3EX7B

The crystal structure of ejc in its transition state
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mago nashi homolog
publication title Mechanism of ATP turnover inhibition in the EJC
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna binding protein/rna
total genus 18
structure length 94
sequence length 94
chains with identical sequence G
ec nomenclature
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ex7B00
2KG0A 2ADBA 2DNGA 3MI7X 1K8AT 2MY7A 2FY1A 1N54B 5DDOC 2Q79A 3VAFA 1WTBA 1VQLS 4EGLA 1WHYA 4YUDA 1X4CA 3BO2A 1R8PA 2KYXA 2RVJA 1OWXA 4YB1P 3VAGA 1KD1T 2MSTA 1WHVA 5LJ5Y 1M5VC 1N8RT 2GO9A 2YH0A 2N3LA 3IWNC 2FHOB 2DNMA 2MZSA 2CPHA 1KC8T 2RS8A 5JVHQ 2MGZA 2X1GA 2MKSA 3CCES 2DGXA 3VAMA 1M5PC 1P27B 3RW6A 2HGNA 2D9OA 4Y00A 2CQ3A 3NNAA 2OSQA 2OJ3A 2L9WA 2RNEA 3MURP 2JWNA 2DIUA 1VQ7S 1FJ7A 2DGUA 2XS7A 1QVFR 2MGZB 3BO4A 1YI2S 1VC6A 2DHAA 2CPXA 2LQ5A 2PE8A 5EN1A 3G6ES 1X4DA 2K3KA 3HI9A 1B7FA 1U1RA 2XNQA 2MB0B 5D77A 4WFBQ 3FEYB 4CH0S 4V19X 3VAIA 1VC0A 3P6YC 2HVZA 2HGLA 2CPIA 2JRSA 4QU7A 1YWXA 3D2WA 1ZZNA 2MY8A 2XNRA 1JJ4A 1DZ5A 1FT8A 3S01A 1HA1A 3R1LA 1O0PA 3CC4S 3G8TA 1L3KA 2DNLA 1X0FA 4J5OA 2LKZA 1G2EA 4WKRA 1H2VZ 3P3DA 3U1MA 1WWHA 3FEXB 1VQ4S 5DM6Q 4F02A 2DNOA 1M1KT 1X4AA 1CVJA 1PO6A 2G0CA 1FO1A 5DM7Q 2DHSA 4A8XA 5GVQA 2PEHA 1X5PA 2LXUA 2KXFA 2M4MA 3MD1A 2QFJA 2EK1A 2X1AA 5H1SV 2HGMA 5IM0A 1WG5A 2KRRA 2ERRA 4W92B 2KI2A 1DHMA 5CYJA 1KOOA 1WEXA 2DK2A 3CCJS 1WF0A 3SXLA 3MD3A 5DETA 3L3CA 1YIJS 1VBZA 2MQNA 1HD1A 2VODA 1N52B 3CCMS 2MZTA 1YJ9S 3CULA 1DBDA 1SJRA 3CD6S 1R8HA 1UFWA 1H6KX 1WG4A 2J76E 3Q2SC 1Q7YT 2RQCA 2MYFA 4LJMA 1VQPS 5GMKa 1ZH5A 5CA5A 2J8AA 3MUTP 1FJCA 1KQSR 2M8HA 2MHNA 3BS9A 3MUMP 3CCRS 3UCUP 2WBRA 3VF0B 2XS5A 2CQ1A 4W90B 3ZZZA 4WF9Q 5HL7Q 3PIPQ 1UP1A 3SDEA 2I38A 1IQTA 3NS5A 2RUGA 2E5JA 1NJIT 3CMAS 4UY8T 2HYIB 2CQGA 1M90T 2KXNB 1RK8A 5MLCV 4F26A 2J0QD 3J7YU 4F25A 3NNHA 4U67Q 3MXHP 5HO4A 2XSFA 2NLWA 1JJHA 1X4HA 3SDEB 3TO8A 2EK6A 1VBYA 1U1NA 2KU7A 2RRAA 3BO3A 1WF2A 4RU2A 2UP1A 3CXCR 2E5HA 3B4MA 4C4WA 3CPWR 2I2YA 1X4GA 2DIVA 1YJWS 1H2TZ 1NO8A 2U1AA 4IOAQ 1HL6A 3VAJA 2SXLA 2B0GA 3UD3P 3THPA 4C0OC 2YWKA 1JMTA 1VQOS 2CQCA 1K73T 4PRFA 3CC7S 3V4MA 1U1PA 2G4BA 2EVZA 2KT5A 5ITHA 5LJ3Y 4M5DB 2M70A 1M5KC 2OSRA 2DISA 1X5TA 1VBXA 2DO0A 1N88A 3S7RA 2MZ1A 2RS2A 2DITA 1QM9A 1U1KA 2CQBA 1X4EA 4LMZA 3UCGA 2HZCA 1WG1A 2YH1A 3H2UB 1URNA 3MOJB 2MQPA 2MZJA 2LA4A 2U2FA 1P1TA 2AYMA 1K9MT 2L41A 2NZ4A 2CQDA 3N9UC 2OIHA 2YKAA 4OZ1A 2FPHX 2FC8A 2KVIA 3MDFA 2CQ4A 1VQ5S 2CPDA 4FXVA 3DLLQ 2DGVA 3LPYA 4ERDA 3DXBA 1U1LA 3R1HA 4YOEA 2YTCA 3VALA 2QEXS 2DGOA 4BS2A 3K0JA 4WCEQ 2OTJS 2BZ2A 1YTYA 1VQ6S 2X1FA 1WF1A 2DNKA 2DHGA 2G1DA 1FNXH 4Y0FA 1JJ2R 2GHPA 1WI8A 2CJKA 3CMES 1SJQA 2V94A 4Z2XA 1SJ3P 5DDQC 1FHTA 2DNYA 3CCVS 3EX7B 5LXYA 2CQIA 2F9DA 3CUNA 3G4SS 2DH7A 2M9KA 3G71S 4FXWA 2CQ2A 1Q81T 1HD0A 2KM8C 2CPJA 2LYVA 4TU9A 5FJ4A 4ZKAA 2LCWA 1WI6A 1U2FA 4CIOA 3CF5Q 4LIRA 2DNQA 2KHCA 2F9JA 1M5OC 4QPTA 5IM0B 1SXLA 4P6QA 2ZJQQ 2LMIA 2DHXA 3CC2S 4C7QA 2LA6A 5BJRA 3B4DA 2LEAA 1RKJA 2DNPA 1SJ4P 4CQ1A 2DGWA 5LSLA 2ADCA 1X5OA 3S8SA 2MZRA 5IFMA 3HHNB 2DNZA 2JVOA 2KFYA 1U1OA 5GADU 4WIIA 3I56S 4TU7A 1FJEB 2CQ0A 4IOCQ 2MKHA 2MKKA 1U6FA 3UD4P 2MKIA 4IUFA 2F3JA 2DB1A 1OO0B 2N82B 2BOPA 2M0GB 1VQ8S 1OPIA 3VAKA 2XS2A 3JB9k 3G96A 2MSSA 2CPYA 1NU4A 3CCUS 3ZZYA 2AD9A 1FXLA 1W2BR 2ZJPQ 2MXYA 1ZZFA 2QA4S 4CH1A 1OIAA 1VQ9S 4ED5A 1YHQS 2MQOA 2L08A 2MMYA 2VOPA 2DNNA 2M8DB 3NNCA 3CCSS 1U1MA 1S72S 2RQ4A 1AUDA 2OTLS 2CPZA 2AYBA 2CPEA 3CTRA 2DH8A 2M7SA 3U1LA 2E44A 1YJNS 2K8GA 1DRZA 1VQKS 5DDPC 2CQHA 2MZQA 3SMZA 3CCLS 2FC9A 1D8ZA 2O3DA 3J7ZT 3G9CA 2N7CA 3TYTA 2E5GA 1UW4A 2CQPA 2D9PA 2KH9A 3G8SA 1VC5A 4IO9Q 2M52A 2N3OA 1Q82T 2X1BA 3RW7A 5IQQA 3TP2A 3VAHA 2MQMA 2AYGA 2MKJA 1X4BA 3R27A 3MUVP 3PIOQ 1XN9A 5LXRA 1QVGR 1U6BA 2VOOA 2E5IA 1U1QA 1WHWA 3P5TL 5GAHU 1X5SA 1A9NB 1KOHA 2MPUA 4PR6A 2MQLA 1UAWA 2A3JA 2MJUA 2DH9A 2KRBA 3I55S 3H2VE 1Q86T 1WEYA 5JVGQ 3IRWP 2RU3A 4TU8A 1H2UX 4OZ0A 2AYEA 4TLQA 3ULHA 2LXIA 4PKDB 3EGZA 2DNRA 1SJFA 4WFNQ 2DGQA 1VQMS 1F9FA 3UCZP 2M2BA 2KN4A 3CCQS 1WEZA 2MKCA 5LSOA 2JVRA 5D78A 5GAEU 3Q2TC 2JX2A 3US5A 4QQBA 3THTA 2LEBA 2M88A 2D3OR 2KM8B 1BY9A 5CXTA 2RT3A 2KXHA 3UWTA 1WHXA 2DO4A 3OW2R 5GAGU 1VQNS 2DNHA 3NS6A 4QU6A 2CPFA 3BEGB 2XB2D 2RRBA 3LQVA 3S6EA 2DGSA 1WELA 3EGNA 4WFAQ 1X4FA 2MJNA 2MQQA 2J0SD 2VONA 4UQTA 3UE2A 3P49B 2DGTA 2ZJRQ 1D9AA 1YITS 1PGZA 5DDRC 1S79A 3NMRA 1A7GE 2LECA 2KG1A
chains in the Genus database with same CATH superfamily
