3EX3A

Human orotidyl-5'-monophosphate decarboxylase in complex with 6-azido-ump, covalent adduct
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
257
structure length
257
Chain Sequence
MELSFGARAELPRIHPVASKLLRLMQKKETNLCLSADVSLARELLQLADALGPSICMLKTHVDILNDFTLDVMKELITLAKCHEFLIFEDRKFADIGNTVKKQYEGGIFKIASWADLVNAHVVPGSGVVKGLQEVGLPLHRGCLLIAEMSSTGSLATGDYTRAAVRMAEEHSEFVVGFISGSRVSMKPEFLHLTPGVQLEAGGDNLGQQYNSPQEVIGKRGSDIIIVGRGIISAADRLEAAEMYRKAAWEAYLSRLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Orotidine-5'-phosphate decarboxylase
publication title Lys314 is a nucleophile in non-classical reactions of orotidine-5'-monophosphate decarboxylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Lyase
total genus 97
structure length 257
sequence length 257
chains with identical sequence B
ec nomenclature ec 2.4.2.10: Orotate phosphoribosyltransferase.
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3ex3A00
2GVJA 3KRUA 2X2GA 3GR8A 1RZMA 3QH2A 2V30A 5E0KA 2Z6JA 4NNCA 4FX6M 3GK0A 3L21A 1XBYA 2CLMA 3E9AA 4K39A 1EP1A 4P2VA 3P8IA 1YTDA 2YPIA 4O4VA 1TPEA 4WOZA 1JCXA 1A5AA 2ZDRA 3N2XA 5T26A 4ML9A 4XKYB 2QDHA 3L68A 1TTQA 3Q58A 3W1RA 4QJ1A 4UMAA 2Q8LA 2QCDA 4M7SA 2H90A 2E6FA 2TSYA 2W79A 4J9JA 5F4WA 1FDYA 3S5OA 3EXSA 3UWYA 1LZOA 3NPWA 3FJLA 4Q32A 5KZDA 3M41A 1SO5A 5EKYA 4UCGA 2ZZ7A 4JTTA 3VCRA 3W7JA 3P81A 4N6EA 2CLIA 5BMWA 3HG5A 5LGXA 2C16A 3NR0A 3G8EA 4LVBA 5AHLA 4IJBA 1KFCA 1F5ZA 3BLIA 1Q6OA 1FQ0A 3W7HA 2FFCA 4O1CA 3CWNA 1G4EA 3NM3A 3C4UA 1J4EA 3TFXA 1QR7A 2NUYA 5AB3A 4JDYA 4FO4A 2WSRA 1OFOA 1C9DA 4UFMA 1BTMA 2YXGA 1IGSA 1FY6A 3CQ0A 1JJKA 2ZA1A 2C15A 5AHNA 4JICA 2JKEA 3IEBA 3SGZA 1XBXA 3R8RA 1W8SA 4RJEA 1BWLA 3R12A 1D9EA 3CHVA 1GVFA 1QPQA 2A1YA 2PCQA 3L66A 3NQAA 5HUPA 3EXRA 4A2RA 3EWWA 1IXNA 5LHFA 1HO4A 1NAL1 1AK5A 3HJZA 2I1OA 3DGRA 3PB2A 3RLVA 2EPHA 1KFBA 1N8FA 3BG3A 3OHIA 2VFHA 4GRSA 1WA3A 4Y96A 4EOUA 1TQXA 4GUJA 4RCXA 4WY0B 3DFSA 1CX9A 5E93A 3MMTA 4HPJA 2BLEA 3LLDA 2E5BA 3B0UX 5K7JA 2GPTA 5FEPA 4UFHA 4DELA 1XDLA 3TA6A 1I45A 4HSOA 1H62A 1KM5A 5FEZA 5ABTA 1R46A 3MI2A 5TBOA 1DQXA 4MY8A 3P5YA 5AYXA 5F2GA 4LC8A 4RZ4A 3PVFA 2TPSA 2QJGA 4UTTA 5DN1A 1B4KA 4XBKA 2QCGA 3DHFA 3KOFA 4LOCA 3EX2A 5L6UA 3T40A 3NXFA 2V82A 4LNYA 4NZJA 1OJXA 3M44A 1SSGA 3WJSA 1I2QA 1S5WA 5CPMA 1AW5A 5HJLA 4KFOA 3LCXA 5U7SA 4JY9A 2A6LA 4ALDA 1NF0A 3ATZA 1TYGA 1GTHA 4PL1A 3HGJA 3LXAA 2B7QA 2RKXA 1P1XA 1XKYA 1E51A 3W7EA 2EKCA 2VEIA 1W5PA 4L4MA 4QNEA 4WUIA 3S5NA 3W7DA 3FYOA 3PUEA 2X16A 4YXGA 4CQ9A 5LZLA 4DF1A 5C55A 2V8ZA 3P8JA 1Q45A 2G5WA 1PS9A 2O7QA 3HGSA 2EF9A 3KFTA 3EWYA 3B06A 3C2FA 2CU0A 3TXVA 1OX4B 4ZMGA 2QUTA 3PWAA 1DJNA 3N34A 3GXNA 3BPWA 5KZEA 4UTWA 2FB2A 4ZL1A 1JCNA 4UTKA 1I2PA 3YPIA 3UWQA 4JX6A 2FB3A 2PRLA 3W85A 2FQIA 2Z1BA 4FX7A 1SW3A 3MYPA 5AC6A 3W1NA 3OVRA 4CNNA 3TE9A 2HTMA 4K8EA 3TK7A 3AJXA 1LBFA 3DI0A 2VEPA 3W7CA 3W7MA 1VLIA 5HINA 3SY5A 1ME7A 3UXDA 3JRKA 3BK0A 2GOUA 2Z0IA 1RQBA 4ZQRA 1W0MA 4DO4A 5LNSA 3C52A 1FWWA 1QMLA 4OV4A 1VR6A 1WOAA 2ATMA 1HUVA 3C2OA 5CZJA 2FDSA 1U5JA 1OABA 4UNKA 4BWLA 1W3IA 1LTDA 4O12A 5K9CA 4JTSA 3I68A 3W23A 2Y7DA 2DORA 4S2BA 3TKFA 2VEKA 1R2SA 4JYDA 2VELA 4EVZA 2ALDA 3KAOA 1OK4A 4ZZ9A 2VXNA 4GUFA 3UZ5A 1VPXA 1TTPA 4U4MA 3S5YA 3UQNA 3W1LA 2P10A 4O19A 3U2OA 1J2WA 4HT3A 1OFPA 4Z1CA 3TU9A 5D05A 2P0OA 4HPXA 1LBMA 1OFDA 4ZQNA 1YADA 4PFMA 4EWND 3GXPA 4JGDA 3NQVA 4UC5A 2HMCA 1OFQA 2YYTA 2DZSA 3C2EA 3LB0A 1SW0A 3CT7A 4LC6A 4YLWA 1GVSA 5AFDA 4N9DA 4JTLA 3DH7A 4XKYA 5G1YA 2QCNA 1AG1O 4E38A 2ZYFA 4MZ8A 3MYOA 3S1XA 5C54A 5I3HA 4C1KA 1YLVA 1W1ZA 3HBLA 1F2JA 5D32A 4XBSA 3NQEA 3A22A 4NT0A 3R13A 5I3GA 2RDWA 3GLCA 3HGOA 4E0CA 1ICPA 4EF9A 2YDAA 3QYQA 1V5XA 3C6CA 2ISSA 4GUHA 4IMDA 5G1TA 4TU1A 5CZTA 4TR9A 4NU7A 3UXAA 2GQ9A 4MUZA 3W1QA 5KITA 4MYXA 1WAUA 5KSWA 1ZJIA 3DFPA 1DJQA 4NX0A 1VCVA 2OMAA 1L6YA 2QCFA 2ZFAA 4P61A 1QOQA 1PL9A 5KINA 3W87A 1VLWA 3IIOA 1X6UA 3CLMA 4ZQCA 1SU5A 2J9YA 4K6AA 1ZAHA 2NX1A 4HNTA 3NPVA 3M7WA 2DZWA 5BOOA 2V5BA 4AF0B 3I6RA 3NZ1A 2FLIA 4MFEA 4IPIA 1K02A 4HNNA 2UV8G 3T4CA 1VQTA 2X1UA 2J9ZA 1DORA 1A53A 3IVTA 3JR2A 5LSMA 5H91A 4CCCA 2Y88A 3LRLA 3EKLA 3W7NA 1H7XA 1XDMA 1ME8A 1TSIA 1WXJA 1P5BA 3MHUA 3N73A 1LLZA 4WD0A 2ABBA 1GT8A 4BI5A 3LHYA 1KFLA 4JX5A 5DY2A 2VFFA 3NZRA 4K37A 4NZFA 4GFSA 4POCA 5AHIA 1TJRA 1CI1A 2CLFA 1ZAJA 4L4LA 1A5BA 2BTMA 2GQAA 5KTLA 5IM51 2CLEA 4UR7A 3PBYA 2VFDA 2V0TA 1YDVA 1EWEA 2V2CA 4LY8A 4Y6GA 3NQGA 3DAQA 1TPUA 2B0MA 4WY0A 3P67A 3WJWA 1VS1A 4FXRA 3IIVA 1OF8A 4FF7A 3BW2A 3MWAA 3NA8A 5D2YA 5EL1A 1JQXA 1K3UA 1P4CA 2QKFA 3A5FA 4HKPA 3W9ZA 4DPPA 5D30A 4RZ6A 3HF3A 1RV8A 5DLCA 3W76A 1F7BA 4O54A 4UIOA 1ICQA 1WX0A 4LVDA 3TFCA 1KM1A 5G2HA 3STFA 4IMFA 5FF7A 3NQMA 1SZEA 4OWGA 3G1YA 2WPBA 1OYAA 3TJXA 1IXPA 3O06A 1W5NA 1QO2A 4YL2A 1QWGA 3PULA 2JKPA 1B4EA 1A50A 4FEZA 4RR4A 5HR6A 4UFIA 1MO0A 5E1QA 3C3NA 3V1PA 1MEIA 2A7RA 3KVKA 2BZNA 3LHUA 1PE1A 5BNKA 1F6KA 2Y63A 3WK2A 1YTEA 1LRTA 2ABAA 3LCFA 3G1FA 1DOSA 3W70A 3DXIA 1H7RA 4CQ8A 2D73A 1KM3A 1YXYA 3G0UA 3C2RA 3T78A 5EA9A 5I3FA 3L0NA 3W7PA 3MHFA 2NV1A 5CPOA 3TSMA 1JUBA 3M1ZA 2TMDA 1EUAA 3CTLA 4K8HA 3UY8A 1OX4A 4N9EA 4A2SA 1G67A 