA 4Q7IA 1YBQB 4LJ3A 7REQB 1W8GA 4JQ1A 3ZVHA 5CLTA 4NZ1A 4RPQA 3URQA 4TMCA 3FW6A 3OHIA 4UOJA 3G1HA 3G3DA 1VGAA 4AIBA 5LKYA 3MO7A 2XHYA 5AECA 3ES7A 4LCQA 2HVMA 3KS6A 1BTCA 1IIGA 3W22A 1R9YA 2BLEA 5C0QA 4DWSD 2V5KA 3NSNA 1NSJA 3THAA 4N9DA 1FH7A 4XZHA 3CZGA 4ZFMA 3ABXA 2BZNA 2D3NA 1R3TA 4WR3A 2VHLA 1ISVA 1MUCA 1XLEA 3SUUA 2VCCA 1EDGA 4P5UA 1IEQA 1EFZA 4I6VA 3NDYA 4US5A 4ZZ9A 5AN7A 3N2MA 4YXGA 3TAOA 1WP6A 4INFA 4CNTA 2GUBA 3DGBA 4KGLA 4YTUA 4BWLC 2R94A 3GDLA 3V0UA 1C3FA 2FDSA 1NDVA 3BVJA 1NFGA 1A0DA 1CCWB 2PC8A 3EAUA 4JTLA 1JJKA 3OJGA 4IGHA 4HIBA 5HWJA 5I02A 2OO6A 1ONEA 4H9UA 4C6OA 2QLYA 4D6JA 1BYDA 2YXGA 1BVNP 1W9BM 3WFZA 3O0KA 3EMCA 1AZ2A 1WDDA 3LQGA 1RR2A 1XF0A 1E0TA 3WF1A 4LC6A 4HNUA 4DJED 4IT1A 3GKAA 5DBTA 4UNLA 1FDJA 3CWNA 1VFUA 4B92A 2OWCA 4MFDA 3MDUA 3NQFA 1DORA 3BMVA 2FIQA 1QNPA 6TIMA 3RF9A 2FHFA 2B7QA 3WBWA 2Y7DA 3MYPA 5HXMA 4TUFA 3K46A 2EG6A 5CJNA 1JPIA 1KXHA 1CLVA 4IG2A 2Z25A 2PDKA 4AZ5A 2PF0A 4I7VA 3N2OA 4K68A 3HFTA 2A79A 4KWVA 1AUSL 1RA5A 3GH5A 1XLLA 1KTBA 1W8SA 4RK8A 2O7SA 3N4EA 1TTPA 2IXVA 3NCOA 6PTDA 2GVLA 4GXMA 4F0KA 2H6RA 3F5LA 2ISWA 2VZUA 4I5UA 1JI1A 5MF5A 3GDRA 5EBAA 4CQBA 4CGTA 2BBFA 3F03K 2F2KA 3RJYA 1LLWA 1N8FA 1B3YA 4C6CA 4GYPA 3OU8A 1TWDA 2CESA 1TCDA 2DT0A 3VCNA 2Y8UA 3CUJA 3LA4A 4A3QA 3A4WA 1OJXA 4QG9A 4BEQA 1A5CA 2YFOA 4W89A 1IEVA 2R9RA 4NXKA 2WV8A 4PMOA 4HU8A 1X7IA 5FACA 3PZNA 1K8XA 4IPIA 4DPPA 3OGRA 3EKLA 3EPMA 5CH9A 4D6HA 4HK6A 3WL0A 3DXIA 4TV5A 2XM1A 1D8CA 4ERGA 1XBZA 3AIEA 3EGJA 4C6MA 2YBVA 4JTTA 1RBAA 4MYAA 1DJWA 3W6LA 2DPEA 3U0HA 3MZNA 3FX4A 3TV8A 3W74A 3UBPC 3G1SA 2VFIA 1M01A 3GDKA 3TQ0A 3LD5A 4DI9A 1J9YA 3WH5A 2WOQA 4JIIX 1Q65A 2AQOA 1I1WA 3W07A 1OC5A 4XUGA 4MJ2A 3C86A 1KTNA 3U4FA 4O1FA 3O7UA 3P7YA 4JTCA 1K02A 1E6ZA 3E6EA 3UWZA 1R9ZA 2VC7A 2ZTKA 2H3DA 1SFSA 3N34A 3WQOA 1S5WA 4KEUA 3UNTA 1FA2A 4GKTA 2YXXA 1OF6A 3LCIA 1XLMA 3F4DA 2FH6A 3GNXA 3WLLA 3R8HA 3PZQA 1U1UA 3GVQA 1W1B1 4B4FA 4GGHA 1BXCA 3GYEA 1AD4A 4JQ3A 5D04C 4ICNA 3WNNA 4BA0A 3M44A 3VILA 3GVGA 4Z2LA 1XKJA 4NAFA 4DF0A 3LZ5A 3GXMA 1IEWA 2QDEA 1YMYA 4JIEA 3FVDA 1C8YA 2DSUA 3VGDA 5E6ZA 2YZ5A 3B0XA 3M0XA 4B16A 3ZS4A 1LWJA 1UKOA 1W1VA 4IIEA 3HV9A 1OIMA 3QYSA 4GHRA 3NXLA 4DJEC 3KRBA 4BF9A 3AXXA 5EPDA 4OV4A 3DHUA 4ATDA 4KERA 3NQEA 2NVCA 4H9YA 4R3UA 4O1DA 1RBLA 7CGTA 1JDDA 4GYKA 5EMKA 3UP8A 5CZJA 4PMDA 3GK0A 3GNRA 3KCJA 3R5EA 2VL4A 1YNYA 2FGBA 4O1EA 1GVFA 3U2ZA 2XZ7A 3GO2A 2HDJA 2E5BA 1NAL1 4KFNA 1DWFM 1JFHA 4JXCA 5GNYA 1J0IA 2OLHA 3N4FA 3WLHA 2HVNA 5EFFA 3NQCA 2WNWA 3JUGA 1MEWA 1GPFA 3W7GA 2WBKA 1A47A 1WNOA 1CT5A 2NX9A 5CEWA 3UF9A 2QNEA 1EQPA 1U33A 1X6NA 1E6RA 2INEA 1B9ZA 4IUGA 4DO5A 1W3HA 2ATSA 2V6AA 3GG7A 2NSOA 5LNRA 4LALA 1W1TA 1H7XA 2ANUA 4WLCA 1XD1A 4XK2A 4U3AA 2WC3A 3ITVA 1XH2A 3WQ8A 1F05A 3BURA 