3KLEA 3T5HA 3R5CA 3R7NB 1ZS6A 5KG5A 3QRRA 3M2VB 2RSQA 2B3TB 4F04B 4FN5A 2ALZA 2HIQA 4GKJF 1KHVA 2ZE2A 2MZSA 3SI8A 3A3NB 3BQ2A 3G6XA 1AFIA 1IKXB 1RSCA 2AGOA 3HFZB 2DJWA 2L9WA 4B9UA 2EG1A 3UNGC 2G13A 4N56A 3LUYA 2QT7A 1T05A 3FSIA 1W7WA 1E6YA 1U1RA 4S0MA 4NZ7A 2Z2YB 1XERA 4LF2A 1RTIB 5HBMB 4JI6F 3G82B 1YRUA 3JSRA 1Y5IB 2J5AA 3LAMA 4J5OA 3AODA 1C0TB 2JEIA 2GGPA 1F2HA 1D9FA 2H5EA 1SC6A 2J7KA 2AMCB 4B3SF 3R5DA 1ZA1B 1X4AA 3KJFB 4H4KA 4DR1F 1PO6A 2ATLA 3CJ3A 1QAYA 3NAHA 2OO4A 2ZFHA 3GJQB 7AT1B 4ZIWA 2QMXA 3LOUA 3D54A 3C6TA 2LP4A 2HHPA 5B08A 2VODA 4CYUB 4FVMA 1NK4A 2XG8A 3E01B 5IT9U 4ER8A 5KFGA 1S1WB 3SYZA 3DLJA 3K8WA 1LW2B 2IVYA 4DV2J 3D0HE 2VPYB 4K4SA 1IR1A 2NR0A 3VQSA 2FIUA 1G4CA 2QFIA 3BBBA 4NLGA 3UDVA 3QRQA 1QUVA 1WF2A 2UUCF 1HI1A 1CJUB 2QG9B 2IFXA 5GAGI 3T6BA 4I6YA 4ZPTR 5E33A 4Q0BB 5LMNJ 3UD5A 2CVIA 1NHVA 1N0VC 2MZ1A 4D3HA 4C3LA 4DR5F 1JX4A 2V2ZA 3H5XA 3KLGA 3PFOA 2DKOB 4USKA 1RHQB 3DLGB 3MM8B 3MDFA 2YQ0A 5A8KB 2CJXB 3LPYA 3THVA 1UW9A 4ED1A 2X1FA 2C2OB 4X4NA 1UVKA 4GC6A 1UEUA 2B9WA 4JV0A 4MYUA 2HQ3A 1SJ3P 5DDQC 4A48A 2IC3B 3NWRA 3L7PA 2CQ2A 4AQYF 5FJ4A 4ZKAA 2P8IA 2LCWA 3RTVA 2BABA 2RU9A 4JV2A 1ZM2A 5LMUF 4I7FB 9RUBA 2APOA 1Q5YA 5IFMA 1Z1ZA 1WTFA 2GNKA 4TU7A 4DLEA 1SKUB 3VZHA 2N82B 1IBCB 1RAIB 3GJTB 1RACB 3J81Y 3CJ4A 2FLNA 3M6UA 1W2BR 1ZZFA 4B9SA 2LU2A 5D0EA 1SVDA 2KVQE 4WWSA 1EQ0A 4PG8A 2VICA 2PI5A 3CCSS 3DN9A 1Y3JA 5J2QA 3CDEA 3K59A 3PX0A 3VGSA 3NWGA 2AP6A 2MZQA 8RUCA 4LUBA 2FC9A 3GG1A 3IM9A 2KDOA 1YGYA 3QATA 2BV3A 2R3VA 2W2MP 1KSPA 3MGJA 3RW7A 2DHHA 3FCVA 2VG6B 4KGXB 5BXIA 4DUYJ 1WHWA 2E1MC 4KQZA 4DV5J 2ZOGA 1JLCB 4C8LA 2XLKA 4QWAA 3KUGA 2NXEA 1WEYA 4K50A 1VRUB 4JYAF 3BKUA 3J7YI 3DM2B 3MEKA 3NGTA 5J2MB 4QOTA 5A8WA 1UFKA 1YQHA 1Q8LA 2DGQA 5F0WA 4CLUA 1RHRB 2E5LJ 2ZHBA 5F8JA 3BGRB 3HHLB 2LQ9A 3J80U 3M8QB 4F4WA 2XMWA 2DPIA 4ID8A 5MAOA 5KFQA 3M1VB 3FZBA 1K1SA 3KHLA 3MM6A 2XULA 2KZZA 1VYAA 5HVFA 5J1EA 1F2GA 4ZCKA 2BJEA 3IR7B 3ZFVA 3L95X 3RUBL 2KHDA 2E1RA 5HLFA 1HNZF 4YUDA 4DI6A 1RT6A 1X4CA 2B43A 3BO2A 3GCWP 2F40A 1WJ9A 1TL3B 2YKMB 2DR9A 1U24A 1S77D 2YNIA 2X1GA 1FEEA 3JTNA 1LKZA 3GPAA 1Y5LB 3MURP 5KTQA 4Q5VA 4DR2J 4IH6A 4G1IA 3UPFA 1AB8A 4IG0A 2P9CA 1UA0A 2LQ5A 2ASJA 5HANA 4K4TA 3CE8A 2MB0B 1RHUB 4YHHJ 1PKUA 2IBOA 1T03A 3BR8A 2HNZB 3P6YC 3TA2A 5J2NA 4ZP6A 3D1OA 4DF4A 4FS1A 4ILRA 3R1LA 1DURA 4TNOA 3TVKA 5HQ8A 1M1HA 3AH6A 3QJLA 3T1YJ 1PJ6A 2HBRB 4GVBA 5HMXA 1CVJA 3LGMA 1SL1A 1UL3A 1S6PA 3C16A 1M5SA 2EK1A 4M63A 4NLPA 4WE1B 4W92B 4C8KA 3NEKA 1U8WA 2JEGA 3GLJA 1RAHB 2MZTA 1HKAA 3CD6S 1WUUA 3SQOP 4ICLB 3MTKA 5CA5A 2RKIA 3GFZA 1S4EA 1IXKA 2OPPB 2ACYA 1OYDA 5EGYA 2HFOA 4K4WA 1RP5A 3EM1A 5MLCV 1SL2A 4K4ZA 4LBHA 1HNWJ 3MXHP 2V0NA 2XSFA 1B64A 1JXEA 2VL1A 1GT8A 4DN9A 3B4MA 4Q43A 4IOAQ 3UD3P 4OZNA 4AFFA 1CEZA 3D5MA 1JMTA 4JBCA 2KT5A 1SH3A 1X5TA 4AXIA 2QYGA 3ILLA 2VB6A 4FF3A 4MFBB 3RG6A 4AT1B 1X4EA 3MEDB 1FKOB 1WG1A 2B6AA 2I5JB 5ETTA 4CLPA 4O4GB 1P9QC 3LP1A 2NZ4A 1B3TA 4KRWA 3ILJA 4JI2J 5BYQA 4NLRA 1TVRB 3HD2A 3MCNA 3ZC4A 1KS2A 1S0OA 1HNXF 1HBOB 3GTYX 2UXBF 2HHVA 2KFZA 4UF4A 4ILMA 2Q1LA 4Q8EA 2D69A 5KFZA 4N76A 4F67A 4C98A 1JIHA 4CIOA 1BQMB 5ETKA 1VLYA 2N4DA 2VBYA 5IM0B 4X4UA 4WJBA 5E3AA 4F4ZA 3M30B 1TAUA 4HL9A 1YJUA 4WU3A 3IWXA 1RGVA 4D3GA 5LSLA 3QT5A 2AV5A 1X5OA 3FBFA 3HHNB 2KFYA 1RHKB 4R0JA 5GADU 4IUFA 2GMJA 3VAKA 3K5MA 4F2SA 3QJJA 1R6VA 1UCNA 1FVQA 1GMVA 1N33F 2AD9A 1J27A 5H9EK 4X2BA 3BSAA 3OXFA 4N47A 4LF4F 1MWZA 1HBNA 1YHQS 1DFDA 1IKVB 2Q43A 3JSMA 2GIFA 2DH8A 4LF9F 3VZIA 4Z37A 3R8YA 4WZQA 3W1YC 4DR4J 2QLXA 1AYEA 4NRTA 3MEGB 2COLA 5DLGA 1BGXT 5AE1A 1NPPA 2E5GA 1UW4A 2MHEA 5EX3A 3TA1A 3HSZA 3BH6B 3Q86A 4H4OB 4AD6A 1F6TA 4YMEA 3FBCA 4HT5A 2QGFB 4J7CA 1CJTA 2IVFB 4B3OB 3IXQA 3NXZA 5JJBA 3QWUA 1JKHA 3HZEA 1NCLA 2F5GA 2CA9A 2VQFJ 2FLLA 3HVWA 3KMQA 4LIWA 3IRXA 1WEZA 1VRTB 1CPZA 3QBCA 2JDJA 5D78A 3HCXA 2Z58B 2FJBB 1LV5A 3GSIA 4KYZA 4OHZA 1FRIA 4USMA 4J9MA 4DU8A 1KNZA 4OI4A 2DR8A 1ZOTA 3S6EA 4K59A 5KG0A 1A7GE 1N5TA 2LECA 4HH1A 1AXQA 4Y65A 3GJRB 3CJQA 4UOFA 1PAEX 3OTEA 3OT9A 1T9UA 2PT0A 5DDOC 4GO7X 2Y9HA 4J9VA 3OTOF 2ZBQA 3V6DB 2L3MA 1SJ1A 3CDAA 1YJ7A 2YH0A 2N3LA 4ZPAA 2QA2A 3W7BA 1F5BA 4Y2KA 4MH8A 3FUYA 4QJVA 1Q7LB 1CLFA 1N32J 1KEKA 3AOCA 3ZTSA 1X0PA 2ILYA 3QIDA 3QT8A 1VMBA 3CJ5A 2YNHA 3A8IA 4F3MA 2UUBF 2B4VA 3MMAB 2ZDOA 2H4YB 1JLFA 4ECWA 4YFUA 4URQU 2A2CA 4DV3J 3TOQA 3IP0A 5SUHA 1IBLF 3NOCA 3EZOA 4U7CA 1FX2A 3OR1A 3U1MA 1FRJA 2DNOA 5HK4A 3ENWA 2KJWA 2O67A 2W7OA 3DGVA 2GVDA 5FD1A 3F73A 2Y1RI 4JI0J 2CYYA 3K5PA 2HGMA 1QAJA 3CCJS 4LF8F 1JLAB 1HD1A 3CULA 1X9SA 4FZVA 4K4VA 4N8OA 2ZBCA 1GH8A 2HURA 4P2MA 3DGPB 2PC6A 3MUTP 2CVEA 2FJAB 2QE5A 2FGCA 2CG8A 4NLUA 1ZETA 2HWIA 4IQMA 1H73A 4NEYA 1SH0A 5LM7E 2I1RA 1QTNB 4KGKA 4FF2A 1U47A 4RBUA 3QT6A 2BJDA 4EK2A 1Q4RA 3RZAA 5KFDA 2YNGB 3KXDA 3ET6A 1IBMF 1DTTB 2YY3A 5KG7A 3THPA 3HHKA 4BDPA 2FJWA 3ILIA 4P7TA 5ETLA 2EKNA 4F4XA 2B5JB 1S7HA 4E2FB 3D1HA 2IAJB 2Y1LB 4DN0A 1H98A 3TVZA 1S1TB 1TL1A 3AJ1A 2RMLA 2L41A 2FC8A 4EMDA 1FK9B 3GYXB 4E8UA 1ACMB 1HWIA 4BS2A 4ED6A 2R2SA 1YTYA 2QLFB 3HM9A 1JJ2R 3IGVA 1V3RA 3M32A 5B0CA 5A76A 2V68A 3MPYA 4DL6A 4DL4A 2OELA 2WB4A 3TQEA 4B3TF 2Z2ZA 3R6GB 5F8LA 3A4TA 4OX6A 3QO9B 3DHWC 2VJUA 4C7QA 2LA6A 3FNNA 5KG3A 2BE2A 1QTMA 5BJRA 5I42A 4Q45A 4DF8A 4PPZA 2QL9B 1FE4A 3M2VA 2LU1A 1GQEA 4KO0B 2MKKA 1F1BB 8ATCB 5EWEA 1WDDA 4DV7F 1C1CA 3JB9k 1ZTWA 1IKXA 3AJ2A 3FK4A 5JXSA 3H5UA 5BR8F 4JUZA 2V4JB 3K2YA 2I0XA 2IDEA 3RJMB 2VFVA 3DOMA 4JV5F 3FDSA 3IAM9 3AD9C 4MIWA 3GFXA 1D8ZA 2F4VJ 3M6WA 4OHYA 3G82A 3TP2A 2O5DA 3DI6B 2AEFA 2AYGA 1QVGR 3W66A 3KJVA 1RTZA 1WOOA 2ZH1A 1XQIA 1XR5A 2MPUA 1PIEA 4NOHA 2MQLA 2CRLA 