5LNRA 1O95A 2E1DA 2YW3A 5AOUA 1KFEA 3H53A 3SZ8A 3PF3A 4UMBA 3H54A 3I7SA 1XBVA 2EHHA 2AAMA 1K03A 1M5WA 1MEHA 2GQ8A 3A5VA 1NVMA 3W73A 1TJPA 3TJLA 3TIMA 2BX7A 1Z48A 1VCGA 3P82A 3B0PA 1LOSA 1I8JA 3PUOA 4RV8A 2JK2A 2ZRXA 3W22A 3DHDA 3Q94A 1JRCA 3L9CA 3W2JA 4BR1A 4IUOA 3NQ6A 3PM6A 8TIMA 1G7UA 2E5CA 5FF4A 2QCHA 4O0ZA 4PH6A 3DI1A 4CCDA 1LROA 3UPBA 4M6QA 4RKAA 1KBIA 2FPVA 1GVQA 4QITA 1QFEA 3B4UA 3QJAA 1VCFA 3C56A 3DKLA 4LVAA 1T0OA 3HG3A 1W54A 1FBAA 4N2YA 4KFPA 3LI0A 1ME9A 3W83A 5J5RA 1OHLA 4LU0A 5K2ZA 1SZGA 5L9FA 1SQ7A 1O5XA 2R8WA 3W7LA 3W75A 4HNUA 3BG9A 3NL6A 3B04A 3M5VA 4IMGA 4BF9A 1H50A 3FA5A 1K8XA 2A5HA 3RMJA 4G1KA 2B4GA 3STGA 3A9IA 1TV5A 3LCIA 4XQ6A 4MZ1A 3W6YA 3M5XA 1Q6QA 2QCLA 2GVGA 3ANYA 2NV2A 4O53A 3P84A 2BWGA 1H63A 1X7FA 1LLWA 1ZY9A 3PBVA 1UCWA 4W9TA 3ZFHA 3LERA 4GXMA 4AWTA 2F7FA 3FFSA 4PA8A 4NJIA 1PV8A 1S3HA 1UUMA 3W1PA 4HN4A 1I4NA 1VYRA 3I7QA 5F1UA 5U4NA 1GPWA 4LUIA 3TV8A 2RH9A 1YDNA 1TQJA 5AHMA 2C13A 2WQPA 2AGKA 2TRSA 2QCMA 3W2LA 2Y6ZA 5G2WA 4YMZA 5C5YA 1GVRA 4QSHA 5D04C 3P61A 2P1FA 3NQ2A 1VZWA 5G5IA 3GAYA 3BGJA 4X9SA 3NQFA 3TAOA 4X3ZA 3NQCA 2RDTA 2YFNA 3RU6A 1EP3A 5D33A 4O17A 4JEQA 2G95A 4AF0A 5D02A 5HNRA 4HSNA 3W7GA 1TPFA 1WDWA 4S2CA 2ZZ5A 2VKZG 5SWUA 1SO6A 3UD6A 1XCFA 3BLEA 3N14A 1JULA 1FCVA 3B8DA 2BXVA 3FYPA 3OBKA 2QAPA 1OFBA 5AC8A 3L67A 1KA9F 1SSDA 2DZTA 5CPNA 5HR7A 3C8FA 5FESA 1IIGA 3LCGA 5K3VA 1F76A 2NLIA 4GE8A 3SJ3A 1JQVA 2A0NA 1SPQA 4GWEA 4N4PA 5DBTA 2RFGA 2YW4A 1W3NA 3CEPA 4IQLA 3QFEA 2DU2A 3LGEA 3N9SA 1W37A 1VH7A 3W88A 3NPUA 4M5PA 3S0CA 1YDOA 1H7PA 2KZHA 4I7WA 3O07A 2XFWA 4PL2A 4A21A 4IOTA 2ZRZA 1DVJA 4Z1BA 5CKSA 4ADSA 4UTIA 4OV9A 5FF0A 2Y89A 3BW4A 3EX6A 5K9DA 1FDJA 1SFJA 1F73A 3WJYA 4WJEA 1L6WA 2CZ5A 4MY9A 2E5DA 1EWDA 4OE7A 1LOLA 2TYSA 3KXQA 1Q6LA 3UWUA 4Z0SA 1Y0EA 3GDTA 5EBUA 4GC4A 2FPTA 3HG2A 4WOQA 1QOPA 1O60A 4EF8A 4ZQMA 3QQ0A 1H1ZA 1W56A 3F4NA 1QPRA 3GX9A 1SUXA 3BG5A 3PS7A 3A23A 2PRHA 3Q37A 1ICSA 5G4WA 3G8RA 4MJZA 2E68A 3NVTA 2XN2A 5D2TA 5TQLA 3TQVA 3QRHA 3MJYA 3NYZA 1T8XA 2Y62A 1FCQA 2WSQA 3LBMA 2DJLA 3TNOA 1FWSA 1XL9A 3DFTA 1AL7A 1EPXA 2Y85A 3TSDA 1KM6A 3NQDA 2PRMA 3W1AA 2JGYA 1GZGA 4JR5A 5IBXA 3TUUA 4PCFA 3UYCA 2VFIA 4UTMA 4MLRA 3W2KA 3CIWA 5D37A 3SGUA 1ZENA 3DZ1A 4FNRA 2YCEA 3UWWA 3WK1A 4BFAA 2JGQA 4M7TA 1KM2A 4X2RA 5I3JA 3ZWTA 3LOTA 1M7PA 1VYPX 2NZLA 1M6JA 1QCWA 1KFJA 4NJHA 1LCOA 1TTJA 3DBPA 1JVNA 3S8HA 3GVGA 3O16A 3TR2A 4O13A 4A3UA 4M6VA 3L5AA 4OHQA 1KLZA 4RX0A 4A22A 2PURA 1KM4A 1OF6A 3GDMA 1JCJA 1VJIA 1G4TA 1GJPA 3SR7A 3CB8A 1LRQA 3F03K 3GKAA 3NGJA 3QQ1A 4CNOA 1SO4A 4JXCA 1JR1A 4JTEA 4GJ1A 3D0CA 2ISVA 3MHGA 1P0NA 4UR8A 1DKWA 4KWVA 2NX3A 3PC0A 1TB3A 3WJZA 4UFJA 1H7NA 1OVDA 3OG3A 4NVTA 2Z6IA 3M0ZA 4MOZA 1KW1A 3ABOA 4CLMA 3IIXA 1G7VA 4JS3A 1SR9A 4NX5A 1ML1A 3S1UA 2A4AA 3WK3A 2OCZA 2WNZA 3QW4B 3GAKA 3MW7A 3QSTA 4E2DA 1TCDA 1HFBA 1TMHA 3RFAA 5CPLA 4AHPA 5C2XA 1X1ZA 2ATSA 1BEUA 4JY8A 4JTIA 3VI2A 4N9BA 4PEKA 2LLEA 5MHBA 1C8VA 1EUNA 4AEOA 2GJNA 3MP5A 5KMYA 4JYEA 3TC6A 2H3DA 4JNMA 3LV5A 2CW6A 4B5NA 4WX2A 4ONVA 3KRZA 3IGXA 5LGZA 1ONRA 1FWNA 2J6XA 5K4ZA 4OGZA 3E12A 5HULA 2ZZ4A 3FKRA 4LWWA 1DBTA 1G6CA 1C29A 4N6FA 1LOQA 4AVFA 1MEWA 2OZ0A 1KM0A 3KVJA 4UTTC 2Q3RA 4UMCA 4NNBA 4AWUA 3BW3A 4AB4A 3M5ZA 1OG0A 1X8FA 3NL2A 2XN1A 4O1DA 3MP4A 5CGQA 4OQVA 1N55A 4NUWA 3NEVA 5H2ZA 4DO5A 1XUUA 1O4UA 4M19A 4JTGA 3VE7A 5FEXA 5FF3A 1WQ5A 3E02A 3G18A 4S1FA 4FXSA 1TV8A 2QDGA 1EB3A 3KX6A 5LNWA 3LXBA 1H7OA 5BRBA 4LS1A 1H5YA 1XM3A 3KVMA 1ZALA 4Q33A 2C3ZA 2FPYA 2YGYA 3PR2A 2E6AA 4HHPA 2NXHA 5D38A 4XUGA 3PG9A 4QAIA 4DXVA 3THQA 1HO1A 2PC4A 2A7PA 5HMSA 1W31A 4JYFA 5K9XA 4LW7A 4I7UA 5BW6A 3OA3A 1MSSA 3IGSA 3CIXA 2RHGA 4O10A 2WNNA 1W5OA 1I2NA 3R2GA 1UBSA 3M43A 3EX4A 1TPC1 4UFLA 4BI6A 2WJZA 2A7NA 5D03A 2DZUA 3LHVA 4BI7A 3W2MA 3OVPA 1F74A 1HG3A 3SW6A 2ZZ1A 1QPOA 1A5SA 3GR7A 4AAJA 3SIZA 5F4SA 2V5LA 4UNLA 2VFEA 2DZVA 3VFLA 1WYIA 4UUIA 3HG4A 1LDCA 1H61A 2VC6A 3B0VC 2ZRWA 2OT0A 1TPWA 3QMRA 3BO9A 1PHWA 4HNVA 4NJKA 2CLKA 1EIXA 3NL5A 2GVLA 5A8GA 3TQ0A 2QCEA 2EGZA 3N3MA 3EX3A 4JIQA 5DBUA 2PE4A 5HWMA 4AHOA 3EWUA 5F2MA 1D3GA 1X1OA 2Z2UA 1WBHA 2ZRUA 5J5DA 3EXTA 4UTHA 2H3BA 4O50A 1FXPA 1KLYA 1Q6RA 3N2MA 1ZHAA 4PTNA 1FWTA 4O1BA 3EWBX 3DFOA 1YYAA 1PIIA 4ZVJA 1H1YA 4XTDA 4WZHA 3W7IA 2YSWA 4NQ1A 1FCUA 2ZQ0A 1MXSA 3HGRA 4O14A 1JCMP 2NWRA 2E09A 4UTLA 4LV9A 3O6YX 4QISA 3LHZA 3W1TA 1YXCA 2A6NA 3HB9A 2O7SA 3EKZA 4R53A 4A29A 1DHPA 2ZZ2A 4Q4KA 3BLFA 3DFNA 1QO5A 1R2TA 3IIPA 5CZ0A 2QUVA 3EWZA 3LTYA 1NSJA 3IIZA 5HUOA 4RLIA 2CZDA 1G69A 3QEZA 3CEUA 3R89A 3GIYA 1W5MA 4C1LA 3UWVA 4UFKA 3T55A 4ORMA 4XZ9A 4NXSA 1K8YA 1TPH1 1OX6A 3LTSA 3GDKA 2R91A 1RPXA 2E6DA 4TX9A 2ZA3A 3N9RA 2DZXA 3S6DA 3M6YA 2C1HA 4ZQOA 5BMXA 2G96A 4IXHA 2BSLA 3LXCA 3CC1A 1YPFA 5FI8A 4ADUA 1LM1A 3HPSA 1KFKA 4ICNA 3G1AA 1IXOA 1GTEA 2HSAA 5DELA 2ZZ3A 4MJMA 1QPNA 3C2VA 4QIUA 3HIJA 2OT1A 3G24A 1R2RA 4K38A 4H3DA 1BWKA 3W1XA 2J24A 3CU2A 1V7YA 5EMUA 3QMSA 5AYZA 3S1VA 3UZJA 1SZFA 5LNVA 1FWRA 2WO5A 3PB0A 3C0JA 3W86A 2WOQA 1H60A 3H55A 4MFDA 3UY7A 1Q3NA 3EWXA 4FIQA 5A5WA 1YPIA 1K7FA 1AW2A 2CZEA 3IVUA 3TH6A 4LVFA 3LBCA 4JTJA 2X1SA 1TTIA 3P7YA 3QM3A 3JS3A 3NDOA 3C61A 