3EX7B

The crystal structure of ejc in its transition state
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
94
structure length
94
Chain Sequence
b'PGPQRSVEGWILFVTGVHEEATEEDIHDKFAEYGEIKNIHLNLDRRTGYLKGYTLVEYETYKEAQAAMEGLNGQDLMGQPISVDWCFVRGPPKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein mago nashi homolog
publication title Mechanism of ATP turnover inhibition in the EJC
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/rna binding protein/rna
total genus 18
structure length 94
sequence length 94
chains with identical sequence G
ec nomenclature
pdb deposition date 2008-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3ex7B00
1XN9A 3CC4S 2M4MA 2MKHA 2KN4A 4QU6A 2OTJS 3BEGB 2SXLA 4LIRA 5D77A 2YH1A 2OTLS 3LQVA 1R8HA 1HD0A 5GAHU 1X4DA 2DH9A 1YJWS 2CPHA 2HZCA 3CCLS 5LJ3Y 3J7ZT 3L3CA 1WTBA 1VQ5S 3CCRS 3PIPQ 1VQNS 4UY8T 3Q2TC 5LSLA 5GMKa 3G8TA 2DNZA 2DGUA 3FEXB 2DHAA 1ZH5A 3MI7X 2HGNA 3N9UC 3BO4A 2N7CA 1WHWA 1VC6A 4F26A 1W2BR 5BJRA 1M5OC 2AYBA 3IWNC 2HYIB 1N8RT 3TP2A 2KG1A 2J0QD 2CPJA 2PE8A 3VAKA 1VQ6S 4M5DB 3U1LA 1VBYA 1M1KT 2EK6A 3P5TL 4FXVA 3CMES 2LA4A 2DB1A 3EX7B 3UCZP 4BS2A 3CD6S 3ZZZA 2ERRA 2MZJA 3G4SS 2KRBA 2M88A 2X1AA 1HD1A 1D9AA 4CH1A 2KM8B 1OIAA 4YB1P 1OWXA 2VODA 2K3KA 4UQTA 3EGZA 3R1LA 2CQ2A 2XNQA 2DGWA 2DHSA 3S01A 5HL7Q 1Q82T 1S79A 1YTYA 5DDRC 1N54B 4IO9Q 1L3KA 1JJ2R 2DNMA 2XSFA 5DDOC 1YHQS 2MJUA 4LJMA 3U1MA 1H6KX 3THPA 3MUTP 1QVGR 3LPYA 3CUNA 2MKSA 2NZ4A 1HL6A 5H1SV 1M5KC 1WI6A 1WI8A 1X4CA 1FO1A 1X4FA 1YIJS 1FJCA 2E44A 1H2VZ 1X5PA 4U67Q 1S72S 2G4BA 1URNA 3G6ES 2RRBA 2CQIA 1KQSR 2B0GA 1U1PA 1VQ4S 4IUFA 5DM6Q 1PO6A 3S6EA 1UFWA 2WBRA 4OZ0A 1VQ7S 2X1FA 2DNQA 5JVGQ 3CXCR 2AYEA 3SDEB 5FJ4A 3SXLA 3TO8A 2AD9A 2MY8A 2CPIA 5GAEU 1JJHA 2ZJQQ 3BO3A 2FY1A 1U1QA 1CVJA 2V94A 2E5JA 2M2BA 2DNLA 2J0SD 3SDEA 3D2WA 2DH8A 1RK8A 4J5OA 1UP1A 3OW2R 1X4AA 2BZ2A 2M8DB 5MLCV 3Q2SC 1UAWA 4QQBA 3EGNA 3MD3A 2LKZA 1WF2A 2MY7A 2RQ4A 2DGTA 2RT3A 3IRWP 1JMTA 2CPDA 1WG5A 4Y0FA 4TU9A 2LEAA 2MZ1A 1FJ7A 2MGZB 3P49B 2JWNA 2QEXS 1VQOS 3NNAA 1YWXA 1AUDA 2CPFA 2DO0A 1U1KA 1WHVA 2MKJA 2KXNB 1DRZA 4WFAQ 2CQ3A 4C4WA 2OJ3A 1WEYA 2X1GA 4V19X 2MZQA 2KYXA 1H2UX 1VBXA 1VQPS 2MQPA 3CCSS 2MGZA 2XS5A 2FPHX 2JVOA 2Q79A 2LECA 3NS5A 1IQTA 4FXWA 2CQBA 2EVZA 2XS7A 2LCWA 3US5A 5GVQA 5JVHQ 3NMRA 2CQ4A 2EK1A 1OO0B 2FC9A 4CQ1A 4LMZA 2MSSA 1K73T 5ITHA 1G2EA 2QA4S 2DH7A 2ZJRQ 1U2FA 2CPXA 3R1HA 3ZZYA 4IOAQ 1SJQA 2G0CA 3CF5Q 2CQHA 2FC8A 2MYFA 3UWTA 1K8AT 3I56S 1VQLS 3G71S 2DHGA 2M9KA 3MUVP 1VQ8S 2DNNA 2MQOA 4QU7A 3CULA 3K0JA 2DNOA 2KHCA 1SJ4P 2X1BA 4OZ1A 1SXLA 2CQPA 1BY9A 3P3DA 1U1NA 3VALA 1VQ9S 2DHXA 2MPUA 3R27A 1P1TA 4F25A 4YUDA 1M5VC 3I55S 1WG1A 1VC5A 3S8SA 2XB2D 2DNPA 1X0FA 2DIVA 1R8PA 2N3LA 3NNCA 4Z2XA 5GADU 3UD4P 1NO8A 5CXTA 1RKJA 2MQQA 1WF0A 1B7FA 2M0GB 5DDQC 4TU8A 4WKRA 1KOOA 2LXIA 2YKAA 3DXBA 1O0PA 3HI9A 3BO2A 2VONA 1U1MA 2DGOA 2DGQA 2KM8C 5LXYA 4EGLA 1WELA 1M5PC 3S7RA 1F9FA 2F9DA 4IOCQ 1NU4A 5DETA 2DGSA 2MXYA 3FEYB 2CPEA 2M8HA 4ZKAA 5LJ5Y 3VAMA 1SJFA 5D78A 4CH0S 2LMIA 3MDFA 3VAIA 3CC7S 3RW6A 2MQLA 2D3OR 2E5GA 2D9OA 3H2UB 3MUMP 2CQCA 2MZRA 2U2FA 3VAJA 3CCMS 4P6QA 2YH0A 1X5OA 5IM0B 1VQKS 2MB0B 2M52A 5GAGU 2CPYA 2DK2A 2JVRA 3CCES 4ED5A 2U1AA 1X4GA 2PEHA 2KU7A 1KC8T 1JJ4A 2XS2A 2FHOB 2VOOA 3JB9k 1D8ZA 3NS6A 2ADCA 2RVJA 5CYJA 2DNKA 1KOHA 1N52B 5IM0A 5DDPC 1H2TZ 1YITS 3MD1A 2N3OA 2AYGA 1DBDA 4WFNQ 2KVIA 1VQMS 2DNGA 2GHPA 4WIIA 3V4MA 3MURP 2RUGA 1WG4A 2J76E 3UCUP 3RW7A 3CMAS 3CCQS 1FXLA 3MOJB 2YWKA 3TYTA 2KH9A 2F3JA 2LQ5A 2RNEA 2JRSA 2MQNA 4QPTA 3G8SA 2DNYA 2LYVA 2MKCA 1PGZA 2M70A 4ERDA 1Q81T 4TLQA 2DIUA 3VAGA 4F02A 2MZTA 2OSRA 1WEXA 4WF9Q 1SJ3P 2OSQA 2L41A 2ZJPQ 2KXHA 1WWHA 2RS8A 3B4DA 2CQ1A 2NLWA 4Y00A 2OIHA 2LXUA 2KRRA 4W90B 1ZZNA 2CPZA 1A9NB 2RRAA 2RS2A 4A8XA 2KG0A 1A7GE 2HGMA 3VAFA 2MZSA 3HHNB 2L08A 2KFYA 1HA1A 2MJNA 5LSOA 3G9CA 1Q7YT 4PKDB 5LXRA 2N82B 2D9PA 3CCUS 2HGLA 4CIOA 2CQGA 1X4BA 3P6YC 1KD1T 3CCVS 1YI2S 2YTCA 2ADBA 3NNHA 2M7SA 2QFJA 1UW4A 1X5SA 3UD3P 1FHTA 4C0OC 4PRFA 1FJEB 3G96A 3CCJS 2A3JA 1M90T 5DM7Q 2JX2A 4YOEA 3CC2S 1WHXA 2GO9A 2E5IA 2K8GA 2RQCA 3DLLQ 3UE2A 2MSTA 3H2VE 1FT8A 2CJKA 2HVZA 1X5TA 1K9MT 2G1DA 2XNRA 1U1RA 1U6BA 2F9JA 1QVFR 1WHYA 2DO4A 2KI2A 4RU2A 4WCEQ 5EN1A 1N88A 3CPWR 2DITA 1WEZA 2J8AA 2MKIA 3UCGA 5HO4A 4C7QA 4WFBQ 1P27B 4W92B 2I2YA 2DNHA 2KT5A 1DHMA 3J7YU 1NJIT 1U6FA 2DGVA 3MXHP 2RU3A 1X4HA 1OPIA 2DNRA 3B4MA 2BOPA 3BS9A 3ULHA 3CTRA 1YJNS 5IQQA 1YJ9S 3VAHA 2LA6A 2CQ0A 3SMZA 2MHNA 2MQMA 4TU7A 2VOPA 1Q86T 2LEBA 2DISA 1U1LA 2MKKA 1FNXH 2AYMA 2DGXA 5IFMA 1SJRA 2UP1A 2E5HA 1QM9A 1ZZFA 4PR6A 3PIOQ 3THTA 1DZ5A 2MMYA 1U1OA 1WF1A 3VF0B 2KXFA 1VC0A 1X4EA 2L9WA 1VBZA 2I38A 2CQDA 2O3DA 5CA5A
chains in the Genus database with same CATH superfamily