4EPKA 1DOSA 4NZFA 4DLMA 5C70A 4G1KA 4GIAA 4H8HA 4GQRA 2XH0A 2WKJA 2B7NA 2RDWA 4UTHA 2VGGA 3WMSA 1QVBA 5CSYA 4FEZA 1YYAA 2WWDA 2ZX7A 3B0VC 4UMCA 1XIBA 3PSVA 3TYEA 3SY1A 4Y9MA 1K9DA 2F38A 3BZGA 1HZYA 1DXEA 4FF5A 5DLCA 3ANYA 3PPFA 3IWPA 3G6LA 2J7CA 3S2MA 2IQ0A 4HOZA 2CWXA 3M07A 1LZOA 3ABZA 2GVEA 1NWTA 1A5KC 4IMAA 3QV9A 3TWAA 1J0HA 1JNDA 1RCQA 4NASA 1LUCA 3AZSA 1BFNA 3P74A 5BU9A 2XU2A 5FIPA 2GSJA 1M7PA 3DFNA 2WMFA 3MI2A 4M6PA 1PUDA 2WZHA 3BAWA 1XQKA 4AFYA 3IGSA 3H70A 5CG0A 2WBGA 1J01A 3CAKA 2GYIA 1F7BA 1TFVA 2WJFA 3K4AA 3LZ3A 1QK2A 3GNNA 3OLGA 3QQ0A 2NQJA 3QPYA 1BKSA 4CN1A 1BRLA 4KIEA 1LORA 4PSPA 1J0JA 1YIXA 3VGFA 1PAMA 1PB0A 4HSNA 4NZ3A 3G1FA 1LYXA 3B0PA 3IJ7A 4FXSA 3LPPA 3L5MA 4F66A 3APYA 1KR0A 3VKBA 3LHVA 4CD8A 3CHCA 4ZODA 1QOXA 4JX6A 1JG9A 1UKSA 3H26A 4GX9A 5TAOA 1P0KA 2BFGA 3CMFA 1AG1O 5EKYA 3PBVA 1K03A 5AHEA 2FQIA 4L6HA 5AHIA 4IXXA 2HQAA 3ARWA 3L12A 4W5UA 2PTYA 2QCHA 3ITGA 2ZZ6A 4UC5A 4K7YA 4GACA 5KEZA 1H51A 2J66A 3BOXA 1XYBA 4XD3A 4RNHA 3F2DA 3KW3A 1DJYA 3ITCA 4NSBA 1MRQA 3R7MA 3MANA 5CC3A 5DBUA 3VM5A 1I2OA 2A6NA 3W7DA 1LROA 4S3EA 5F7UA 1SJDA 2DVUA 5CZKA 5HK4A 3AJ7A 4OWGA 4O57A 1OYBA 2JKPA 1X1OA 2XN2A 1WXZA 3G0SA 4FNRA 5HPCA 2CBUA 2QUMA 2QCMA 1VJSA 5DF0A 3H2FA 1BEUA 4S3JA 3PBGA 5U4NA 3NO3A 2ISVA 4LAUA 5HR6A 2QS8A 4K1GA 3T40A 3VIMA 1XISA 3KZSA 2XH4A 2V9DA 3CIXA 3Q45A 1R2SA 2WO5A 2J88A 2VP8A 1ESWA 4JFWA 1IXOA 4QNWA 1U30A 1MQQA 3BQ5A 2BNJA 3NQ2A 4TOQA 1TV7A 2YDSA 5A5WA 1Y5XA 1ZPTA 3UGVA 3LPOA 4H9VA 4RLIA 2YA0A 3T81A 1Q2SA 3AS0A 3M0JA 4AD5A 1VRXA 1E0UA 3VNDA 2PDLA 1G9HA 2A7PA 4DUVA 1MNZA 3NZGA 5LZLA 2PLKA 3PPGA 2AQWA 3WMCA 2D0GA 1AL8A 4EPDC 1UR3M 1Z48A 3T8QA 5C71A 3BL3A 1UG6A 4PFMA 1PXGA 1ISWA 1CBGA 3D3FA 3L0GA 3I6EA 1SW0A 3VU2A 4D72A 4AEEA 2HISA 2VC6A 2EKGA 2NX3A 1FH9A 1W6TA 3H23A 1Q6LA 3IEBA 3DDMA 5ABHA 5CQ1A 2ZIDA 2PCEA 1X6UA 4O18A 4J3SA 4ZO8A 5U7SA 1XGZA 4MAZA 1TMQA 3D6NA 2BHZA 4UCGA 4Y9AA 1PSCA 3WD4A 4ROPA 1GVSA 2PD5A 3GFXA 1A0EA 3NYZA 2E9BA 1A5UA 3PB2A 4ECLA 1VR6A 3LHTA 3KLLA 2QCFA 1L6GA 4HZ8A 5DQPA 1D8WA 4B4HA 1F3TA 2UY5A 2FMNA 3ZSSA 3VVGA 4J40A 3AICA 3SQLA 3FSTA 1MRAA 1NDYA 2YDRA 4AY7A 3IGHX 1DQUA 1P7TB 3OHMB 2W4XA 3VGHA 4QM1A 1RPKA 1RAKA 3STGA 5D09A 3M16A 3CWOX 5DX7A 2VX5A 4HNVA 4RV8A 5I2UA 4RXFA 1CNVA 6A3HA 4H7CA 1H7PA 1ITCA 1OY0A 1K9EA 4CNPA 3I7SA 4UTKA 3SSJA 1BXNA 4YHEA 5BWFA 1G7VA 2WVUA 2O92A 3UERA 3L2MA 3KBJA 3LNMA 3RITA 1UPMB 4MLJA 2C1HA 3V3WA 3R2GA 1HL8A 3V35A 3M9YA 2MUCA 2PWFA 3WIJA 4W7WA 1XS2A 2PE4A 4Y9NA 2XN1A 1K3UA 5JUVA 2DUAA 4QSFA 1KFEA 1DTUA 2W79A 1A53A 3MP5A 4DN1A 1OABA 5AZ1A 2FMOA 3O6YX 4FOKA 4BZYA 3W76A 1XWYA 4DNHA 1W0MA 2OSWA 1GG1A 4GI9A 3S5NA 3ZFHA 1TG7A 3S8HA 4E2BA 1W3LA 4RX0A 3WO8A 2EGZA 5FA5A 2V0TA 4XAFA 3WH6A 2YGYA 3E02A 2OVLA 4GQ0A 4YVXA 4QFUA 3PBUA 3CH9A 