3AO0A 3CPRA 1K7XA 2C6QA 2DZPA 2FJKA 3K30A 3IGUA 4ADTA 3HMJG 2QJIA 3G3MA 3IV3A 2A85A 1QDSA 5TIMA 4M6PA 3G1HA 2V2DA 2XN0A 1H7WA 1P0KA 1IXQA 3UPWA 1UUOA 1LYXA 3FEMA 2QR6A 5DY3A 3P60A 3THAA 3UWZA 3PY2A 3O6DA 2J9XA 3W7RA 1AMKA 1ZFJA 6ALDA 7TIMA 1J5TA 2Q3OA 5EPDA 3BVJA 3P80A 3BGGA 3ZWSA 3G1VA 1RD5A 3O8AA 4O18A 3W3OA 2GJLA 3IVSA 2YFOA 2R14A 4JTHA 4CQAA 4TMCA 2NUXA 4CNPA 3NNTA 5AHFA 3A24A 4WXZA 3E96A 3TXZA 4JDBA 1W5QA 2X1RA 3L0GA 1NFBA 4MLJA 3NAVA 4JTFA 3SSJA 5D2XA 1SO3A 4LTSA 2Y70A 5CZSA 4DBDA 4Z1DA 2ZZ6A 3NOEA 4YWIA 3QMTA 3LM7A 1VHCA 3L5MA 4R33A 3BARA 4JIPA 3A21A 3FJ6A 3G1SA 3QPZA 5AYYA 2ZA2A 3G0XA 3LI1A 4DQWA 3L0KA 5HWJA 2CLHA 3CWOX 4FNUA 4Z1AA 2Y7FA 2V9DA 1S5TA 1GG1A 1JRBA 1RR2A 2IQTA 3NPXA 1KTBA 4O0KA 4ORIA 5KZMA 3GDRA 3W7OA 3I7RA 2YR1A 2QCCA 3O1NA 4AHQA 3WK0A 5LKYA 3RNDA 5EY5A 2YZRA 1PHQA 2J27A 3M47A 2B7NA 2ZTJA 3VE9A 1Z41A 2C0AA 1BKSA 1OYCA 2WSYA 3EB2A 3MUXA 2FTPA 4OBTA 4YCOA 2NX9A 3RF9A 1ZCOA 4WY0F 1IF2A 3O15A 4H6KA 4IMEA 4NNAA 1O5KA 5G2IA 4FNQA 2B7OA 3LDVA 4I7VA 4Z08A 3MI3A 3O05A 3QW3A 4IX2A 1G4PA 3TROA 3LX9A 2EAWA 3L5LA 3NQ8A 1MZHA 4XWUA 4EIVA 1OK6A 3INPA 2E6YA 3M5YA 2C18A 3L65A 4O16A 4CCEA 3E0IA 2NXIA 4FIRA 4FNTA 4DF2A 3NQ7A 2X30A 4O11A 1WV2A 1UB3A 5HWNA 1TPDA 1AL8A 1GYLA 3BV4A 4OT7A 1T96A 1HL2A 3FS2A 1JCLA 4IMCA 3W07A 1TIMA 1FXQA 1SZNA 1I2OA 2ZTKA 4JTUA 2ISWA 3QSRA 1TO3A 3IRDA 1FDZA 1SW7A 2F84A 3MBDA 4RXGA 2YYUA 5GVJA 1K8ZA 4QQ3A 3HO8A 4MYAA 3LTPA 4RXFA 3G0SA 3GKFA 3DKJA 1TPVA 1RQEA 3EEGA 3DENA 3KVLA 1CW2A 2I14A 3TCEA 3HPZA 4DO6A 4LS0A 4GNJA 4DPQA 4WXYA 5I3IA 1KV8A 1TRDA 4MIMA 4GUIA 1THFD 3S5ZA 3TAKA 1DQWA 2HS8A 1FCBA 1XUZA 3KRSA 4JD4A 2DJXA 1VC4A 2NUWA 3ABSA 5DCDA 5CSRA 1Z42A 4I9AA 3T44A 5AHEA 4AH7A 4IGHA 3PBUA 1EEPA 4Z0JA 1VGAA 1QAPA 2CFFA 3FIGA 1DL3A 2QF7A 5F2IA 3E49A 3QPYA 1KV5A 4AMAA 2ZBTA 2CZFA 1U83A 3CM4A 3GNNA 1OX5A 5FF2A 1ZNNA 1OFAA 5F4XA 2CWNA 3NM1A 1YXDA 4JTKA 2QEZA 3SFKA 3W72A 1KTNA 3HOJA 4O52A 1HTIA 3M16A 4NXKA 4LV4A 4DEFA 4YCPA 1GYNA 1PCWA 3G22A 3NL3A 3TW7A 1TREA 3PG8A 2HS6A 1FX6A 1F05A 2WNQA 3OIXA 2VENA 1XC4A 3O63A 3DFQA 2W0UA 2NXGA 1W3TA 4LRSA 1UASA 4X22A 2GUUA 3SECA 3PSWA 4KKXA 1VRDA 2H6RA 3TDFA 1OFRA 3WJXA 1PCKA 2QCDB 2CLOA 2NWSA 4TMBA 1OYBA 4Y8FA 4O1AA 4RK8A 1ZAIA 2A2IA 2Y61A 1WOBA 5F2LA 4KFNA 3RLUA 3TC7A 1L9WA 1GQNA 1GOXA 1XFBA 4TIMA 4FB7A 3PUDA 1UJPA 2H8ZA 2C14A 2QUUA 4O28A 4OU1A 4UTUA 3LRMA 4LT9A 3KHJA 3VKJA 2X1TA 4TO8A 3STEA 1EX5A 4PODA 3QF0A 3ATYA 3LCHA 2Q8ZA 3GZ3A 2QJHA 4DBEA 4FNPA 5K4XA 5DCEA 5DXYA 3TMQA 1AW1A 3SI9A 3HQ1A 4R7JA 1B9BA 1GG0A 4NJJA 1L6SA 3PAJA 3V75A 2YX0A 3FKKA 1A5CA 1B3OA 1WBJA 4IXXA 2C19A 1NF7A 1H51A 5FEWA 1NEYA 1L2UA 2V81A 3F1QA 2R94A 1GWJA 1LRNA 1XXXA 3OVQA 2OJPA 1IIHA 3B03A 3S42A 4MZYA 1LBLA 2ZCGA 2ZRYA 3LHWA 3TSBA 3P5ZA 5I3KA 1GVOA 5G4EA 1TPB1 4GBUA 1DV7A 4MVAA 3S9YA 2WKJA 3RK8A 2QAFA 1JCYA 3GB6A 2CLLA 2JKAA 5HQEA 3U6WA 5DCBA 3OEXA 3PBWA 1M7OA 1XBZA 4O8RA 1S5VA 4IPJA 3P62A 4N9CA 5CSSA 1RQHA 5EYWA 4IWWA 4LUJA 5CG7A 4FHAA 3DU0A 4UTWC 2VOMA 1R30A 3W7KA 2ZRVA 1LP6A 3U8GA 2W6RA 1B57A 1R47A 4QM1A 3W2NA 5IBXC 4ZQPA 2FIQA 3HPXA 3GXTA 2V2HA 3TQKA 3ZS4A 3P74A 1LORA 1VHNA 5C6MA 4RZ5A 3EX1A 3W71A 5D09A 4JX4A 3QC3A 5AN7A 1JUEA 6TIMA 3T7VA 3FLUA 3LLFA 2VFGA 4K7YA 4E2BA 4UTJA 4LRTA 3W2UA 4BK9A 1KBJA 1KTCA 3B05A 2Y7EA 1RVGA 1F6PA 1ADOA 3TW6A 3G1DA 4BWLC 4D2JA 4U28A 1PVNA 3F4WA 3PSVA 4O4WA 1I2RA 5AC7A 5D2VA 4HIBA 3ABQA 4Y9AA 4NJGA 2H8XA 3MP3A 3L2IA 3NO5A 3N19B 4FNSA 3FOKA 4DF0A 3W74A 4AXKA 3USBA 1SFLA 4UXDA 3LHTA 3STCA 3I65A 3G3DA 3LCWA 3GDLA 3MBFA 4O15A 4MPQA 3LV6A 1Z44A 2JBMA 2G97A 2B7PA 1YTKA 1G4SA 1K7EA 2I9EA 4LVGA 4QNWA 3W1MA 2VEMA 3W84A 4Y90A 1XI3A 3TMLA 2AQWA 3QZEA 3O6CA 4MKNA 3GNDA 2E77A 3LCLA 5F1VA 4XTIA 2OX1A 5D2WA 3ABRA 1O94A 5LNUA 4FX8A 4O57A 4PC8A 3W1UA 4LS2A 4R34A 3GYEA 5LHEA 3VNDA 2DP3A 2WV8A 4N4QA 4K7VA 1N7KA 2J88A 3UNDA 3WFAA 3W7QA 3ELFA 1T99A 1FUYA 1TV7A 1QNVA 5DXXA 1D3HA 4GUGA 1ALDA 4AWSA 2RDUA 3R5EA 1EP2A 3Q2DA 3G1XA 3LRKA 4KWWA 1EA0A 3MI6A 3M9YA 1OFEA 4IX0A 2Y7GA 2A21A 3ZR4A 3MO7A 3NG3A 1JUKA 4JN6A 4WQ6A 4K36A 1TRIA 3S1WA 4H4IA 4MY1A 4N02A 1VYSX 1GEQA 3TX9A
chains in the Genus database with same CATH superfamily
2V38A 3CL6A 2Q8XA 3DG7A 2CXGA 1PX3A 3GR8A 4KEVA 1UKTA 4DHGA 3CZEA 1UR9A 1E6NA 4JN8A 3SRDA 3OGSA 3V0SA 1V3MA 1XBYA 2CLMA 3KCLA 1EP1A 3T2OA 3P8IA 2YPIA 3NZGA 1JXJA 3MU7A 2HEJA 3WLMA 1U30A 3L12A 2XM1A 3AU6A 4DB7A 1EL3A 3BOXA 3L68A 1TTQA 2G4JA 1TJ0A 1C90A 4UMAA 3B97A 3KLKA 2W79A 1YRRA 4HU4A 1XIJA 3NSMA 1I0DA 3U48A 5CJMA 3FJLA 1V02A 4RV3A 5EKYA 4GXWA 1X98A 1F6YA 3VPLA 3W7JA 3P81A 3THDA 4YVXA 5LGXA 1S2WA 2DEPA 5T9BG 1OCQA 1X6NA 4Q8MA 3ZVHB 3BSMA 5AHLA 2Z28A 2F8QA 4RDWA 4IJBA 1NWUA 1KFCA 3WG6A 2VJXA 2YCLB 2FFCA 1J4EA 1NARA 1QR7A 3WDHA 5AB3A 4FO4A 3PZVA 2WSRA 4IFKA 3B8TA 1BTMA 3SBFA 4Y9OA 3WKZA 3NQBA 3CQ0A 4J4KA 1XQKA 4LCSA 3BURA 4R7WA 2C15A 4PBGA 5AHNA 4D6JA 4JICA 3GG8A 3IEBA 1P7TB 4D6GA 4N7QA 3E1F1 1BKHA 1BWLA 1KRAC 4JFVA 4D6EA 1WKFA 3AMKA 4AZCB 4ZE4A 4MHBA 4K1WA 2FHBA 2I1OA 2E8ZA 4NAEB 3PB2A 1KCZA 1N8FA 4GRSA 4Y96A 4EOUA 2BOFX 3VGDA 2D0GA 2Z27A 4WY0B 2IQDA 1JEZA 4AVOA 4HPJA 3B0UX 2GPTA 5FEPA 4DELA 1PKNA 1HIZA 2WBGA 