3EXSA

Crystal structure of kgpdc from streptococcus mutans in complex with d-r5p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
208
Chain Sequence
LPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RmpD (Hexulose-6-phosphate synthase)
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 77
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3exsA00
1WDWA 3QQ0A 3LRMA 5K9XA 3BW4A 4LS2A 5C5YA 5TIMA 2CZEA 1G4TA 1OJXA 2CLIA 2Z0IA 3BG3A 1VCVA 5AHNA 3O1NA 1A5BA 3LM7A 3G18A 4K7YA 3VE7A 3SGUA 4Z1AA 1Q45A 3W6YA 2OZ0A 2QF7A 3PBWA 4BR1A 3W07A 3TIMA 1F73A 2OT0A 3TA6A 4ZVJA 3AO0A 1RQHA 3W84A 3GNDA 2WSRA 1AK5A 3SJ3A 3TJXA 4Z08A 3MHUA 2Y88A 1XUUA 2J9XA 4JNMA 1H60A 4HKPA 4JX4A 1DORA 2RHGA 3F1QA 4O18A 3GKFA 1LP6A 4BWLA 1GVQA 4EWND 4X3ZA 1U83A 5F1UA 3SY5A 4PH6A 5I3FA 3GX9A 4DELA 1KFKA 2RDUA 3L9CA 3UD6A 4XKYA 1MEHA 1ICQA 4QIUA 3HPXA 1VCFA 2ATSA 3DH7A 1YDVA 4S1FA 2ALDA 4FIRA 5CGQA 2YXGA 3FYPA 3PUEA 3W7GA 5D05A 2CLHA 5HWMA 1A50A 2YCEA 3KRUA 4X9SA 3W22A 5LNSA 3NQMA 1TV5A 2YW3A 3EX6A 4GWEA 3UYCA 1AW5A 1BEUA 3O07A 4UR7A 3TMQA 1X6UA 4MLJA 3UWYA 1FCUA 1SFLA 4OWGA 4O53A 1I4NA 3TC6A 2E1DA 1SZNA 3W7PA 2VEKA 1X1ZA 2ZRWA 3CIXA 2XN0A 4GUFA 3TMLA 3HMJG 4O15A 4UTJA 5K3VA 1LBLA 1TYGA 4XTIA 2CLMA 4A21A 4XBKA 1W1ZA 1S5TA 2ZA2A 3W7NA 3W7CA 2Y63A 4JTKA 2YX0A 3PBUA 1GZGA 2EKCA 4Y9AA 4UFLA 3QW4B 2RKXA 3N34A 3LHYA 2NV2A 3PULA 3N2MA 4CQ9A 1ICPA 4CCCA 5FF4A 4E38A 4BK9A 1RPXA 4EF9A 4UMBA 3H54A 1K8ZA 1NFBA 2H8XA 1KA9F 2VKZG 4LRTA 5AYZA 4LVAA 4MFEA 3DFOA 1OFQA 4DBEA 1W3TA 4OV4A 3SECA 3UPWA 3EEGA 2ABAA 5K2ZA 1WA3A 4Q4KA 4E2BA 2GUUA 2J24A 2FDSA 3NPUA 2QJIA 4DXVA 3E96A 1SPQA 1W5QA 1OFBA 3G1XA 2WNQA 4LNYA 3UWUA 3WJZA 3CB8A 4XZ9A 2P10A 1O5XA 5EMUA 4NNAA 4UFKA 3LHVA 1D3HA 1G69A 5FF7A 