3LTOA 3IMQJ 3GG0A 4IKAA 3DLEA 1ITPA 3HPOA 1NB7A 4RW8A 3Q22A 2DNRA 4DV1F 3G6VA 1KLMA 3H4DA 1RYSA 1F0XA 1XC9A 1HR0J 1H7WA 1D9DA 1NKBA 3MPWA 2VKRA 5D8HB 1DLOB 3W2WB 3THTA 3M9OB 3M6VA 2J8SA 3KLFB 3W9IA 1BY9A 4CYUA 4H4KC 1TKXB 1Q79A 5E3RA 2XSJB 3E01A 3I4PA 4LFBJ 3TZZA 2DNHA 2Z8QA 3NS6A 3AQPA 4UUXA 4QU6A 3ITHA 3DRXA 5M2PA 2ZZTA 3SSRA 5KFNA 2OFGX 4N5SA 1VIOA 3UO0A 2WVBA 3CJKB 1OMSA 4YB1P 5AXKA 2ZH9A 2J0WA 3IWNC 3MCMA 1RWNB 5IT0A 3C2PA 4X4TA 4NZ6A 3M9MB 4LVNP 1RU1A 3DMJB 3T1AA 2HVHA 4DMZA 3QLHB 4ED3A 3HZGA 3MTJA 3PZPA 3WX8A 1FRKA 1I1GA 1X4DA 4I4BA 2Q6CA 2EFNA 3WIVA 2HVZA 1R0AA 5GADI 1HI0P 4FF4A 3QGIA 1ZZNA 1RHMB 1DZ5A 1T8EA 4C3KA 2HFNA 3UVJB 4J9PA 2LKZA 2DPJA 4WKRA 3V6HA 1AA1B 1LWFB 2HPUA 5GVQA 2PEHA 1RT1B 3RBXA 5F3TA 1JNZB 1VI7A 3KOAA 1SUQA 1FDAA 1JLBB 5E5NA 4RW9A 2PD1A 4EZ6A 1T11A 1PILA 2VC0A 5F8GA 2MKYA 2HBYB 3IA0A 2RQCA 4EI2A 3CDUA 6FD1A 5D15A 3KHRA 4K0KJ 4ZIVA 1XMQF 1JLQB 2CQ1A 2CNNB 1HW9A 2D41A 2PI4A 1RBLA 4TY9A 3KK2A 1TKDA 4HACA 2YWGA 4ZVGA 4RU2A 2R8GA 4ELVA 1UJ4A 1T9XA 4ANDA 2U1AA 2BRLA 2RE1A 4NLSA 1K73T 4PRFA 1U2RA 1ZBTA 4Y2AA 1TK5A 4K7QA 3K17A 4RPFA 1BUXA 1WSRA 2RQKA 1N88A 5F0UA 2AF6A 4XO0A 3UCGA 3A8JA 4QPXA 2MQPA 3GV5B 2VFSA 2RHQB 1KQFB 1KRPA 1EETA 2W9BB 1WACA 4OIXA 3R7SB 7FD1A 4Y0FA 3GIMA 3LGNA 3BSNA 3DRRB 3RR8A 1MWQA 4QIVA 1C2PA 4X4VA 1YDLA 3SSQA 2KM8C 1RBAA 3EYZA 2AIRB 2HKEA 3MR7A 3LP2B 2LEAA 4EBCA 4RJVA 4PG4A 5KFLA 1JXLA 1U6FA 2A10A 2DB1A 1XMOF 2NS1B 1XTZA 3M2RB 2LXFA 2UVVA 2V8GA 4CT8A 3CCUS 4LT6A 4ZMMA 1EZZB 3OR2B 4DV6F 5FDLB 4ZCMA 4A8KA 3BDEA 1U1MA 1S72S 2VA2A 4CWBA 1GXUA 2M7SA 2XZTB 5DDPC 3OHAA 3MPDA 2VDHA 3MM5B 2GQ2A 2GS8A 4MTPA 3DLKB 2P2CB 3IFEA 3BBCA 3OXLA 3MZIA 4HEA9 2XHWA 1N5SA 2MQ8A 4KHMA 2YNFA 3C14A 2JNJA 1OY9A 2CWKA 1RZMA 4WK1A 2GJ2A 3NCQA 1IR0A 2Z4PA 2ZEJA 3AQOA 5AXNA 2Z2LA 4LFAF 3A8KA 2OD6A 2DXFA 3PRBA 5DZ7A 3O5TB 2LEBA 2J9EA 1GTEA 1CJKA 3BZQA 4KFBA 4ICLA 2L9DA 3SFGA 4ES3A 2XB2D 4DSEA 2CJYB 1T3OA 3JAMY 4WFAQ 3QFWA 2VONA 2FTRA 1JNRB 1HBMA 1I6JA 3TEHB 4YQWA 3NBPA 1GMUA 3LALA 3PFEA 4WXWA 3V4IA 3NAIA 2HVIA 4DL5A 3QAEA 4KIAA 4WFXA 2UUAF 2V8PA 1VDHA 3OJUA 1N56A 3L9ZA 2WVCA 1L3SA 4JI5J 2HAFA 3V6KA 2RD5C 3UR0A 2XY7A 1O5JA 4FPIA 3H4BA 2CPHA 1LWEA 2RS8A 5JVHQ 2MGZA 1XNQJ 1KLNA 4IYQA 4ZVTB 4OI3A 3RW6A 2D9OA 1RWPB 4GVLA 1Y5NB 2C2ZB 2ZE2B 3Q0AA 4M5KA 2DRAA 3KHGA 2DGUA 2HLTA 3MEDA 1FKOA 4FVCA 5EN1A 2I5JA 4PQAA 2GHWA 3FEYB 3NCRA 5D4LA 3Q8YA 1TP7A 2DT9A 2NYIA 1T05B 4G1QA 1FT8A 2AJ2A 5KAKA 1DQ8A 4LF7J 1HWKA 2UUWA 3CSKA 4F2RA 5F9LA 1T9TA 4J9QA 2XMAA 2XO7A 3IGNA 4YY3J 5L1JA 1VR6A 1OSDA 3AA9A 4BHQA 2XBPA 4ECZA 4BCAA 1RT2A 5T41A 2V67A 2GGPB 3W2VA 2ZC3A 2CJBA 1KONA 1RHJB 1S1XA 4NZ0A 5IM0A 2JFDA 3M30A 3M4XA 5C24A 1FF2A 1EB0A 1R8CA 3OBIA 4QR2A 1WG4A 4MK9A 4Y28C 4TY8A 3FRZA 2HBZB 1VK8A 2JLFA 3C6TB 3D3BJ 5HMZA 2EEYA 1Y00A 2WBRA 2OGUA 1TMMA 4OI1A 2RRNA 3PIPQ 3M2UA 5CAAA 3HLUA 4ED2A 4X4SA 1MW7A 4KH1B 2N4CA 2VKZG 2J0QD 5JMNA 3AT1B 4F25A 3H2LA 1IKVA 1RXOB 2VD3A 3OPKA 1JWWA 5F8HA 1FERA 3S1TA 4DG1A 3MEGA 3UDEA 2OPSA 5D0HA 3I5AA 3KMSA 3CC7S 1IKWA 1GNKA 2CDQA 4R5PA 1HWLA 2DO0A 3DYAA 3MCSA 2BR0A 1U1KA 1N36F 2CQBA 5FLXY 4DWIA 3V81A 3N4WA 2HFUA 4B3OA 2HLUA 2AEMA 4LRAA 3ETOA 1M0SA 3KLGB 2FHJD 1FNXH 2W4DA 1FDDA 3CMQA 1CG2A 1UA1A 4Q8FA 5A6WA 5EHHA 2UZAA 1HD0A 4G65A 1IBKF 3OLAA 4ZN1A 2KHCA 3ZTRA 2DHXA 4DV4F 2Z30B 3FZ2A 1O51A 3OTDA 1SJ4P 3W9HA 4PABA 1NSAA 4PYAA 2MZRA 2RQMA 1K47A 1Q8KA 2DNZA 3CD0A 1S9EB 3D7SB 4QBUA 2RHSB 3W62A 3O8WA 5T14A 3B6BA 4OQJA 1BD6A 1NLKL 3EXYA 2ZJPQ 2IJFA 1VQ9S 4USUA 4K4XA 2WONA 4B9NA 3NGDA 1XR6A 2HHWA 2ZM6F 1B0PA 2BJ8A 3AY0A 3CTRA 4GC7A 1YJNS 2K8GA 3BYRA 4L72B 2MLZA 3MM9A 4ANEA 4B3RF 4P2XA 2HNDA 4MIBA 4ZA1A 2DEJA 1UMJA 5J2QB 3OVAA 3BYPA 4CNYA 1GXTA 4HVZA 3W65A 3W63A 5CYMA 2KZMA 2A3JA 3RU0A 2KRBA 4L75A 5I4MA 3I55S 4DOZA 5A2QU 1KTVA 4L73A 2M2BA 2MKCA 1U45A 1QUPA 5IXUA 4NA2A 5A8WB 1IWGA 4OYZA 2KM8B 3MWBA 1QLNA 4FYWB 4QIGA 4LF5J 1MSWD 2R9LA 2DO4A 1LOUA 1NK5A 2NZCA 5JUMA 2MJNA 1I51B 2JH3A 3UE2A 1U2CA 3JQJA 4NLDA 2PO4A 5KFOA 2C2MB 5IOLA 4NLYA 1HHQA 1ICEB 3LA0A 4WFZA 1VJWA 3GZ7A 3AB4B 1WHYA 5A8RA 4RU9A 2KYXA 2RVJA 4EO6A 4WIQA 5J1EB 2YNGA 1RLDA 4XPCA 3NLCA 4USIA 3RB6A 3CCES 1RT6B 2QJ3A 3GFYA 3NS7B 3KJNB 4QIEA 2B5JA 4M1KA 1W2IA 4JI3J 3J7AN 4HHJA 3FGVA 2YNIB 2A1BA 2D1CA 2OHDA 1OSCA 3EJMA 3HI9A 2XNQA 3QYYA 1O6XA 5D77A 1HIYA 1I94J 4CH0S 4ZHRB 4JV1A 3QMQA 2FHJA 3HO1A 4DR1J 4IG0B 1YWXA 2AZ3A 4OX9J 1SIZA 1L3KA 5CYQA 1PJ5A 4JOUA 1T03B 2WHOA 4ECRA 3FRYA 1NZAA 4ZJLA 4K8RA 4LF6F 3IN5A 3FEXB 2BJ3A 4R8UA 2FHMA 5J2NB 2ZC4A 2N7YA 4QIWD 2F7VA 4Y34A 5D4OA 4ZVOB 1P1LA 3E8OA 4BLGA 2UVUA 3M05A 3DOLA 4GVBB 2ZH7A 4RX6A 4ED7A 4FNHA 2E5LF 4P72A 5K9FA 1S6PB 3C16B 1N5YA 2MYFA 1SI9A 3QT7A 2XMKA 3FFIA 1FRHA 1X31C 5G0RA 2A2DA 5AXLA 1ULRA 2J6SA 2ZOMA 4L6V3 4WTOB 2J6UA 2RKIB 1F3FA 4AL6A 1M90T 2KXNB 3AAWB 2WSFC 4Q2MA 4HLBA 4B02A 4QW9A 4K4UA 2E7XA 3MAHA 2UP1A 2X51A 3F44A 1YJWS 4FYDA 2SXLA 2NXNA 3MMBA 4DPUA 1I3OB 2EVZA 2IIHA 5J1PA 3LWLA 2HG4A 2EFVA 2JFKA 5HQMA 2VJVA 1NSQA 3PR5B 4OJ1A 2RF2A 4DSIA 3IR6B 1HQ2A 4N41A 2CPDA 2DGVA 2XLJA 1U1LA 2NXUA 2OTJS 2BZ2A 