3R0DA 5AYZA 2VZTA 4HOWA 1NY1A 3T4WA 3AS3A 1NWUA 3GDTA 4QG6A 1L9WA 2FVKA 2GUYA 2OMAA 1NOUA 5A3HA 1H5VA 4AZBA 1CDGA 4L4OA 2ZX8A 3BCDA 4FS9A 3TSDA 4I8YA 2QUNA 1E51A 2IS7A 5A95A 3RX4A 1QI4A 4AYSA 1LJYA 1O1HA 4QROA 4PBEA 4ADTA 4LBSA 4MTVA 1S38A 3K8LA 1K8YA 5HAOA 2VDHA 4GGBA 1XIGA 3C3UA 4UQ9A 4HU3A 3FFSA 2OYMA 3E9AA 5FF3A 3SI9A 2C0HA 3CV6A 4DO6A 3NA8A 5C9WA 3VO0A 3W7PA 1TIWA 4PC8A 3KBVA 4JD4A 3TJIA 5IM51 3A5VA 3LLDA 3OA5A 5FEPA 4ZOEA 1JD9A 1JXJA 3NPXA 3VM7A 2ALDA 4PTMA 1LOQA 4JEQA 4Q6XA 4JTGA 2A1YA 1KO0A 1FWWA 1F76A 2ZVIA 4M19A 2PP1A 5CGTA 3GNDA 1BWKA 1AQFA 1TZZA 2OEJA 4JNZA 5G5IA 4O8RA 1JZ2A 1Z69A 2E09A 5LNSA 1MQPA 3THCA 2Z2BA 2FGLA 3SCUA 4XZWA 3GXNA 4CD5A 2A5HA 1GQIA 3WEZA 4O4WA 2FZBA 3UQNA 3BMXA 3K4DA 4P7RA 1QBAA 3CIWA 1E6SM 3CHFA 1HO4A 3G22A 5I07A 2QYGA 1TX2A 4BI7A 4ZENA 3HV8A 3FV9A 4LC8A 1NELA 2X1TA 1W56A 3I7RA 3VOHA 3S9IA 4LUYA 1XYAA 5I09A 2E1DA 3AZRA 4CEUC 4E5TA 5CJMA 3F5KA 1R46A 4AXNA 1RP8A 1PKMA 1OIFA 1N2VA 3TONA 4FLQA 3QPEA 4PUUA 1Z9AA 1TB3A 3GXPA 1CXFA 4Z0JA 3NQDA 2RJGA 1OSEA 2HBXA 2VC5A 4PUEA 3FYPA 2VEKA 3A24A 7ENLA 2NT0A 3QKZA 4V28A 2G4FA 2Y8VA 3MVTA 4PMUA 1BG9A 1JF6A 1V51A 4FX7A 2UV8G 1BWLA 1F2JA 1M7OA 3EWCA 3OVPA 4MY1A 3TYZA 4ZVJA 4UTMA 3QFWA 2FB3A 4XZMX 5TIMA 1QDSA 3GUWA 1P0BA 2QJHA 4LBUA 3ARZA 3DC0A 3EXSA 1V6VA 3QW4B 3G8RA 3QV8A 3CB3A 1CEOA 1EDQA 4NIRA 1SO3A 2XFRA 4RE2A 4RR4A 3AYSA 4PUJA 3NR0A 4W7UA 5ABFB 1NH6A 2W92A 3KOZA 1EF2A 4W8AA 4AG0A 1BYBA 1NJJA 5AFDA 1J8VA 1GVRA 1OG0A 3N9RA 4O17A 4IISA 3LX9A 2C15A 4Y9OA 1F3XA 3GVRA 4C6JA 3QSRA 3NEHA 4OQVA 4BS0A 1R0MA 2DSWA 3KHJA 4B90A 1XBXA 2ZZ7A 3UCDA 4UTTA 3E3HA 1UASA 4PGLA 1I0DA 3LHYA 1LLOA 5AYXA 1UD8A 2H9AA 2QV5A 1SUXA 3HG4A 2BHYA 1ZP3A 3ATYA 2ACSA 3HPSA 4DBWA 1LWIA 2VT0A 4BFAA 4G7EB 5T26A 3BZJA 4ORMA 2HVOA 2QCDB 4FX8A 3CV7A 4G7FA 1BPLB 3B04A 3OG2A 2IPJA 1XIMA 1TWWA 3PZOA 3ZXWA 4AC7C 1IZCA 3FSUA 3O6AA 2FJUB 1RPXA 1EX1A 1KFBA 1RALA 1PPIA 3OZMA 5C7VA 2PBOA 2EEXA 3R58A 3WL1A 2VNCA 3TW7A 4QJ3B 3WFLA 2UY3A 3TTEA 1JCMP 4L1GA 2OKTA 3MHGA 2P76A 3QV6A 3RLVA 5D30A 2ZRYA 4WY0A 2I16A 5CZ0A 2TRSA 2CEQA 4JN7A 4L4LA 1PBGA 1HL2A 4XZIA 2DIJA 4N6EA 1P5BA 2Y1HA 1IWAA 5K9CA 3K5XA 3EYPA 2CHRA 2A7RA 2WSRA 1CGUA 1VFMA 2E40A 1LL7A 2ZZ3A 2ESCA 1KTCA 3SCQA 4BWLA 3LB0A 4NYUA 5E5CA 4C60A 1XRVA 4C6KA 9RUBA 1V03A 2D0HA 4D8AA 3L2LA 5LA0A 4FF7A 1QI2A 2XG9A 1DIEA 3BLDA 1Q63A 4HJFA 3W81A 2GSHA 1MFVA 1XIDA 4FPSA 3VZYA 2O7QA 2ZX9A 3BG5A 1FY6A 3P61A 4H2CA 5F1UA 4A8IA 3SJ3A 1G1YA 2QVHA 5FJIA 4K8GA 2TPSA 2VOMA 3PM6A 2QCNA 1GW9A 3OB8A 3QZ6A 4P8UA 2YJQA 3GFYA 1VBRA 1OFBA 2RH9A 4HB7A 1RJQA 1R87A 1Q8AA 5GJPA 2ISSA 1KM1A 1C91A 2BDQA 4ZQMA 1ZBVA 3KOXA 3OTRA 4GIEA 1XIJA 3LNPA 4WK9A 1FDZA 1P0EA 5A8GA 3GWQA 1LOLA 1HJVA 1FP8A 1FDYA 2E6YA 3HB9A 4HK5A 4LX4A 1JUEA 4L6DA 2O0TA 2BB0A 