1EA0A 1SO4A 1VZWA 1OFEA 1DQXA 4UMAA 4K7VA 2E5BA 3JS3A 4FNSA 2QCCA 1KM6A 1MSSA 4M7SA 3NO5A 2X1TA 4IPIA 2QUVA 2VEPA 2ZYFA 3INPA 3M47A 1IXOA 4MIMA 3HG3A 4AHQA 1OYBA 3TAKA 5EYWA 3EWBX 2HS8A 3EB2A 1XBYA 1GTEA 2B0MA 2F84A 2QCLA 3G0SA 3W2JA 2X2GA 4NQ1A 1THFD 3EXTA 1I2PA 5F2LA 5G4EA 4RR4A 1WQ5A 3BLEA 1WOBA 1R46A 3ABOA 3NA8A 5D2TA 4AH7A 2Q8ZA 4FX7A 1XBXA 1RQBA 4P61A 3M7WA 2QAPA 4N4PA 1SU5A 3K30A 2R8WA 3G1FA 2QUTA 3DFPA 1R30A 3KRSA 2NXIA 3N9RA 1H63A 1MO0A 3R5EA 3S0CA 2A0NA 4FXRA 1ZALA 1HTIA 3QFEA 2NWSA 4CNOA 2CWNA 4MKNA 5KZMA 3NPVA 4UTWC 3NL2A 2FB2A 1TPFA 3PB2A 4ZMGA 3O06A 3BLFA 1XXXA 5K4ZA 3P5ZA 3CIWA 3NQAA 3QMTA 1KM3A 3EWYA 4AMAA 1H51A 3M9YA 1SSDA 2Z6IA 4LS1A 5DY3A 1JVNA 1P0NA 3QRHA 3C56A 3LCHA 1WBHA 1DJQA 4ZQPA 2DZTA 3V1PA 1I2NA 2XN2A 1I8JA 5D37A 3P67A 2WSYA 3RLVA 1B3OA 4LS0A 1NF0A 1ZAJA 3W1NA 1EPXA 3ANYA 1T8XA 4HNTA 2FTPA 4BFAA 2VEIA 5BRBA 3FIGA 1K7EA 2YYTA 4J9JA 3THQA 5G5IA 3QYQA 2FLIA 4WX2A 4O12A 3G24A 5LNVA 5H91A 5DLCA 3UZ5A 3HGJA 2W0UA 2VFDA 4N9BA 1Y0EA 3STCA 2ZZ4A 3NQFA 2X30A 4R53A 1OFPA 1KM5A 1SW0A 1F6PA 3LHZA 4LW7A 1WOAA 4NJKA 1P1XA 3P81A 1C29A 1M6JA 3HBLA 5K4XA 4JTGA 4DPPA 1LTDA 5CKSA 1SZGA 1FXPA 3L67A 3EWWA 4K39A 4IOTA 5IBXC 1RR2A 1FCQA 3JR2A 1GJPA 3NR0A 1KV5A 2X1UA 3STEA 3GXTA 4O4VA 1FCVA 1KLYA 2CZ5A 3USBA 4QSHA 3OVPA 5F4XA 2VFEA 1TO3A 1TQXA 1XFBA 4FEZA 4O28A 1SSGA 1FDZA 3N2XA 1HFBA 1M7OA 1ZJIA 5LNRA 1GVRA 1O5KA 5AC7A 3NM1A 2V2CA 4BI5A 4ADSA 5C6MA 1K3UA 1XUZA 1LOSA 1TPH1 1SW3A 3G1YA 2CFFA 5I3JA 3FS2A 3HQ1A 3A24A 3M5ZA 1SO5A 1KW1A 4QQ3A 2JKPA 3P5YA 4O54A 2YFNA 5U7SA 1VHCA 4Z1DA 3A21A 2ZRYA 5CPMA 1Z42A 1W0MA 1Z41A 2RH9A 3PS7A 2AGKA 1JCNA 2JGQA 5F2MA 3TW6A 3WK0A 1AL7A 4DEFA 3DFQA 3L66A 3CM4A 5DN1A 3BG5A 3T7VA 4LUJA 5HMSA 2J88A 1UJPA 3QMRA 