4OI6A 3W2WA 3LP1B 2CJKA 2HQDA 1G7CB 5C2CA 1JLGA 1TKXA 2DNYA 2B8QA 4F8RA 3D6HB 4K5SA 4J37A 4O3PA 3KLVA 3QWPA 4URSA 4YB5A 3Q24A 3PW0A 2VZ9A 2HRTA 1F60B 4ITSA 3QZ8A 3OD2A 3B78A 3DRYA 1TFWA 1FWLA 1VQSA 3EVOA 2JVOA 4WIIA 3I56S 3UD4P 5F8MA 4NYZA 4OLPA 2WW4A 4YN3B 1FVSA 3G96A 1FX4A 4UZCA 1KFSA 1U4BA 2QA4S 2R7VA 2ZHAA 4KY3A 2MQOA 1HARA 4OZJA 2L08A 4JI4J 3EDRB 4OLOA 1D0EA 1VQYA 5L1IA 2CPZA 1NK6A 1HNWF 1DRZA 2W4PA 3UN3A 3PY8A 2XQCA 5KG2A 3TX0A 2F63A 2OPQA 2CNLB 4P10A 3OUYA 4NMLA 1KTQA 4I68A 4JYAJ 3NGUA 3RAMA 2IRXA 2BKNA 2E1AA 3H8YA 3MM7A 3TR5A 3D1QA 3C46A 3RAXA 1FJGF 1LWFA 1PC5A 4B17A 4OZ0A 2XZDB 4RNOA 1UVJA 3OL6A 2GX8A 2BQ3A 1CJTB 3AOAA 3C15A 4NEZA 2HVEA 1RAJA 4TQRA 4FKYA 1JLBA 4YR2A 1JKHB 4HHHA 4ZVSB 2PFFB 1CJVA 1CS4B 3L7UA 5ETPA 1G6BA 9ATCB 4ZK7M 4X62F 3M9NB 1FEHA 1KP6A 2RRBA 1HNZJ 1FFWB 1YRXA 3TRGA 2MQQA 2AZ1A 4YDDB 4ETXA 1ZM4A 1RT7A 5EWGA 2B4UA 1K8AT 1N5QA 3CB4A 2Q79A 3GCXP 1WTBA 2OEMA 3M8RA 3D6TB 1VS3A 1KD1T 1MMDA 1BQXA 3KTQA 1ZA2B 4ILLA 2V2VA 3DDIA 3W64A 1NJZA 4DSFA 2B7CB 1VHFA 2MKSA 4DL7A 5HROA 4USJC 1MLAA 1EP4A 1JQGA 2F8MA 2YBVA 2WCXA 4LQ9A 3HP6A 2XS7A 2AHOB 1QVFR 3CWJA 5DG9A 3P45B 3BSOA 2PE8A 3G6ES 1RAEB 1CQNA 2LDYA 3MR5A 4DFPA 4KE5A 1NHUA 2YNHB 1KQKA 3PRVA 1S5ZA 4M5IA 4KSEB 1JLFB 3CD5A 2RB7A 2P6TA 4JP8A 3OVSA 2C3UA 4UQGA 1WWHA 1RTJA 2PFDA 3OVBA 3GYNA 1FFGB 5AT1B 4LR8A 1SKSA 2B56A 2HHXA 3OR1B 2V2QA 3W5ZA 3MD1A 2VQFF 4QWEA 1FDNA 4YR3A 2X1AA 3ZZUA 4A8SA 4R25A 3MD3A 3LP2A 1YIJS 1SJRA 4UTGA 2XMTA 3Q2SC 3M8PB 1ZH5A 2H51B 1BXNA 3R5AA 3HVTA 1Z2LA 3KLIA 3VVTA 3G6YA 2I38A 1FCAA 4RUBA 4DX7A 1ZYQA 4ENOA 3CMAS 2ASYA 4IRDA 3D6FB 5FDLA 3PEJA 3CIMA 1MN9A 3ADAC 4M5MA 2XMVA 1R0CB 2BQUA 3BO3A 4G3IA 4LRDA 3TI0A 4CLWA 2I2YA 4M5JA 1RU2A 3DLKA 2Q6BA 1FE0A 4C48A 1N32F 1R6YA 3ET6B 2BANA 1S59A 3W60A 2VBWA 1HMVA 5CCLA 4C11A 3KG4A 3VHQA 2K7KA 2CJ9A 1B4SA 3OL7A 3VCDA 2FPHX 4RWXA 1B0VA 4X4QA 3VALA 3K0JA 4LFCF 2OH2A 4ELTA 4PQUA 1TL1B 4DV3F 3GR1A 1RTHA 1PG5B 2LQBA 2V94A 3N6MA 3CCVS 2Q66A 4F0KA 2DH7A 1Q81T 4CZCA 3HMJG 3IM8A 4DSLA 3PHEA 1UWBA 2DNQA 5DGBA 1SKRA 4MK7A 3M32B 4JI0F 3R5BA 4M94A 5DGAA 2EC0A 1REVA 1RKJA 2NUHA 2UXDJ 1HQUA 4CQ1A 2AX1A 1TK8A 4NWBA 4LF4J 3K89A 2CQ0A 4MKBA 4USVA 1M1GA 2BE2B 5I42B 5CABA 5AE3A 1OPIA 4DUZF 4P9SA 4RWWA 1VRQC 4LF9J 2B4OA 5KOWA 2BW2A 3BB5A 1VBKA 4QR0A 5F8NA 1OIAA 7FDRA 1YX2A 1C1CB 1U09A 3FMWA 3N79A 2M8DB 3OTBA 4WYWA 4CM2A 5SZTA 2AYBA 4GO5X 1S48A 2F8HA 1DTQA 1S9FA 4DPWA 3X1LB 1Q82T 3DOMB 2R2TA 4B9LA 4UOCA 3VAHA 1WC0A 3BGLA 2R7QA 2XM3A 1X4BA 3MUVP 4M5GA 3PIOQ 3MECA 3GILA 2YPYA 1U6BA 1U1QA 3ZTQA 1DQAA 3U1NA 2HVDA 1RADB 1Q86T 3QGPA 4C8MA 2YQ1A 3KJVB 2YX1A 3GB0A 1CBKA 3DLEB 4TYAA 4QWDA 4ZPBA 4RW8B 3LWMA 1FDBA 2FJDB 1KLMB 3KUHA 3HJVA 2FVPA 4KGZB 5D0RA 5B0AA 3GWCA 1WELA 4ZJOA 2XMJA 1PGZA 2QLWA 1A6LA 5THWA 4X4OA 1N6QA 2QMUB 1RISA 5IS2A 1WKKA 1K44A 3ITHB 4O3NA 2O1PA 1R8PA 4ZVQB 1XIQA 3OV7A 1R27B 1X7VA 1TL7A 4RR5A 3CW2C 2GJIA 4USHA 3RRGA 4NXMJ 2UUBJ 2WOMA 3JSYA 3EVWA 4P2SA 5KFMA 2FZCB 2Y8WA 3TUPA 3BF4A 3I4HX 2A6OA 2OJ3A 3G8QA 4DJBA 2Y1IA 4OZ3A 5HN0A 3BO4A 2V63A 4USTA 2K3KA 4UW2A 3BPSP 1N4LA 4G6VB 4MIAA 3EGVA 2QRRA 4I2PA 5L1LA 3DHXA 2HFVA 2E1PA 5CD4H 3W5YA 2F4VF 3PW7A 2XNRA 1TAQA 2DCLA 2V8VA 1X0FA 5L1KA 2WZ1A 3HVAA 2WSCC 1R0AB 4F02A 1M1KT 2UV8A 4MKAA 4LF8J 1WORA 1HHTP 4IRKA 2OI2A 4CLTA 2EW9A 3D28A 3ISND 1TUVA 5D4PA 5H1SV 4O23A 1WG5A 1DHMA 2PSZA 4IR1A 5DETA 5ETVA 2MQNA 4DPOA 3CCMS 3N0VA 4OFZA 1H6KX 4DSKA 1S9EA 1SUQB 2CG4A 4LSLA 4LFBF 4OHWA 2R8KA 3UCUP 4RW9B 3ZZZA 3FSYA 4LSZB 1IBMJ 3CO0P 3DNCA 4PWWA 2E5JA 2O66A 1RK8A 4NXNJ 4EWTA 3O6QA 1ZM3A 1LWCA 4FKXA 3WDOA 1S49A 4DDFA 2KU7A 1U1NA 2C3YA 2F65A 2E5HA 4JI1F 2ROPA 3TX8A 2W7PA 2ZDPA 3R9LA 4ZJQA 1HL6A 3KK2B 3SCLE 3K5NA 1QSSA 4HACB 3RRKA 1VQOS 2CQCA 3GE9A 2HMIA 4DR3J 1TL5A 4E0DA 3TAMB 1M5KC 5CD4A 4LQ3A 1VBXA 5DO2A 4J9OA 3PRDA 3RBEA 1NK7A 4LSNA 1IWAA 2MZJA 4HH0A 4L3KA 2LA4A 5ADZA 2GJFA 3DXBA 4ZDNA 1U26A 5E3CA 2DGOA 1GX5A 5KFVA 4DS5A 4B3TJ 3QIPA 3PKMA 2LLZA 4IQXA 4NLTA 1EETB 1NUEA 3RB4A 4HR2A 2PEBA 2DVIA 3I9ZA 4EYHB 4FXWA 3I31A 3OFFA 3DU6A 2OD4A 3M7VA 2DD8S 3R5JB 3GIRA 4DS4A 2DGWA 2ADCA 3S8SA 1Y0HA 1PSDA 4TKTA 4ZLJA 4M95A 3FBEA 2UXCJ 3W8PA 5LT5A 5BR8J 1H72C 2MKIA 2IMWP 5E3QA 2GMLA 4JV5J 2MSSA 4I56A 1SQGA 3ZZYA 3KYLA 3K7RA 4DX6A 1HWJA 2G0JA 3T41A 1EKRA 3AXKA 1TKTA 3ISZA 1FD8A 3BN4A 2V8DA 4ZP7A 4ZHRA 3RAQA 2WVDA 5U47A 1F5CA 2D9PA 2FJEB 2KH9A 4RBVA 4DV1J 4N77A 3KK1B 2ZBRA 4I69A 5K20B 2E5IA 1DARA 5D0GA 1Q5VA 3SV4A 1C0UA 1ZPWX 4RW7A 5KFFA 2NCKL 5KFCA 2IRYA 5ETMA 2XO6A 2HK3A 4TLQA 4AYBD 4PPDA 2YNFB 3C14B 4J91A 4QW8A 5ETOA 3QGGA 3BGUA 5KFEA 2V9WA 3TWZA 2NSCA 3QAUA 2R7RA 1EJ7L 1UZHA 5CXTA 2I9SA 1QD1A 1WHXA 3MMCB 4U8VA 1HHSA 2W8KA 1CJKB 4Y2MA 4A8FA 3IBFB 1YITS 1KR4A 4M5NA 3RRHA 4KFBB 1YVFA 4Y6IA 1CULA 2DNGA 3PHTA 3NOGA 3MAQA 4DFKA 1RQ0A 2OAUA 3I5CA 1S99A 1HBMB 3NBPB 3V4IB 2AQ4A 1T9WA 2DNMA 4B9VA 3FJ2A 3J81j 2DGXA 3L7OA 4HTJA 5B0DA 4IG3A 2CJQA 2DIUA 2GHVC 2DRDA 1LWEB 4NLWA 2MGZB 4O3SA 2W01A 2GZOA 2VG7B 2QYCA 3BBFA 3PTWA 1R7IA 2XZWA 3OHBA 4I1TA 2MY8A 4IOBA 3LF0A 1HA1A 3X3UA 2DNLA 4ZLNA 4W98A 1HBUA 2V5HG 