4B5VA 3BWWA 3S47A 2XFRA 3PZNA 5ABTA 4LBSA 4AU0A 1ONWA 3LN3A 1QU4A 1I1XA 4AZBA 5I7GA 1R0MA 2TPSA 2V3EA 4JL1A 4M0XA 3NYDA 5DN1A 2DSWA 5F7UA 2J7EA 1JF6A 5L6UA 3TP4A 3TTYA 2VZSA 3T40A 3NXFA 4LAOA 4GQGA 1NWTA 1E3XA 1HL9A 4IGSA 5AZ1A 5HJLA 3WH9A 5U7SA 4ROQA 2P50A 3LXAA 1XS2A 3KL3A 4L1GA 1E51A 3W7EA 3E38A 3S5NA 1XYLA 2BGQA 4YXGA 4EXBA 3GHRA 5C55A 2V8ZA 3P8JA 1EC9A 4EK7A 3HGSA 4FXFA 3AS0A 2PODA 4Q8OA 1OX4B 3CAVA 4BEQA 1E15A 2CESA 1DJNA 3N34A 4R85A 3PWAA 3GXNA 3L4XA 1E5JA 1OT2A 2FB2A 5ABGA 1JCNA 4ZL1A 1BXBA 3FN9A 2EXOA 2PLKA 3LPGA 2P5NA 3F5JA 2VUYA 4ES4A 2WNWA 1IV8A 3W7MA 2PDIA 5HINA 1RCXB 3GNOA 1ME7A 2QPSA 3R6IA 2XM2A 4IIGA 1MUMA 3WQPA 3C52A 4OV4A 1WOAA 4KGJA 5CZJA 2FDSA 1OABA 1W3IA 4O12A 5K9CA 4HJFA 1E73M 3I68A 1PZ2A 3VGGA 2DORA 4S2BA 3H22A 3WEMA 3TKFA 2VEKA 1R2SA 5CC5A 4JYDA 1Q6GA 4C6CA 4HSHA 1TWDA 4GUFA 3CUGA 4D6IA 3W00A 3HFYA 3W1LA 3OW1A 1S5MA 1OFPA 1CCWB 3VINA 2E9LA 2P0OA 1LBMA 4PFMA 1BGGA 3OG2A 3GXPA 4JGDA 2Z4GA 1UD6A 2MANA 1E40A 4UC5A 1RJRA 3LB0A 1SW0A 4LC6A 3CB3A 1GVSA 5AFDA 3PPGA 4LAMA 4JTLA 3DH7A 5G1YA 3V18A 1DWHM 3N15A 2YB1A 2ZYFA 2XH2A 3MYOA 4OKDA 3S1XA 1JI1A 1IZKA 3HBLA 3WFLA 4F2BA 4NT0A 2D2OA 3FEQA 2BY3A 4EF9A 1EJXC 1F8IA 5CZTA 3ZOAA 4NU7A 3UXAA 2NQJA 4YJ5A 3ARRA 1POJA 1DJQA 1F4HA 5I24A 1L6YA 2WAGA 4JTQA 3GXDA 3W87A 2J9YA 1ZAHA 1JZ3A 3CWHA 1T7LA 1MFUA 1JI2A 2OELA 3I6RA 3QHMA 4K3ZA 3AMCA 3ES7A 1X96A 2J9ZA 1J0HA 4QE1A 4DZ5A 5M5DA 1XD0A 4CCCA 1H7XA 1ME8A 1TSIA 3M0KA 3GVQA 5DX7A 1GT8A 3VDCA 4BI5A 2VFFA 4NZFA 4K1GA 1SR0A 1TJRA 2CLFA 1UZHA 1ZJHA 2UY5A 1UQYA 2UZ9A 1BG9A 4HJWA 2CLEA 3PBMA 3PBYA 1R9YA 4LY8A 3OTRA 1YEYA 1JGMA 4GA8A 2NQ5A 5IHSA 1TELA 3BW2A 1HQTA 1EXPA 3NA8A 7PTDA 4XIMA 2EO7A 2XWEA 3A5FA 2QKFA 2FTWA 4H7CA 1A0CA 3UXIA 4WKFA 5DLCA 1RY8A 6CGTA 3W76A 3CQKA 2BHUA 1F3XA 3QV6A 4R5EA 1E0VA 4LVDA 3BAJA 3MUIA 2PPGA 1ISWA 3LSCA 5EMJA 4JL2A 5G2HA 4IQEA 1CXKA 3O3RA 2HBVA 5FF7A 3NQMA 3KL0A 5JBFA 1IR1A 1LT7A 3TJXA 3O06A 4QS6A 4BS0A 4HP5A 1B4EA 2BV9A 4Z1YA 3W28A 4FEZA 3IARA 4RR4A 5HR6A 3ZT7A 2G3JA 2NLYA 3XIMA 3VA8A 3KOYA 1Y7VA 3LHUA 1QXLA 2DVUA 3E3HA 1E0UA 1F6KA 5BNKA 1OGSA 1LRTA 2ABAA 1F3EA 1MI3A 3LCFA 3DXIA 3N4EA 4CQ8A 2D73A 1JPIA 1YXYA 1FKXA 5I3FA 1NH6A 2HK0A 2NV1A 2X0SA 3QZAA 1XP3A 1WKEA 1ZGDA 4AISA 2XU2A 3WMLA 2D2HA 3UY8A 3PPCA 1G67A 1JFHA 3PPHA 4RE2A 2CNCA 4J3ZA 4ASTA 2QVNA 2V68A 4B4HA 3L2MA 5AC4A 3I7SA 1TV3A 1ZS2A 1B3XA 2AAMA 1G94A 4HYWA 4CCZA 4DN1A 4TVDA 4CD4A 1MEHA 2XGZA 2VGIA 2FH8A 3AJ7A 3TIMA 2XINA 3PZUA 1VCGA 2W66A 2I9UA 1MW1A 3P82A 3TWAA 5CAHA 1LOSA 3PUOA 4J3VA 2UWFA 3A64A 1LQAA 4XBJA 3W2JA 2PLMA 1FRBA 4F66A 4DYJA 3GW3A 3VIJA 1LROA 3UPBA 4DXKA 3RX3A 1KBIA 1DE5A 4QITA 3S46A 3KBSA 4KETA 4WR3A 3HG3A 1W54A 4WDUA 3RN6A 1ME9A 3W83A 5I09A 1XGZA 2OZ8A 2V6AA 1P43A 3T6CA 1O5XA 1QHZA 5A6TC 2GSHA 3BG9A 2WXDM 3TJ4A 4HU3A 2A5HA 4XV0A 3RMJA 1PEZA 2FH6A 3BLDA 1W17A 1TV5A 3LCIA 4XQ6A 5DF0A 4MZ1A 3W6YA 2GVGA 1QOXA 3WUGA 1OSEA 4O53A 3S83A 4F9JA 1LLWA 1UCWA 3BE7A 4G8TA 1VBUA 1PV8A 3A9BA 2OLAA 3N12A 3K2GA 2YDQA 3PHAA 3I7QA 4QG9A 4OJYA 5U4NA 4Z2HA 3OZOA 2FHFA 5D4YA 1JDCA 4LUIA 2RH9A 3M64A 1YDNA 5E5CA 5C9UA 2WQPA 4L1XA 4KCVA 5A2BA 1VPQA 1GVRA 1YHTA 5FJRA 2J7CA 3RU6A 1UZ1A 3M0LA 1GVEA 1S3TC 3BZGA 1MDRA 4O17A 3E2RA 4JEQA 4AF0A 4INFA 5HNRA 4HSNA 2J74A 1WDWA 3TYAA 2ZZ5A 3NOYA 3WNNA 1CZ1A 1Z7AA 4GO8A 1JULA 2PTZA 4MDOA 1FCVA 1EQPA 2BXVA 3OBKA 3PZGA 4LPCA 2OGYA 1JZ7A 3C8FA 5FESA 3DX5A 3ZVIA 2W61A 2A0NA 3L4TA 3N13A 4NZ1A 2RFGA 3TZNA 3MSGA 2PWEA 1Z69A 4KRTA 3QFEA 1NDZA 1TUFA 3N9SA 4QJ4B 3Q4DA 4MB1A 5A6MA 5DMYA 1CLKA 3S0CA 1R9XA 1YDOA 1YPXA 2KZHA 3DDMA 4KIRA 4A3QA 1FWCC 4WIWA 4PL2A 2OO6A 1PZ1A 1DVJA 2PCEA 1GJWA 4OV9A 4F0RA 4I90A 1C8YA 2ZVRA 1V6YA 3A3XA 2ZXQA 1V6TA 1L6WA 2REQA 4UTFA 1HP5A 1EJUC 1LOLA 1WO2A 2AKMA 2TYSA 3KXQA 4FS9A 1P0DA 2X0YA 4S3KA 3HG2A 3SUVA 1QOPA 2CBUA 4WHBA 1KQYA 1W56A 3F4NA 4GKTA 4HA0A 3Q37A 4C6QA 2PDJA 1ICSA 2YLAA 4D72A 5IHRA 2E68A 5D2TA 4FR1A 4ZOBA 2Y62A 1EXBA 3RLHA 1R3WA 2DH2A 2Z7GA 1RAKA 3CYJA 1K8CA 4FXJA 4P8XA 4C6OA 4TVUA 4L4PA 2JGYA 3ZZ1A 3SCRA 3UYCA 1Q5MA 2VFIA 1RUSA 3ANUA 4BF7A 4MLRA 3W2KA 2E9BA 3CIWA 1IWBA 4MAZA 5I3JA 1FWIC 2WJEA 1M7PA 1V3IA 4KMQA 1M7JA 1V0LA 1KKOA 3DBPA 1S1PA 4J40A 3IGHX 3S8HA 1E6PA 3TR2A 1B1YA 4U3CA 4A3UA 4GVIA 4OHQA 1A47A 4RX0A 2PDFA 2PURA 2J66A 3GDMA 4G6CA 1JCJA 4DXXA 3NUKA 4IH3A 1LRQA 3FXGA 2Z24A 3QQ1A 1GQJA 3ITTA 3R94A 3DG3A 2YOCA 3MHGA 2ZX8A 3AWOA 1W6TA 3WBXA 1T41A 2I56A 3GNXA 6PTDA 1UWQA 3OG3A 1GKRA 2PGEA 4IPPA 1YBQA 1MQRA 1JG9A 2HPIA 4HA1A 4CLMA 3IIXA 2OWWA 1JL8A 3M0JA 4NX5A 5TNVA 3VX1A 2A4AA 3QW4B 1WNOA 1V3LA 1G0CA 1ZP3A 3QSTA 2OVLA 3RFAA 4DJDA 4GYKA 3ISIX 1JFXA 4AHPA 3ANVA 5C2XA 2HWGA 1BEUA 3WBEA 4GIEA 3F4CA 3KOWA 4JTIA 4C90A 4PEKA 1PJ9A 1TVLA 3A47A 4XUYA 2GUBA 4JNMA 2PC8A 4MNJA 3TA9A 3NVDA 4PUJA 1B90A 1FWNA 1NM9A 2J6XA 4UQ9A 4OGZA 2WJDA 3GTXA 1Z3NA 2ZZ4A 4S38A 4LWWA 3F7JA 3H8AA 1BYAA 1G6CA 4N6FA 4NYUA 3B9DA 2YL5A 3G2GA 3CJPA 1NU5A 9XIMA 3KVJA 1US2A 1Y5VA 4NNBA 3WQDA 2AMGA 3QV7A 1X8FA 3N2BA 1X1NA 3NL2A 3OYZA 4LCRA 3MP4A 4XX6A 4YTRA 5H2ZA 4IFOA 1IWAA 3TNBA 4C5ZA 1NTHA 2WM0A 5C7HA 4S1FA 3KX6A 2P8CA 3LXBA 3ZSTA 4LS1A 1XM3A 1ZALA 3AYRA 4Q33A 