1JULA 3F4NA 2YFOA 1W5PA 2WO5A 4D2JA 1F5ZA 1VQTA 1OF6A 4HHPA 1H7PA 2I1OA 5G1TA 3TFXA 4WY0F 5FF3A 3GVGA 3C6CA 1KTBA 4GXMA 3PF3A 3W2UA 3CHVA 3HG5A 1SUXA 4RX0A 2OJPA 3QPZA 3B06A 1M5WA 2E6FA 2QCDB 5DCDA 2C18A 2QEZA 4O11A 3MP3A 1F7BA 2A7RA 3LXBA 2ZDRA 3WFAA 4CQ8A 3M44A 4R33A 3W7DA 4C1KA 3H53A 3E02A 1NAL1 1WAUA 1EUAA 3MP4A 1WXJA 1BKSA 3M6YA 3PUOA 4S2CA 1BWKA 1VLIA 1B57A 1KTNA 4JTSA 4E2DA 1LRQA 2DZWA 3SGZA 4NNBA 3LRKA 3BW2A 1MEWA 1Q3NA 1OF8A 3ATZA 3LCIA 4N9EA 1XC4A 3LXAA 5D2VA 5FEZA 4AWTA 3L2IA 4WZHA 2I9EA 4FO4A 1OX4B 2ZA3A 3W7MA 1DQWA 4JX5A 4DF0A 2CLKA 2WV8A 4AEOA 5ABTA 1QR7A 3FOKA 3BLIA 3L5MA 4Y8FA 1DV7A 1H1ZA 3TSBA 4MZ8A 3LHWA 3DFTA 4TR9A 5LZLA 3LI0A 1W5NA 3LOTA 5KSWA 1VCGA 3BO9A 2ZQ0A 3G0UA 4FNRA 3SI9A 3G8RA 5G4WA 3ABRA 1F76A 3PC0A 3NDOA 4JY8A 3DU0A 3O05A 2J27A 4TMBA 1A5CA 3P7YA 3W86A 1OFDA 2ZCGA 3GR7A 3PBVA 4M6QA 4JTUA 2VELA 1VS1A 2Q8LA 5BMXA 3I7RA 3EKLA 1CX9A 4YCOA 4U28A 4KFNA 1JJKA 2AAMA 1VHNA 5AHMA 3WJYA 4UTKA 2V8ZA 4CNPA 1J5TA 2O7QA 3W3OA 2EPHA 2QDHA 1B4EA 4A29A 4RV8A 3QF0A 4LTSA 4JTLA 1FDJA 2ZTKA 2C16A 3W83A 4MY1A 1OYCA 1QPRA 2LLEA 3WJWA 3Q2DA 4JR5A 3GAYA 4O0ZA 2DP3A 4Q33A 3LERA 4NZFA 3W88A 4N4QA 5CPLA 5AYYA 1GTHA 4MJMA 4NX0A 5K9CA 4FNTA 1EUNA 4UTTA 2NX9A 5I3KA 4FB7A 3W75A 2CU0A 1KFJA 1ZFJA 1N8FA 4UMCA 4H6KA 5FEPA 1AMKA 3TSDA 3EXSA 1VJIA 4HNNA 3OVRA 3UQNA 2CW6A 1YPFA 4Z0JA 2NLIA 5E1QA 3O6DA 4HPJA 5DCEA 3NQ7A 1Z44A 2R14A 3IGUA 5DELA 2YR1A 3IVSA 2RDWA 4I7VA 3TH6A 2E5DA 3LCWA 3VFLA 1Q6QA 1W3IA 3KX6A 4HSOA 3S8HA 3U2OA 4GE8A 3UNDA 1PHQA 4ONVA 4OQVA 5EKYA 1QFEA 1TIMA 4NUWA 1IXNA 3HPZA 4JICA 2QCNA 2TSYA 2C3ZA 1LOLA 4BI7A 4UFHA 5D09A 3LCGA 2W6RA 4JN6A 1ADOA 3EX4A 3VKJA 3MUXA 3BV4A 3W1PA 4I9AA 4M5PA 3C8FA 1R2TA 3O63A 4TIMA 2OMAA 2VFFA 4MYAA 1FWNA 4YWIA 