4DQPA 3SCKE 4DU7A 2OEKA 3OL9A 2ZVSA 4G1QB 1MWYA 4LR9A 1KVIA 4J90A 2LXUA 2YXLA 5M2UA 2QFJA 3AD7C 4JI8F 1QSLA 2QC3A 2ERRA 1S4FA 3WX4A 1XMQJ 4CO5A 2ATCB 2R8HA 1B0TA 2C2EA 5CCMA 1RT2B 1UFWA 3W2VB 1RT3A 1S1XB 2J8AA 1PBUA 4AL5A 5C24B 2XS5A 1WKLA 4AUKA 4FNIA 3SIPB 5HL7Q 2YKPA 4TY8B 1HFEL 3QRPA 2QX0A 3U02A 1NSPA 5IC6B 1S10A 4ZVUB 2K3IA 2KJVA 3NNHA 2F1FA 3RR7A 2J6TA 5K8NA 2NLWA 3M2UB 2RRAA 2DEIA 4JI5F 3CPWR 1X4GA 1H2TZ 2XYPB 3D4JA 1S12A 4OHVA 2B0GA 2HHHF 3N6LA 3V4MA 1U1PA 1BLUA 4CO2A 5GMEA 3LP0A 4DG1B 2OPSB 2RS2A 2BRKA 1WC1A 3H2UB 1IKWB 3ELHA 4R5PB 3N9UC 2KVIA 2CQ4A 4NYOA 3DYAB 4GMKA 3JTOA 2CZ9A 1RT4A 1S6UA 2PA3A 3NP5A 3V81B 3QSIA 1RWOB 1NPKA 1UFLA 2FB0A 4OV6A 2MDAA 4LF7F 1WI8A 1SV5A 1HPZA 1Y9OA 4B3MF 2GAGC 1MROA 1CS4A 2IM2A 1T3NA 2D74B 2XWXA 1ZTTA 3AD8C 3MR2A 1UWAA 5GMDA 3MOZA 2OUGA 5CQGA 3JXOA 2NXJA 4QYRA 3CC2S 4JI7J 4A8WA 3LO3A 2GIRA 1BMQB 2P5VA 5HJYA 1H74A 2W2OP 1YKWA 2DR6A 4WXOA 2HZVA 2BBEA 1FJEB 2R2RA 3D68A 2VFUA 2VF3A 1NDCA 1LQ9A 4DCPB 3U27A 2BACA 4RKUC 3J80Y 4ED5A 2RUSA 1D1UA 3VR1A 4QWBA 2OTLS 1DAXA 4YR0A 3BN7A 3TANA 1MG7A 2RJZA 1FNMA 1SPBP 2PMHA 4F0MA 2WONB 3PDNA 4IO9Q 3EE3A 2N3OA 3W61A 2MKJA 2OP5A 4LFAJ 4X66F 3H20A 3ENVA 1IJEB 2Y0BB 2P6SA 1SB6A 4KJIA 3MM9B 1NM2A 4P2FA 1UAWA 2HNDB 4DQRA 3JTPA 2P9EA 1NEEA 4WZMA 3IBWA 2ZH3A 3QPIA 4TU8A 2LXIA 3N6NA 3AA8A 1F9FA 3EGWB 5CYMB 3J81U 4IFVA 4ANCA 5LSOA 4NI2A 2CIMA 1Q95G 3DOKB 4KKOA 1FKPA 1TUWA 1ZAXA 4P74A 3GIKA 3M8PA 1MNEA 2UUAJ 5AJ3J 3KDNA 1KKHA 1CSJA 1I5OB 3ZTOA 2RDDA 2DGTA 1D9AA 4URGA 2H65B 3UW1A 2ADBA 2IMOA 3I32A 1HQEA 2XLIA 4IDKA 1NDPA 1TELA 1YLXA 1N34F 2NQPA 1QDUB 3MMJA 2Z57B 5CZVA 2NXCA 1WHVA 2R7SA 1M5VC 1IJFB 1PJ7A 4F4AA 3DLBA 2KO1A 3DRPA 4LBPA 4C2MA 3GV7B 5A8RB 3VAMA 1NZ8A 4Y00A 4FS2A 2PIIA 3WIUA 1V9OA 4DR6J 1FNOA 4PXBA 2O01C 4Y2CA 1R0BG 3ONQA 2DHAA 2CPXA 1J5EJ 2ZBIA 1RWUA 2C3OA 3SBMA 4UY85 3NGSA 5L38A 1YSJA 4HI2A 4EFAC 2JHEA 4QU7A 4MKYA 3P5BP 3W3SA 2XYGB 4P75A 3S01A 2VPXB 1VCTA 2C3PA 3ZXWA 2HAIA 1S6QB 4XAKA 2EFGA 1F9EB 2BM1A 4ZPCA 2BJ7A 2GA7A 1H0HB 2XCPA 5CYQB 2HBQB 5L9NA 3FQLA 1R89A 2J0XA 2C2RA 1RAFB 4R8UB 2JLGA 1YZ7A 1J5OB 3SV3A 2KRRA 2DK2A 4NRUA 4LF1A 3L3CA 2V34A 1N52B 4HTIA 4AE5A 2IM1A 3DOLB 4PYDA 4W4MA 4Q44A 1WC4A 4LF5F 2V4QA 1KQSR 3IWLA 3BV8A 2DBBA 3OJSA 4WF9Q 1LFPA 3BJYA 1AZSA 1N5YB 2K7JA 1S1UA 4CLLA 4DHVA 1NJIT 1QE1A 4NA3A 1H3DA 2CQGA 3FFIB 4J9UE 3GIJA 2QV6A 3M6XA 5G0RB 5LSRA 4PAAA 3R5GA 5HO4A 1TZ0A 4V19J 1VBYA 4M5DA 3CXCR 1N36J 2BM0A 1BQNA 4RW4A 3J7A1 3MEEA 1HLWA 3G2XA 5LJ3Y 2M70A 2L48A 2W9CA 2VASA 4JI3F 3MMBB 4ECTA 3WC0A 1S1VA 2YH1A 2DXDA 4O3OA 2HS3A 2F8EX 3PACA 3I0SA 2OIHA 5D3GA 4K2XA 2UU9J 1I94F 1UEKA 4ERDA 1Q78A 2ROEA 5ETSA 2IYGA 2QEXS 2HWHA 4WCEQ 2RF2B 3LAKA 1IBKJ 1WC6A 2XHCA 4OX9F 2ZH8A 3I6PA 2V50A 3J7Z5 5DRKA 4PWUA 4TVAB 4RNNA 5AXMA 4QZVB 4DV4J 5IZHA 3OSPA 3PO5A 4CRJA 3V2UC 3CUNA 5HI7A 2M9KA 3KNAA 4KHPJ 2A0FB 4DR7J 1T95A 4YB7A 1FXDA 4ATNA 4C97A 2CPJA 5T7LA 3JYTB 4B9MA 2JZ5A 3WHIA 1JLGB 4QPTA 2KKHA 2ZJQQ 1TTHB 4NX9A 2FZKB 1LFWA 4GRSA 4IH7A 2KTQA 4ZP8A 5HJXA 1OPZA 2CWXA 1YZ6A 3FKBA 2YWWA 3K5LA 1WSVA 3ZZ0A 2MKHA 3OFEA 4HDGA 4O3RA 1IM4A 4KBIA 2ZM6J 2F3JA 1OO0B 2BOPA 3R6LB 1OYEA 3TEGA 5KG4A 2FVRA 5A0YA 3UDLA 3HX9A 2VV5A 4RNHA 4CH1A 1AFJA 4GKKF 3PX4A 3T5KA 4B3RJ 5EWFA 2VOPA 3SQGA 1HYSA 1WOSA 2ZNZA 2GVZA 4FPRA 3MFIA 1RI7A 4HT7A 2O3DA 4ID5A 1VC5A 2M52A 2H5JB 5KFWA 4PEOA 5IQQA 2HHUA 3H25A 4HYKA 2JJ4D 2OPQB 1UEVA 2A18A 2GO8A 3OUYB 5GAHU 5KFPA 3RYLA 2EFOA 2DH9A 3MM7B 4TN2A 1HNIA 3ICLA 5IWAF 1VQMS 3UCZP 4KGMA 2JVRA 1Q8IA 5GAEU 3HXMA 3Q2TC 2CZVC 1MN7A 1S6OA 3PYFA 1Y3KA 3DC2A 3M8YA 3C15B 3ZNJ1 5CH7B 3KDOA 2ZD1A 3MAAA 1TUGB 4KR0B 1X4FA 3LH2S 2Y1JA 5DDRC 1S79A 1CJVB 4M5LA 4QIFA 1FA0A 2M5YA 3JS9A 3LGHA 5DQHA 4HKQA 2OFHX 2GCFA 2RAQA 4WTYA 5I3UA 1RCXB 1RT7B 3PXGa 1NJWA 5IV4A 4A46A 1L3TA 2DXEA 4ZLLA 2YWFA 5D4NA 4PWDA 2HGNA 3KK3B 1XJWB 3ETMA 2OSQA 1R31A 3TAMA 3T9NA 1S7IA 1Y7PA 2QLJB 1FJ7A 4ED8A 1UVIA 1O8BA 1YI2S 3C6UA 5HROB 4JI4F 3K5OA 2NYHA 5M2RA 1JK9B 4LF6J 4NLOA 2R7TA 1EP4B 1M5HA 3BR9A 1WD6A 1PC4A 3D2WA 2PMZD 3NCPA 3CDWA 4ZPDA 3G8TA 2IJNA 3DDNA 1G2EA 4WBFA 5DLFA 1VQ4S 2NUUG 1XBWA 3BM7A 1RTDA 1TQLA 3L09A 3HJFA 1X5PA 4ETZA 3A13A 5DZ6A 3G86A 5DQGA 1JLEA 3C3LA 2XMMA 1RTJB 4RW6A 1SH2A 3ZO7A 4F4YA 5HAOA 4IH5A 2KI2A 5CYJA 4CCHA 4F7VA 2FVQA 1Q8BA 3B54A 1XNRJ 4LREA 4I2QB 2ZWOA 1PYOB 1VQPS 2ZBPA 2BJ9A 3TUJC 3UN5A 4C8OA 4DV0F 4I6WA 1IQTA 3NS5A 4O44A 3HD1A 3PCOB 2HS4A 1UKUA 3B82A 5J2PB 1V3SA 3HVTB 2QA1A 3PW4A 3KLIB 3EZUA 1XEZA 4KV8A 3TO8A 2C28A 4DX8H 4QWCA 4Q7AA 5HMWA 1XWLA 4CO4A 2HQGA 2V9KA 1RYRA 4C3MA 2NREA 3HHDA 2H9ZA 4U7UK 4C8NA 5ITHA 2QSFA 2OSRA 3KK1A 3KNGA 2ZVIA 2IA0A 3PO4A 3I5BA 5J1NA 1G3OA 2DITA 4CO3A 2WTFA 4LMZA 4X65J 3NY0A 3L4BC 2BANB 2CQDA 1HMVB 1AUSL 4N7TA 4C11B 1QJHA 4LR7A 2NPFA 3GFHA 2VA3A 5K14B 2YWEA 3W8GA 2DNKA 2GHPA 2JEFA 4DCOB 2W2NP 5IQ6A 2VPWB 3D6MB 1GMWD 3ISNC 3HFKA 1IQZA 3CNQP 2IPOB 3MMCA 2VQEF 4ZITA 3G71S 1TV6A 4PQUB 1RTHB 2LYVA 1WI6A 1LK5A 2X3GA 3CF5Q 3DRSB 3GYGA 1SXLA 4P73A 1PAUB 1S97A 2VHGA 4WKYA 5L46A 4OMFG 1HWUA 1T9YA 5HVGA 1ELOA 1UWBB 2B9YA 2B4PA 2NSBA 4IOCQ 