2PFDA 3QZ7A 1ZM9A 4C11B 3D67A 2FJEB 1ZTTA 2ZHBA 4WXOA 3MPYA 2AJQA 1YJWS 2E9RX 3OJSA 3FBCA 2VBXA 3BBFA 4RNHA 3G8TA 1VRUA 2J6TA 4DWIA 4DV5F 1VHIA 1LNQA 1I1GA 3DU5A 3E01B 2KG1A 3HO1A 3GYNA 1VQSA 2DR6A 2QFIA 4FXVA 2APOA 3AT1B 5JUMA 2W4DA 2R7VA 3R5BA 3POTA 1GQEA 4TY9A 1S0VA 4B9MA 4FDFA 2DXFA 3CDAA 4RUHA 2XNQA 1S9FA 3GCWP 2COLA 2XMVA 5DDOC 3L4BC 2AIRB 4LF6F 1QVGR 1F9EB 2Z8QA 1BGXT 1SB6A 3T1HF 2V34A 2VL1A 2E44A 2V69A 3KJNB 4HDHA 3OD2A 3M30A 3RR7A 4F7VA 4DV1J 1HWUA 2UVRA 2ZM6F 2KT2A 3EMTA 3GTYX 3AQPA 2LXFA 2UUBF 2W2MP 1RT5A 1RP5A 1QUPA 1FKPA 5FJ4A 1XR6A 1Y5IB 4DX6A 4ZK7M 4CYUA 3OXFA 1AFIA 4RX6A 2ZH1A 5KFDA 1VBKA 3K2YA 2H51B 3DLBA 1UP1A 1M1GA 2NXCA 3AHPA 3RGIA 4XPCA 2YKNA 4QQBA 3CWJA 2V4JA 1JMTA 2VKRA 3ZNJ1 1P8GA 4K4TA 3AQOA 3IAS9 1VQOS 1NJYA 1N36F 4FKYA 2MKJA 2HHWA 4C4WA 1H2UX 2MQPA 4CM0A 5LMNF 2E9ZA 3V4IB 4DR7F 3OXGA 2XS7A 3EGWB 4JI5J 5HSPA 5F8NA 3NMRA 3M4XA 1Q5VA 2HQDA 5I42B 1O5JA 3SEOA 3M1VA 2RILA 2VQFF 2ZKUA 2VG6B 2NREA 3PJXA 4WFZA 3M6XA 1Q8KA 2QRRA 2HZAA 1VJQA 4UW2A 3DDIA 4F25A 4YUDA 3I55S 4YY3F 3MFIA 2DNPA 2DXDA 1YKWA 3NNCA 1BMQB 2MQQA 2ZZMA 1HBOB 1U0SA 4MJKA 1YZ7A 1KOOA 2K7KA 3PCOB 3HMJG 2VONA 5BR8J 2DGQA 2F9DA 5DETA 4ZVRB 2EI5A 4LF7F 2E5GA 1U6ZA 5D3GA 4B9TA 2M52A 1TMJA 2IYIA 2KU7A 4DFJA 2HBZB 4M8LA 2ZH5A 2EFPA 4O4GA 4LF8J 3IR5B 3UQSA 2GHPA 4NRTA 4KPCA 1AROP 3MM6B 3OL7A 2HFUA 5AE3A 3HULA 3TQ1A 2F3JA 3ILJA 3KLFB 2DR8A 4AL7A 1RAAB 1Q81T 3QAUA 2DIUA 1HW8A 4WU3A 1SUQB 4LQ9A 2Y8WA 3Q89A 4P7VA 2CJYB 3PYEA 1T05A 1PBAA 2NCKL 3EVWA 4MK9A 2BUNA 5HI7A 5AJ3F 2E1RA 3OUYA 4NLUA 2N82B 4QIGA 3LW5C 4KFBB 2QL9B 4J9MA 2J6SA 1F60B 3MM8A 4Z7CA 4RW8B 1ZETA 3OFFA 2F7VA 2LQ8A 3CC2S 4G1QB 1QY7A 2RQCA 3DLGB 1MU2A 2D3ZA 4PXDA 3UI3A 1GX5A 2RF2A 4PG7A 1RTJB 2J8AA 3PX4A 3C3LA 1T94A 3CD7A 4WFBQ 4HKQA 1FTCA 2DY9A 2GIFA 3MEGB 4DOZA 3A8IA 3D0HE 4UUWA 3RTVA 1IKWB 1Q5YA 5A8RA 3GWCA 3O44A 3BYPA 4X65F 1FE0A 3ETMA 4K8RA 2AYMA 1SH0A 1HI0P 2EFGA 2E5HA 5AE1A 3PNIA 4OLPA 2XY5A 4KYZA 2W8KA 4LSLA 1X4EA 3N79A 4TNOA 4DV6J 4B9SA 3K57A 1BE4A 2WCXA 2OTLS 3LQVA 4YMEA 5GAHU 5EDWA 4MIBA 2ASLA 2CPHA 3I5CA 1FWPA 1LK5A 5ETRA 3PIPQ 4KO0B 3Q2TC 5LMUF 3KUEA 2DHAA 1FX4A 1JLCB 1T3NA 1I6JA 3DRXA 1QE1A 1RXOB 3ITHA 1KKHA 2CPJA 3ZTQA 1AZSB 3L9ZA 2Y8YA 5DQIA 1MMNA 4F4AA 2FJWA 3DN9A 4LFAJ 4RNFA 1GT8A 3J81j 6FDRA 2ZC4A 1WJ9A 4EU0A 1VS3A 1FJGF 4PXBA 4O3OA 5T41A 2CXEA 1J2VA 2XYPB 3TA1A 1S6OA 1JLEB 4LJMA 1TAQA 4I68A 4DG1A 1X4FA 3QT5A 1D1UA 5KFHA 1NK9A 5LSRA 4L3NA 3OLBA 2CQIA 2Z2LA 1SL1A 4O23A 1U1PA 1LW2B 2WW4A 2HMIA 4Y6IA 1W2IA 5DS7A 2WW8A 1PYSB 2FHMA 3R7BB 2C2KB 1SQFA 4NLOA 4UOHA 1S99A 3MEEA 2WSCC 5HMYA 4C8OA 4U7CA 3PZPA 1LW0B 3LP2B 4I1TA 4I2PB 1XNQF 2V8HA 2OPRB 2Z2MA 4LFCF 3JS9A 5FD1A 3BH7B 4DV3J 4DDFA 1AUDA 1U8SA 3OSPA 4IRKA 1RAIB 3E2EA 3G8QA 2X1GA 2MZQA 3ETOA 2RHQB 1H98A 1HNIB 1H74A 4TLRA 4XDDA 4BDPA 4ICLB 2A10A 2KDOA 3IXQA 1ACMB 1WKLA 5DG8A 3AD8C 4FYDA 2MYFA 4IG0B 3MFHA 2VIHA 2QMXA 4I0WA 1RZMA 2CAJA 2DNOA 4GO7X 4CLZA 2PEBA 2BANA 1FNMA 4IQMA 5T14A 3HVRA 2R2TA 3UDVA 5KG4A 4Q0BB 1RWPB 3NGTA 3OL9A 1F2HA 3M2UA 2HFSA 1RT7B 3B8HA 2DGOA 1UFKA 1J5EJ 4X64F 1M5PC 2EEYA 5FLXU 3Q23A 2AGQA 1UWAA 4JYAF 3KLVA 4NZ6A 2U1AA 2O67A 5A0YB 4IKAA 3GR1A 2VOOA 4ECQA 1IKYB 2O1PA 2KVIA 2FJAB 5KT5A 2GO8A 3CMAS 4FBTA 1IXKA 2AW0A 2KH9A 1HWIA 1DAXA 2PMZD 2KJWA 3ZC4A 4L73A 1Y3KA 2VFRA 5B08A 2BXJA 4FS1A 1RI7A 4C9DA 1SJ1A 1FRIA 3BQ2A 2C2ZB 4B3TF 2AWZA 2HGMA 2HWHA 1HA1A 4I2QA 2FJXA 4NA2A 5LXRA 1S76D 2XM3A 4JV0A 3CCUS 1EAYC 1RTHA 3HZEA 1WC6A 1X4BA 4ZPTR 1S9EB 8RUCA 4MH8A 2OPSB 2ZE2A 3ZZRA 2QLFB 4M63A 1U4BA 3QSIA 3G96A 4RR5A 1TUWA 1TL5A 4K0KF 1B7YB 1BQNB 5HANA 4FF4A 3OL6A 3H2VE 4P7TA 1K9MT 1R0BG 2IC3B 3FUYA 3IRXB 5GAHI 1EKRA 4UY85 1HQUB 1IBCB 2MQ8A 2OUGA 1VRTA 1Y10A 2QE5A 1UVJA 3IBCB 3B4MA 3GV5B 3W3SA 2ZH9A 3SQGB 1RWUA 1WDDA 1EETA 1NBEB 3SMZA 3H42A 3Q22A 3PR5B 3QT6A 5F8LA 2V2VA 3SV4A 3RJMB 5K9FA 5DZ6A 4DPOA 2W9BA 1N6QA 3PM9A 1KHVA 4PR6A 1L3TA 3H5SA 3PIOQ 2ILZA 3THTA 5D4NA 2YPZA 2DRDA 3EXCX 3ILLA 1CS4B 5CA5A 3OXLA 2OP5A 2OTJS 4RJVA 1F1BB 3CCLS 1HHQA 5LJ3Y 5L1IA 4ENOA 2HNDB 3CCRS 3DM2A 2OH2A 2WOMA 3R5GA 5HN0A 4UT4A 4EBEA 3N9UC 3EVOA 3T6JA 2HHTA 4Y2KA 4TYAA 4FVCA 4U9RA 2PFFB 1M1KT 3E51A 2B4OA 3Q8QB 1HBMB 1Z2ZA 2KRBA 2QLJB 1DLOA 3OTDA 3UVJB 1D9FA 5KAKA 4ZDNA 2H4YB 3H5XA 4NZ0A 2F4FA 3QIPA 2DNMA 1XIQA 2AKWB 4USHA 3LGHA 3MAQA 1RWVB 3CUNA 3DU6A 2NZ4A 1HL6A 1NK5A 4LRAA 1JKHA 1NAQA 5KFPA 1R43A 4GKKJ 2ZZTA 3UDLA 3W1YC 4DL4A 3L95X 1PCAA 5K8NA 1RT4B 4CM2A 1VQ7S 2RDDA 4AYBD 2BQUA 2FJBB 1MROB 2ROPA 2DH8A 3VR1A 1HPZB 1X4AA 4QWCA 4Q43A 3CVKA 3NMAA 3C15B 2OHDA 1NJWA 3K8VA 2MY7A 3N5BA 2HPUA 3QSYB 4NCAA 2B6AA 2W25A 5BR8F 1B64A 1N32F 5F0UA 4Y0FA 2B5JA 3W7BA 1LKZA 4DF8A 3NLCA 2VQEJ 3NNAA 2R4FA 2L9DA 3IFEA 4YB6A 1X9SA 2UUAJ 2AT1B 3OR1B 1JX4A 2Q79A 4KHPF 3JQKA 2V8PA 3I87A 2LEPA 1C1CA 2B4VA 1Y11A 4LF8F 4MK7A 5ITHA 3AFGA 3MTJA 5F41A 1NHKL 3PR4A 1NDKA 2BMBA 1RTDA 2FC8A 5RUBA 3UWTA 2GQCA 3WC2A 5M2PA 3T9ZA 2RD5C 3R27A 3BPDA 1P1TA 2V6AA 1GMVA 2DEJA 1GMUA 4GVBA 2F4VF 3CDUA 3ISNC 1G1XA 5CXTA 2R2RA 1B7FA 4WKRA 2WZ1A 1N33J 3HHLC 4QYRA 3CT9A 3DOKB 4JI8J 4OX6A 2ZH6A 1S6PA 3C14B 4URQU 2FGOA 2CPYA 4I6WA 2YX4A 1HR0J 2RB7A 3JAMU 4F0MA 1N48A 3NS6A 3DRRA 3QRRA 2R7XA 4C97A 1N34F 1WOPA 2HIQA 2HFNA 3A1YG 5B0EA 2GS8A 3OLAA 4QPTA 3G8SA 3RAXA 2YNFB 1RGVA 3MAHA 3RAQA 4MK8A 1RWWB 2PA3A 2CJQA 3HSZA 3K17A 2BQRA 3PV8A 3KLIB 5JJBA 1YK9A 3VZIA 5K8MA 5L1JA 2AZ1A 2ZBIA 5LOQA 4TQRA 4DZ6A 4CZCA 4W98A 1NJZA 1Q7YT 3E8OA 3PW7A 