4GNJA 1YYAA 2VXNA 3P60A 1RQEA 4HSNA 4O50A 4NJGA 5E0KA 2YW4A 5U4NA 4AHPA 3B0UX 2C15A 1ZCOA 1QO5A 3UXAA 5D04C 2O7SA 2H3DA 1FY6A 1TJPA 3SSJA 1RZMA 3PSWA 4KFPA 3LCXA 4UTWA 3W76A 2QCMA 2QCHA 3OVQA 1XI3A 4UTUA 1JRCA 1FWSA 3G22A 2D73A 1LM1A 1W31A 4KKXA 2V2DA 3G1VA 4N2YA 4UTHA 3WK1A 3FJ6A 4QAIA 5DBUA 4POCA 3LTSA 4AVFA 1YXYA 5AHLA 4IX0A 3M5VA 3NL3A 2VENA 3N3MA 1A5AA 3B03A 5F1VA 4EIVA 4DBDA 4NX5A 5TQLA 2PCQA 3THAA 4MY8A 4PEKA 2QCDA 4K36A 3NM3A 3P62A 3TXZA 3NAVA 5KMYA 4QISA 3AJXA 3CWNA 3L0NA 3NQDA 4HIBA 1ZAHA 5EPDA 4Z1BA 3R8RA 1LRNA 1TPUA 3P82A 3TK7A 3M43A 3P84A 2C1HA 2Y7FA 1I2RA 3O6YX 1RVGA 1L9WA 3ABSA 4UC5A 2TPSA 3H55A 3OIXA 4N6FA 4P2VA 5AHIA 3A9IA 3LV5A 2DZPA 3NQGA 1ME8A 2Y70A 1FCBA 1EWDA 3UY8A 5D02A 3TKFA 1QPNA 3W1UA 1EIXA 3S1VA 1O4UA 2ZBTA 3SZ8A 3W1AA 1NEYA 1SR9A 5MHBA 1W3NA 3MI6A 1XCFA 1PS9A 2E09A 1JCXA 3W73A 1K8XA 1W5MA 2ISWA 5D33A 3LBMA 2VOMA 3QM3A 5G2IA 2ATMA 1HG3A 3TQ0A 3EKZA 2G96A 1TTIA 1TMHA 5SWUA 4GFSA 2OX1A 4O17A 5AHFA 2V0TA 2HS6A 6TIMA 3BARA 4CQAA 5F4WA 4JEQA 3DKJA 4JTEA 4K6AA 1W37A 3I7SA 4PL2A 3RMJA 3TDFA 1QPQA 3W7RA 3G3DA 1TV7A 1V5XA 4N02A 1SZFA 1OVDA 2G97A 3T40A 1H7XA 1NVMA 4QJ1A 4EOUA 1TPEA 2A1YA 3BK0A 4OE7A 4WJEA 4ADTA 1G4PA 5CZJA 2GQAA 1IGSA 1WX0A 4M6VA 1ZY9A 2Z1BA 2JGYA 2WPBA 1PIIA 3NNTA 3UXDA 1FX6A 1Q6LA 4UCGA 1TV8A 4ZQNA 1U5JA 1F2JA 3NQ6A 1DKWA 3UPBA 3T55A 3W7LA 5HQEA 1KBJA 4Y96A 4ADUA 2B7NA 2QJGA 4WQ6A 2X16A 1OG0A 4AF0B 5FEXA 4UR8A 1PHWA 3LCLA 1HO1A 3D0CA 4OGZA 3MBDA 5F2GA 3E9AA 2BLEA 2FQIA 1TTQA 3MYOA 4LC8A 2Q3OA 4RLIA 1ZENA 3LXCA 4GUHA 3R12A 4A2RA 3ELFA 4FX8A 1GVSA 1AW1A 1QOQA 2NXGA 3C2VA 3CC1A 2BSLA 4MPQA 3P80A 1R2SA 3KVMA 2ZZ5A 3FYOA 2HTMA 2WKJA 5D03A 1EP3A 2BWGA 1DL3A 4N6EA 1PCKA 5CSRA 4OT7A 1N7KA 5CG7A 3YPIA 2A21A 4ZQCA 