2M0GB 1HNVA 1REVB 5KT7A 2WVFA 1HQUB 2G1HA 2E7VA 4F4KA 4FXDA 1OY8A 1FXLA 2NPIA 3AHPA 4KGVB 3DKDA 3CCZA 3HKZD 2YKNA 4NCGA 5F41A 2V4RA 1NB2A 3POTB 1V6HA 4XIUA 3U1LA 2XYHB 1K0TA 1VQKS 2VG7A 3T1HJ 3KG0A 2CQHA 2W25A 3D0GE 3C8YA 1FJGJ 4X64F 3G9CA 3TYTA 4RUCA 1PYTA 2X1BA 1RT5A 3BKTA 3Q8PB 2VH7A 2YX7A 1DTQB 3MHYA 4PR6A 1LWXA 2PDAA 3CJ8A 3GQCA 3H2VE 5JVGQ 1C1BA 2W4CA 3MECB 1UETA 3CDBA 4Y2IA 4WFNQ 4FYXB 1MMNA 2G2ZA 4X62J 3V6JA 4XPEA 3PVXA 1BC6A 5CZXA 2D3OR 3MR3A 2HQCA 1WKJA 4UOHA 1R8AA 4BC7A 4CTAA 1PYSB 2OEJA 2I8EA 3PM9A 3PYDA 3P8BB 4NA1A 3PV8A 2KT2A 5KT3A 1CC8A 4RO0A 4OYAA 2CKWA 4P7VA 1IVZA 2Q3PA 2VG5A 2IRUA 4MJKA 3VAFA 5KFTA 1NK0A 3Q23A 2UXDF 3D66A 2MSTA 4FP9A 5H9FJ 2JL9A 1N6QB 3NGRA 3QFHA 3NMAA 1KC8T 1W26A 1RLCL 2HHQA 3TUZC 1S0NA 4NMXA 1TL7B 2J9DA 3W9JA 3UDCA 5C42A 4ED4A 5ETQA 1LEOA 3F0NA 1VC6A 2WOMB 1IKYB 1EX8A 4PG6A 1B7FA 2ILZA 2VU5A 1UZDA 1RB0A 1RDRA 1VC0A 2HGLA 3KKFA 3TJ8A 2JRSA 5KFHA 3O44A 1GX6A 5DG7A 4J9RA 2CNOB 4P52A 1GMWA 4I2PB 3GMGA 3ZZOA 4DPTA 4E98A 4ZCLA 1V5VA 2H4WB 3GSDA 3I0RA 2HSEB 2AJ4A 3MR6A 5HP1B 1UJ6A 1QAXA 4F50A 5F3ZA 3IG1B 1WF0A 1V3ZA 1JJCB 4L76A 1P9YA 3R97A 4ZN3A 1UPMB 1YBAA 4IR9A 1WC3A 2OKQA 2K06A 5GAHI 5L39A 1LW0B 3PEHA 4NLVA 1OQ6A 1RABB 3VF0B 4W90B 4WFYA 3IS9A 3SDEA 2FDNA 4OV1A 4OX8A 1OS5A 4C0BA 1FFSB 4I67A 5B0FA 2EPIA 2HNYA 4LSLB 2B51A 1TKZA 5GAEI 4U67Q 3PR4A 4ECVA 4H4MA 4Q2LA 5C25A 4FBTA 2BJ1A 2VBXA 4C4WA 1RAAB 4DV2F 3I96A 3VTIA 4NXMF 3HT0A 1LWCB 2CXEA 2ZUGA 4FBUA 3MPUB 3PNIA 1YJRA 4N8NA 2OPRB 4L74A 4LFCJ 4ECQA 2EFQA 3N28A 3I9V9 2HMIB 4F0HA 4OZLA 2XY6A 4OX7A 5LMNF 1RAGB 4LSNB 2CAJA 3R1HA 3FSXA 4PUOA 3FVYA 1YJTA 2YTCA 1N0UA 3NGKA 2H48B 3DOKA 1OY6A 1WF1A 1U25A 4P71A 3HDSA 2I6WA 1KDNA 1W25A 3WQPA 1KBRA 3RGIA 3VQTA 3BQ1A 1S9GB 3QIPB 2MEWA 2ACMA 5D6GA 3HSJA 4CNZA 3H5SA 4DUZJ 3KUEA 3B4DA 3R7BB 2P9GA 3IO1A 2XC9A 3E3XA 4GKJJ 4NPOA 1K1QA 1SKWA 1VQ8S 1WOPA 3TAQA 3VWSA 4XK8C 1T94A 1VFJA 2EC2A 1VHIA 1Q53A 2RDJA 4RL1A 3N01A 1KN6A 1J2VA 3TARA 1GFWB 5AE2A 3Q8RB 5KFUA 2HRYA 4NXNF 3NNCA 3DXSX 2DTJA 4MMOA 2KT3A 3CJRA 2ZKUA 4JI6J 1T9VA 3TW0A 1TKTB 2N7CA 1YG0A 3G8SA 3GU0A 2EBGA 1U0HA 2V69A 4ZVPB 2B8PA 4OYBA 2HWTA 4DR3F 1AW0A 4HDHA 3SZ2A 4B3SJ 5C5JA 1KOHA 1S6QA 1VJQA 4C6AA 2BX6A 3CJTA 3CIZA 1F5AA 5HSPA 2AJ0A 2HRUA 4CLFA 3Q8QB 3TZYA 4DFMA 2E29A 1U02A 4DUYF 4K4YA 2BDPA 1C0UB 1J5OA 4O0IA 4EEYA 4RW7B 1NDLA 4TXSA 4DV5F 2K1RA 3VGTA 4QQBA 1FTRA 2XMUA 3AFGA 4RNMA 3FQKA 4MKVA 1WC5A 4XDDA 4CLZA 2RT3A 3E2EA 3DU5A 1EQMA 4WU2A 4RLEA 2WAQD 2CPFA 3BEGB 2EBEA 1LXJA 1UVLA 2WVEA 2Y8YA 5KOXA 2WBMA 1APSA 2IA6A 3CCTA 4YB6A 4DQIA 2D3ZA 4F36A 4EYIB 2BVZA 4OJGA 2UUCJ 2AW0A 1CULB 3H42A 2G9OA 2UXCF 1WDTA 3HKWA 5KFKA 3NKYA 1M5PC 2ZUAA 2CQ3A 1B99A 2XI2A 2Z56B 3GR0A 1B7YB 1VQ7S 4IO1A 3LW5C 4DR5J 2IHR1 1Z4UA 1RTIA 3EPIA 5HBMA 3AOBA 1Q1KA 5KFYA 1ZPVA 2IJRA 4DX5A 3TJ9A 4IG3B 3UR3C 4R0EA 5K8MA 1T0TV 1C0TA 3IC1A 2MTLA 1IN0A 3JAMU 1GEHA 4DR2F 1FRXA 2E9RX 1O0PA 4FF1A 1L3UA 2DR5A 2QSWA 4YHHF 3U7JA 3DDKA 3P96A 3ZZTA 4AQYJ 1FO1A 1JXVA 3H98A 2KXFA 1HBUB 2YX4A 3KLHB 5LMUJ 3JYTA 3T1YF 3HHLD 1R8BA 2ASLA 2YKOA 1KOOA 1WEXA 4NYPA 1TU0B 1S1WA 2EFPA 4TLRA 1R8HA 2J76E 1Q7YT 1LW2A 5GMKa 3ENQA 3PG9A 2M8HA 3MUMP 3CCRS 1REGX 3E51A 2BE7D 4JI1J 1N5VA 1RT3B 2RUGA 4Z7CA 3CO9A 1NJXA 4USWA 4WP3A 1CJUA 2DRBA 3OLBA 6FDRA 4F26A 2DCUB 4DQQA 2D7SA 4J9KA 1RA7A 3OFGA 4KHRA 2EI5A 2EK6A 4NCBA 4Q0BA 2VC1A 1NJYA 2KB2A 3VAJA 4KB7A 2YWKA 3ZTPA 2G4BA 1ROFA 2GW8A 3DLGA 5KFAA 3MM8A 4ECUA 5A8KA 4FDFA 1GXLA 1QM9A 3HT3A 2JLEA 4EO8A 2MLYA 2D3O1 4C8ZA 4DL0C 1RE1B 2AGQA 3FMBA 3LP0B 2YKAA 1VQ5S 4FXVA 3DLLQ 4CLKA 3ZZPA 2J7WA 1NSKL 5E3PA 2IC3A 3F56A 2FJVA 2K2PA 2G1DA 2BW7A 3SEOA 2DY1A 3T9ZA 4A8YA 1RA6A 1RT4B 4PG7A 2KFNA 4JI2F 3A8EA 4I7FA 2FLOA 1YK9A 2QLBB 3AJDA 5L9XA 4Z7YA 1NAQA 4U9RA 5C2GA 1SV5B 1HPZB 4OYMA 2HEKA 3NRBA 4FYVB 1MROB 2FQQB 2F9JA 1D8YA 2LMIA 2EKYA 1NXIA 1VOMA 2G2YA 1IR2A 5FLXU 4O4RA 3ILOA 3SCJE 1QAIA 3EZ5A 5A2QY 2XS2A 2XY5A 4U7UD 1FWPA 3KK3A 3EDQB 2MXYA 1P6TA 4ZP9A 1FD2A 2AJFE 1FWKA 4KT0C 3MPVA 2MMYA 2DNNA 1KQGB 5EDWA 2B7BB 4V1Ak 3A1YG 2IBKA 4DL3A 2VG6A 3CCLS 4K5RA 2AEJA 2V8HA 1MU2B 4A8QA 1JLCA 1E6VB 2PA8D 3A3OB 8AT1B 3UNYA 5KT2A 3DCAA 1VRUA 2H1YA 3DM2A 5J2MA 3R27A 2POKA 3CD7A 5LXRA 2FVSA 4DR4F 1X5SA 4DPYA 2W9AA 4QYZJ 2W2QP 4ZOSA 3BGRA 3HHLA 2RU3A 2XCAA 3M8QA 4PKDB 5K5MA 4WP8A 4BC9A 3CJ0A 3GONA 2C42A 3PKYA 4MAKA 3M1VA 3M8WA 5L8RC 1NH7A 4PCQA 4IFYB 4QCLA 4IFVB 4I2QA 3T5LA 2BE9B 4NI2B 4F3QA 1RWVB 4CI0B 1QY7A 3VVUA 2EXUA 4KKOB 3QZ7A 2DGSA 1FKPB 2J0SD 4UQTA 3P49B 2RILA 3KHHA 2XGPA 2BA9A 1XK8A 2KG0A 3QGHA 1TL3A 2YKMA 2FUG9 3O3LA 4JI7F 1N54B 5J2PA 2VUGA 1VQLS 1VK3A 2PGCA 1RAOA 3VAGA 5LJ5Y 2QL5B 1N8RT 1VLOA 2FHOB 1KHWA 1HQEB 2QA4G 5A6PA 4X4PA 4IDKB 2XWYA 3D67A 3H59A 3Q8UA 4BWMA 1HW8A 2C22A 4WK3A 2HNZA 1X9MA 3DRPB 1PBAA 3W5XA 1TR0A 3K8VA 4JB8B 2QMWA 4DSJA 3FCHA 3V5RA 2HQFA 2KL8A 3VAIA 3OTCA 2CPIA 1SC1B 3HVRA 1U8SA 5G4DA 2IYIA 2UVRA 5K14A 1HNXJ 2UXBJ 4NLQA 2IM3A 3PJXA 3UFCX 1EKSA 4JI8J 5EUHA 2ABYA 3HF5A 5DM6Q 2G2OA 3PYEA 3UI3A 2ZH4A 4WE1A 4KTQA 1U6ZA 3MCOA 5DM7Q 4A8XA 2MLXA 3IR5B 1TK0A 1FI4A 3JQKA 1VGYA 