2YGYA 4GACA 2CWXA 4HHPA 2NXHA 2Z00A 4JIRA 4XVEA 3U0HA 3W82A 3VGFA 2A7PA 1W31A 2I7GA 4LW7A 4RE4A 2IKGA 2D1ZA 1ZCCA 1GJUA 4QBXA 1MSSA 3IGSA 3CIXA 3N04A 4OUEA 2WKLA 2WZEA 1UBSA 3I3BA 4WVXA 1GOWA 3EX4A 1SJAA 1UR1A 2C79A 1Z9AA 4HGXA 4BI6A 2WJZA 3LHVA 4CEXC 4DJDD 1YKWA 2YJQA 4I5UA 1F74A 1F9CA 1FWAC 1W9VA 3KEHA 2FJUB 4CQBA 5F4SA 2VVNA 2V5LA 4E3TA 3VFLA 2DZVA 1WYIA 3BV7A 1R85A 3HG4A 3GYCA 2ZRWA 3AALA 1TPWA 1IT0A 4PTVA 3BO9A 4KERA 1L0PA 2J8GA 4HNVA 4DWSC 5A8GA 3M46A 2Y8VA 3H26A 3EX3A 5DBUA 2DT3A 1UR8A 5HWMA 2DW7A 1UKQA 2I5IA 2Z2UA 1D7KA 1LWIA 1WBHA 2YCJA 3MPGA 2OO0A 3EXTA 2E1WA 1J93A 1TIWA 2TODA 4HYVA 1A5OC 1SFSA 3DFOA 4WZHA 3UJRA 3L2LA 1MXSA 1E1EA 2PU1A 1OADA 1JCMP 1IHIA 2NWRA 2E09A 3W29A 3W1TA 3HB9A 2XWDA 3T9PA 3TR9A 3W38A 2ZZ2A 4Q4KA 3DFNA 4AEFA 1R2TA 4DNHA 1CT5A 3TLLA 1R3VA 1EZWA 3MUY1 3CV1A 4XZNX 4DLMA 1US0A 1XLJA 1DWGM 6TAAA 3CUHA 1WPCA 3T55A 2FZMA 4ORMA 5REQA 2WHKA 4XSLA 4YTUA 4LJ3A 1J6OA 4HNLA 1RPXA 4KWSA 4P7QA 2C1HA 1LG2A 3T0CA 5BMXA 2PDPA 4GI9A 3LXCA 4DUVA 3SAZA 4YTTA 4Q4MA 3HPSA 1IXOA 1CNVA 2X41A 3VM5A 2V5DA 4HK5A 4DI9A 3IJLA 4K38A 4H83A 1KGXA 4H3DA 4I6VA 2J24A 1V7YA 1V77A 3LPOA 4LFYA 3S1VA 3NIYA 3TN6A 3ITCA 2WO5A 3PB0A 3C0JA 1ONEA 3BTNA 2I5GA 3U3HA 2WOQA 3U5YA 4WDTA 1Y8BA 3H55A 1Q3NA 3P6LA 4MAVA 4FIQA 3OQ8A 5A5WA 2ANUA 3E2SA 1YPIA 3IVUA 2PZNA 4JTJA 1XRVA 2X1SA 1V93A 2PD9A 4BA0A 4IIFA 1N2VA 3ITVA 5FACA 4LNCA 2J79A 4M8UA 4C6LA 3UVAA 1RBOB 3K30A 3IGUA 1WDPA 2XH7A 3N3TA 1XLMA 1HGYA 3RRXA 3G1HA 1IXQA 1EF3A 1UUOA 3FEMA 3THAA 4XKMA 5BXSA 3VDHA 2DFAA 1CLVA 9CGTA 2QJMA 2J9XA 1YQ2A 4IG2A 1AMKA 2HE5A 1WUFA 7TIMA 3WH7A 4WSJA 2EG8A 5RUBA 3P80A 2J7GA 3UZYA 3QLDA 4G7EB 4PMOA 4O18A 3W3OA 3WUFA 1T6MA 4Y9MA 2NUXA 3NNTA 1V0NA 3BLPX 2HNHA 3A24A 5H8UA 5BYWA 5BXPA 5D2XA 1SO3A 1VFHA 3GTIA 2Y70A 1IEQA 3OB8A 2FMOA 2X7VA 1AQMA 3H2MA 1XPYA 2AQOA 1ZJBA 5CZSA 4DBDA 3QMTA 3AZTA 3PZOA 4OBRA 1XLCA 1UKOA 5XIAA 3BARA 4JIPA 2C91A 3A21A 1R86A 3LI1A 3AHZA 1A0EA 4U33A 1E6ZA 3ABXA 1S5TA 1ZL1A 4QEEA 5EMLA 1JGIA 4PMUA 2QUMA 3UWEA 1Q13A 3U4FA 5KZMA 1XLGA 2CKRA 5DFAA 3QKEA 4J7RA 2YR1A 2QCCA 2PGWA 4QQUA 3FSTA 5LKYA 5EY5A 2WANA 3CUXA 4QLJA 1MNSA 1TWIA 1UWIA 2CBVA 5FJIA 5HA7A 2J27A 4LUSB 2VDHA 3VE9A 1Z41A 1OC6A 1XYZA 1XSIA 3MUXA 2W3ZA 2WM1A 3SUTA 3RG6A 2GGGA 3AICA 5TF0A 1AH4A 1DIOA 3O15A 3STPA 3TCSA 2FHCA 1EJRC 2XYLA 4H19A 3LM3A 3E0WA 4Z08A 3BAKA 2F6UA 1V7AA 3O05A 2WMIB 3BC9A 3QW3A 4S3JA 2EAWA 1MZHA 4XWUA 3ZJ8A 2NXIA 3FVMA 4FIRA 1QK0A 2P3EA 3TZFA 2X30A 1S2AA 3LMZA 1GYLA 3AMDA 4IMCA 3W07A 4CN4A 4UQBA 4Q6JA 2V69A 4WSKA 1TO3A 1TZ7A 3K8MA 3IRDA 3M7SA 4GZJA 4RXGA 5T9CE 5CZKA 3MUAA 2YYUA 5GVJA 3SGGA 4QQ3A 4WKHA 1OY0A 3HO8A 1KXVA 3LTPA 3P3BA 1WDDA 1GGOA 2UY4A 1WDSA 5HOSA 1HP4A 4UWMA 4WGXA 1I6NA 1D7FA 2NQHA 1RY0A 3HPZA 4GNJA 1PBGA 3C0LA 1KV8A 3IJ6A 5D8ZA 1FTXA 1QW9A 3B8VA 3S5ZA 1BF6A 4JD4A 4W89A 5CSRA 3DFYA 4I9AA 3VC5A 4RPQA 1OBAA 3XISA 1VGAA 2ZX6A 3FIGA 2QF7A 4GC3A 5F2IA 1B3ZA 4AMAA 1HKVA 1K9FA 1U83A 2CZFA 1FHDA 1OX5A 2O9RA 1OFAA 1HW6A 2DVXA 2YDSA 5FJOA 1OINA 4HZMA 4JTKA 3NTYA 2QEZA 3SFKA 1AVAA 1TV4A 4PB4A 3R10A 2R9RA 3HOJA 2BGSA 3MV01 4WF7A 2WZIA 1GYNA 1FX6A 2VENA 3O63A 3DFQA 1W3TA 4LRSA 4S3DA 4X22A 2WC4A 1B3YA 2GUUA 2EEXA 2VNCA 3U2CA 3PSWA 1VRDA 2H6RA 3N4AA 5BU6A 2QCDB 3S2JA 2Y61A 4EANA 3RLUA 2CLPA 1L9WA 1I60A 4ZO8A 3CZ8A 3UCQA 4F8XA 4AD4A 1XW8A 3SSZA 4O28A 4UTUA 1PSCA 5JBDA 5CGMA 5AC5A 3QOKA 4DBEA 4FNPA 3ES8A 4KS0A 3SI9A 3QGAC 3HQ1A 4R7JA 7REQA 2OR2A 3V75A 1A5CA 4MG4A 1B3OA 1AODA 3UXLA 1NF7A 1NEYA 1OWQA 1GWJA 3RRAA 3UA3A 5FL0A 2PGRA 3OVQA 3GIQA 4UQEA 3BAXA 4XG1A 3P5ZA 1QJWA 1HKMA 3PZMA 3S9YA 1B5TA 5KEZA 1UWTA 4MWAA 1M68A 1PUDA 4IL2A 3U6WA 5DCBA 1NOWA 3SN4A 1XBZA 4O8RA 4DJFA 3AROA 1DWIM 2VOMA 4H9XA 4O8AA 4FPSA 1OEPA 2CKSA 4QM1A 1XIMA 3APGA 3P74A 4KT2A 4A3RA 4RZ5A 2VZOA 1RSCA 4JX4A 2VD8A 6TIMA 3LLFA 2VX4A 5FSEC 4BK9A 4C6DA 3HPFA 3QPEA 1GOMA 3WLOA 3B05A 2Y7EA 4ENLA 5TAOA 4XZLX 2GGJA 3ZR5A 3TW6A 3G1DA 5JQ9A 2QYGA 3PSVA 3WDIA 4NF7A 1BXCA 1KXQA 2GYIA 4Y9AA 3GVWA 3AYTA 2H8XA 2OEJA 3NO5A 4A3YA 4FNSA 3WD3A 3USBA 1P6BA 4FOUA 1SFLA 4UXDA 3I65A 3FK4A 1JD7A 3PFRA 1GOIA 4O15A 5BXRA 3LV6A 3USZA 2JBMA 1UPPA 1PYMA 3GHSA 3MKVA 4W8AA 3CHDA 2VEMA 2DZAA 1V0KA 2OYMA 1V03A 2FZBA 5IFTA 4ZXLA 3I4EA 4XAYA 1NWSA 3W01A 4XTIA 2OX1A 4HOWA 4HMEA 1O94A 4FX8A 3EDDA 3RIKA 5LHEA 4MWAD 3WNPA 4ZE5A 3VNDA 2DP3A 3GBDA 3TTSA 1VPYA 4YNGA 3CYVA 2GVYA 4OFCA 3UNDA 1UIPA 4IICA 4DJFD 3FCPA 1FUYA 1XIDA 1ELSA 1DXIA 1TJ2A 3KCJA 5CPSA 3VD3A 4CD6A 4FLOA 2YDRA 4J3WA 1XYFA 2IQ0A 4DWSB 3FDGA 1EA0A 4EKJA 3MI6A 3TWBA 5AVNA 3DIPA 1GKQA 2Y7GA 1RA5A 2ZE3A 1B0IA 1JUKA 4JN6A 1TRIA 3S1WA 4N02A 1M65A 2PWDA 1JIBA 1RJQA 3ID7A 3KRUA 5JH2A 1W1TA 3W37A 1RZMA 3OA5A 3QH2A 1AQHA 5E0KA 2HZGA 1VP5A 3POCA 3GXMA 3S2LA 5I02A 4M3PA 4LX4A 4P2VA 1YTDA 3KDNA 2PDMA 4B2DA 2VX7A 2WVTA 2XVPA 1TPEA 2IKJA 3VM7A 3SCWA 4D8LA 4FF5A 1DWFM 4WEVX 2B31A 1VIZA 1H5VA 3QTGA 1W2VA 4ML9A 2QDHA 3A4XA 4GINA 4QJ1A 6XIAA 2Q8LA 3R0KA 1QW7A 1IE7C 4M7SA 4NAFA 2H90A 2E6FA 2TSYA 1FDYA 3QVQA 2XSAA 1LZOA 1CGUA 1CGVA 4TVCA 3AIRA 3GXFA 4LCQA 3SCNA 2QQ6A 4HHMA 4KEMA 4N6EA 3JUGA 3HG5A 5CBJA 3G8EA 2ZKMX 5J04A 1F5ZA 4QLLA 3W7HA 4A3HA 