1JZ3A 4M1RA 1XBYA 1WDQA 3PTQA 2C1IA 4EANA 1JVNA 1KM2A 1LUCB 1QWGA 1UB3A 4DIAA 3S6TA 2YA1A 1YKWA 2VD9A 3BAIA 1XG3A 2CETA 1OX4A 3HGJA 1J0KA 2GDVA 4G2DA 2YYTA 1US3A 4Z0SA 2QXWA 3F1QA 4LB4A 2GGJA 1EJWC 5I79A 5LSMA 1B3WA 3AROA 3ZR5A 2JIWA 5G4EA 3AMLA 1GOQA 2OU4A 1RQHA 3IV3A 4LUTB 3DAQA 2WJEA 5DCDA 2X2YA 2O9RA 3FN9A 3N73A 4KT2A 1TJRA 1XP3A 1UZHA 3HPFA 2D2JA 4HTBA 2PMQA 1PTGA 1JGIA 4X3ZA 2QDGA 1KBBA 3MMWA 3I3DA 5CPLA 1JDEA 2A85A 3BLOA 2XN0A 1KRMA 1LRQA 3STEA 2ZZ1A 3W86A 3U3HA 4NJIA 4TU1A 4HVXA 2Z24A 2Z1XA 3DFHA 3K13A 5J5DA 2CZFA 3SAZA 2WZMA 1KFKA 3ERPA 1V02E 4IJCA 2GLKA 3QZEA 3CAWA 1P43A 2QIIA 4HOXA 1V08A 2UBPC 1XQLA 1MQRA 1ICSA 1LQAA 2Y70A 2BXVA 4HJWA 4N4QA 4AIOA 4L80A 5G2IA 1KFCA 2XVLA 3GB6A 4HHHA 1UA7A 2NVDA 3CQ0A 4CD4A 1MYRA 3RAOA 1U1HA 1HT6A 3H22A 2HMCA 3CUXA 3RU6A 1W3TA 1M9HA 3BDKA 1D7FA 4M7TA 1Q7ZA 4I9MA 1Q3NA 1QI0A 4GKLA 1H1ZA 3FA4A 4U2ZA 1QAPA 4EXQA 4F48A 1Q6FA 1CGTA 1S1PA 2P50A 1JCYA 1TPDA 2XJ7A 1EP2A 3CLMA 3O6DA 5RUBA 1D9EA 3MMTA 3W28A 2WM1A 5DT7A 3WEOA 1EHNA 2W62A 4C6EA 3GDMA 4GNJA 1QASA 5CPTA 2VWSA 3W84A 1MFUA 4LUSA 4DF2A 3QTGA 2E28A 4QLJA 1Z41A 2V68A 1L6WA 3LEPA 1JUKA 4AW7A 3ARXA 2X1SA 1Z42A 2XINA 3TA6A 2Q6ZA 1UCWA 1QOPA 3P84A 3MSDA 1H2JA 3DGRA 4KS0A 3PZ9A 4EKJA 2A3BA 1M7XA 4GQQA 4JTFA 2OWWA 1FCVA 4YTRA 2G5WA 3HFYA 4QCEA 1J4EA 4Q4QA 1OYAA 3UG5A 4MWAA 2F6KA 1BSLA 3T9PA 2WZIA 3EDKA 5I00A 5FD0A 3NZQA 2V5LA 3B8DA 5L6UA 1Z8AA 3VCRA 2CZ5A 2ZDRA 1KW1A 2ADAA 2QJNA 4XD5A 4HNCA 2UWFA 3WH8A 3WF0A 1XJBA 2GWNA 3W25A 3VIIA 4DBEA 4NNBA 3LERA 2HPIA 2R24A 1XYFA 3GM8A 3S42A 4QGCA 1PWMA 1LOSA 3LU2A 3WLPA 4H3DA 1JCXA 3N25A 3TIMA 4DJFD 1MDLA 3EOSA 4Y9PA 1KBLA 1BYCA 3S6OA 2NV2A 4KQNA 4JFUA 4ZE4A 4LUJA 1JAEA 2BP1A 3T1GA 1F8IA 4MWAD 4XV0A 5FAJA 1CXEA 3NJ3A 2Z27A 2BX7A 3BLLA 3GBEA 3KRSA 5XINA 3TKFA 4UOZA 5CSRA 1MZRA 3PZGA 5CGMA 3R0UA 3IIZA 1S2UA 1TWSA 2XUCA 3TU9A 1AH3A 5HQMA 4IIBA 4CVUA 4MNJA 1BWVA 1TA3B 3PBWA 4AHQA 2V81A 4ADSA 4OJYA 3B0UX 4Q7BA 1MW2A 1J5SA 4L1WA 4H00A 1XSKA 3LXCA 4LUSB 1TRDA 2FHBA 3PWIA 3A4XA 3PC0A 3TN3A 3PJUA 3ZJ7A 1N7KA 3FVMA 2CU0A 1FOBA 1O68A 4OUEA 5K9XA 5JU6A 1F74A 2YA2A 4GRSA 2O4QA 2P88A 3UXLA 1TQJA 7A3HA 3UWWA 3KBWA 3KDNA 3M0LA 3B06A 2V5BA 1SZFA 4GUGA 2J7DA 4AZ7A 1DJGA 2CKSA 3SRHA 3S1GA 1F6YA 5F4XA 2OQYA 1MVYA 3HJZA 1SVDA 2WMKA 4DQWA 3LTPA 2GGIA 4WJXA 3DBNA 3CS2A 5E6YA 4W8LA 1M68A 1VFLA 3T4CA 1I4NA 2ZUWA 2BS9A 1A3HA 4GZ7A 1SZRA 3PR2A 3IAQA 2PWHA 1GGOA 4U33A 4NNAA 1EZ2A 1W91A 3V5CA 3GSMA 4CUCA 1JEZA 2HCVA 3AS2A 1K8ZA 1XI3A 2ZBTA 3W7EA 2EJ1A 5IFPA 4QRNA 2FB2A 5A2CA 7XIMA 4UFMA 2J47A 3OZPA 2WC7A 4NP7A 2DZTA 2A4AA 3O1NA 3IANA 4JIHA 4P8WA 3QHOA 2CC0A 2HZGA 4UQAA 3UXAA 2E1WA 2Y62A 3AMKA 4GYPC 1ZZMA 3ABOA 3MT1A 1KGXA 4M81A 2VFGA 2ZUVA 1ECEA 3HG2A 1BF2A 4WKFA 4D9PA 2B0MA 5I3DA 4XTDA 2VVSA 