4FF1A 4CIOA 2CNLB 3VGVA 2XLIA 1S49A 3LGMA 5J2PB 3HPOA 1M90T 2IRXA 4YOEA 1TKZB 3QGIA 2XYHB 1R3NA 2GO9A 1B3TA 2ZBQA 3DLLQ 1S6QA 1P9QC 4RW4A 3IC1A 1FT8A 3Q8VA 1GMWA 1TZ0A 2Z2ZA 2CJBA 1PAEX 3IG1A 3J7Z5 2WONB 3MM9A 1S5ZA 1WEZA 3R5CA 4OJ1A 1GK8A 2MTLA 4N7TA 3W8GA 1ZM4A 4CO5A 4MFBB 4X62F 5I3UA 1DHMA 2CADA 5J2QB 4YFUA 2BVZA 1IVZA 5A8WB 2RH3A 3QFHA 4EFAC 2RAQA 4ZITA 1LFWA 1YGYA 1TL1A 2C22A 4P75A 3UDCA 2ZWOA 2KXFA 2GMLA 3F73A 2O3DA 1X31C 2FYXA 1NM2A 5B0BA 4C8LA 2MKHA 4QU6A 5KFUA 5C25A 4IRDA 1VRUB 3BQ0A 1IBKF 4QIFA 3W9HA 1H3DA 3ILIA 4C6AA 2CWKA 4D3GA 1NNDA 1VQNS 3DKDA 1HQEA 1NPRA 5D0EA 2AMCB 3SCLE 3IBWA 3QO9A 2ASYA 2V2ZA 3POTB 4DLGA 3MPWA 3GYXB 5HMZA 3L7UA 2EBGA 5EWGA 1SVDA 1WDTA 4KPYA 1B4SA 3DOMA 2MZJA 1S6UA 3GG1A 4PABA 1RWXB 2W9AA 3CJTA 4OV1A 1AW0A 1V3SA 4NLTA 4DV3F 3TJ9A 2BKPA 2RKIA 2HRYA 1H6KX 2MKSA 3DGPB 5HQ8A 4DBQA 1Q16B 4PG4A 1ROFA 4HHUA 1FKPB 4PXCA 5ETPA 1R31A 4CYUB 2QMUB 4TY8A 4A8SA 4I7FA 3WZ0A 4WP8A 1BUXA 2AEFA 4P10A 1MWYA 1SIZA 3SXLA 2R7WA 1S7HA 3GFZA 2ZJQQ 1IKVA 2VICA 2VG7A 1Q8BA 4UF4A 2ZNZA 3HSGA 2DNLA 3SDEA 2V4JB 3TUZC 1NSQA 3MGJA 2JZ5A 5KOWA 1NB2A 2NXNA 2XULA 2WVFA 3W2VA 2G2YA 2Q6BA 1WF2A 5AXMA 2RQ4A 1IR0A 3ZXWA 1WG5A 1FRMA 1FJ7A 1WHVA 3AA8A 1NKEA 2KXNB 2BX6A 1S10A 2FTRA 1WEYA 3FZBA 5J1PA 4E8UA 2LLZA 1IBLJ 1S4FA 1KFSA 4ZVFA 3Q86A 4LMZA 5D4OA 3GE9A 3G82B 1RHRB 4J9PA 3PO5A 5HJYA 5AXLA 2W24A 5KT7A 4ED8A 2DNNA 3BBBA 4OZ1A 5L1KA 5KFGA 1UPMB 2BDPA 1S1WA 2N3LA 1XEZA 4DEZA 2A1BA 5D3GB 1XTZA 2YNIA 4N41A 4OX9J 2I0XA 3VAMA 4QR0A 2CPEA 3EPIA 3CD5A 3L7PA 3TAMA 1TVRB 4O4GB 2QL5B 4P6QA 4ED5A 3BBCA 2HQ3A 1IWGA 4LF9F 4LVOP 5LM7E 3OQ2A 4MIWA 2EBEA 3W5ZA 3ISND 2N4DA 5IM0A 4RUCA 4BC9A 1ZS6A 2G13A 3MURP 1Y3JA 4EO6A 2XBPA 3CO0P 2ZH3A 3PX0A 2RNEA 1T05B 4RNMA 1YRXA 2XLJA 3D1OA 4WF9Q 4JI4J 4KB7A 5BYQA 4Y00A 2QA1A 2FHJA 1VIXA 3OUYB 2JOQA 3VV2B 4RW7A 1JLAA 1Q1KA 1Z4UA 3PRBA 4ZLNA 3MM8B 2R8GA 2HFZA 2ZOGA 3DYAA 2C2EA 4RBUA 3MCNA 3O5TB 4C3KA 4JI3J 3KYLA 4OHWA 4MAKA 2QFJA 4FBUA 1MU2B 3OTOF 2XI2A 3BGLA 5AXKA 2RF2B 3C46A 1RT1A 6FD1A 1FRLA 1IJFB 2DO4A 2D3O1 4Y2AA 4XK8C 2BYCA 2V2QA 1K1SA 4YR2A 5A8RB 2I2YA 2DNHA 3KDNA 1YSJA 2BA9A 3SSQA 5DGBA 2GVDA 3MXHP 4USUA 1GTHA 4DV2J 4K4VA 1YJ9S 1TELA 2CQ0A 5HMWA 2XHCA 2B9EA 3KUGA 4LSLB 1VFJA 4G6VB 4ZPDA 2B4UA 4JI1J 5GMEA 2XO7A 1KFDA 3T5JA 4J9OA 2MMYA 3D7SB 2B7CB 1S77D 3ET6A 5KTQA 4BCAA 1I94J 2FLPA 3CJSA 3UN5A 4GKKF 3PX6A 4LIRA 5HVGA 3M05A 1HWLA 3RBZA 3JXOA 1QE1B 3ITHB 5J1NA 3KHGA 4U95A 4B3SJ 2ACMA 3NY0A 4F8RA 1LWFA 4RNOA 1PSDA 1N8RT 3TP2A 2ZOMA 5KFZA 2PE8A 3VAKA 5C5JA 1RABB 4OYXA 1FTRA 1NEEA 4ECZA 3NKYA 2DB1A 2W4CA 3T5KA 3FBEA 1R8AA 1OY9A 5D0HA 2F8MA 2N4CA 4JI2F 2BR0A 2AP6A 4ZJLA 1GX6A 2XCPA 2UVWA 1TFWA 2UU9F 5B0DA 1KQKA 3G2XA 5DDRC 4DG1B 3OSNA 4K7QA 2NXUA 2IDEA 5D0GA 3MHYA 4GKJF 4RLEA 3U1NA 4WTOB 1WI6A 1FRXA 4PWUA 3HHKA 2HMIB 2QMWA 1IN0A 2HS4A 4FPIA 1VYAA 5F8HA 2QZ8A 4OV6A 3TZZA 1RYRA 2XYGB 1UFWA 2WBRA 3MEEB 3LALA 1C2PA 3EXYA 1NMEB 4M5MA 1ELOA 1SBRA 2XMMA 1C0UA 1HNXF 4PWDA 2J0SD 4JI0J 3TZYA 4CP5A 1XERA 4Y3CA 3FCWA 4MKYA 3VQSA 2R7TA 2GQQA 1N33F 3DI6A 4V1Ak 2ZH8A 4ZVTB 3ENQA 1M5SA 2CFXA 1DRZA 4WFAQ 4TQSA 3TARA 3D0GE 2J9CA 2Y1RI 4ID8A 1KVJA 2R8IA 3CJ4A 3KLFA 1UEUA 4PAAA 1HR0F 2GFFA 4N8NA 3IWLA 3BDPA 5JVHQ 5IT4A 3ELHA 5HJXA 3W66A 2BANB 3R1HA 2I9SA 4WBFA 1F3VA 3N01A 3K0JA 2JL9A 3D6HB 3HT3A 2V4QA 2VV5A 1S48A 4DUYJ 2P9GA 3KG4A 1N5QA 2HFOA 4K5SA 5KT4A 2IM2A 4ELUA 3R97A 2BM0A 1BXNA 2W7AA 3TVYA 2IFXA 2VPZB 5K8OA 4F2RA 1PC4A 2AJFE 5DDQC 4JI6F 4F0HA 1WD6A 3DDNA 3I5AA 1XBWA 5LXYA 2R9LA 5I3QA 1KTQA 4B9LA 2RIJA 4IH6A 2M8HA 2UXDJ 3FZ2A 1TFYA 4YN3B 5E41A 2HQGA 1JQGA 3NWRA 1VQKS 2Z56B 4A8YA 4ILMA 1HLWA 2YWHA 5DZ7A 1LWEA 2W2NP 4MIAA 4DR1J 2HWTA 3BDEA 1IR1A 3EJMA 1O8BA 4NLGA 2XMKA 1FXLA 3H5YA 2BEFA 4DR4F 2BE2A 2MQNA 1ZYQA 2MKCA 3QQCD 2M70A 4TLQA 3EUNA 2OSRA 3DOLA 1OY8A 3MEDA 3NL0A 4CLFA 4FXDA 2CQ1A 4I2QB 3V2UC 1ICEB 2LXUA 4K4UA 1RCOB 1TUGB 3CCZA 2QA4G 1PILA 4ANEA 4OZ5A 4DCJB 5GAGI 3FMBA 4EO8A 2GMHA 5HQMA 1YJRA 2ZE2B 4HI1A 3D3BJ 4ED1A 2GHVC 5K8PA 5KFCA 3BGRA 1JLCA 1N5SA 1KD1T 2YXLA 4FN5A 2A2DA 5CYQA 3BSAA 3ZZPA 2A3JA 2CWXA 3CO9A 3KJVB 4J9NA 2QIFA 1U6BA 4RU2A 1WORA 1VRTB 1R8BA 2ZH7A 2GA7A 2ZC3A 3B6BA 1B70B 2J7UA 2RHSB 1U6FA 5M2RA 2W9BB 1TL3A 1N6QB 1RACB 4LREA 4Z7YA 2YNGA 1LXJA 2UP1A 2DRBA 2MDAA 3A3PB 3M8ZA 2RE1A 4QR1A 3VGUA 4B3OA 1KNZA 3HM9A 3DM2B 1LV5A 1WTFA 2WOMB 1HNZJ 5KFAA 3RG6A 2C3MA 4R25A 1I5OB 3LWMA 4DX8H 4DUZF 3VGSA 2ZDPA 1LW0A 2DNZA 4YB7A 3R6GB 3KUHA 4KQZA 2PGCA 1DLOB 3I0RB 4DSEA 4ZIWA 2WK4A 3SSSA 3BKFA 8ATCB 3G4SS 1FK9A 3QIPB 1HNIA 3M2VA 4YB1P 2WVCA 4S0MA 5EX0A 3CJ2A 3D66A 3EGZA 5HL7Q 1NH8A 2XMJA 2QJ3A 3HHLA 1OY6A 1RWOB 2FQQB 2GW8A 3K5OA 5C2CA 1I3OB 4ES2A 2JLFA 3MCOA 1WNEA 1K1QA 1RAJA 2VC0A 2RMLA 3RB6A 2VF3A 2OLWA 2G4BA 1W26A 5IT9Y 2L9NA 1M0SA 2VG5B 1H7WA 4EYHB 2IHR1 3M7VA 3JTOA 2Y1IA 3MR7A 1F5CA 4NEYA 4DU7A 3CXCR 1RT7A 3K5LA 2IJRA 3C2PA 2FLLA 5SUHA 4DPYA 3GJRB 4OMFG 4I4BA 3OVBA 4ZHRA 2BM1A 4F2SA 2YWFA 3ILOA 4I56A 3D2WA 2B5JB 3OT9A 4HHHA 5E7OB 1HMVA 1JNRB 2BJ9A 4B9NA 4O44A 1KP6A 4QW8A 1DTQA 2VA2A 3CJQA 2CPFA 4L3KA 1C1CB 2OJ3A 4CO4A 2G1HA 4V19X 1FNOA 1H0HB 