5KETA 3UETA 4O1CA 1G4EA 2VGGA 4H9YA 1BQGA 5CCZA 3K4AA 3E5BA 2F2HA 2QJNA 1PWLA 2QZRA 5CQ1A 4C1NB 1IGSA 1JD9A 2ZUNA 4FLQA 1PKLA 4HD5A 3JZUA 3SGZA 4W8BA 3R8RA 4JQ4A 1W8SA 3RGTA 4V1XA 1D9EA 4I9TA 3CHVA 1GVFA 1QPQA 2OODA 2PCQA 1EPVA 3NQAA 2WZHA 3EWCA 3EXRA 3EWWA 4YYCA 1AK5A 1JZ2A 3GBEA 2VDIA 3A4WA 3RLVA 2EPHA 1KFBA 3BG3A 4G7FA 3AS2A 3V1HA 1WA3A 4B5UA 3UJEA 2VQTA 2E0PA 4RCXA 5E93A 1CX9A 3MMTA 1E56A 2BLEA 3LLDA 5JMUA 1CGTA 4L6DA 4B2DD 3RX4A 1HNYA 1I45A 1GHSA 1UIOA 1ZUAX 2X8RA 3VGEA 5JVLA 3L7RA 3SB0A 1R46A 3LA4A 5CEWA 3P5YA 5AYXA 3VXGA 4TX8A 4HBKA 1ZBWA 3OYXA 4H9MA 1BVWA 5FOOA 1EX1A 2Z2BA 2POZA 2ZX7A 2QCGA 1PB0A 2OB3A 1V8EA 3KP0A 3M0MA 4QE4A 1P6WA 2DH3A 4HHHA 4I5RA 3M44A 1KB3A 1I2QA 1S5WA 4B92A 1FWDC 3VD9A 8XIMA 1IT7A 4JY9A 5HPOA 3OQEA 2B7QA 4XB3A 2ACRA 3EGJA 1P1XA 1XKYA 1EFZA 2VEIA 1W5PA 3FGCB 4NSBA 3PUEA 4CQ9A 3F4DA 3DFHA 5ECVA 2G5WA 1PS9A 2O7QA 1HJXA 1Q8JA 1BSIA 4FOKA 4PTDA 3AFBA 3C2FA 4X9YA 4LY4A 1HZYA 3L4UA 1OD8A 1M7XA 3BPWA 4NASA 3UWQA 1PXGA 2FQIA 3GUGA 4FX7A 3W1NA 3OVRA 2WVVB 4JFSA 1DJGA 1ZPTA 3AJXA 2VO5A 3W7CA 2FFIA 2HVOA 3SY5A 5M17A 5T8GA 1MWOA 3MO4A 2Z0IA 3MCOA 1W0MA 4DO4A 5A8OA 1PWMA 5LNSA 1H4PA 1FWWA 1VR6A 2ATMA 4QSFA 1W1YA 1U5JA 1VFLA 1XFCA 4UNKA 1LTDA 4MJ2A 1RH9A 4QEHA 3QGKC 2Y7DA 1L8NA 1NELA 2X0HA 1C9WA 2WZTA 3QOMA 2VELA 2ALDA 3GO2A 3KAOA 1XCXA 4F3HA 2R1NA 3QY6A 3VDGA 2ADAA 3B8SA 4NZ5A 3L4VA 4ZTXA 1ZTVA 4IHCA 3O0FA 3F2CA 1REQB 2Z7KA 1A5NC 3EB4A 3KWXA 4ZQNA 3KRBA 3NQVA 1OFQA 3C2EA 4NHVA 1TE6A 3SCUA 2GGHA 4PMRA 4N9DA 1AG1O 3ARTA 4C1KA 1YLVA 1W1ZA 2C71A 5D32A 3A22A 3R13A 3DYOA 1ITQA 3B8IA 3RR4A 4TR9A 1TJ1A 2GQ9A 2FKPA 4MUZA 1PIGA 4KCTA 3H2FA 5KITA 2CCRA 4MYXA 1WAUA 3ZVHA 1VCVA 3WQ5A 4P61A 2J8FA 1QOQA 2BHZA 3N2CA 1PL9A 2GDVA 5KINA 2PLCA 5T91A 2YCLA 2DPEA 3THUA 3I6TA 3CLMA 1SU5A 5CSUA 4H01A 1KGUA 3M7WA 5BOOA 4QDWA 3EEZA 4MFEA 4IPIA 1K02A 1EEXA 2UV8G 3SADA 1P7TA 1UD8A 1W1A1 2GK1B 3JR2A 4ZOEA 3VAVA 1XDMA 1WXJA 5BOEA 3MHUA 1Q4NX 4WD0A 2VRQA 5CPQA 4AZCA 2BHYA 4M24A 1KFLA 5I00A 2WCAA 5DY2A 3NZRA 5DT7A 1KNWA 1GORA 2PDYA 3N6QA 4NAEA 2BTMA 2GQAA 1DJHA 4UR7A 2ZE0A 1EH9A 3TYBA 3WO8A 4IMAA 2ALRA 2Q09A 2F6KA 2V2CA 4Y6GA 3DOPA 4IP7A 4HVXA 4WY0A 1WZAA 2OYKA 4FXRA 1BYBA 3FJNA 4FF7A 3ZJ6A 4P7NA 2W5FA 3B8UA 4RZ6A 2Z1XA 3EDEA 1K9DA 4O54A 3VNMA 4UIOA 3UGVA 1W9BM 1WX0A 1W91A 3TFCA 3Q45A 1ZBKA 1GOQA 5E9AA 2Z2AA 3STFA 4L80A 4EXQA 4HZ7A 4PBEA 1OYAA 1YW1A 1QWGA 2O4MA 3PULA 3WF0A 3B9NA 3WQGA 4AYSA 1LUCB 1XISA 4U5IA 4LB3A 1MO0A 3C3NA 2GL5A 2BZNA 1PE1A 4OUIA 2YBTA 3LU2A 4YS1A 1IEWA 2GSEA 3E0FA 3G1FA 4CEUC 1TE1A 1H7RA 1KM3A 2Z26A 3G0UA 3TOYA 1RBAA 4PUMA 3L0NA 3VD4A 3MHFA 1UR4A 3TSMA 4DJDC 1JUBA 4TV5A 1OX4A 4N9EA 4KCWA 1TMLA 5LNRA 1O95A 5HATA 2AMXA 2YW3A 4LEFA 4XD5A 3VOGA 3EB3A 3AUJA 3MV11 2EHHA 5CC7A 2QDEA 2GQ8A 3W73A 5LIXX 1Z8AA 1TJPA 5HQMA 4S23A 4MB5A 4XIAA 1I8JA 2JK2A 4PEEA 2ZRXA 3VNZA 4HZ8A 3L9CA 1YDYA 2W9MA 3NQ6A 3AI0A 1G7UA 3CV7A 8TIMA 4QG8A 1YIXA 2QCHA 4PH6A 4E6MA 3KOXA 3GNRA 4CCDA 2IS7A 3CUIA 3QR3A 4XD4A 4F40A 3QJAA 2X09A 5G4HC 3REQB 2X40A 2OYLA 3KBJA 1T0OA 4NZ3A 1FBAA 4KFPA 5J5RA 4LU0A 4F48A 3BDKA 3LY0A 1SQ7A 1NJJA 3ZJ7A 5HMFA 1E0XA 4JTRA 3B04A 3M5VA 4BF9A 2OZTA 1H50A 2PGFA 1E4MM 1QHOA 3W27A 1GUVA 1QUMA 1MUWA 4BQ5A 3HQOA 3STGA 3L23A 4AC1X 5H6HA 3M5XA 3U5UA 4CU7A 3P84A 1E9LA 1O7AA 3T0BA 4Q3MA 4W9TA 3ZFHA 4GXMA 2RAGA 2HE8A 1Z89A 1J01A 2VL4A 3LERA 4PA8A 5CAKA 3IANA 4NJIA 1UUMA 2VI0A 3W1PA 4HN4A 1I4NA 2QHAA 3RM9A 3V5FA 3UF9A 5F1UA 3TV8A 1TWSA 2VC5A 3OZPA 1QTWA 2QCMA 2WJFA 4U2ZA 2V63A 4FALA 4QSHA 2G3NA 3MS8A 2PS2A 2J7BA 4EACA 4X9SA 2BY1A 1VRXA 4X3ZA 2QNEA 3B9OA 3VZZA 4MPKA 4X60A 2G95A 5JH1A 2Y8UA 2FGZA 4S2CA 4C6PA 1WXYA 2A3LA 1RXOB 3MSYA 5SWUA 1HT6A 4QS5A 1XCFA 2OXNA 1PTDA 2QAPA 4FR6A 1OFBA 5HAOA 1AD4A 3PZTA 4PCSA 2DZTA 2NW0A 5CPNA 3NURA 1QPKA 3KL5A 3WFZA 4W87A 1IIGA 3WLIA 1W3HA 5LIUX 2OFJA 3BZJA 1JQVA 4GWEA 5DBTA 2JF7A 3SCQA 1X7IA 3CEPA 4IQLA 2DU2A 1F3WA 1W37A 3W88A 3EMZA 2HPMA 4HA3A 4I7WA 3VNKA 3AXMA 5HNUA 4DWDA 3MANA 3M0XA 4ADSA 3V0TA 4R88A 5AYBA 1E55A 2WSKA 3GFXA 4DZIA 5FF0A 4RNHA 3EX6A 5K9DA 1F73A 1EF2A 4LANA 1R7OA 2YKKA 4MY9A 4OE7A 1T5AA 3UWUA 3M0YA 1KRMA 1RCOB 3ZLGA 4AC7C 4M82A 4C65A 4WOQA 2XH0A 4CQCA 4EPKA 1O60A 3CZJA 4KWUA 2AAAA 5G4WA 5TQLA 5HMEA 3QRHA 5E6ZA 3UFYA 4MSSA 2ACSA 3TNOA 1FWSA 1XL9A 1EPXA 1NOUA 2PUZA 3WY1A 3WF1A 2NV9A 3WNLA 2BY0A 3KTSA 5IBXA 4S3BA 4RDZA 3SGUA 4PRTA 2YCEA 3WSUA 2GGEA 2CHRA 3WBAA 2DIKA 4M7TA 1KM2A 3DYMA 3LOTA 1VYPX 2X2YA 4KEZA 1QCWA 5A1AA 1KFJA 1TTJA 3OLDA 4F2UA 4J2MA 3L5AA 5ABHA 4A22A 1EKOA 3N1AA 1VJIA 1DJYA 4CNUA 3CGTA 3F03K 1PX4A 4CNOA 3UU0A 4JTEA 4P7RA 3TTEA 2R1PA 3AC0A 1P0NA 4UR8A 3N2OA 1DKWA 1IT8A 3PC0A 2BS9A 4UZUA 3T42A 3WJZA 4UFJA 1H7NA 3UBPC 4LEQA 1R9ZA 4NVTA 3M0ZA 2WMKA 4MOZA 1R3SA 3ABOA 1HJSA 1DJIA 3K4WA 1SR9A 1CB2A 3EYPA 3S1UA 3WK3A 4W93A 2OCZA 2W62A 3CV2A 3URBA 3A12A 3MW7A 1PIFA 1B54A 4YTSA 5H8PA 4JIEA 2BMBA 1X1ZA 1VF8A 1UC4A 3T05A 2P53A 2UY3A 4UCFA 1OD0A 1EUNA 4AEOA 5EFDA 3SUWA 2QMJA 3LV5A 2CW6A 4B5NA 3VILA 1M9HA 4ONVA 3KRZA 2YCKX 4H04A 3IGXA 2WWDA 2ACUA 3PK7A 5HULA 1CGYA 1DBTA 4MJ4A 1LOQA 3GH4A 5A95A 1XYCA 1MEWA 1YNQA 5HBFA 4XAPA 1KM0A 3IV8A 