1S3HA 1E6NA 1UP3A 2WPGA 3RLUA 2ZXDA 1JAKA 4TV6A 4Q4PA 3IVTA 5GJMA 3LV6A 2Y5EA 4LVDA 4IJBA 1YDYA 3BV4A 3K4WA 4U5KA 5D2XA 4Y90A 1RQEA 3DH7A 5JBFA 5AY7A 1V5XA 3LS9A 4EK7A 2FZDA 1MO0A 1ZCCA 4KWWA 3KP1A 5I78A 2D24A 4ZQOA 1OK4A 4IXHA 1EC9A 2R1KA 4IOTA 3GXFA 4G6CA 2OO0A 3L9CA 1G4TA 3WNMA 1Q7MA 1TIMA 4UFJA 3NSXA 2FTPA 4QSHA 5KZMA 5EGRA 5TF0A 1VBJA 1OFQA 2JK2A 3QFEA 1Q6RA 1DWGM 4LANA 5AHMA 3GW3A 4X22A 5BRQA 4WXYA 2ACQA 1KLZA 4ERAA 3CZJA 1KCXA 4P8XA 3SRFA 3ATZA 2JE8A 3RPTA 3TTSA 9CGTA 4LVGA 5A6LA 4XD4A 3SIZA 2ZUSA 3AMDA 2WM0A 1ENUA 4LUTA 3VD9A 3FXYA 1LBFA 2WQDA 5D2WA 2GDUA 3DHPA 5K7JA 1B1YA 3W7RA 3HMCA 4BI6A 2WAGA 2WVTA 4DWSC 1GVEA 4RZBA 4QAIA 2A3LA 1IZKA 3C2RA 4MKSA 3L7RA 4GJJA 4L5ZA 1GHRA 3L68A 5DEZA 4O28A 1X97A 3MDWA 1G5AA 4UCFA 4R33A 1NP2A 2QMKA 1OHLA 3W71A 1G0CA 2XFFA 3ZT6A 3CAVA 2D0FA 3OPSA 1LT7A 1T96A 2YCJA 3XISA 2ZRXA 3CL6A 3NIYA 4GLEA 3PAJA 5FCZA 3BAYA 2VZVA 1JYXA 1O5KA 3ARPA 4ZQNA 3ONCA 3IJ6A 4GABA 3GQYA 2VEGA 3GE7A 1RHCA 4JTKA 4GQBA 1EOMA 1FXQA 5DRIA 4DXKA 1ZY9A 2G3MA 5KITA 1XIEA 3W0KA 1J2BA 4HU4A 2HNEA 2PDMA 1IR2A 3TN5A 2C3ZA 1QNRA 1P0NA 3IAPA 4E6MA 3H2EA 3WBYA 2CCRA 3S1UA 2AAAA 3FEQA 4E4PA 3V4BA 4E2OA 3KLKA 2XIOA 4NU7A 3W82A 2DW7A 1K1DA 2QJMA 4V1XA 3ICJA 2EO7A 2DDXA 1OFAA 3CPRA 2NV1A 2QCGA 3WJSA 3AJXA 3EKZA 4D1JA 4YCOA 3W01A 1AMYA 1CX9A 5BOFA 2H9AB 4IH3A 2PI6A 4AAJA 4PTDA 4L61A 3T2OA 2VX6A 3VE7A 1S2WA 5IRPA 3HOJA 1K7EA 2VCBA 1SMAA 4LXFA 3CMJA 5E9XA 2DZXA 3WDQA 1P6CA 2FZ9A 2V3EA 4A29A 1H49A 2X1IA 4AHOA 2CWNA 4F79A 5CAKA 1E6QM 1U83A 5M1TA 4QX4A 1LTDA 1I2NA 4NL1A 1V8EA 3LRMA 1HKKA 5JQ9A 2XZ9A 3W1LA 2HROA 1PL9A 2KX9A 1OD0A 4E8DA 3V18A 1GJWA 1QRQA 1VC4A 2PDUA 1KGUA 4CCCA 3H2CA 4YWIA 4S3AA 1C8VA 3YPIA 2WKLA 3LMYA 4JTIA 2F84A 1S1RA 2NXHA 1FWEC 1UA3A 4UWMA 1VPXA 4RDZA 1ZSXA 1MMFA 4PRTA 2PGRA 5ENLA 3GY1A 4M6VA 4HYVA 5I24A 4UNIA 4OT7A 2HE8A 4GJIA 3EOEA 3V75A 4WOQA 5K9DA 1Z44A 3KXQA 3NZRA 4L4MA 4YU1A 4AQLA 3STFA 4H19A 3W1PA 2Z1VA 3HO8A 2Z6IA 1AQMA 1XYLA 2VGFA 3B97A 2P3EA 4KPLA 4DXXA 1NTHA 3I7QA 3W7OA 4WF7A 4GVIA 3SCNA 4I9TA 5BU6A 2W63A 3AMGA 1MXSA 2IPGA 2NQ9A 4PBFA 3NURA 4OV9A 4QQ3A 3RUBL 1K9TA 2J13A 1RZMA 4WDXA 3NPUA 3GNPA 2GOUA 3TAKA 3G1DA 4JAWA 2AMXA 1W1IE 1ML1A 4TXEA 2J62A 1DXIA 2NSXA 1Q4WA 2WHKA 4GC3A 2QV4A 1AMKA 4GO9A 3W29A 4AH7A 3UPBA 3MC5A 4IICA 3NPVA 3E0IA 5AYBA 4IMGA 5D8WA 4V27A 1SO6A 4X0NA 1RA0A 1UROA 4Q3MA 1JQVA 2VRJA 2VC9A 4FNTA 5ABGA 1B3XA 2PDNA 2OYLA 3MBDA 2D2OA 1NARA 1HGWA 4FNQA 3BWWA 4UTIA 5J5RA 3PSWA 4KW2A 4JTEA 4HTYA 2XVKA 4JTSA 2ZCGA 4LAZA 1C9WA 4F2UA 4F0HA 4AF0B 3K30A 4MKNA 4RE0A 1IXNA 2Y4SA 3T0BA 2OEKA 1KBKA 1ISYA 2AOSA 2IKIA 3LGEA 2O9PA 1VFSA 4GFSA 2Q8XA 3TTQA 2QW5A 3MHUA 2QJJA 1CECA 3AIVA 1DHKA 4BY3A 3M0VA 4EAMA 9XIMA 4A2RA 3TYCA 2QT3A 1W3NA 1FKXA 4TQTA 3M5ZA 4QEHA 3E0LA 