3L09A 1U8WA 4K2XA 1RTDB 1NZ8A 5IT9U 4K4WA 4M5GA 3MR6A 2QA4S 5EWEA 1VJWA 2E9TA 4NLWA 3CF5Q 1YBUA 3LWLA 3G86A 3MUVP 3IA0A 2DR9A 2LVWA 4LBHA 3GIJA 2EG1A 2CQPA 1HFEL 4ZVPB 2VPWB 4CRJA 2A6MA 3DHXA 4N77A 3DRPA 3SFGA 1S6PB 2LXIA 4FZVA 2KM8C 2HEKA 2KB2A 4CLYA 4I67A 1SL2A 2HRUA 2IC3A 1U0HA 3ENAA 1TR0A 1Q8LA 4G1PA 1RU2A 2V67A 3TNVA 3DRRB 4WFXA 2V9WA 3LP1A 1KLMB 3C6UA 3H90A 3D28A 4O4RA 2XY6A 5DJBA 2HFVA 4CI0B 1G4CA 3BJYA 5KG2A 3FGVA 3F41A 1IBMF 3CGIA 1N52B 2AYGA 1H2TZ 5ETSA 3OR2A 3SQGA 1VQMS 2PN6A 1WG4A 4LF5F 2E1CA 3FSYA 4DCPB 2JRSA 1MMLA 1GAOA 2LYVA 4ERDA 5B0FA 1GNKA 1RAGB 3KHHA 1YG0A 2CUYA 4F02A 4FYWB 4EYIB 2ZH2A 2XMTA 5KFQA 3UFCX 2NLWA 2EW9A 5ETQA 1VK3A 4W90B 2QL7B 4L75A 4PQUB 2HAIA 4A47A 1PJ5A 2WVDA 3KKFA 3Q8RB 4BHQA 4X4RA 3W5YA 4IQXA 2NQPA 1O6XA 4P9SA 3A13A 5IQ6A 2IRUA 3O2IA 5KG7A 5F8MA 3C19A 4OQJA 3P6YC 2B51A 2UXBF 1C4CA 1WSVA 1S6QB 4RW4B 3CCTA 1UW4A 1X5SA 3CMQA 1KRPA 3IG1B 1E6YA 4OYOA 3PY8A 3MM9B 2EG2A 2V2KA 4USKA 2CJKA 2XNRA 2C3YA 1U1RA 2KI2A 5I3UB 2HHUA 1FA0A 3CPWR 2GIQA 4NCBA 4B3SF 4M5IA 4CO3A 1XMBA 1CC8A 1QUVA 4I64A 4GO5X 4PXEA 1FEEA 1TL1B 3H4BA 4DV0J 3BF4A 1YJTA 1ZOTA 4RL1A 3DXSX 3H98A 1CJTA 3VVTA 4R0EA 4OHYA 4BC7A 5C25B 1U1OA 1WF1A 5IWAJ 2WRMA 2FVRA 1L3SA 5KFLA 3MM5A 2XSJB 1PYTA 3UN3A 2G0JA 4DN0A 3KG1A 4NXNF 3QO9B 1HPZA 2AGOA 1TKTA 4NX9A 4DUTA 3MI7X 3DOMB 1V9OA 4WYLA 4MMOA 1W2BR 2H5EA 2AYBA 3PACA 2VDHA 3HFKA 3I32A 3T1YF 3U1LA 2EK6A 4DR6F 1ZBTA 3TZXA 4DMZA 3OR1A 3BSCA 3QMQA 4JI0F 2CA9A 2RKIB 5IOLA 5E5NA 1M1HA 5KFVA 4R0JA 5B7WA 5D15A 2DGWA 3UO0A 2XLKA 2YQ0A 5ADZA 1T9YA 4AE5A 3TANA 1P6TA 3SZ2A 2E1MC 2NYIA 2IAJA 3D1QA 1N5TA 2QLBB 1F3FA 3UR0A 1M5KC 4OYPA 3GR0A 3C8YA 3GQCA 4TY8B 4I7FB 3GV8B 1PAUB 1KN6A 2CNOB 3CNQP 1SC4B 2B0GA 2OD6A 1UZHA 3M9NB 2VG7B 1UCNA 4PUOA 4DL3A 4KSEB 3AA9A 3SDEB 1YX2A 3W65A 3PG9A 3I9V9 2PO4A 4J90A 1PBUA 4LRFA 4DUYF 3W2VB 3QGPA 2GQ2A 4ID5A 4G3IA 1B99A 4J5OA 3O8WA 3U02A 3DLEB 3AJ1A 2LQJA 3N5FA 4FP9A 1HI1A 4ANDA 4RWXA 2DYAA 3BV8A 4AQYJ 1L3UA 4CH7A 3P49B 1U2RA 1F2GA 4JI7J 4ELTA 3CCSS 5F3TA 3CW2C 3HXMA 4LSZB 2O5DA 2NYHA 2D41A 4KGMA 4LBIA 3SSRA 1RWNB 3MAAA 3NCQA 4CQ1A 5C24A 4QBUA 1G2EA 2CPXA 3ZZYA 4L74A 1DQ8A 1K8AT 2BRLA 3H40A 2V9KA 2J7KA 3PTWA 4L76A 1VQ9S 3BYRA 2LP4A 4DR2F 2E7WA 3TUJC 4RBVA 2YNIB 1WC1A 1JXLA 5J2PA 1R8PA 4CO1A 4QPXA 3TAMB 3R5AA 1KLNA 2QSFA 4EGLA 4JV1A 5HROA 3QRPA 1CEZA 3VAIA 4NL5A 5KOXA 4ED7A 3WIVA 4B3MJ 4MYTA 3P96A 5IM0B 4Q5VA 3PJ9A 1RWKB 4F67A 1WKKA 2XMUA 3TX0A 1PYOB 4M5KA 4ZPAA 5A8KA 2ZD1A 2C3UA 4URSA 4HL9A 3MOJB 3CJ8A 4DZDA 2BOAA 3KK1A 4OYBA 3VWSA 3BQ1A 3ZTOA 1GTEA 1HHSA 1NZAA 4RW7B 4ZVHA 3T41A 1JLAB 1OQ6A 1SJ3P 2XMWA 2KXHA 3Q8YA 4DV7F 1SI9A 4U7UK 1VOMA 1X0PA 1P1LA 3DYAB 5AE2A 2CPZA 4B17A 3UPFA 3NWGA 3K5PA 1NK4A 3GPAA 1SL0A 2YPYA 2UUCJ 1WSRA 2IA0A 1YBAA 2E7VA 2PMWA 1JXEA 1UVLA 1RT1B 4C3MA 3FNNA 2OD4A 3M2RA 1HNZF 3TW0A 4OFZA 9ATCB 1V5VA 2E5LF 2JH3A 2GVDB 2NXEA 3J81Y 4A46A 1WACA 1Q0NA 3RZAA 2KT5A 4GC6A 2F40A 3HLUA 2Q6CA 4J91A 1RHKB 3P4UB 2EWHA 3FBFA 3O6QA 3DGPA 3VTIA 2CYYA 1FI4A 5KFOA 4O3SA 4J9UE 1Y00A 4CLLA 4IFYA 1KWMA 3ET6B 2QYGA 1Q79A 2HKEA 3EZOA 1IQZA 3VF0B 2Y1JA 2YQ1A 2CQDA 1H73A 3FJ2A 3CC4S 3CB4A 3EYZA 5DO2A 2SXLA 1T9WA 3A3OB 5D77A 2YH1A 1HD0A 1X4DA 2OPPB 5F9NA 1NRKA 2HZCA 2OEJA 4YEAA 3D68A 3TOQA 4QWEA 4A8MP 3M6UA 1LWFB 2WTFA 1BWVA 1XQIA 2IM1A 1RTIA 2Q1LA 1KVIA 3J81U 2FLOA 4BBYA 5BJRA 2W9CA 3KWMA 1YLXA 4OZ2A 1VQ6S 3MR3A 2OEMA 3ZZZA 2ERRA 4W4MA 2X1AA 1HD1A 3KNGA 1RLDA 5KFEA 1YDLA 3AJDA 2MLZA 2XEXA 2UZAA 3G82A 1RT2B 4CLWA 2MJUA 4OYMA 2VJUA 5EGYA 2AEMA 1HNVA 2YX7A 1IM4A 3QT8A 2PC6A 1FO1A 2R7QA 1JB0C 1VHFA 4OZNA 5GMDA 5EWFA 1CBKA 1GH8A 4OZJA 5HVFA 4WJBA 3MOZA 2RRBA 1KQSR 3FC9A 3IAM9 4ECYA 1XMOF 4IUFA 1C0UB 5DQHA 3SBMA 3TAPA 1H7XA 2DBBA 2E1PA 2DNQA 2FVQA 5EUHA 4PWDB 2W1BA 2V68A 4IH5A 3I0SA 2BJEA 4F4XA 2BJ1A 2DCUB 3TRGA 1JJHA 2FY1A 5DG9A 2B8PA 2M2BA 4P2FA 3BN7A 1TVRA 1PJ7A 3DI6B 3OVSA 2C28A 1RB0A 2P9CA 1UJ6A 3I4HX 2M8DB 3QWUA 2ALYB 2GAHC 3WX4A 4OIXA 2DGTA 1CPZA 2RT3A 4FNIA 4ECRA 3ADAC 3CJKA 1HARA 2FGCA 2YKQA 2HQFA 3WQPA 1CG2A 4NRUA 2CQ3A 3MCSA 4Q7AA 2MGZA 4LF4J 2VPXB 7FD1A 2EKNA 8AT1B 3V81A 4UZCA 3HHDA 2KT3A 2ZJRQ 4A8OA 1SJQA 4DR3J 4PG5A 4X4OA 3HD1A 3JYTA 3B78A 2ZFHA 4ITSA 2JSXA 4FPRA 4WE1A 5EX3A 3V6JA 5JXSA 1RJJA 3JSBA 5GADU 3Q8SB 3QNWB 4JV5F 2WVBA 2YKAA 3DXBA 3OFGA 1XK8A 3NCPA 4IOBA 1GXTA 3C66A 5D78A 2QT7A 4DV5J 2GC8A 2E66A 3LANA 1LWEB 4K59A 3MUMP 2CQCA 1CULA 3CCMS 2A6OA 4AT1B 3LUYA 3RBEA 2XG8A 4ELVA 1MWQA 3JB9k 3LA0A 1F9HA 1MWZA 3KG0A 4PWWA 2P8IA 2DNKA 4B9UA 2FVSA 2BE2B 1XJWB 2DNGA 3DOLB 3TYTA 5KFKA 4J7CA 2LQ5A 3MEDB 4UOFA 4ES1A 3FFIA 4HH1A 4N5SA 5IC6B 1DQAA 2IVMA 2JFDA 3T1HJ 1HIYA 2O01C 4XPEA 4J37A 4MYUA 5K14A 3BGRB 2J5AA 2ZM6J 2L08A 2KFYA 3J80Y 5CYQB 1V3RA 5C2GA 4YHHF 3LP0A 1RU1A 4ER8A 2R42A 2IDLA 2B8QA 2XWXA 5ETVA 3H59A 4RO0A 3H5UA 3FVYA 5DM7Q 4F36A 5IC4B 2GJIA 5ETKA 4KC5A 1B0TA 2AX0A 2HVZA 3HKZD 4M5HA 2G1DA 1QVFR 3SQOP 1WHYA 2D1CA 3FQLA 5CQGA 1EZZB 2IM3A 3I5BA 2B56A 4DI6A 1TL3B 1P27B 3W9IA 1N36J 4EBCA 2IRYA 3E3XA 4NI2A 3FMWA 3ISZA 4FF2A 2HZVA 1OPIA 3BM7A 3CTRA 2YNGB 5LMNJ 1YJNS 4DR7J 2AHOB 3R6LB 3KJQB 2MHNA 