4UTTC 1XLKA 2PDKA 3M0HA 3TONA 8CGTA 4HU8A 3SCVA 2NQLA 4S3CA 2XN1A 4O1DA 4AIBA 5A6SA 1P0BA 3VIFA 1N55A 1KGWA 2ZXDA 5A8PA 1OIFA 1O4UA 4JTGA 4B90A 5FEXA 5FF3A 1WQ5A 3E02A 3G18A 3GWQA 5LXXA 4E5TA 2QDGA 1EB3A 4L65A 5BRBA 3KVMA 4ZENA 4ATLA 4JQ3A 3PR2A 4ROPA 4XUGA 3PG9A 4Y8EA 1HO1A 4JYFA 3SFWA 3H24A 5BW6A 5E09A 3OA3A 4DJEA 3WF3A 4ECLA 4US6A 2DIEA 1Q2SA 2WNNA 3VCCA 1W5OA 3R2GA 1C92A 4NZ4A 4PUWA 2AOSA 1R3YA 3IJDA 1Q85A 4UFLA 1CGXA 3U2ZA 4JQ1A 3V4BA 4L9ZA 5D03A 2VYOA 2DZUA 2WHLA 5BRPA 3CLWA 4TV6A 3GVVA 1QPOA 1A5SA 3AISA 1YE6A 1CGWA 3B40A 3SIZA 4F0KA 4U31A 4UUIA 1LDCA 3B0VC 1CXLA 1VFMA 3QMRA 3W53A 3C3UA 4Q4QA 6XIMA 1V3KA 1GVYA 1UKSA 3MUZ1 1O1ZA 4NJKA 3WLLA 3VIPA 2OEMA 3EOOA 4ZR8A 3TQ0A 4IM4A 4JIQA 4H2HA 2PE4A 4AHOA 4GISA 3WBWA 3F2BA 3P14A 3RCYA 4OOZA 1V6WA 1D3GA 2GVEA 5FJUA 3B9EA 2ZRUA 3QYSA 3R79A 5J5DA 2PF8A 4Q6XA 2YL8A 1BRLB 1XLLA 2BY2A 1W3JA 3VKKA 4WRHA 2YSWA 1UP0A 1W1B1 2ZQ0A 1IEXA 1QT1A 1A4MA 4O14A 3O6YX 5ABFB 2A6NA 3THCA 2O7SA 3LENA 2EJ1A 5IDZA 4A29A 4C91A 1DHPA 1ZBVA 3IUDA 1XH1A 3BLFA 3HPAA 2HV5A 1A0DA 4DJED 2XVLA 5CZ0A 1HGWA 2QUVA 3LTYA 4A8RA 5DMMA 1VJZA 1VJSA 2YL6A 4PYSA 3JVAA 2CZDA 2QT3A 3CEUA 3R89A 3GIYA 5D9PA 3UWVA 4B5TA 4XZ9A 4GGHA 3HV9A 3IJ7A 3ZO9A 1OX6A 4H2CA 2Q71A 2E6DA 5A6BA 2DZXA 1C3FA 5EU9A 3M6YA 4ZQOA 3A6OA 2CBJA 3CC1A 2IXVA 2GUYA 4Q4OA 5FI8A 1LM1A 4ZB2A 4K2SA 4YN5A 1SM9A 4ICNA 3VGHA 4JFWA 4UZSA 5I23A 2HSAA 2V5CA 3VDAA 1QPNA 1ITCA 4ZXOA 4IIDA 2OT1A 3G24A 4UQAA 3E2VA 3QMSA 3NSNA 1W1VA 1TX0A 4V33A 4QTGA 5AYZA 3UZJA 4IGNA 2Z25A 5LNVA 4A8NA 4MWAC 2ZWZA 4MF4A 4MFDA 3UY7A 1MYRA 1E4IA 4DJFC 1AW2A 3LBCA 4NI3A 1CXHA 2YXOA 3ZXWA 2VHLA 3P7YA 3QM3A 3JS3A 3NDOA 2C6QA 2VUNA 4AY8A 3HMJG 3G3MA 3DYPA 3MZNA 1MQQA 3LUTA 5DMNA 2CITA 4M6PA 2YA0A 1P0KA 2QR6A 3AAMA 3KP1A 3UWZA 3V16A 2QIIA 1OGBA 3PY2A 2BGNE 3O6DA 2GZXA 4UNIA 2E8YA 3VIMA 1WDRA 3S6OA 1ZFJA 4L1WA 3CV6A 1ENUA 3BGGA 3ZWSA 1WKDA 4XZMX 2YFOA 1JZ6A 4JTHA 4CQAA 1C93A 5A6BD 2QIWA 4WXZA 4JDBA 1RVKA 1W5QA 2X1RA 3H12A 2PI6A 4MLJA 3NAVA 4JTFA 2EBNA 3T0DA 1AMYA 1PPIA 1RD6A 1K1DA 4H7VA 1QBBA 1IWPA 3NOEA 4US5D 1OC5A 5CLWA 4M51A 3ZM8A 4R33A 1M41A 3FJ6A 4JFUA 1DXFA 2V9DA 3NPXA 3GC2A 1NFGA 4ORIA 4RL3A 4BQ2A 1ISXA 4C6IA 3ONBA 4PBFA 3J7HA 2WK2A 3GUWA 3W7OA 3I7RA 1EDTA 3FYYA 4MADA 2VURA 1LL4A 2B7NA 2HRWA 4IZGA 2C0AA 3BCJA 1GVIA 1OYCA 2WSYA 3RYSA 2FTPA 1XC6A 3AYSA 4YCOA 4XZBA 2NX9A 3RF9A 4WY0F 1S2TA 3TW9A 1WZMA 4XAGA 1H3GA 3WCZA 4CD8A 3DC0A 5G2IA 3LDVA 1E9IA 4I7VA 2OU4A 4IX2A 1G4PA 3EMQA 3L5LA 1PZ0A 1OK6A 1NQKA 4MNKA 4NRSA 2V3FA 4QCFA 3AZRA 2E6YA 3KDOA 3L65A 4RDYA 3E0IA 3K5XA 2XVKA 4DF2A 1G5AA 3NQ7A 1XINA 3CTTA 2VZVA 1UB3A 5HWNA 3U2EA 3FHAA 4GYPC 1SZNA 1I2OA 3WL0A 2GJRA 3UA4A 2BFGA 3PTDA 3R43A 3S4TA 4Q7IA 2G0WA 3IWPA 1SW7A 4M81A 4LQ1A 4Q22A 1T8QA 1OQFA 4OIFA 4MYAA 2GDUA 4RXFA 1Y5XA 3BCFA 2R6OA 2J8TA 1WUEA 4WXYA 5I3IA 1TRDA 4MIMA 4QX4A 4PULA 3AXIA 1ADDA 1QI2A 2J77A 4Q8VA 3TAKA 3W25A 4ZOAA 2DJXA 2Q6ZA 3DGBA 1RP8A 2IPFA 3QR0A 4TUFA 1ODUA 3T44A 5AHEA 4AH7A 4Q4PA 3PBUA 3XINA 2OGJA 1DL3A 3LQLA 2AL2B 1KV5A 7XIMA 2DIJA 3GNNA 1XF0A 3UT0A 5FF2A 1ZNNA 5F4XA 3LGGA 3NM1A 1YXDA 2VP8A 1KBKA 1TFVA 1NFPA 1YNYA 4W85A 4O52A 1W3LA 8A3HA 1M04A 2BVYA 1HTIA 4NXKA 2QF8A 4BQ4A 1KXTA 4YCPA 1PCWA 3NL3A 1PDZA 3TW7A 3D46A 2HS6A 1F05A 4PRRA 2WNQA 1XC4A 1MRQA 1Z32X 2NXGA 4GZIA 4TOQA 1UH4A 2V5KA 5A6KA 4Z42C 3SRFA 2YBUA 3SECA 2QV4A 2Z29A 1XYBA 1OFRA 1X8CA 4KRUA 3KE0A 1YNPA 2BNJA 1OYBA 4KIEA 4Y8FA 4QGCA 1WXZA 1XKJA 1JPHA 5F2LA 3TC7A 1GOXA 1XFBA 2O4QA 5EB8A 3C0QA 1E0WA 2QUUA 2J7DA 4J1OA 3R1ZA 4OU1A 2WYSA 4I9JA 1V3JA 3KHJA 4XD3A 1GZ1A 3UZXA 2X1TA 4P8WA 4XO7A 2O9PA 3STEA 4PODA 3QF0A 3BAWA 3V5OA 3LCHA 2OWXA 2Q8ZA 2QJJA 3GZ3A 3WN6A 4H00A 3UERA 5DXYA 3TMQA 1AW1A 1J11A 1B9BA 1L6SA 4D6DA 1GZJA 3WELA 5A8QA 1DP0A 1UR3M 1WBJA 1J10A 4G7EA 1H51A 1VFFA 4G56A 1L2UA 2V81A 3F1QA 2R94A 3PP7A 3BANA 3IUHA 1GNXA 4W88A 4JNYA 4MB3A 2VCCA 1FP8A 5G4EA 3R11A 1TPB1 2I5QA 3U57A 3HMCA 3RK8A 3EPOA 2QAFA 1AFSA 4H8UA 1JCYA 5HQEA 4BQ3A 3PBWA 3WH8A 1S5VA 2Z1VA 5CSSA 4IWWA 4TTUA 2ESCA 5CG7A 3DU0A 1R30A 4Y9PA 2ZRVA 3S2CA 3VMOA 2W6RA 3W2NA 2FIQA 3GXTA 2V2HA 3BAYA 3TQKA 3ZS4A 3AU2A 1LT8A 1V6UA 1H09A 4Y2WA 5C6MA 5AN7A 3FLUA 4LUSA 2IKIA 2DW6A 4E2BA 4LRTA 1YMYA 2XIIA 1KBJA 1GW9A 3EWDA 1CWYA 1F6PA 4YU1A 4HPHA 2HVNA 3NZQA 4D2JA 3F4WA 1E6QM 4H7ZA 4REQB 4NILA 3RM4A 3D3AA 3PN8A 4H6RA 1BQCA 3FV9A 3SUSA 3DBNA 5I3DA 1JZ4A 1UWRA 4KCUA 2WMIA 3RPTA 3W74A 3N18A 4AXKA 4P5UA 3LHTA 2FGLA 3AIUA 2CEQA 3G3DA 3GDLA 3W6LA 2OOGA 1WE5A 1YTKA 4FZIA 4QNWA 2P76A 4QP0A 3IS4A 1A3XA 4Y90A 3FJ4A 1QBAA 2AQWA 4F2TA 4GIRA 3LMYA 2QMKA 4MKNA 3GNDA 3LCLA 1GOKA 5F1VA 3WH5A 1OCBA 3MZ2A 1PTAA 2YZ5A 3H6OA 3K4DA 5LNUA 4WKAA 4KF1A 1XSJA 5B7ZA 2D24A 4N4QA 3LGDA 2BXYA 5BU9A 4UOQA 3W7QA 3ELFA 1T99A 1V79A 3NO3A 4PCTA 1IEIA 3MWCA 1D3HA 4GOAA 4GUGA 3OPSA 2RJGA 4IPLA 1ALDA 4J3TA 2RDUA 1NDWA 2QPXA 3S6TA 2Z1KA 4IP5A 3MSRA 2WVUA 4QHRA 4CU6A 1X39A 4IX0A 5CBIA 4G5DA 3CHCA 4WQ6A 4H4IA 4AW7A 5LXEA 1VYSX 1CW2A 1VENA 2GVJA 5IOBA 1GOOA 3P0XA 3TYDA 4AD0A 1VFTA 5DMLA 1E1CB 2Z6JA 4NNCA 3ARVA 3GK0A 3SO7A 3E9AA 3S5SA 3K1GA 4PMVA 4QFUA 1Q63A 4C6NA 1JCXA 4HPGA 3OZYA 1XRTA 1VD6A 5T26A 