4H7VA 1JGMA 1SYTA 1M6JA 1R3RA 2E8ZA 4X2PA 1DL3A 3H7VA 1SW3A 3I68A 3GX9A 4XZNX 5IDIA 5C7HA 3WY1A 1FKWA 2VFEA 5CPSA 3A64A 3T2PA 3EDEA 4LY8A 1Z89A 3WENA 3H2AA 2BMBA 1FWFC 3HN3A 2X41A 4FK9A 5FEWA 3LG3A 3AS1A 4C90A 1OX5A 2YPIA 4MPQA 4AF0A 1QU4A 2VR2A 1KM4A 1XLKA 3WLNA 5EMYA 3MSYA 1A4MA 5DMLA 3S83A 3TCEA 1RJRA 3RRAA 1KRCC 2WCAA 2VGBA 3CUIA 4GYFA 5IXEA 1O95A 3QTPA 3ONBA 2DW6A 1VPQA 4O54A 5FAGA 1WXJA 4GK8A 2DH3A 4QAWA 3ID7A 3P67A 4FOUA 3EEZA 3KTCA 4FSAA 5IDZA 3T05A 1R2RA 4Q4RA 3B8IA 3WEMA 1JXKA 5D8ZA 3GBDA 4R85A 3UZJA 5XIMA 4G5DA 3CEPA 3W6YA 5HUOA 1EJ7L 3ABQA 3DKJA 1E1EA 4CNNA 2ONEA 2P5NA 3CYJA 4AISA 3UR8A 4S1FA 3UETA 3EX6A 2J6XA 2V30A 4RNFA 1PVNA 1A3XA 1T8QA 5CZSA 5IHRA 3GVWA 2A7NA 1VJZA 1CGXA 2FH8A 2DVXA 3QC3A 1L6FA 4HP5A 1H3GA 2PU1A 2E68A 3DENA 4DELA 3EX2A 2QQ6A 2RDUA 3CZEA 3UWQA 3W1AA 3F2CA 2W0UA 1I8JA 3RM8A 3GTNA 4IF2A 1YDNA 3T0DA 3MI6A 1AH0A 4IQEA 4BQ2A 3GXDA 4RDVA 4LTSA 1OC6A 4ZEPA 4B5UA 1R3QA 5BMXA 2DEPA 3OQEA 4HNLA 2Q01A 1UWRA 1POJA 2Q8ZA 2NX1A 2CBIA 3W4RA 4A8RA 2PGFA 3SZ8A 1CWYA 3TXZA 3C8FA 3CM4A 1XKYA 3W6MA 5EMUA 3B05A 4AU0A 1R30A 2G3NA 4OE7A 1B9BA 4DYEA 4ZTYA 2Q71A 1CXKA 3WQEA 3BW2A 2C14A 3CLWA 1DQWA 3MUZ1 4DVOA 1FWIC 2Z1SA 2OT1A 3H54A 3SDOA 2ZZ4A 3TWBA 2R8WA 3UG3A 3PFMA 4ZSUA 1JD7A 3UJFA 1JYNA 4JTDA 4GQGA 4CNOA 1BKHA 2VELA 3P5ZA 2PDXA 4S38A 4Z1DA 4PL2A 3CQIA 2OFJA 4BR1A 1QPQA 5GNXA 1VJIA 3AMCA 2C18A 3KUMA 4KRUA 4WSJA 2ZC1A 4S3KA 4C65A 1BAGA 2NQLA 3VIFA 2WZTA 1BGGA 3TN6A 3HQ1A 3RRXA 3TW6A 2ZYFA 3GC2A 3B9EA 5JXQA 1M65A 4H6QA 2C0AA 2J7FA 1TJ2A 1VQTA 2A6LA 3C2EA 4DRSA 3TJXA 3PZIA 4FLOA 2ZUUA 4QE5A 2PP0A 1YDOA 2PUZA 2Z2AA 4AZ6A 3KX6A 2AGTA 1YXYA 2OLSA 1OX6A 4JQ4A 4O0KA 1HVXA 3ALGA 1S5VA 4NAEA 1KKOA 5HATA 3ZR6A 3O63A 3G1XA 5F2MA 4PMYA 3T78A 3R25A 2YLAA 3SSZA 3OO2A 3RYSA 1GYMA 3U2OA 3G0XA 1E4MM 3P8JA 4K1WA 5DELA 1XCFA 3P5YA 5H1WA 3IJQA 1TWIA 1R3SA 1WDPA 1HKVA 3DERA 3K1GA 3N3TA 4E2VA 3GC4A 2DSKA 4UTFA 4E8CA 1TV4A 1H11A 4JTUA 3QVQA 1SW7A 4MB5A 4ZL1A 2PDIA 3HZ3A 4HN4A 4M1BA 4AVOA 2WKGA 5I7GA 3O3RA 3NTYA 5DY3A 4GY7A 1GKRA 5T9BG 3T09A 3B8TA 1I6NA 1PWLA 3SURA 2Q09A 1W9PA 3SRKA 1E5NA 2FTWA 3PK7A 3L4YA 2HTMA 3DBPA 1FXPA 1RUSA 1B4EA 1PIFA 1KXVA 1YNQA 4XAPA 1OT1A 1ONXA 3N2XA 3QN3A 2XVNA 5DRCA 3GS6A 3W70A 2Y89A 2RHGA 2GQ8A 5A6BD 4TTGA 2BSLA 3KBMA 4JX5A 4ZSTA 2V8ZA 2ODOA 1XICA 4PUWA 3JS3A 1B0IA 1VLIA 3OEXA 3S4TA 3VK5A 3IJDA 3EA3A 5AHNA 1O5RA 4ADUA 1E9IA 4MY8A 3SN0A 2ABBA 3HMJG 3AHYA 4LVBA 3FOKA 3MO4A 5LHEA 4IP7A 2B31A 2NW0A 4EOUA 3OZOA 2WCSA 1L2QA 3FEMA 2VDGA 4G9PA 2ISFA 1FCBA 3O16A 4CD6A 3M0IA 4BQ4A 3TCSA 3VMOA 2WMIB 4JQ2A 3NZ1A 3WZ0E 2VJXA 1TWZA 2IQDA 2P53A 5FOOA 3WCZA 4GVGA 1VIWA 4AZIA 3QOMA 3UJ2A 1XCXA 4MWAC 4AMCA 3TMQA 1PTAA 4UUIA 3AQUA 3NQ6A 1JUBA 1JCTA 3TC6A 3RO8A 3UESA 5DCEA 4Z08A 4LVAA 