1CW2A 1B4KA 3IIOA 1JCLA 3C3NA 1I2OA 5AHEA 1RV8A 2E77A 4MVAA 3GDTA 5D38A 2BTMA 1FWRA 2TRSA 4JTTA 3NGJA 4Q32A 2ZA1A 5IM51 2I14A 1X1OA 4LVBA 1CI1A 2NX1A 3FA5A 3NZRA 3A5FA 3PBYA 2VEMA 1PL9A 3TQVA 3G8EA 2GQ8A 3DZ1A 5FF0A 3O8AA 3LRLA 1VYPX 3QMSA 4RXFA 1N55A 2B7PA 5AC6A 3RK8A 1TSIA 3I65A 4JS3A 5LHFA 1QNVA 5FESA 3MP5A 3LV6A 1GYLA 4UFMA 3MO7A 1GYNA 4LVFA 1GWJA 1KM1A 3W7IA 3EX1A 2QAFA 2E6DA 2DZVA 3IGSA 3M16A 4M6PA 2J6XA 2NZLA 3EWUA 3UZJA 4L4LA 3B4UA 1YXDA 4JD4A 4O1AA 2B7QA 1W5OA 3U8GA 1BTMA 2ISVA 4FIQA 4NXSA 3NXFA 4ICNA 5I3IA 2ZRZA 3HG2A 4ZL1A 1GVOA 3GIYA 1LLZA 2C6QA 2YDAA 4CNNA 1O95A 3TU9A 4JIQA 3S1XA 2FB3A 2CLLA 2H8ZA 1KV8A 1XDMA 2EHHA 2ZZ2A 3DI1A 3PM6A 3EWZA 3MWAA 3PUDA 3MHFA 2Y6ZA 3EX3A 1YLVA 3QQ1A 5DBTA 4UXDA 1MZHA 4IQLA 1SW7A 1TQJA 1JRBA 4LVDA 1A5SA 2BXVA 2A5HA 3A23A 5DY2A 1LDCA 2WOQA 4H4IA 4K8HA 4A3UA 3GK0A 5BW6A 4H3DA 1QWGA 5LNWA 1X7FA 1MEIA 3TQKA 3UWVA 3KVKA 4UTMA 3GXNA 2P1FA 2IQTA 1LBFA 4NU7A 3BVJA 3STFA 4IGHA 3OG3A 5CZ0A 5HINA 3W74A 5AC8A 4MLRA 5KTLA 3NPXA 4PODA 4JIPA 3PG8A 1AL8A 3PSVA 4OHQA 3RF9A 1H50A 2R94A 3NOEA 4NT0A 4RXGA 3IIPA 4BI6A 1PE1A 7TIMA 2BX7A 4DF1A 4OV9A 1UB3A 2V81A 3HB9A 3C52A 3GAKA 4IUOA 5GVJA 4DPQA 2PRHA 5F2IA 2YPIA 1H5YA 3UWWA 1T99A 4CCEA 1RD5A 3S5NA 3S5ZA 2QJHA 1TPWA 1EX5A 3CPRA 3G3MA 5HUPA 4LUIA 5LGZA 4UFIA 4QNWA 3LGEA 2H6RA 4PCFA 3R13A 3MW7A 3O6CA 3PAJA 1OK6A 4MOZA 3DBPA 4O14A 4LOCA 3L5AA 3P74A 5D30A 5EA9A 3TV8A 4RZ4A 5K7JA 5HR6A 1T0OA 1XDLA 4XBSA 1XL9A 1QCWA 5I3HA 1T96A 5LNUA 2QUUA 3HPSA 2A7PA 2X1SA 3E12A 3HF3A 4WUIA 2F7FA 4O13A 1S3HA 1W54A 4B5NA 3TAOA 1YPIA 2Y89A 1G6CA 3NL6A 1UUMA 8TIMA 3RLUA 4AF0A 2WJZA 3BGGA 3BW3A 3G1HA 4PA8A 5C55A 1GEQA 3Q37A 2DJXA 3VI2A 1SO6A 4GUGA 4DO4A 4RCXA 1QOPA 1XKYA 3MJYA 4AWSA 5DXXA 3I6RA 3QJAA 