2H1YA 2H65B 4B3OB 2FJDB 5IFMA 1NKCA 1AFJA 4HTIA 4FF3A 3J80U 1DJ0A 2GX8A 5C42A 3G6XA 2VQFJ 3HZGA 1NCLA 3THVA 4DFKA 3GIIA 2I6WA 5DLGA 2IYGA 5KFWA 3RB0A 3RB3A 4E0DA 1S1TA 4XDCA 4J9KA 2N7YA 3H25A 2C3OA 1ZH5A 3BO4A 1XMQF 5FLXY 3A8JA 2FUG9 4F4YA 4OX8A 4U6PA 1FK9B 4MKBA 3OV7A 3M2VB 2FVPA 4O0IA 1KQFB 2CVEA 4LF7J 1RADB 5L9NA 3R5DA 3DFEA 3I31A 3TEGA 3HHLB 4CH1A 2DCLA 3MF5A 4UQTA 1Q82T 2DHSA 1YTYA 3D1HA 3HF5A 1RBAA 1NK7A 3S1TA 2IIHA 3OPKA 1PKUA 1S72S 1EP4A 1URNA 3HSDA 4A48A 3OHBA 1TK5A 4YR3A 5CHCB 2ZDOA 4GC7A 1XNRF 1ZAXA 4ZP6A 2I8EA 4ZHRB 3T1AA 1N0UA 2AJ1A 2AD9A 4ZJOA 4DL7A 1Z1ZA 1U47A 4WFYA 2V94A 1HMVB 2ASJA 3TJAA 1FERA 4O44B 3R2CJ 1DTQB 3MPUB 2HBYB 3FCHA 5HMXA 1HBNA 2LQ9A 2WSEC 3Q2SC 2OPQA 1QAJA 3CJ5A 3Q83A 4Z37A 1FFGB 2H3EB 3VHQA 1HYSA 2YWEA 2XGPA 5GADI 5KT6A 4ETZA 1VLOA 3KOAA 4I6AA 2OO4A 4B3MF 5AT1B 4OZ3A 3PFOA 3NS5A 4FXWA 4PYDA 4Y2CA 5GVQA 4ZLPA 3BGOP 3FSXA 4J9SA 3SIPB 1RKIA 4X65J 2G0CA 2IMOA 5KFFA 3TWZA 3I4PA 3CDWA 3K5MA 3RYLA 2BQ3A 3HK2A 5E3CA 2R3VA 3HFVA 2OKQA 2HNZA 3ENWA 3DRPB 5L8RC 2MPUA 1UETA 3U27A 3Q8PB 1M5VC 2DT9A 3S8SA 2X51A 3CIMA 1U0HB 1FD2A 3IWXA 4H4OA 3LP1B 1O0PA 4PG8A 3BO2A 3HI9A 3C6UB 3KJVA 1U48A 2IJFA 4IOCQ 2DY1A 5LJ5Y 1Q4RA 1PC5A 2MZRA 5THWA 3OR2B 4Q45A 1QJHA 2I1RA 2OGUA 1Q53A 3PHEA 4ATNA 3R2DJ 2W01A 5CYMB 1J5OA 3MD1A 5BYSA 4TKTA 1JLGA 3N6LA 3OBIA 3MTKA 1FJGJ 3T5LA 3HHEA 3N6NA 2YWKA 3KLEA 4IFVB 3I6PA 1QSYA 3QGGA 2D69A 2DNYA 4C3LA 3R7NB 1UVKA 5B0GA 1RDRA 4PYAA 4HLBA 4HDGA 2RQKA 3SCJE 1YQHA 2VBZA 4ZN3A 3QATA 4JOUA 2L41A 2ZJPQ 4DV1F 2OIHA 4Y65A 2LFVA 2RRAA 2UV8A 1LOUA 3GJQB 2HLTA 1UVIA 2KHDA 4K2JA 2J0WA 2F8HA 1E6YB 2HGLA 3UR3C 4MKAA 3M8QA 1DFDA 1D9DA 3KMSA 1SKUB 3I0RA 1WHXA 4I69A 2V50A 2E5IA 1RA6A 5HQLA 2RU9A 3TQEA 5FIIA 2UUTA 4H4MA 1XNQJ 5D6GA 2YY3A 4UOCA 1S0NA 4LFCJ 3UCGA 2ABYA 3VVUA 3GFXA 1HNWJ 1CJTB 1NH7A 4JI5F 1X4HA 4ZCMA 4QW9A 2DJWA 3BS9A 2CDRB 2JEIA 2LA6A 4HT7A 1KVKA 3PDNA 1HQ2A 2MKKA 1FNXH 1UKUA 2VG5A 3MM5B 2FVCA 3ICLA 2PI4A 4QR2A 5L9XA 4DSIA 4ECSA 2FDNA 1TQLA 2KYZA 4RPFA 1VBZA 2VU5A 2JEFA 2VBWA 1V5IB 2H5JB 3ENVA 1TKTB 3PKMA 1L5UA 1MW7A 2UV8G 5HP1A 1U02A 4GMKA 3KLHA 1OSDA 2OMOA 4DPUA 3KK2A 1K44A 3N4WA 4U7UD 2I5JA 3HVAA 2VJVA 1NXIA 1K0VA 3JAMY 1VBYA 1NDCA 5T7LA 4JYAJ 9RUBA 2IAJB 1AXQA 3IS9B 4ZVOB 2CQ2A 2Q3PA 4BWJA 2D3UA 2AU0A 4U8VA 4CLUA 3GJTB 2HS0A 4HVZA 2K1RA 4X4SA 2AJ0A 3AB4B 3OFHA 4LF4F 4F50A 3GIMA 2LDYA 2PA8D 4PUOB 3G6ES 2QO3A 2EC0A 2QN6B 1RSCA 4OJHA 4CLTA 3W2WA 2B3TB 4F4KA 4B3TJ 2AYEA 4ID5B 4QIWD 4AFFA 4L72B 3PW4A 2R8KA 1S12A 1UPPA 1NHVA 4NZ7A 1FDDA 2ZZNA 2D7SA 3FK4A 2VKZG 1KLMA 5ETOA 4RW6B 1LWXA 1CLFA 1SC1B 5MLCV 2BV3A 1HKAA 5E2QA 2HQCA 4N8OA 1UJ5A 4K0KJ 4K5RA 3UNGC 2JWNA 2IY5B 4NLDA 3MAAB 2C2OB 3FCVA 5C24B 3DDKA 1FE4A 2FPHX 4M1KA 1L3VA 3TA0A 4DXLA 3US5A 2HBRB 2GVZA 2MSSA 2Q43A 1ULRA 2DH7A 3MWBA 4ZP9A 1U2FA 1NSKL 2ZUAA 3UN2A 3QZ8A 2RJZA 3SCKE 5F8JA 3AOBA 2YKMA 1NPKA 3DMJB 3I82A 4WZQA 4PQUA 2BJ3A 2V4RA 4CTAA 4DV6F 3GMGA 5KFSA 2P6TA 1T9VA 4OJ3A 5HROB 1X0FA 2CZ4A 1DTTA 3HVTA 4OHZA 3S7RA 2QC3A 2DGSA 3A8EA 1VRQC 3CSKA 4ZP7A 2PI5A 1EARA 4LQ3A 4PEOA 1X5OA 5A8KB 2DK2A 2ZD1B 4A8WA 4UUXA 4AUKA 4F0KA 3MPVA 4LFAF 3NBPA 1D8ZA 3JQMA 2MKYA 4ED3A 1IUJA 2RVJA 5CYJA 5DDPC 3N0VA 2ZEJA 3KK1B 4Q8FA 2GIRA 2VUGA 1SH2A 2DHHA 1U45A 4WWSA 2J7WA 2K7JA 1FESA 1EB0A 4OJGA 3IR7B 3RRHA 2ILYA 3EWGA 3GSIA 4C98A 3ZZUA 1WEXA 1OMSA 3UD5A 4DPXA 1U26A 1TUVA 3AXMA 2XSJA 5F0WA 4X4PA 2KG0A 1YRUA 4EK2A 5J2NB 3GIRA 1MLAA 4X66J 3LOUA 3M2RB 3VZHA 3KK3A 4QOTA 4OI0A 4EBDA 2UVVA 2GZOA 4F3MA 2K2PA 1HI8A 3UD3P 1T3OA 2DTJA 3SFUA 1FHTA 4I6YA 4PRFA 1I51B 4P2XA 4OI1A 3CCJS 2A0FB 5J1EA 2MSTA 5L46A 2C1EB 1IR2A 4DSJA 4KTQA 4WCEQ 1X7VA 1N32J 5HO4A 2F65A 1IWAA 4CDIA 1KDNA 4ZA1A 4R5PA 2UXCJ 2DGVA 4IFYB 1PJ6A 4B3RJ 4DQIA 1TK8A 1Y9OA 4KHPJ 5DRKA 4ZPWR 1FRJA 4RZRA 1T9XA 4CLPA 2DISA 1OYDA 4KKOB 1R89A 4M5NA 3QRQA 4LF2A 2CZVC 1FDAA 4Q8EA 3HSJA 3BGUA 3HD2A 2L9WA 3W62A 1REGX 1FKOA 4KY3A 3PEHA 4AXIA 2DR7A 1RTIB 1R8HA 4P71A 2YNHA 1TU0B 2F4VJ 2W9CB 1J5EF 1S1VA 1FEHA 4NLSA 1VQ5S 3W63A 3DLEA 3I9ZA 4QJVA 2CNNB 1G3OA 1N5VA 2P6SA 2HGNA 2W2QP 4LVNP 2OAUA 4ZIVA 1SPBP 2Y0BB 1W7WA 5LL6d 3MMCA 3C16A 1NPPA 3F44A 4LSNA 2XWYA 2LA4A 3FRZA 3CD6S 2M88A 3H0PA 2VODA 4M5DA 1HNVB 4QYZK 4M5LA 5HBMB 1N34J 3QLHA 4DQPA 1B0VA 2W7PA 5CCLA 2Z30B 2YWWA 2AJ4A 3NG8A 4H4KC 4TVAB 5CCMA 2HHHJ 1FFSB 1D09B 3GP9A 1S1XA 4U67Q 2QV6A 3HJVA 2BRKA 4FNHA 3QJLA 4NMXA 3AH6A 1X9MA 4ETXA 2JFKA 1ZPVA 3I0SB 2DPJA 2WBMA 4B9VA 4OZ0A 4CLSA 5JVGQ 5L1LA 2HVEA 4ECXA 4DPTA 5D8HB 3P5BP 2GJ2A 3NRBA 3KLGA 2QSWA 4DQRA 4OYAA 4QIEA 1UW9A 2IA6A 1XWLA 1RK8A 3CJKB 5IT0A 4YR0A 2J0XA 3OW2R 3WX8A 1RT3A 1F5AA 5ETNA 4UTGA 3UDEA 2HNYA 4USIA 2J9DE 3PW2A 4HTJA 2MGZB 3ZZTA 4R8UB 4ZPCA 3ZTSA 3JSMA 2Y9HA 3V81B 2X7IA 4ZCKA 2L3MA 1VQPS 2Z2YB 2HHPA 4X62J 2A18A 4KV8A 2CQBA 3U7JA 4BWMA 1OO0B 4IDKA 3GFHA 4DSKA 2VFTA 3JYTB 4QWDA 1N5YA 4ES3A 1EJ7L 3NS7B 2XC9A 5ETMA 4WE1B 4WP9A 2KHCA 2X1BA 2JHEA 2E29A 1U1NA 3VALA 3CJ3A 5HVHA 4C8YA 4KGXB 1QAYA 3M8SA 4OZLA 4YQWA 3LAMA 4IRCA 3IM8A 1FFWB 1IBKJ 2BBEA 2F1FA 4NLRA 1QSLA 4DSFA 4RW9A 1CULB 3CDEA 4O3NA 4C0BA 2KVQE 1OPZA 3TVZA 5G0RA 1QLNA 