4L1XA 4AX6A 3TTYA 2RJHA 3PTKA 2XH7A 1ODZA 4KRTA 1VHCA 4Q4OA 2G50A 2W27A 1ZLPA 4WQ6A 4AY8A 4EF9A 1UWUA 1GOMA 4AZHA 3WBAA 2YDQA 1C9DA 3JVAA 3MZ2A 4D8ZA 1UZ1A 3WD0A 3TNBA 4B5VA 1JZ8A 3VGEA 4W93A 2CW6A 1QFEA 1M41A 3QYQA 4C91A 4LS2A 4JHZA 5G1MA 4RDWA 2WMHA 4TR9A 3W26A 1VD6A 2WHMA 4D1IA 3KOFA 3LGGA 1VRDA 5CZTA 3D47A 4PMJA 1GVQA 4BF7A 4YVVA 1KXTA 1AK5A 4WVXA 1OFRA 3KL3A 3L2IA 4JHOA 1AA1B 3ZQ9A 2G4JA 5EL1A 5LIWX 3GTXA 3MU7A 1FCUA 5AVNA 3EOLA 2PF8A 3VYLA 3UWEA 1DWJM 1XCWA 1YEYA 4TTUA 1TVLA 2PRHA 4Z1YA 4H6KA 1ALDA 3II1A 1J2WA 4O50A 1UR0A 4E8GA 3IIPA 4D8LA 1VFHA 1HQTA 3LCGA 3IUDA 3IJLA 3SB0A 1R5YA 2PS2A 2GZXA 2G3JA 3P3BA 1UH3A 1HKWA 3O06A 4AXKA 1YPIA 5ABFA 4Y6GA 2GFTA 1QWKA 3I10A 3PG8A 2LLEA 3U48A 5CC5A 3ZVIA 4MGGA 1NWSA 2O9OA 4HHPA 2AMGA 4LBRA 1WKFA 1X1ZA 2F6UA 3VNMA 2GGGA 4US6A 1UR2A 4HPGA 1H5YA 1JIBA 3MPGA 4F9JA 2MNRA 1PHQA 4E3VA 3OODA 5EMMA 1B4KA 1VPYA 2DUXA 4IMFA 3NDOA 1WZAA 1UH2A 2A3CA 3MKKA 3M0HA 1FQ0A 4PTWA 3IJ9A 1ADDA 1QR7A 3WJWA 3WD2A 1HKMA 3A3HA 1VLWA 2J77A 2JGYA 2NVAA 2XWDA 3UW6A 4R7WA 2BVWA 4C6NA 3P6LA 1E70M 3PNZA 5LNVA 3DHDA 4Z2KA 1ZALA 5PTDA 4YMZA 8TIMA 4OVXA 3EMZA 4HA4A 4DBUA 3PBMA 3CHEA 1CLXA 3M46A 4R53A 2PGEA 3CBWA 3L23A 4MPKA 4DZ5A 3BJTA 2L5HA 3NM3A 4O0ZA 3WLQA 3IIVA 3NOYA 3U6WA 2GSEA 3VZXA 3RGTA 3ZR4A 3AYVA 1AODA 4F0SA 2INFA 2V2DA 2CBJA 1BGAA 2D3LA 1PKLA 3O6CA 3W72A 2X16A 3RILA 3GZAA 2FHCA 4GI4A 2GJPA 1KB3A 4W9TA 4X63A 4AD3A 1E72M 3G0UA 4KWOA 2PTWA 3SCOA 4XD6A 3TYDA 4R5EA 1EF3A 1A4LA 3VXGA 3EWWA 3QPZA 2I57A 4MB4A 1ITQA 3QW3A 1LDCA 3TXVA 3H24A 2HXTA 5I3FA 1O94A 1CENA 4WSHA 2X09A 1TPUA 1Q6EA 4HA0A 1VEOA 5A8PA 3GIQA 1DQXA 1GJPA 3N19B 3L65A 4LAKA 5HOSA 3KTXA 4W5ZA 4DAFA 3LPFA 1K6AA 3WF4A 2PA6A 1TELA 4Q8WA 4D6EA 3GAYA 4XAGA 4KWSA 4LS1A 2AKMA 4HKPA 3PANA 4ZQPA 1EGMA 1V6TA 1XLBA 3JRKA 4MDPA 2QAFA 4NNCA 1W54A 5DCBA 3S3GA 3QGVA 1FHLA 1LWHA 2RDXA 1H50A 4GY1A 2WYSA 1HG3A 4GISA 4DUWA 3WQ6A 4JYDA 4PMRA 4Q4SA 1VZWA 3G8EA 5BXSA 3WELA 1QW7A 1GOKA 3LRKA 1RD6A 4H8UA 4NZCA 2XGIA 1YTKA 3VNLA 3L4ZA 2OODA 4KEMA 3XIMA 3MUY1 3R11A 3NQMA 1QHPA 5D05A 1ICQA 1XLGA 5D9MA 2OOFA 4DJEA 5HUPA 4E2DA 2FPVA 1D7KA 1BHGA 3QGAC 4TO8A 1N8IA 3KCLA 1BTMA 3ZO9A 4I9AA 2DT1A 1UQYA 1SR9A 4S3GA 5A8NA 5LIYX 4WY0F 1Y0EA 1MXGA 3AIBA 4HPHA 3QF0A 3HPAA 3ZJ6A 2QJGA 1ECQA 3ZT7A 3P60A 4GZJA 4AHPA 3EX1A 3I3EA 3A3XA 5E93A 2J7GA 2J8GA 1BD0A 1D3GA 3W7NA 4IGSA 2XSBA 3S1VA 2TAAA 3PHAA 1C7TA 3C56A 4NYYA 1NM9A 4FO4A 3TX9A 4RNIA 5DANA 1GZGA 4Q8NA 1ADOA 1NU5A 2OCZA 4W85A 3G77A 3LPGA 3T7VA 3U5UA 1KGWA 4X9SA 3WSUA 4W88A 4PMXA 4AIUA 5G2WA 3EA2A 3G18A 3CH0A 1E4IA 1FUYA 4DY1A 3QXBA 1DPMA 2J9XA 1WAUA 2GL5A 3N12A 1UWAA 2D22A 2F61A 2AKZA 3TTOA 4ZTXA 5ECUA 1REQA 3C0QA 4PCSA 4L56A 9XIAA 3OLEA 2CIPA 3UFYA 2F6XA 5FJJA 3FAWA 5M3WA 3GIPA 2Q3RA 4IX2A 1FVPA 