3STGA 4JYFA 3S1UA 3C2RA 2Y62A 3GLCA 3SIZA 3M1ZA 4EF8A 4RKAA 4HT3A 1O60A 3DKLA 4KWVA 3A5VA 3M5YA 2J9ZA 2ZRUA 3C0JA 3VNDA 1TPDA 3C2FA 3F03K 2FJKA 1C9DA 4DO6A 3QSRA 3CEPA 2Y85A 3L21A 4LC6A 2V9DA 1JCJA 1IIHA 4FX6M 4M19A 3Q94A 1VLWA 3IVUA 2E68A 4O1DA 2A4AA 5BOOA 1EP1A 4JTIA 4JTHA 1AG1O 5BMWA 1YTKA 3W9ZA 1OK4A 4S2BA 2NX3A 1F6KA 3RNDA 4W9TA 3G1AA 4UTLA 3SR7A 3W1TA 4GC4A 1LROA 3QPYA 2W79A 3NQCA 1YTDA 1DOSA 1WYIA 4M7TA 1H7NA 2ZZ1A 2FPVA 1FBAA 3HGRA 5KZEA 1V7YA 1L6SA 5DCBA 5C2XA 3FKRA 2CLOA 3L0KA 1ZHAA 5AOUA 3R2GA 2CLFA 4FNUA 4K38A 4IMGA 1KBIA 3DGRA 2RDTA 2FIQA 1PCWA 2OCZA 3TXVA 1P0KA 1QAPA 4XTDA 1F74A 5G2HA 5T26A 5HJLA 2J9YA 2GPTA 4YMZA 3CLMA 5G1YA 1H61A 4TO8A 4OBTA 4DO5A 4ZQOA 3S5YA 1TCDA 4FF7A 3L65A 1LORA 2G95A 2GVJA 2DORA 4WY0B 5CZTA 1VH7A 6ALDA 4GBUA 4NJHA 3UWZA 3I68A 1QO2A 3LCFA 2Y7DA 4NXKA 2ZRVA 5L6UA 4XUGA 3W72A 1EEPA 3NQ2A 3WK3A 3W7OA 1JUEA 1TTPA 3GR8A 2V5LA 2OT1A 4WXYA 3FKKA 3PR2A 3PY2A 4LWWA 3ZWSA 5TBOA 1TREA 1HO4A 1E51A 1PVNA 1K7XA 1OFAA 2ISSA 3ZWTA 1H7WA 4HN4A 1TPB1 4BF9A 1Z48A 2TYSA 5L9FA 4WD0A 2WSQA 3V75A 2WQPA 4R34A 3TR2A 1OHLA 2Y7GA 3QH2A 4C1LA 2NUYA 5FF2A 1IXPA 4XWUA 3DFSA 1I2QA 2FFCA 1WBJA 1DJNA 3LI1A 1K8YA 3W2KA 1IXQA 2NXHA 4UFJA 1R47A 3BPWA 3VE9A 3KOFA 4KFOA 3N19B 4JGDA 1GOXA 1J4EA 4LV4A 1G7VA 2NUXA 5AB3A 4PFMA 1TPVA 3G1DA 3VCRA 1FWTA 3TNOA 1KM0A 1LLWA 4N9DA 4KWWA 3GDMA 1LZOA 2B4GA 3MHGA 3R89A 3TE9A 2A85A 3FEMA 1UCWA 4Y6GA 3W7QA 1UBSA 3PWAA 4MY9A 1TB3A 1Q6OA 4I7UA 3QZEA 3S1WA 3M5XA 3NQVA 1ICSA 1QPOA 3FLUA 3OHIA 2HMCA 3Q58A 5KINA 5DXYA 3ZFHA 4IXXA 4NVTA 3IEBA 4UTIA 1J2WA 3SW6A 2CZFA 1OX4A 1L6WA 2QDGA 1K03A 4LVGA 1JUKA 3P8IA 3KVJA 3NZ1A 2PE4A 3TROA 3GXPA 1GT8A 3ZS4A 4YL2A 5D32A 3NYZA 1S5VA 4YLWA 2FPYA 4N9CA 1TRIA 1OX6A 4UIOA 4QITA 