2IBKA 3VAJA 1JWWA 5GAGU 3GFYA 4NXMJ 2R8HA 3MMBA 1KC8T 3GV7B 1Y5LB 5HLFA 4ED6A 3PJWA 1KOHA 1YITS 2OFGX 4EI2A 3FFIB 3V4MA 3TEHB 3QJPA 1DARA 1GMWD 4UQGA 5E3RA 1A0OB 2FJVA 1EX8A 2ACYA 3ZTRA 2ZKTA 3G6YA 3FDSA 2BW2A 4XO0A 1RBOB 1HWJA 1IKXA 1HNWF 1VR6A 4FKXA 4YDDB 5K14B 2R2UA 2GMJA 4ECUA 1WWHA 3B4DA 4V19J 3LH2S 1VGYA 2EFVA 2RS2A 4J9QA 3LP0B 4A8XA 4USVA 4DL0C 2OPPA 1Y5NB 1CJUA 4KH0B 3ZZOA 4CT9A 3MM7A 3V6DA 3M8RA 4WZMA 2CQGA 3RUBL 5CD4H 1TV6A 4B08A 2KJVA 1KS2A 1NDPA 4LF1A 4NYZA 3GU0A 1FD8A 2CDQA 1FJEB 1RT6A 1YJVA 4ZVQB 2JX2A 1UWBA 2VDIA 4X4VA 3C6TA 2JJ4D 4USJC 3BZQA 4J9RA 1SV5B 3A4TA 2VQEF 1KTVA 5EN1A 3AD7C 1AB8A 4NI2B 2OELA 4QZVB 2DITA 2PDAA 2G2ZA 2QYCA 4RNNA 5K20B 2UUAF 4C7QA 4HH0A 3AAWB 1PIEA 4ZOSA 3W64A 2JEGA 3D3CJ 2EC2A 3J7YU 4DFPA 1RT2A 2JDJA 2R2SA 3ULHA 2HHXA 3T5HA 5B09A 1Y0HA 3DLHA 1T03A 2MQMA 5C42B 4N56A 2HQIA 3HDSA 2DVIA 1ZZFA 4HACA 2EKYA 4YP3A 4USWA 3WDOA 2NUUG 5DLFA 1TAUA 3TR5A 3BSNA 4ZVEA 1JXVA 1XN9A 5B0CA 2M4MA 1S1TB 2ALZA 3IP0A 2PT0A 4G1IA 3HKWA 4P2SA 1MN9A 1AYEA 2MLXA 3BR9A 2HK2A 2GGPA 1P9YA 5F3ZA 4UY8T 4JI8F 3WHIA 4F4ZA 2Z57B 4DX5A 3A3NB 4LUBA 3AY0A 1QDUB 5K5MA 3G6VA 3IM9A 2HYIB 2JC1A 4DU8A 4DL6A 3CMES 3EX7B 3R7SB 1Y7PA 2G9OA 3B82A 1R0AA 2KM8B 4LF9J 1C1BA 3J7AN 1XR7A 2CNKB 3R1LA 2QX0A 2HVDA 1SH3A 2VFSA 4CCHA 5ETTA 2PD1A 5B0AA 4WXWA 1CJVB 4MTPA 1EP4B 3THPA 1LWCA 2CIMA 2HK3A 3CD0A 4J9LA 4FYXB 3VGTA 3TUIC 2GJFA 4URGA 2F5GA 4LR7A 1VQ4S 2X1FA 4P52A 5SZTA 1JJCB 3D6FB 1HBNB 2BE7D 2OPQB 5CAAA 4MKVA 1JLQA 4JV2A 1K47A 1HYSB 1RHJB 4NA1A 1TMMA 3OTOJ 4ZMMA 5H9EK 4YB5A 2CPDA 1S57A 2V0NA 2IVFB 4WYWA 3KDOA 2RQMA 2QEXS 3I96A 1YWXA 2C2MB 3GYGA 3OL8A 4JB8B 5J2MA 1OYEA 2KFNA 4AL6A 4KRWA 4C2MA 2R7RA 3NOGA 3EZ5A 1WC5A 1FXRA 2EK1A 2ZWPA 1NUEA 1HW9A 1HBUA 2IJNA 2YBVA 2HNZB 2EPIA 3I56S 1YRTA 2M9KA 2NZCA 4ZPBA 2GCFA 4H4OB 1UEVA 2D74B 4WP3A 1FRHA 4DV4J 5KFBA 2DIVA 3J7A1 1U25A 1VI7A 3KXDA 2FHJD 5AXNA 4NWBA 4X66F 2AZ3A 1BHNA 4Y2MA 3FEZA 4XTTA 2LMIA 3N6MA 1K0TA 2B9WA 1GXUA 3M9MB 1J5OB 2DRAA 1JLGB 4KJIA 1FDNA 3KLEB 2XZDB 1REVA 3TI0A 4K50A 4ZVUB 4WFNQ 4JI2J 3TA2A 1JLFA 1RCXB 4NEZA 5G4DA 2UU9J 4DQQA 1NSPA 3K59A 1PGZA 3NGDA 1Y4ZB 2MZTA 2UXCF 5E3QA 4GKJJ 4B3RF 1R7IA 2Z4PA 1F0XA 2B9YA 1R8CA 4ZS6A 3J7YI 3X1LB 3LPEA 2WVEA 1FCAA 3M8QB 4NLQA 2CG4A 2EFNA 2YVSA 2MJNA 3X3UA 2D9PA 4OYIA 1PG5B 5KFIA 4A8QA 3CCVS 2YTCA 2ADBA 4CNYA 2WSFC 1HNXJ 4DN9A 3MMAA 4N47A 4H4MB 4J9VA 1QAXA 3F56A 3BB5A 5E3PA 3OHAA 4LR8A 2NPIA 4GVLA 1FX2A 4OI2A 2OFHX 1F5BA 3JSRA 3QFWA 5DGAA 1LK7A 2FY8A 1IBLF 5IZHA 2DNRA 3W61A 4KGKA 5IS2A 1NJXA 2ROEA 4NCGA 4ZP8A 1KR4A 3EZUA 2DGXA 2HIYA 3HCXA 1YJUA 3R3TA 3ZFVA 1KSPA 4HYKA 2XTJP 1SCJB 2HHHF 4KIAA 2IPOB 4RBTA 3RBXA 2QG9B 5HP1B 3KLHB 3BEGB 2MEWA 3KK2B 4KBIA 2DH9A 2QLWA 3NEKA 1QAIA 2FZKB 2I5JB 4N76A 3L3CA 5KT3A 3J7ZT 2HVIA 1AA1B 4OX9F 5GMKa 4KHMA 3FEXB 2AV5A 3H4DA 4JI6J 5CABA 1UFLA 1WHWA 1VC6A 5T7LB 3PFEA 3MCMA 2DD8S 3IWNC 3PYDA 2VH7A 1Q8IA 3QYYA 4LRBA 3K5NA 3ONQA 3P5TL 1FRKA 3OVAA 2R7OA 3GZ7A 4TN2A 4IO1A 1BQMA 2PSZA 2HHSA 3GG0A 3OTEA 1N56A 2F63A 4WTYA 2K1RB 2ATCB 4KT0C 3RR8A 1S79A 1MG7A 4ZVGA 3IGVA 5H9FK 2B43A 3U1MA 2BABA 1U7LA 1UJ4A 4DR4J 3LPYA 5KT2A 3M32A 3PVXA 1NSAA 1JLBA 1RYSA 1RHMB 1HHTP 4IG3A 4A8FA 4JI4F 3SYZA 1WI8A 3TVKA 1FJCA 3W2WB 1QD1A 3QAEA 4KR0B 2BKOA 3M8WA 2WAQD 1E6VA 2R7UA 3IO1A 2LU1A 1PO6A 3WIUA 4F04B 1H38A 3Q24A 2CPIA 4JI3F 1UTAA 4Y28C 2W4PA 4AD6A 3D6TB 4ZN1A 2JC0A 4ED0A 1FXDA 5IV4A 4DFMA 3BPSP 2EXUA 4X84A 1S1UA 1AT1B 5KG3A 1TP7A 2P9EA 3EGNA 2LKZA 4XIUA 3DRSA 4HT5A 5CYMA 2LDIA 3BN4A 2HAFA 2DO0A 4ILRA 1S7IA 1TK0A 4IFVA 4ANCA 2GVZB 2M5YA 1B0PA 1XR5A 2Z58B 4A8KA 4DV2F 4NXMF 2K3IA 1UA1A 2H48B 1IQTA 2EVZA 4LFBJ 2YKMB 1TL7A 2CQ4A 3VQTA 4CTAB 1NK6A 3M6VA 4JI1F 1RAEB 3DC2A 4OYWA 4IYQA 2JEJA 3MECA 1I94F 3CULA 1UA0A 3NGKA 1RE1B 3M30B 2WHOA 1DTTB 2DHXA 3ZTPA 1RUSA 4ZLLA 2A2CA 1C0TA 3HVTB 2W8LA 4ED4A 2X3GA 1TKXA 3D6MB 2KZMA 1RT5B 1RWMB 2M0GB 2VFUA 1U1MA 2W7OA 3PW0A 4DHVA 1RTZA 4DUZJ 1F9FA 2ZHOA 4QYZJ 3NBPB 3HJFA 4Q44A 3RW6A 1KONA 3CCWA 2V8DA 1BD6A 3H2UB 1S97A 2Y1LB 3WBZA 1KQGB 2YKNB 1ZAWA 2H9ZA 1JJ4A 3N28A 5A76A 2ADCA 1RAOA 4WKYA 2WB4A 1UZDA 2VASA 1T9UA 2VHGA 3FQKA 2HURA 3UCUP 4O3RA 3IGNA 2KKHA 2W2OP 1CJKA 2GAGC 2NXJA 2B7BB 3M8PA 4TXSA 5C7PA 3M1VB 1S0MA 3KK3B 5U47A 3AXKA 4M95A 4CWBA 4WK1A 1RLCL 2RRNA 4PKDB 1Q78A 5D0RA 1WUUA 1VIOA 5J1EB 2JNJA 4H4KA 1H72C 1YI2S 3NXZA 3NNHA 3M6WA 2XO6A 1S9GA 2DEIA 4ZVSB 3JQJA 3FRYA 2VD3A 1X5TA 1WC4A 5DG7A 3QJJA 4LT6A 4R5PB 5L38A 1JNZB 3DLKA 1IJEB 3W60A 3KHRA 2V8GA 3IS9A 4KE5A 4YDXA 1J27A 5FDLA 3AOAA 1CQNA 2KL8A 1KHWA 3KHLA 5IQQA 1FWLA 5KFNA 2ZOFA 2LEBA 3KMQA 1TTHB 1SJRA 1D8YA 3R8YA 1FKOB 3JTPA 1NLKL 3PYFA 2P2CB 4ZPVR 3HHLD 3RAMA 2YNHB 1X8DA 1S1VB 2XY7A 2XHWA 4OX7A 3H8YA 5KFYA 1W25A 3MZIA 3RB4A 3NGSA 4OHVA 1OSCA 2C42A 1WTBA 2XQCA 1T8EA 4RW6A 4C11A 2XZTB 3MMCB 2UXDF 3K7RA 3C16B 2DGUA 1U49A 3BR8A 3TX8A 4LSNB 6AT1B 1TL4A 1M5OC 4AXJA 2ZUGA 2CJ9A 4M5DB 3H20A 1VQYA 3DCAA 3LTOA 3D5MA 4DR1F 3QLHB 2NR0A 3E01A 5KFJA 4DQSA 2K3KA 3CE8A 1IBMJ 1LEOA 1N54B 1ZTWA 4PG6A 3MEKA 1S1XB 4LF5J 3B54A 5L39A 3DMJA 3ZO7A 3G87A 4ECVA 4D3HA 4Q2LA 4WPAA 1YIJS 2YKOA 1X5PA 