4MYTA 4UT4A 1FXRA 1T7PA 3DRSA 2AX0A 1NHKL 2R4FA 4KH0B 2LQ8A 1RWKB 4OZ2A 2E9ZA 3HK2A 5CHCB 1C4AA 3SXLA 4HI1A 1R43A 2OPPA 1X9WA 2H3EB 4I64A 4FYYB 3IAS9 3AXMA 1RJJA 2MHNA 3TA0A 5AJ3F 4LVOP 5K8PA 1N33J 1T02A 4DQSA 3FBBA 3KLEB 2W8LA 4U6PA 4KPYA 2GQCA 2HHHJ 2HYIB 1EIYB 4ES2A 2RIJA 5H9FK 2YKQA 3POTA 1EHWA 4UZBA 4CT9A 5BYSA 5B0GA 1JJHA 1AZSB 3QQCD 1S1UB 3VGUA 1QE1B 2IDLA 2WRMA 2WW8A 2XEXA 1NO8A 3RB3A 1G1XA 4MFBA 4LRBA 4HHUA 2HFZA 4M5DB 4O4GA 1FRLA 2FHKA 2L9NA 3HULA 4DR6F 3S7RA 1TVRA 1TFYA 1BQNB 2FYXA 4RW4B 1URNA 3MEEB 1E6YB 4OJHA 1J5EF 2U2FA 1HBOA 4ZPVR 2WSEC 4B3MJ 3JSBA 4OZ1A 2W9CB 5KG1A 1YJVA 4OYXA 1S1VB 3KWMA 3GJSB 3KFWX 2HHSA 3PX6A 1EAYC 4C0HA 3I0SB 3IBCB 4A4JA 4KC5A 5D3GB 2B9XA 4CO1A 1BQMA 4Z2XA 1NPRA 2HIYA 3EX7B 4OI2A 5ETRA 2F9DA 3G4SS 2ZZMA 2JC0A 1DY3A 1RUSA 3UQSA 3H7HB 4Y3CA 3M8SA 3PYGA 3CVKA 2YPZA 2UUTA 4LIRA 2D3UA 1M5OC 4P6QA 3BKFA 4G1PA 1ZAWA 1F9HA 5K8OA 1EARA 5DQIA 3Q83A 3OTOJ 1UPPA 1URRA 2DNPA 5T7LB 3OFHA 3WC2A 4NL5A 1U1OA 4LRFA 1R3NA 2GMHA 2GIQA 4NASA 2V6AA 3Q8VA 1RWWB 1XMBA 5LOQA 4LBIA 1GTHA 4EBDA 3QNWB 2B9EA 1BWVA 1VISA 2ZH5A 4K2JA 5E0OA 4LRCA 4DZ6A 2J7UA 5B0EA 4IRCA 4AXJA 3EWGA 1U7LA 3AB2B 1UTAA 2JC1A 4H4OA 1IKYA 2RQ4A 2CPEA 5B09A 5A0YB 2ZNYA 2GC8A 4X66J 2R8IA 3SMZA 3OSNA 4ED0A 2CQPA 2VDIA 4YDXA 3SQGB 5B7WA 1IBLJ 4RNFA 1HYSB 5I3QA 3VV2B 5DG8A 2GVZB 3HFVA 4NCAA 1XN9A 2VOOA 4ID5B 1VRTA 2MJUA 5FIIA 2RH3A 1LXNA 3IRWP 3RBDA 1SJFA 1NK9A 2ZZNA 5HP1A 1SQFA 4ZS6A 2KN4A 2UU9F 1SBRA 4ALZA 2AKWB 4TYBA 2VFRA 2UVWA 3IG1A 3KG1A 4KAIA 4RZRA 5F9NA 1Y4ZB 1HNIB 1XR7A 2XTJP 3H90A 5DS7A 2W1BA 1YBUA 3OW2R 2FGOA 2IVMA 1NKEA 1VQNS 1HR0F 1LW0A 4DZDA 3LQVA 1N34J 4KHPF 2GFFA 4DR7F 5E2QA 2BKOA 2JOQA 3V6DA 2LQJA 4DFJA 3NMRA 4M8LA 4ECSA 1RKIA 2KG1A 2EG2A 2J9CA 2ZD1B 3MAAB 4I6AA 3MF5A 1BHNA 2GV1A 3T5JA 2AWZA 1OWXA 2GO9A 2FVCA 3TQ1A 1FESA 5KFRA 3O2IA 1P27B 4OHXA 3MMAA 5I3UB 4PXCA 3NNAA 2ZOFA 3G87A 4MK8A 2JWNA 1DJ0A 6AT1B 1RWXB 2OPRA 3TZWA 3C19A 4J9LA 3FEZA 1S0VA 4PWDB 3R2CJ 1AROP 1UVMA 4V19X 4BWJA 2W7AA 2CUYA 2R7UA 4B08A 4AL7A 2H54B 3C6UB 3I87A 2CZ4A 2AGPA 3GIIA 2HZAA 3T6JA 1F3VA 5B0BA 4DLGA 3RBZA 2LVWA 4ZCIA 2FJXA 2PN6A 2G0CA 5ETNA 2GAHC 1JLAA 1S9GA 2AJ1A 3WBZA 2M4MA 1SQEA 2XGQA 2VPZB 1RTDB 2E66A 3DLHA 3DGPA 1YJ9S 4EU0A 3TVYA 4U95A 3PJ9A 1JLEB 4RW6B 4DUTA 2ZKTA 4LJMA 4DPXA 3K57A 1U49A 1KWMA 4DV7J 3B8HA 2GQQA 3HSGA 4ZVEA 3MM6B 2R8JA 1UP1A 2UV8G 2F4FA 3TJAA 4ZVRB 2BYCA 2IM0A 3BGOP 3OQ2A 4YS2A 5KT4A 3CCWA 1S0MA 1DTTA 2H5IB 1FKAF 1SC4B 5HLFB 1NNDA 1KVKA 4K0KF 1X60A 2JEJA 1X4HA 2DY9A 4O44B 1JB0C 2ZITA 3TAPA 2E7WA 2IAJA 2OMOA 1D3WA 2QTWA 3Q89A 4KV8B 5IC4B 1S1TA 2OMLA 2EWHA 3BQ0A 5KT6A 4BBYA 4UOGA 1FK9A 3PW5A 3ZZRA 2R42A 2VIHA 2HZCA 3F41A 3MOJB 1P1TA 2BKPA 3EUNA 1S76D 1ZAVA 4OYOA 2BQRA 4YOEA 3BH7B 1RBOB 4J9SA 1VQ6S 1NRKA 4OYIA 2KYZA 5KFXA 4C9DA 3CMES 1SJQA 1NK8A 3UN2A 4J9NA 4DL2A 1GK8A 3SSSA 3QO9A 2CQIA 5LXYA 1NKCA 1SL0A 3TNVA 4RUAA 2HW3A 2W24A 1U2FA 3M8ZA 3VGVA 4OJ3A 3OXGA 3A3PB 3EXCX 4KO0A 1QSYA 1H7XA 1TV6B 1Z2ZA 3HHEA 4PZVA 1LNQA 4EBEA 4YEAA 1XNRF 2YQ3A 4WPAA 1TMJA 2ZHOA 1UVNA 2DYAA 5KFJA 4GKKJ 4UUWA 1YRTA 2R7WA 2R7XA 5LL6d 2V4JA 4CP5A 1VIXA 1CC7A 3NL0A 5HATA 2CPYA 2Z0GA 4DXLA 3CJSA 3TZXA 1Y10A 3CGIA 4ZVFA 4X4RA 1HNVB 4A8OA 5KFIA 3BSCA 3GV8B 1L3VA 1AUDA 5E7OB 3DI6A 2WK4A 1ZM9A 2YKNB 4NCGB 2XI3A 3BGFA 1RCOB 3DFEA 2MQMA 5IWAJ 1IM6A 2C2DA 3A12A 5IT9Y 3P5TL 1A9NB 4XDCA 2FD2A 5KG6A 2B6AB 2RDIA 2FLPA 1RT5B 2CFXA 1DLOA 4X65F 3ULHA 3KLFA 1X8DA 1B70B 2W2PP 3KLHA 4M5HA 4CO0A 2C1EB 4OZ5A 2XSJA 1H38A 3US5A 4X84A 1DQ9A 2C2KB 1C1BB 4U96A 2M88A 3HSDA 2KXHA 1BE4A 3UWTA 2G0IA 5KT5A 1V5IB 3C66A 5GAGU 4KPCA 4DCJB 2C3MA 3EGNA 2A6MA 2ZJRQ 3CJKA 2Y0SD 1AT1B 1MMLA 4CTAB 2HHTA 4PXEA 3MI7X 2AT1B 4OYWA 1NDKA 2MY7A 2FY1A 4EGLA 3DMJA 2QIFA 3PW2A 3QLHA 1A0OB 4CLSA 1N48A 2VG5B 4A47A 2V2KA 2BOAA 5I3PA 1NBEB 2RNEA 1HBNB 1HI8A 2LDIA 5HMYA 3EPGA 3JSMB 1D09B 2HK2A 2CJAA 1XNQF 2HS0A 4WFBQ 3UVJA 2LEPA 5RUBA 4NLXA 1SCJB 3T1HF 1UJ5A 5C42B 2BUNA 3K58A 4ZPWR 1Q16B 1JJ4A 4ELUA 1YBTA 2E9TA 3CC4S 2ROGA 1RT1A 2WB1D 1GAOA 1H2VZ 3ENAA 3P3DA 1U48A 2QO3A 4QYZK 1C4CA 4OYPA 5F8IA 2CNKB 2DHSA 4H54A 3CEDA 2YWHA 2LFVA 3SCIE 5IV3A 3H40A 3IRXB 1FTCA 3O1LA 5HQLA 3JQMA 4YY3F 3T3FA 4DV0J 1VBZA 3KJQB 1JLQA 3I0RB 5EX0A 1DBDA 2DR7A 4RUHA 2J9DE 2HQIA 1Q0NA 2R2UA 4TQSA 1SIWB 4CH7A 1XMOJ 3CT9A 1FJCA 3BS9A 4DEZA 3EMTA 2JSXA 1OQ3A 4C8YA 2BMBA 5DJBA 2ZWPA 1P8GA 4ES1A 4DV6J 3N5BA 4UY8T 1OJ4A 4WP9A 3FC9A 2AJQA 2OLWA 3D9BA 5H9EJ 3J7YU 1RWMB 1L5UA 4PXDA 3GP9A 3IS9B 1LK7A 3SDEB 2M3DA 2ASDA 2DIVA 1MU2A 2HNYB 2QL7B 1TKZB 4C0OC 1E6VA 4H4MB 5C25B 1FRMA 2R7OA 2DISA 4WYLA 2W9BA 4L3NA 3T19A 3NG8A 3BDPA 4B9TA 3R3TA 1TL4A 2AYMA 1K9MT 1KVJA 1BWEA 3DRRA 5BYRA 2VQEJ 2QZ8A 2FY8A 4YP3A 2Z2MA 4MT1A 2DHGA 2CDRB 4O0NA 3LANA 4IFYA 3R2DJ 3ZNUA 4CLYA 2ZH6A 1FHTA 4PUOB 3HHLC 2VFTA 4F3OA 1U0SA 2GVDB 3H5YA 3BREA 4TU9A 5HVHA 1CQMA 5KFSA 4RBTA 2FZGB 3QJPA 4NE9C 4A8MP 4XTTA 3M2RA 3Q8SB 4ECXA 2X3DA 2C2NA 1K0VA 1NMEB 1PCAA 2HFSA 5IT4A 3D0IE 3WZ0A 3OR2A 3RB0A 4OL8A 4U8YA 1S57A 3I82A 1NU4A 4QR1A 2QN6B 2VBZA 3BPDA 4X64J 3H0PA 4ZVHA 3MM5A 4PG5A 2E44A 2BEFA 4EUVA 2E1CA 4DBQA 1KFDA 3PJWA 5E41A 3J7ZT 2ZH2A 2BXJA 3LPEA 3CJ2A 2ALYB 2Y3YA 3QSYB 4EZ9A 3P4UB 3D3CJ 3EVMA 5C7PA 3EICA 1U0HB 1H2UX 1SC3B 2AYEA 3EGZA 4CDIA 3N5FA 4CM0A 4ZLPA 1NH8A 3CCQS 2IY5B 4O3QA 2AU0A 2JX2A 1IUJA 3MFHA 4OI0A 3TUIC 3FCWA 2X7IA 3OL8A 5KFBA 2K1RB 2PMWA 4I0WA 1WNEA 2YVSA 3SFUA 4ECYA 2CADA 1Y11A