3ARWA 3TJIA 2P8BA 4XKYB 5AZ0A 5A6LA 3Q58A 2QCDA 1J0ZA 3QTPA 2WMHA 3V3WA 1XGEA 4J9JA 4V28A 5F4WA 4CN6A 4GLEA 1BVNP 3S5OA 5CH9A 3GTFA 3UWYA 3NPWA 3KBWA 3VKCA 5KZDA 1XIGA 4LUYA 1UQZA 3VCRA 2SFPA 2CIPA 3BJFA 3NR0A 4R3UA 3VABA 4DUOA 4LVBA 4LH8A 2DVTA 4B4FA 3BLIA 1FQ0A 3CWNA 3WLNA 2NUYA 4V2XA 4D6CA 4GBDA 1C9DA 2YXGA 5B80A 1S2VA 1FY6A 1DTNA 1EJVC 1JJKA 4K8GA 2PD5A 2ZA1A 4QLKA 2PLJA 3GNPA 1FH9A 1LWJA 3HZ3A 1ZBCA 2DT1A 4RJEA 1RP9A 5HNTA 1XLFA 3R12A 3BSHA 3MMWA 3ALFA 1A49A 2A1YA 1HJQA 3L66A 3QHNA 4DM2A 3QV8A 4A2RA 3T81A 4H8HA 1VEPA 4KQNA 3QXBA 4PMQA 3DGRA 5A94A 1W1PA 5E70A 3OHIA 2VFHA 3WYZA 4JTAA 4U2YA 3OBAA 4LF2A 1QI0A 2PDGA 3UCDA 5I03A 1TQXA 2PBGA 4CVUA 4GI4A 3WDJA 3S2NA 3DFSA 2V5JA 2E5BA 1BF2A 4LB4A 4L64A 3U9IA 2Y2WA 4HSOA 7A3HA 1KM5A 1EC8A 3OU8A 4CVWA 2VWSA 3MI2A 5TBOA 1DQXA 2ICSA 4PGLA 2XIJA 4GHRA 3KZSA 1D8CA 2W67A 4RZ4A 1GCYA 3PVFA 2VCAA 1H0GA 1QI3A 3RMEA 1B4KA 2D20A 4XBKA 5CC6A 1UWUA 3DHFA 3O2LA 2OPJA 3KOFA 5JBEA 3EX2A 1MVYA 5GNYA 4AZ7A 2V82A 3M4HA 4FLSA 1IZCA 1EHNA 1OJXA 2HBXA 3H4WA 3WQOA 2GJXB 1C8XA 2BB0A 3DUGA 1AW5A 4KFOA 5I77A 2A6LA 4ALDA 1NF0A 3ATZA 3N4FA 4RNIA 1TYGA 1GTHA 1MMFA 4PL1A 1BD0A 3HGJA 2RKXA 3QFWA 4MB4A 4MM1A 1H0IA 2HXUA 2E3ZA 4WUIA 4QNEA 5LZLA 4R7OA 1TVPA 3RJXA 1UROA 2EF9A 3KFTA 3EWYA 1J2BA 3B06A 5ENLA 3ZMRA 5FCZA 1QI5A 1XYAA 2DT2A 2CU0A 3I3EA 4ZMGA 2QUTA 1RHCA 4UTWA 3E5PA 3NCOA 1I2PA 3YPIA 1FFQA 2PRLA 1K6WA 4H9ZA 3UG4A 3W85A 2Z1BA 1SW3A 3KBVA 3MYPA 5AC6A 4CNNA 2HTMA 4ILSA 2YBVA 4L61A 4K8EA 1QNOA 1LBFA 3DI0A 2VEPA 3VZYA 2IUZA 1EA9C 3UXDA 3BK0A 2MNRA 2POTA 1RQBA 1S2CA 3BMWA 2PDCA 1YE4A 1QMLA 4S39A 4GZEA 1HUVA 3C2OA 3QBUA 3QHOA 1Q7ZA 4D8AA 4DWSA 4BWLA 4G2DA 2G41A 3W23A 4PMDA 2ZDSA 1J0YA 1FWFC 4EVZA 1MUCA 1OK4A 4HCDA 4ZZ9A 2VXNA 2DT0A 2GQ3A 3BQ6A 5EFFA 2RGMA 1OCJA 1VFOA 4U4MA 3S5YA 1XIEA 4PMXA 1GKPA 3UQNA 3GR4A 2OTDA 3H2AA 2CERA 2P10A 3U2OA 1XG3A 3FY1A 4Z1CA 3DERA 3TU9A 4AD3A 4HPXA 2D69A 1YADA 3MSDA 3QV9A 3WQ6A 1UJQA 3TOPA 2HMCA 4J35A 2INZA 3NZPA 4YLWA 1JDDA 4PTMA 2QCNA 3EA1A 4MZ8A 2F9RA 5C54A 2VDGA 5I3HA 3R25A 2PP0A 3IJIA 2O9TA 1XRFA 5I3GA 2OSWA 3K1DA 3IPWA 4E0CA 1ICPA 3GC4A 2PF0A 3C6CA 4EPDC 4GUHA 3F5KA 5G1TA 2YA2A 3WIJA 5EMMA 1N82A 2R82A 1UW9A 4XO6A 3RCNA 4EPEC 3W1QA 5KSWA 1ZJIA 3MA8A 3DFPA 1QATA 4NX0A 4QDMA 2ZFAA 3I4KA 5CLTA 2CZVA 5EBAA 4GVHA 3CO8A 3WQCA 3KTXA 4M6UA 3WDRA 4TTGA 4C1NA 2X42A 1ZLPA 3CHFA 4HNNA 3VK5A 4DWSD 3I6EA 5AECA 3WQ4A 3GHUA 4JTCA 1SFTA 3IVTA 3W7NA 4GJIA 8RUCA 3D6NA 1HKKA 1GPFA 4PMZA 3G1RA 1LLZA 4DYKA 2ABBA 4Q7NA 1TV2A 4K37A 3UG8A 3T8QA 4GFSA 4POCA 5AHIA 3GG0A 1CI1A 3UR8A 1ZAJA 4L4LA 1A5BA 4LYRA 5KTLA 1K70A 3AXKA 2WW5A 2VFDA 2V0TA 1YDVA 3E2QA 3NQGA 3DAQA 5CPTA 3SM0A 2B0MA 1A5KC 3Q67A 1DWJM 3P67A 3WJWA 1VS1A 2ZC8A 3H7VA 3IIVA 1OF8A 1OM0A 1LL6A 3MWAA 5MKGB 1XLIA 3PANA 3QKZA 2DSUA 1EGVA 1P4CA 4DNMA 3FW6A 4DPPA 2EQDA 3SRHA 3HF3A 3UPMA 1RV8A 3UCCA 3N6HA 3OZMA 4B5XA 2EG7A 4L6HA 5AKQA 1F7BA 2CHOA 1ICQA 1BHGA 3NDZA 3VOJA 4ZFCA 2WZMA 3SIMA 4AY7A 1RLCL 2VCBA 4DAIA 4BKNA 3KBNA 5JXQA 1S46A 1O5QA 4OWGA 3G1YA 1Q7MA 1L8PA 2AL1A 4W5ZA 1TKKA 1NP0A 1W5NA 4LXFA 1QO2A 2BVDA 4YL2A 3WD2A 1OGGA 4QG6A 1A50A 4UFIA 3H23A 1R5YA 5E1QA 2H9AB 4ML4A 3CL8A 1XLDA 2EJAA 1MEIA 4FA3A 1PZ3A 2A7RA 3UG3A 4ZO7A 4IGMA 1UWSA 4IP4A 3FGCA 3W70A 4S3FA 1EHAA 1UBPC 1ZZMA 1KO0A 3E74A 1A5LC 2PWUA 4MWAE 2ISFA 3C2RA 2BP1A 5EA9A 1NOFA 3GU9A 5CPOA 3U7BA 2VT0A 5BRQA 2TMDA 4E8DA 1TA3B 4GYFA 3CTLA 4K8HA 4J27A 1EBHA 4A2SA 2R1KA 1S1RA 2E1DA 3GFYA 4JCMA 3SZ8A 3WMSA 3PF3A 4WDXA 3H54A 4LGXA 2WVVA 3G77A 1K03A 1M5WA 1NVMA 2VR5A 2BX7A 1Z48A 2ZXAA 1TZ9A 4IPNB 4FP1A 2INEA 4RV8A 4MMWA 2DDXA 1I75A 3W22A 1F3TA 3ZYZA 3Q94A 2J7HA 3G5EA 1VBJA 2E5CA 4O0ZA 3IK2A 3DI1A 5I78A 4PUEA 3B8WA 4M6QA 1ITXA 2DQXA 2JALA 1VCFA 3H2CA 3DKLA 5M3WA 4LVAA 4Z17A 4N2YA 3GG1A 2DGAA 4GQQA 3QY7A 4NRRA 3CUJA 3WL1A 4O1EA 5K2ZA 5GJNA 3W75A 3M07A 4PTXA 1EGMA 1REQA 1OZQA 4HYRA 1KC7A 2OG9A 4L4OA 1K8XA 1Q2RA 4XZWA 2IPWA 4DJEC 3LBOA 4G1KA 5DRIA 1MQPA 2B4GA 2IXUA 3A9IA 3B0YA 1JNDA 2QCLA 5HXMA 2NV2A 2PA6A 2BWGA 1H63A 3PBVA 1R38A 3SN1A 3FFSA 1V6XA 1XIHA 1XIIA 4JHMA 2GGIA 1S3HA 4C6MA 1EOMA 1VYRA 3RDKA 4JHOA 1A5UA 1QNPA 3CAKA 4QROA 2UBPC 1XLHA 3UJFA 4N42A 1TQJA 5AHMA 2AGKA 3KTCA 2TRSA 3M0IA 2Y6ZA 4MGGA 5D04C 1J96A 3P61A 1NY1A 2P1FA 3NQ2A 3WDPP 5G5IA 3NQFA 2OZ3A 3TAOA 3WLHA 2RDTA 1EP3A 1V0MA 5D33A 1E9ZB 1EO7A 3CH0A 1R3RA 1TMQA 2YCIX 5XIMA 5LA2A 3PTKA 4DBWA 2OLHA 1O1HA 2VKZG 4GIAA 4ZODA 2GK1A 1TX2A 3BLEA 3B8DA 5IDIA 1DJWA 3VCNA 2X1IA 2VGBA 1DIDA 5GNZA 3L67A 1KA9F 1SSDA 1DXEA 1B3VA 3LCGA 4GE8A 3JU2A 1F4AA 1SPQA 2YW4A 3ME3A 1KKRA 1W3NA 1MNZA 2VZUA 1J5SA 2ZC1A 1AJ2A 2D3NA 1EQCA 2OOFA 4PR4A 3EDKA 3O07A 4GY7A 2BG5A 4IOTA 2ZRZA 3SUUA 4A8LA 1E43A 6REQB 4KBXA 4B5SA 1XDJA 3BW4A 3NJ3A 1C91A 1FDJA 4HNCA 2E25A 4B9YA 3EBVA 2ONEA 3BJSA 2E5DA 1Q6LA 4Z0SA 2XISA 4KPLA 1Y0EA 3RITA 5EBUA 1G9HA 3GS6A 4GC4A 4EF8A 3QQ0A 1H1ZA 1LUCA 3KCOA 1U33A 4IUGA 1QPRA 3GX9A 4E4PA 1SUXA 3BG5A 4XAFA 3PS7A 3CUZA 1Q66A 4HB7A 3HN3A 4N0RA 3G8RA 5CXPA 4MJZA 5HDRA 3NVTA 2XN2A 3TQVA 1JPMA 1T8XA 3A3HA 5CJ5A 1FCQA 3WLJA 3UP8A 3AMGA 3LBMA 3T09A 2DJLA 3PUGA 3TSDA 1KM6A 1QNSA 3NQDA 1WZKA 4GCAA <