5CSSA 3WLMA 7REQA 3VKAA 2C8NA 4KESA 2Y61A 3UY7A 1RLCL 1IT0A 3QJAA 5HMEA 4RZ6A 1W2PA 2R1LA 4H04A 4OGZA 4ACYA 4DNMA 4M0XA 3BGAA 4HHLA 5I3IA 1NOWA 2IKHA 4O1CA 3B9DA 2V2HA 4X0VA 2Z28A 3ANVA 3MS8A 2PD9A 3M4HA 5CXPA 4A22A 3APTA 4F2BA 3THUA 5DN1A 3HQPA 2OYKA 3CL7A 2R1PA 2X42A 1G67A 3TQVA 1Q66A 1OT2A 3VNYA 5AYYA 1MDRA 1K4GA 1GEHA 4ZOAA 2QJIA 5C9UA 1B30A 3W87A 2JF7A 5A94A 2PDJA 4LS0A 4JKMA 4ML4A 1OGGA 4LNYA 5K4ZA 1IWPA 1F4HA 5F1VA 2AL2A 4M3PA 2O9TA 3CUFA 4XKMA 4JOMA 2DP3A 1UJQA 4ZO7A 4UZUA 3FHAA 4LB3A 1TO3A 4MJ4A 3ITXA 1V0LA 1UD3A 4ZB5A 3NL2A 3VMNA 1QTWA 1QPRA 3KRUA 3SIMA 4CQ8A 3P82A 2DZVA 2BOFX 1O5QA 2HS6A 2QZRA 1R47A 1ME7A 3WYZA 4B9YA 2FTYA 1YRRA 3S46A 4YCPA 2RDTA 1XUZA 1MI3A 2YCEA 4NKCA 4PCPA 1TZ7A 1TVNA 4ZQCA 4K8EA 1GORA 4GY0A 2QULA 2PLCA 2D2HA 3SCTA 1U2YA 3R0KA 2YL6A 2ZRZA 1UUOA 5HQEA 3FS2A 1S5TA 3HQOA 3N6JA 1OINA 4PODA 3F4WA 2VQTA 4GUJA 4KWUA 3MTWA 4DWSB 2G96A 1KV8A 4HD5A 3EOOA 1IF2A 3QHMA 2DT3A 2DZBA 4JDBA 4X9YA 3TZFA 2C7FA 1M1BA 1ZU8A 4JY8A 2F2HA 4JL1A 5H91A 5G1YA 3AUOA 4AD0A 3B9OA 2CHOA 1Q85A 1J79A 4UTLA 5D2TA 1QNQA 4Y8EA 3ITLA 2IXUA 1Q6QA 3BG9A 1I45A 2VR5A 2VOTA 5C9RA 4QJ4B 3S47A 2INZA 4OECA 5DT5A 4HQVA 3DCPA 1E5JA 4ASTA 5EBUA 3M0ZA 4XIMA 1RK6A 2DJLA 4C7FA 4R27A 1XLIA 4FLSA 2GJXA 4C1NB 3GXIA 3JZUA 4FXJA 3UZZA 2BXYA 3VFLA 4GC4A 1WO2A 3A6OA 3FK4A 3RG6A 1EXPA 1OQFA 1A3WA 5D37A 2GK1B 4DWSA 4FX6M 1US0A 3S6DA 3PJXA 4H01A 4IGNA 2PZNA 2XGBA 5AC4A 2QIWA 2ZX6A 3HQNA 4IL2A 4IWWA 3CZ8A 3TYBA 3EMQA 4O0QA 4XG1A 4ZA0A 1C7SA 3GLCA 4US5D 4QS6A 3WQFA 4I6KA 1ZP4A 4IPNB 4DWDA 2FJKA 3W7JA 2Z2UA 3E2QA 4QCFA 1DTNA 3BICA 5CCZA 5B80A 4LQ1A 1LM1A 3CO8A 2PWVA 3VINA 1GYNA 4F0MA 3T8LA 3BLPX 4WGXA 3UR2A 3FXGA 4NT0A 2G3FA 3WLSA 1V77A 3WUFA 3RPMA 1V3IA 2JEPA 4GIRA 4GVHA 1IHIA 4HPNA 3BGGA 4U4MA 3DG3A 1WZKA 1V79A 3BCFA 4KF1A 5K3VA 5I23A 4DJFC 4ZOBA 3RXZA 3V7PA 4PCNA 1GKPA 1H7NA 3RX3A 5TQLA 4GH3A 2OEMA 4ICMA 1WOAA 2JFEX 2VQUA 2VFFA 1VBHA 5C5YA 2DY3A 3EXTA 3NQ8A 2RAGA 5BW6A 1DEDA 5GQBA 3S2LA 1UC4A 3MJYA 2XVPA 1OBAA 2J7HA 3I4EA 3NQGA 1Q6GA 2E5DA 4MMWA 1TSIA 2W66A 1QHOA 4ZMGA 1ZRQA 1XLAA 3W7HA 2IQTA 3GR4A 5D9NA 3D3AA 3WFAA 4JN8A 5D32A 4K2SA 1S2VA 4DM2A 1QHZA 4U2YA 4JFTA 2Z6JA 6REQA 5IBXC 4UTJA 1F73A 2PCQA 3GHRA 3H2NA 2JQXA 4RNJA 1NF0A 4RCXA 2G0WA 1L8NA 1R3VA 4YTQA 4C1LA 3VMPA 3VAVA 1HFBA 3VGBA 2X0HA 3DC8A 4LYPA 4WIWA 4AZCA 1RLDA 1B3VA 3MJMA 5E70A 5HANA 4UFHA 3UT0A 3GYCA 3URAA 3QMRA 4D6DA 4H7ZA 4AWSA 1NQ6A 4Q8MA 2PWUA 2C13A 3U2CA 1XIIA 3O0FA 4ZQRA 4JNMA 2ZXAA 2ZC8A 3AIWA 1W1A1 2PAJA 3C5QA 4IM4A 1PYMA 2EF9A 4XBKA 2QVNA 3SECA 4JEJA 3VDBA 2WMGA 1VFOA 1QNSA 4PA8A 2EPHA 3L0NA 4BF5A 3UA3A 3RCNA 2CZEA 3T55A 5CBJA 4M82A 2TODA 4PMVA 4ALDA 1IV8A 4UTUA 1IWBA 3LLXA 5D38A 4N02A 1EGVA 1S5MA 4GIYA 2J74A 4FNSA 3M1ZA 1S3TC 1I2QA 1VH7A 2Y63A