5HATA 3EVMA 2RDIA 4NLXA 4RUAA 4P2MA 5KFTA 2NPFA 1ZM3A 3QIDA 2IMWP 3S6EA 2XMAA 3KLGB 2VFVA 3D9BA 1ZPWX 3RU0A 5GAEU 4EMDA 3PEJA 4DCOB 1RT3B 1YZ6A 2NSBA 2HNYB 2BW7A 2UXBJ 4USTA 1SC3B 2Y0SD 4DV4F 3GIKA 1VK8A 2HHVA 3JSMB 3DGVA 4M94A 3IRWP 5F9LA 4UZBA 2YQ3A 2K06A 4KV8B 1ZM2A 4KGVB 1BWEA 1URRA 4E2FB 4IDKB 1R6VA 2P5VA 2KYXA 1R27B 2XS5A 2BE9B 2JVOA 3EDRB 1N5YB 3GB0A 2LECA 1GFWB 2FC9A 1VMBA 1K73T 3V4IA 1BLUA 2RSQA 1VISA 3CJRA 4C8MA 1WC0A 2ZNYA 2MHEA 2W2PP 4P72A 3D4JA 3G71S 5I42A 2DHGA 1VQ8S 3EE3A 5J2NA 3BGFA 1SXLA 3A12A 4NASA 5F8GA 4RW9B 2VG6A 2J6UA 2XB2D 3UW1A 2HG4A 2V8VA 1G6BA 4CO0A 2CVIA 5G0RB 1V6HA 1WKJA 4DS4A 4C48A 3LAKA 4OI3A 4NXNJ 4FYVB 1LXNA 4EZ6A 2O66A 3FEYB 3MMBB 3ZZ0A 2VA3A 2IVYA 4OL8A 1HBOA 5HLFB 3CC7S 1EQ0A 2MQLA 1FF2A 2D3OR 2UVUA 2D9OA 2KFZA 2JVRA 3CCES 3PRVA 2WB1D 2GNKA 3T1YJ 4Y34A 2KO1A 2XS2A 2FHOB 4DR6J 1T95A 3GLJA 3Q8UA 2V5HG 1DBDA 1IKXB 5KG0A 5M2UA 2EFQA 5IXUA 3CCQS 1O51A 4KKOA 3HFZB 4F3OA 3VAGA 3MM6A 3GCXP 1CJUB 1TKDA 3MM7B 3V6DB 4U96A 2EFOA 4C8KA 1T02A 4MT1A 2AQ4A 1SUQA 1A9NB 3A8KA 5H9EJ 4ZLJA 1TV6B 4NMLA 2QLXA 3G9CA 1RT6B 4E98A 2ZBCA 3PW5A 1UWBB 3C6TB 4IH7A 3M2UB 4DX7A 4KFBA 5CD4A 3AODA 2K8GA 3BSOA 2C2DA 4RW8A 2F9JA 1WOSA 3FBBA 4G1QA 4PPDA 2CG8A 2AX1A 3DLGA 5HBMA 4RKUC 2CZ9A 1T03B 1A6LA 3IMQJ 1NJIT 2RU3A 1RTJA 2BOPA 4OLOA 1NK0A 2HVHA 4EUVA 4HACB 1Q86T 2XI3A 5KFRA 3MEGA 2CRLA 1GEHA 5IV3A 1ZAVA 3UNYA 1IKWA 1QM9A 5BXIA 2L48A 2NS1B 1RHQB 4ZCLA 4F3QA 1NHUA 1VC0A 1KEKA 4NLVA 2FLNA 1BC6A 4P74A 2GGPB 4NYOA 1UEKA 4CLKA 2DXEA 4DPWA 2KN4A 4EZ9A 4DL5A 3EPGA 4DR2J 3JSYA 3T3FA 2YKPA 1YVFA 2POKA 4DJBA 4ECWA 3O3LA 4DR5J 4RWWA 3MR2A 5D4PA 2LQBA 1RTHB 4F26A 3AB2B 1UVMA 1G7CB 4KO0A 1R0AB 1YBTA 4R8UA 2J0QD 3P8BB 1C1BB 5CZXA 1JIHA 3CIZA 5GAEI 1Q7LB 4JUZA 1UVNA 1D9AA 4QIVA 1OIAA 2FIUA 1AZSA 1LWCB 3S01A 4L6V3 4IO9Q 2ROGA 2HRTA 1L3KA 3MUTP 4RUBA 4DLEA 4PCQA 1EETB 1H2VZ 3K58A 4LRCA 1ZA1B 1JLEA 4LFBF 5E33A 4DV7J 4JBCA 4WK3A 4X4NA 4OYZA 1EQMA 1JLQB 1HWKA 1NK8A 1X9WA 2NSCA 4M5JA 3TO8A 2BJ8A 1FWKA 1RISA 4OHXA 3V6HA 1LW2A 3BO3A 3H2LA 1D3WA 2E5JA 1RAHB 1S0OA 4JP8A 5A6WA 3QBCA 2ZHAA 4RU9A 1Z2LA 2ATLA 1UAWA 5J2MB 1UL3A 1QSSA 2ASDA 3LP2A 2E5LJ 4I2PA 1U1KA 4LF6J 5HAOA 4NOHA 2Q66A 1CQMA 4ALZA 2OPRA 2HHQA 1VBXA 1HBUB 3Q0AA 4DV0F 2LU2A 3HT0A 2AGPA 2AF6A 1NDLA 1D0EA 4IOAQ 1N4LA 2CQHA 1SQGA 2UUBJ 5IWAF 4ICLA 3TUPA 2J9EA 3LF0A 2GV1A 4QU7A 1JKHB 4DSLA 4U8YA 2ZBRA 3LGNA 3GSDA 1SJ4P 3NGUA 4NPOA 1IM6A 4F4WA 1BY9A 1F6TA 1VLYA 2OI2A 3NCRA 3P45B 4IG0A 3IBFB 4Q2MA 2FHKA 2Y3YA 3UD4P 1RKJA 3EDQB 3EICA 1T9TA 2FB0A 4Q0BA 1NU4A 1SV5A 2MXYA 1SJFA 5EHHA 2IM0A 1JK9B 1OJ4A 4B02A 3MDFA 4NE9C 5H9FJ 1REVB 1ZA2B 5BYRA 2QTWA 1Q95G 4KHRA 1X4GA 2OEKA 1JLFB 3H7HB 2B6AB 5MAOA 2C2RA 2CKWA 4ZCIA 2N3OA 4C8NA 2R8JA 2OMLA 2RUGA 5A0YA 2J76E 1SKSA 1MN7A 3BKUA 3DHWC 3RW7A 7AT1B 3K8WA 5I3PA 2G0IA 1IKYA 1VCTA 2IBOA 1DQ9A 4TYBA 1M5HA 1EKSA 2OSQA 3GONA 2RDJA 3PKYA 4YY3J 2KRRA 4K4ZA 1CC7A 5A2QY 4G65A 1A7GE 4A4JA 3HHNB 1RA7A 5LSOA 1XMOJ 4CNZA 3RRGA 2CJXB 2H54B 1S59A 3MMAB 2PMHA 1SQEA 2XZWA 2CJAA 3T9NA 2F8EX 4GVBB 3PRDA 4C0OC 2RUSA 3TJ8A 1UMJA 1RHUB 3GILA 1LFPA 1S9EA 1RQ0A 5F8IA 2MLYA 3OTCA 2OPSA 2R7SA 3PYGA 4AQYF 1MNEA 1NB7A 2BACA 1N88A 3FSIA 4JI7F 1SC6A 1BQNA 3W9JA 2DR5A 4NCGB 1CJVA 3SV3A 3IRXA 2HSEB 5JMNA 2UUWA 2YX1A 3WC0A 1HQUA 4USMA 3D0IE 1SKRA 3NAIA 4QCLA 3QT7A 4TU7A 2VOPA 5A2QU 3T6BA 1U1LA 2VBYA 2H4WB 4PQAA 4O0NA 2VPYB 5AJ3J 3D54A 4YS2A 2ZVSA 4XAKA 1DZ5A 1FKAF 2QA2A 4WU2A 2YWGA 3O1LA 1MMDA 2V63A 4CT8A 2E1AA 1T7PA 2VC1A 2DPIA 2XGQA 1KBRA 2X3DA 3CDBA 5I4MA 1CS4A 1T0TV 5ETLA 1CSJA 4GRSA 1FVQA 5LSLA 3V6KA 4JV5J 1MSWD 4HEA9 4X4TA 2N7CA 2FD2A 2C3PA 1GXLA 4ED2A 3ZNUA 2HNDA 3MR5A 1AUSL 4NLYA 4ECTA 1BQMB 3PO4A 4PPZA 5KG6A 4K4SA 3VCDA 3UCZP 4BS2A 3FKBA 3KJFB 1U24A 2B9XA 1R0CB 2HS3A 1OWXA 3CJ0A 3M32B 1JLBB 4IG3B 1HBMA 3EM1A 1JJ2R 2XSFA 4CO2A 1V3ZA 3LO3A 3UVJA 1YHQS 1RBLA 3TZWA 1E6VB 5H1SV 4DS5A 1X4CA 3BKTA 4K4YA 4WIQA 5KG1A 2HLUA 2FZGB 3KTQA 2M3DA 1ITPA 3QGHA 2DKOB 5DM6Q 2UUCF 4C0HA 4P73A 5LMUJ 3PHTA 1C4AA 4DF4A 2MY8A 1S1UB 2KZZA 1RT4A 3IN5A 4OI6A 1U1QA 1CVJA 3AOCA 4YHHJ 3DRSB 4X2BA 5E3AA 2J8SA 1X60A 5KFMA 3HVWA 2HWIA 2BZ2A 1HQEB 3NGRA 1R6YA 2Z0GA 3MD3A 4KAIA 1NKBA 1YJ7A 5KG5A 1MROA 4DL2A 4TU9A 2LEAA 2MZ1A 3JTNA 2KTQA 3NP5A 4KH1B 3V5RA 1BQXA 3C15A 3CEDA 4OI4A 1TL7B 1QTMA 2HW3A 5A6PA 2BKNA 2AEJA 2LCWA 3MECB 3W5XA 3BH6B 3OTBA 3HX9A 4LR9A 3NOCA 3T19A 1VQLS 4EEYA 1C0TB 3SCIE 4IR9A 5CZVA 3SI8A 2MQOA 1TKXB 1WC3A 3P3DA 4C8ZA 4QWBA 1S4EA 3OJUA 1OS5A 1WG1A 3QPIA 1SIWB 3RBDA 1VC5A 2ZITA 2H5IB 4H54A 2AJ2A 2VB6A 4Z2XA 1NO8A 4AL5A 2BJ7A 1WF0A 5LT5A 4TU8A 3KNAA 1DURA 1WELA 2B4PA 2BJDA 4ZKAA 1IKVB 4HI2A 4CH0S 1XMQJ 1U09A 2U2FA 2MB0B 3PXGa 2YH0A 1N0VC 1APSA 1OQ3A 4ILLA 3DOKA 2PEHA 1LQ9A 1EIYB 3QWPA 3BREA 3DLJA 3C14A 3M9OB 5KFXA 1DY3A 2QGFB 2NUHA 1CJKB 4BLGA 4WIIA 3GJSB 3OFEA 3M8PB 3HP6A 4FYYB 4X4UA 3K89A 3F0NA 3L7OA 2E7XA 1SKWA 5D4LA 1RAFB 2C2NA 4KGZB 3W8PA 2ZH4A 2ZVIA 2RS8A 2VZ9A 4O3PA 2YNFA 3RRKA 5E0OA 3AD9C 4IR1A 1ZZNA 1U2CA 2JLEA 1QTNB 4K4XA 3VAFA 2MZSA 4X64J 4ZJQA 1XNRJ 3KLIA 4NLPA 3DNCA 1VDHA 4HR2A 4NYPA 1S9GB 3IR6B 4UOGA 2G2OA 4PZVA 3KFWX 2M7SA 1S1WB 2GHWA 3R5JB 3DLKB 3UE2A 3M8YA 4LRDA 5FDLB 1FVSA 3R9LA 7FDRA 5CH7B 4DR5F 3EGVA 1TKZA 2MKIA 2XCAA 3AJ2A 1XC9A 3NAHA 4W92B 4FVMA 5HK4A 1WOOA 4LBPA 2WONA 2JLGA 3DRYA 1T11A 4FS2A 3MMJA 4X4QA 4MFBA 3VAHA 5DQGA 1FDBA 1EHWA 2HBQB 4Y2IA 4NA3A 4DR3F 5J2QA 2J9DA 2ZBPA 4LIWA 4HHJA 5A8WA 2FZCB 3TAQA 2PIIA 4EWTA 4O3QA 3MPDA 2I38A 4QWAA