1YDNA 4FXSA 4RK8A 4UTTC 3W7HA 4PC8A 5AFDA 3LB0A 3C61A 3MI2A 5IBXA 3HIJA 4GUIA 3W1QA 1ME9A 5FEWA 3LX9A 4G1KA 4JTFA 4O8RA 2YSWA 3KRZA 3IVTA 1JCYA 1ONRA 1FXQA 3KXQA 4JXCA 2ZFAA 1KTCA 3W1RA 3IIVA 5EL1A 2ZZ7A 3IIZA 1KFBA 4IMEA 3ATYA 1O94A 4PL1A 4ZQMA 1IIGA 2V2HA 2GVGA 2C0AA 3A22A 1W56A 3W2MA 3GDLA 2DZXA 3LLDA 3W2NA 2GVLA 4ORMA 4PTNA 1H7OA 1MXSA 1VPXA 3C4UA 5HWJA 3B05A 4GUJA 4AHOA 1D3GA 5HR7A 4A22A 1C8VA 1ZAIA 3T4CA 4BWLC 3QEZA 4TU1A 3DFNA 4TX9A 2V5BA 2JK2A 3W71A 2QKFA 3HG4A 4IPJA 3TW7A 3N14A 3DI0A 2WNNA 1OABA 1SFJA 3P61A 3LBCA 4MZYA 1HUVA 5CZSA 4O1CA 5A5WA 1G67A 1HL2A 2Q3RA 5D2XA 3LTPA 3CTLA 1H62A 1UUOA 4O16A 1K02A 1GQNA 1IF2A 3W7JA 5HUOA 1M7PA 2JKAA 2BZNA 4JDYA 3WJSA 2A7NA 3ZR4A 1GPWA 1SO3A 4QM1A 3W23A 3RU6A 3WJXA 4QNEA 4WY0A 4X2RA 1VR6A 3W7EA 3B0PA 3KVLA 1K7FA 1PV8A 1YXCA 2P0OA 2WNZA 5EY5A 3W2LA 3CT7A 3DXIA 3G1SA 3UWQA 2EGZA 3GDKA 1NSJA 2GJLA 4O4WA 2FPTA 2A2IA 3CEUA 1XBVA 3NEVA 3GDRA 2C14A 4WOZA 1SZEA 5KZDA 3DHFA 3HOJA 3PG9A 4AXKA 3UY7A 1AW2A 3L5LA 2YGYA 1LOQA 4Y90A 2DU2A 4IMCA 4K37A 4E0CA 1DVJA 1ALDA 3NVTA 4MUZA 4HPXA 3IRDA 2C13A 1KFLA 4TMCA 4AAJA 1FWWA 1ZNNA 1OFRA 4JY9A 4CCDA 4Z0SA 2UV8G 3IIXA 2EF9A 3LHTA 4OU1A 1KM2A 1DHPA 1LCOA 3KHJA 2A6LA 4LU0A 4FHAA 4UNKA 1TJRA 3W1XA 5CSSA 2DZSA 2ZZ3A 1YADA 2VFHA 3TSMA 1A53A 4JYDA 3N73A 3W1MA 3TCEA 3L68A 4WXZA 2E5CA 3QW3A 3CU2A 4LY8A 3E0IA 4FNQA 1EWEA 2YYUA 3LDVA 5CPOA 2HSAA 2DZUA 3HO8A 4AB4A 3F4WA 1FUYA 3M41A 1D9EA 3W87A 4X22A 3PVFA 3OA3A 2ZTJA 3U6WA 4YXGA 2NWRA 4MZ1A 3MI3A 3KAOA 2E6AA 1KFEA 4JTJA 2GOUA 2QCGA 3RFAA 3DAQA 3BG9A 1G4EA 1R2RA 3OBKA 3FFSA 3LLFA 1DBTA 1OFOA 1TRDA 2KZHA 2VFGA 4RJEA 4FNPA 3B0VC 2NUWA 5A8GA 3EX2A 2PRLA 2GJNA 4CLMA 1NF7A 4LT9A 1S5WA 2ZZ6A 1EP2A 1UASA 3LTYA 3B04A 4MFDA 4NNCA 2B7OA 3TFCA 