chains in the Genus database with same CATH topology
3KLEA 4Y6IA 1APSA 2IA6A 2DNGA 4YQWA 3CCTA 3NBPA 4YB6A 3T5HA 4DQIA 3LALA 3PFEA 2D3ZA 4WXWA 3V4IA 3R5CA 3NAIA 2HVIA 4DL5A 3QAEA 4KIAA 4WFXA 2UUAF 3MAQA 5KG5A 4DFKA 1RQ0A 3OJUA 4EYIB 2OAUA 1N56A 3I5CA 1S99A 3M2VB 2BVZA 4OJGA 2RSQA 2B3TB 1L3SA 1HBMB 3V6KA 2RD5C 2AW0A 4FN5A 3UR0A 2ALZA 2HIQA 2XY7A 2G9OA 3NBPB 4GKJF 2UXCF 1KHVA 3V4IB 1O5JA 2ZE2A 2AQ4A 2DNMA 3H4BA 2MZSA 2CPHA 1LWEA 2RS8A 3SI8A 3HKWA 5KFKA 3NKYA 2MGZA 5JVHQ 1KLNA 4B9VA 3BQ2A 3FJ2A 4IYQA 3G6XA 2DGXA 1M5PC 1AFIA 4OI3A 3RW6A 1IKXB 2D9OA 3L7OA 4HTJA 5B0DA 2AGOA 2DJWA 2CQ3A 2XI2A 4IG3A 3GR0A 2L9WA 2CJQA 4B9UA 1Y5NB 2ZE2B 2DIUA 3Q0AA 1VQ7S 4IO1A 2EG1A 3LW5C 2GHVC 3UNGC 1LWEB 2G13A 1Z4UA 1RTIA 2IHR1 3LUYA 4N56A 3EPIA 3KHGA 4NLWA 2DGUA 2QT7A 2HLTA 5HBMA 2MGZB 4O3SA 1T05A 3MEDA 3FSIA 1FKOA 1Q1KA 4FVCA 5KFYA 5EN1A 2I5JA 1ZPVA 1E6YA 1U1RA 4PQAA 2GHWA 4NZ7A 2VG7B 3FEYB 4IG3B 3UR3C 4R0EA 2QYCA 5K8MA 1XERA 1C0TA 3IC1A 1IN0A 1R7IA 3NCRA 5D4LA 1RTIB 1TP7A 2XZWA 5HBMB 2DT9A 3OHBA 2NYIA 4JI6F 4DR2F 4I1TA 1T05B 2MY8A 4IOBA 3LF0A 4G1QA 1FT8A 5KAKA 1DQ8A 1YRUA 1HA1A 1FRXA 1Y5IB 3JSRA 1O0PA 3X3UA 2E9RX 4FF1A 1HWKA 2J5AA 1L3UA 2DNLA 2UUWA 3CSKA 3LAMA 4F2RA 4J5OA 2DR5A 2QSWA 4YHHF 3U7JA 1C0TB 1HBUA 2V5HG 5F9LA 4DQPA 2JEIA 3DDKA 3P96A 2GGPA 3SCKE 4J9QA 1D9FA 2H5EA 1SC6A 2J7KA 2XO7A 4B3SF 3IGNA 3R5DA 5L1JA 1X4AA 3OL9A 2ZVSA 3ZZTA 4H4KA 4DR1F 4G1QB 1PO6A 1MWYA 1FO1A 2ATLA 1OSDA 3CJ3A 1KVIA 3AA9A 1QAYA 4BHQA 2XBPA 3H98A 4ECZA 4BCAA 1RT2A 2LXUA 2KXFA 3NAHA 5T41A 1HBUB 2YX4A 3KLHB 3JYTA 2GGPB 5M2UA 3W2VA 2ZC3A 2CJBA 1KONA 2QFJA 4JI8F 2OO4A 3HHLD 1R8BA 3T1YF 1S1XA 2ZFHA 4NZ0A 1QSLA 5IM0A 2ASLA 2ERRA 1S4FA 2YKOA 3WX4A 2QMXA 2JFDA 3M30A 1KOOA 1WEXA 3LOUA 3D54A 3M4XA 3C6TA 4CO5A 4NYPA 2HHPA 5C24A 1B0TA 1FF2A 5B08A 1S1WA 2R8HA 1R8CA 2VODA 3OBIA 2EFPA 5CCMA 2C2EA 1RT2B 4TLRA 1R8HA 1UFWA 3W2VB 4QR2A 1WG4A 2J76E 4FVMA 4MK9A 4Y28C 1Q7YT 4TY8A 1LW2A 1RT3A 1S1XB 1NK4A 2XG8A 3FRZA 3E01B 5GMKa 2J8AA 3ENQA 1VK8A 2M8HA 2JLFA 3C6TB 5HMZA 4AL5A 3MUMP 5C24B 3CCRS 1Y00A 5KFGA 2WBRA 1S1WB 2XS5A 4AUKA 4FNIA 3SYZA 4OI1A 2RRNA 5HL7Q 3PIPQ 3E51A 3DLJA 3K8WA 3M2UA 2YKPA 1N5VA 4TY8B 1HFEL 1LW2B 1RT3B 2IVYA 2RUGA 3HLUA 4ED2A 3CO9A 3D0HE 1NJXA 2VPYB 4K4SA 4X4SA 2NR0A 2DRBA 1MW7A 3U02A 2N4CA 3OLBA 6FDRA 4F26A 2VKZG 1S10A 3VQSA 2FIUA 2J0QD 2DCUB 4DQQA 2D7SA 4J9KA 1RA7A 2K3IA 2KJVA 4F25A 3H2LA 3NNHA 2F1FA 3RR7A 3OFGA 2J6TA 1IKVA 4KHRA 5K8NA 4NLGA 2NLWA 2EI5A 2VD3A 3M2UB 2EK6A 1QUVA 2RRAA 3OPKA 4NCBA 1WF2A 1JWWA 5F8HA 4Q0BA 2VC1A 2UUCF 1HI1A 4JI5F 1FERA 3S1TA 4DG1A 3CPWR 1X4GA 3MEGA 1H2TZ 2OPSA 1NJYA 2KB2A 4OHVA 3VAJA 2IFXA 2B0GA 2HHHF 4KB7A 3N6LA 5GAGI 3T6BA 4I6YA 3I5AA 2YWKA 3KMSA 3CC7S 1IKWA 1GNKA 4ZPTR 3V4MA 1U1PA 5E33A 2G4BA 1BLUA 4CO2A 1ROFA 2GW8A 2CDQA 4Q0BB 4R5PA 3DLGA 3LP0A 1HWLA 5KFAA 3MM8A 4DG1B 4ECUA 5A8KA 2CVIA 2DO0A 1NHVA 1N0VC 2OPSB 3DYAA 3MCSA 2MZ1A 2RS2A 2BR0A 4D3HA 1GXLA 1QM9A 2BRKA 4C3LA 1U1KA 1N36F 3HT3A 2CQBA 2JLEA 4EO8A 5FLXY 4DR5F 1JX4A 4DWIA 3V81A 3N4WA 3H2UB 4B3OA 3H5XA 3KLGA 1IKWB 4C8ZA 3PFOA 4DL0C 2HLUA 2AGQA 3FMBA 4R5PB 3N9UC 3DLGB 2YKAA 3LP0B 2KVIA 3MDFA 3MM8B 5A8KB 2CQ4A 1VQ5S 4FXVA 3DLLQ 4NYOA 3DYAB 4GMKA 3LPYA 3ETOA 3THVA 3JTOA 1RT4A 1S6UA 3ZZPA 2J7WA 2PA3A 3NP5A 4ED1A 3V81B 1M0SA 5E3PA 2IC3A 3KLGB 3F56A 2FJVA 2X1FA 2K2PA 1UFLA 2FB0A 2FHJD 4LF7F 2MDAA 1FNXH 2G1DA 4X4NA 1UVKA 2W4DA 1FDDA 4GC6A 1WI8A 1UEUA 1SV5A 1HPZA 2B9WA 3SEOA 1Y9OA 1CG2A 4MYUA 4JV0A 1UA1A 4B3MF 2HQ3A 1SJ3P 5DDQC 3T9ZA 1MROA 4A8YA 1RA6A 1RT4B 2IM2A 4Q8FA 4PG7A 2KFNA 4JI2F 1T3NA 3A8EA 4A48A 4I7FA 2D74B 2FLOA 2IC3B 2XWXA 3L7PA 1ZTTA 2CQ2A 5A6WA 5EHHA 5L9XA 4AQYF 3MR2A 2UZAA 1HD0A 1IBKF 3MOZA 5FJ4A 1NAQA 4U9RA 4ZKAA 2LCWA 5CQGA 1SV5B 1HPZB 3RTVA 2BABA 3OLAA 3NRBA 2RU9A 1MROB 2KHCA 2F9JA 1D8YA 4JV2A 1ZM2A 5LMUF 4QYRA 3CC2S 2LMIA 2DHXA 2EKYA 3LO3A 4DV4F 4A8WA 4I7FB 2GIRA 2APOA 2P5VA 1VOMA 3FZ2A 1O51A 3OTDA 1SJ4P 2MZRA 2RQMA 4WXOA 5IFMA 2DNZA 1Z1ZA 3CD0A 2BBEA 4O4RA 1WTFA 2GNKA 3SCJE 4TU7A 1FJEB 4DLEA 1S9EB 2R2RA 3VZHA 1QAIA 4QBUA 2N82B 3EZ5A 5A2QY 3J81Y 2XS2A 3CJ4A 3O8WA 5T14A 2VFUA 2XY5A 4OQJA 1LQ9A 1BD6A 2FLNA 3EXYA 3M6UA 3KK3A 1W2BR 3U27A 2ZJPQ 2IJFA 2MXYA 2BACA 1ZZFA 1P6TA 4B9SA 2LU2A 4RKUC 1VQ9S 4ZP9A 4K4XA 3J80Y 2WONA 4ED5A 4B9NA 1FD2A 2AJFE 4PG8A 3NGDA 1XR6A 3MPVA 4KT0C 2MMYA 2HHWA 2ZM6F 2DNNA 1D1UA 1B0PA 1KQGB 2PI5A 5EDWA 2B7BB 3VR1A 3AY0A 3CCSS 4QWBA 2OTLS 3DN9A 1Y3JA 3CTRA 3CDEA 5J2QA 3K59A 1DAXA 3A1YG 2IBKA 4GC7A 4YR0A 3PX0A 1YJNS 4DL3A 2K8GA 2VG6A 3BN7A 3TANA 2RJZA 3NWGA 2AP6A 4L72B 1FNMA 2MZQA 2PMHA 4LUBA 2FC9A 3GG1A 2V8HA 4K5RA 2WONB 3CCLS 1MU2B 2KDOA 1YGYA 3PDNA 3MM9A 2BV3A 4A8QA 1KSPA 4B3RF 1JLCA 4IO9Q 2HNDA 3MGJA 1E6VB 2PA8D 4MIBA 2N3OA 5KT2A 4ZA1A