chains in the Genus database with same CATH topology
3GIIA 3QZ7A 1ZM9A 4C11B 2FJEB 4GKKF 3KLHB 3PX6A 3BEGB 1ZTTA 4LIRA 3KK2B 2ZHBA 5DLGA 4KBIA 2IYGA 3M05A 3MPYA 4WXOA 2AJQA 2DH9A 2QLWA 1YJWS 1QAIA 1HWLA 2E9RX 2I5JB 4N76A 3OJSA 3L3CA 5KT3A 3J7ZT 2HVIA 5KFWA 2VBXA 3RB0A 3RB3A 4RNHA 1QE1B 4OX9F 4E0DA 1S1TA 4XDCA 3ITHB 4J9KA 2N7YA 5J1NA 5GMKa 3H25A 3G8TA 1VRUA 4KHMA 3FEXB 2AV5A 2C3OA 3H4DA 2J6TA 3KHGA 4DV5F 4DWIA 1ZH5A 3BO4A 1UFLA 1WHWA 1XMQF 1VC6A 5FLXY 5T7LB 2FUG9 3PFEA 4F4YA 2DD8S 4OX8A 4U6PA 4F8RA 1I1GA 1FK9B 1PSDA 1LWFA 3DU5A 3E01B 4MKBA 3TP2A 4RNOA 3OV7A 3M2VB 2KG1A 1N8RT 2FVPA 4O0IA 2ZOMA 2VH7A 1KQFB 3HO1A 1Q8IA 5KFZA 2PE8A 3VAKA 3QYYA 2CVEA 3GYNA 5C5JA 1VQSA 3K5NA 3ONQA 1FTRA 1NEEA 5L9NA 3P5TL 1FRKA 4FXVA 2APOA 4ECZA 3NKYA 2DB1A 2W4CA 3R5DA 5JUMA 3OVAA 3T5KA 2W4DA 3DFEA 2R7VA 1R8AA 3R5BA 2R7OA 3I31A 3GZ7A 3HHLB 1GQEA 3POTA 4TY9A 4CH1A 2DCLA 2F8MA 4TN2A 4IO1A 1BQMA 2PSZA 1S0VA 2N4CA 4B9MA 2HHSA 3GG0A 4JI2F 3OTEA 2BR0A 1N56A 3MF5A 2AP6A 4UQTA 2XCPA 1GX6A 4WTYA 2K1RB 2UVWA 1TFWA 3CDAA 2UU9F 4RUHA 4KT0C 2XNQA 5B0DA 2DHSA 1Q82T 1KQKA 3RR8A 1S9FA 1S79A 1YTYA 5DDRC 4DG1B 3D1HA 3OSNA 2NXUA 4ZVGA 3IGVA 3HF5A 2COLA 2XMVA 5DDOC 4LF6F 2B43A 3U1MA 2BABA 1U7LA 1UJ4A 1NK7A 1QVGR 3LPYA 3MHYA 5KT2A 4GKJF 3M32A 2Z8QA 3S1TA 1BGXT 4RLEA 3PVXA 1JLBA 3U1NA 1RYSA 1HHTP 4IG3A 4A8FA 1SB6A 4JI4F 1WI6A 3OPKA 3SYZA 3T1HF 1WI8A 2VL1A 3TVKA 2E44A 1FJCA 3W2WB 4HDHA 3QAEA 1FRXA 1S72S 4PWUA 4KR0B 1EP4A 3HHKA 3M30A 1URNA 3RR7A 2HMIB 2WAQD 2QMWA 1E6VA 1IN0A 4A48A 3OHBA 2R7UA 2HS4A 1HWUA 1TK5A 5F8HA 4YR3A 2UVRA 2ZM6F 2KT2A 3IO1A 5CHCB 2QZ8A 2ZDOA 2LU1A 4GC7A 1XNRF 3AQPA 1RYRA 1ZAXA 4ZP6A 1PO6A 2LXFA 2I8EA 1UFWA 4ZHRB 2UUBF 2WBRA 3MEEB 1RT5A 1RP5A 3T1AA 3LALA 1H38A 1C2PA 1QUPA 3Q24A 1FKPA 3EXYA 1N0UA 2AJ1A 5FJ4A 2AD9A 1XR6A 2CPIA 1Y5IB 4JI3F 4Y28C 1ELOA 1SBRA 2W4PA 4DL7A 2XMMA 1Z1ZA 4ZK7M 1U47A 1C0UA 1HNXF 3OXFA 4WFYA 2JC0A 1HMVB 2V94A 2ASJA 4ED0A 4PWDA 1FERA 1FXDA 2J0SD 1AFIA 4RX6A 2ZH1A 4DFMA 5KFDA 4O44B 1DTQB 3K2YA 3FCHA 4X84A 1S1UA 5HMXA 3DLBA 1UP1A 1HBNA 2LQ9A 5KG3A 1XERA 4Y3CA 3AHPA 2WSEC 3Q2SC 2OPQA 1QAJA 1TP7A 2P9EA 3CJ5A 4XPCA 2YKNA 4QQBA 3EGNA 4MKYA 3VQSA 2R7TA 2LKZA 3CWJA 4Z37A 4XIUA 3DRSA 2GQQA 1N33F 2V4JA 3DI6A 1JMTA 4HT5A 2VKRA 1HYSA 2ZH8A 1P8GA 5CYMA 2YWEA 4K4TA 2LDIA 2XGPA 3AQOA 5GADI 3BN4A 5KT6A 3IAS9 1VQOS 1NJYA 1N36F 4ETZA 3ENQA 3KOAA 2DO0A 4ILRA 1M5SA 2MKJA 2CFXA 4I6AA 1TK0A 1DRZA 2OO4A 4WFAQ 4TQSA 2HHWA 4C4WA 3TARA 3D0GE 2J9CA 4B3MF 4IFVA 2Y1RI 4ID8A 1H2UX 2M5YA 1B0PA 1XR5A 2MQPA 3CJ4A 3KLFA 2R8IA 2K3IA 1UEUA 5LMNF 4DV2F 3PFOA 3V4IB 4NXMF 2E9ZA 4DR7F 1UA1A 3OXGA 3NS5A 1IQTA 1HR0F 4FXWA 2EVZA 2GFFA 4N8NA 3EGWB 4Y2CA 2XS7A 2YKMB 5F8NA 3IWLA 5GVQA 5JVHQ 3M4XA 2CQ4A 3BDPA 3NMRA 4ZLPA 5I42B 3FSXA 3VQTA 4J9SA 1O5JA 3SEOA 5IT4A 4CTAB 1RKIA 1NK6A 2BANB 3M1VA 3M6VA 3R1HA 4JI1F 2G0CA 2IMOA 5KFFA 3DC2A 3I4PA 3CDWA 3K5MA 4IYQA 2RILA 2I9SA 2VQFF 3RYLA 3MECA 2JEJA 3N01A 2BQ3A 2ZKUA 3HK2A 2VG6B 5E3CA 2NREA 1I94F 3CULA 3K0JA 2JL9A 1UA0A 3PJXA 3HT3A 4WFZA 2V4QA 2VV5A 3NGKA 1S48A 2OKQA 2HNZA 3ENWA 3M6XA 3M30B 2WHOA 1DTTB 3DRPB 2QRRA 2P9GA 2DHXA 1N5QA 2HFOA 2MPUA 3KG4A 4K5SA 5L8RC 5KT4A 4UW2A 2A2CA 4F25A 2IM2A 1C0TA 1UETA 3U27A 4YUDA 4ELUA 3Q8PB 1M5VC 2DT9A 3HVTB 2W8LA 3I55S 2X3GA 1TKXA 2BM0A 2W7AA 3TVYA 5K8OA 2IFXA 2VPZB 3S8SA 4YY3F 2X51A 3MFIA 2DNPA 4F2RA 3NNCA 1PC4A 3CIMA 2KZMA 2AJFE 1RT5B 2MQQA 2ZZMA 1FD2A 3IWXA 4H4OA 1HBOB 2M0GB 5DDQC 4MJKA 2K7KA 1KOOA 3LP1B 4JI6F 1O0PA 2VFUA 3HI9A 1WD6A 4PG8A 3HMJG 3BO2A 3DDNA 3C6UB 2W7OA 2DGQA 1U1MA 3PW0A 2VONA 3I5AA 1XBWA 5LXYA 3KJVA 2R9LA 4DHVA 1U48A 2IJFA 5I3QA 1KTQA 4B9LA 1F9FA 2F9DA 2RIJA 2ZHOA 4IH6A 4IOCQ 5DETA 2M8HA 5LJ5Y 4QYZJ 3NBPB 3HJFA 3FZ2A 1Q4RA 2EI5A 4Q44A 3RW6A 1KONA 4LF7F 1TFYA 3CCWA 1PC5A 2V8DA 1BD6A 2E5GA 5E41A 1U6ZA 3H2UB 5D3GA 2MZRA 5THWA 1S97A 1VQKS 4B9TA 2M52A 3OR2B 4Q45A 4A8YA 3WBZA 1QJHA 4ILMA 1KQGB 2I1RA 1ZAWA 2H9ZA 2IYIA 2KU7A 2YKNB 4DFJA 1JJ4A 3N28A 1Q53A 2YWHA 3PHEA 4ATNA 2ADCA 4M8LA 2ZH5A 4WKYA 1LWEA 2EFPA 2WB4A 4O4GA 5CYMB 1J5OA 4MIAA 3MD1A 2VASA 3IR5B 2HWTA 3UQSA 4TKTA 5BYSA 1JLGA 3BDEA 3N6LA 3FQKA 3OBIA 2GHPA 4NRTA 3MTKA 1O8BA 3UCUP 4NLGA 1AROP 2XMKA 3MM6B 3OL7A 1FXLA 3T5LA 3H5YA 4O3RA 3HHEA 3N6NA 2YWKA 3KLEA 5AE3A 3IGNA 4IFVB 3TQ1A 4DR4F 3I6PA 2F3JA 1QSYA 3QGGA 3KLFB 2DR8A 2BE2A 2KKHA 2MQNA 2DNYA 1ZYQA 2MKCA 4C3LA 2M70A 4AL7A 1UVKA 1Q81T 4TLQA 3QAUA 1RDRA 2DIUA 5B0GA 1HW8A 3EUNA 4HLBA 4HDGA 4WU3A 2RQKA 1SUQB 2OSRA 4LQ9A 3SCJE 3M8PA 1YQHA 2B7BB 2VBZA 3DOLA 4P7VA 4JOUA 4TXSA 2L41A 2ZJPQ 3MEDA 4DV1F 1T05A 3NL0A 3M1VB 4FXDA 2CQ1A 4I2QB 3V2UC 1S0MA 2OIHA 2LXUA 4K4UA 4Y65A 3KK3B 4MK9A 2RRAA 3CCZA 2QA4G 1PILA 5U47A 2BUNA 4OZ5A 4M95A 5GAGI 2UV8A 1LOUA 5HI7A 3FMBA 4EO8A 2GMHA