1Q6RA 4ALDA 4AWUA 3N9SA 1LBMA 4XKYB 3TJLA 2VC6A 4GRSA 2Y61A 5FI8A 1YDOA 4RZ6A 4IMFA 3HGOA 2GQ9A 4O52A 3B8DA 2Y7EA 4IX2A 2TMDA 3KFTA 1JUBA 3TX9A 2H90A 1GG1A 5HULA 3HJZA 4DF2A 4NJIA 1JQVA 4NZJA 4HNUA 1TTJA 1GG0A 3BGJA 2H3BA 2V82A 4O0KA 4MJZA 5LHEA 2JKEA 3WK2A 1YTEA 1GVFA 1LYXA 1WV2A 4UNLA 1KM4A 4I7WA 2NV1A 3SFKA 3OEXA 3QC3A 1VRDA 2A6NA 4IXHA 1JCMP 3O16A 4O1BA 3P8JA 4A2SA 4U4MA 2QR6A 3M0ZA 3G0XA 1P4CA 2C19A 3S42A 4O10A 1G4SA 4JDBA 1VYRA 3W1LA 5D2WA 1JR1A 2JBMA 2ZRXA 2PURA 4ZZ9A 3GB6A 1SQ7A 4YCPA 4IMDA 1I45A 1B9BA 3C2EA 3I7QA 1QMLA 4WOQA 4R7JA 1P5BA 1ML1A 2ABBA 1VYSX 4ML9A 3E49A 4O19A 5BNKA 3IV3A 2DJLA 2Z6JA 3GZ3A 4EVZA 3W70A 5I3GA 1TPC1 3GYEA 4RZ5A 3IGXA 5E93A 5J5DA 2Z2UA 3TC7A 1XM3A 4JYEA 2QCEA 3CQ0A 3TUUA 4LV9A 1F05A 3W7KA 3S5OA 3FJLA 3HGSA 1KLZA 5LGXA 3EXRA 3QSTA 1G7UA 5EBUA 2R91A 3GNNA 4K8EA 4O57A 1H1YA 1EB3A 1VGAA 2QCFA 3NQEA 5D2YA 3DHDA 3T78A 1VC4A 2V30A 3EWXA 4ORIA 1OYAA 1KFCA 5LKYA 5KITA 1ME7A 2EAWA 2E6YA 1X8FA 5J5RA 1OX5A 1W8SA 1JQXA 3ABQA 5CPNA 4MYXA 2YZRA 5AYXA 2CLEA 1XBZA 4IWWA 3NL5A 2XFWA 4L4MA 3T44A 2CZDA 5H2ZA 2XN1A 1LRTA 4IJBA 4LRSA 3NG3A 4NJJA 3L0GA 1QDSA 4Z1CA 5C54A 2VFIA 3W85A 1L6YA 3NPWA 3PB0A 5F4SA 3S9YA 2X1RA 4HNVA 1L2UA 4XQ6A 3NQ8A 2PRMA 1BWLA 2RFGA 4UUIA 5G2WA 3CWOX 4DQWA 3DENA 4GJ1A 5AN7A 2G5WA 1FDYA 5K9DA 1H7RA 2PC4A 3GKAA 3C2OA 5HNRA 1FQ0A 4ZQRA 5HWNA 4JX6A 5LSMA 3LHUA 3S6DA 3JRKA 2AQWA 3MMTA 3MYPA 3MBFA 3O15A
chains in the Genus database with same CATH superfamily
1X98A 4IISA 3LRMA 1EBHA 5I78A 3BW4A 4JHZA 4FALA 2PTZA 1ITQA 3BG3A 1VCVA 4MB4A 1XW8A 3UR7A 3LM7A 4K7YA 2Z26A 3VE7A 2F6UA 3PZ9A 5FJOA 1Q45A 2OZ0A 4BR1A 1P7TB 3TA6A 3SDOA 3WDJA 1AK5A 3TJXA 2VI0A 4OBRA 4RNJA 2VL4A 1QNPA 2Y88A 1S2TA 4KCVA 4LUTB 3T07A 3AYRA 2OR2A 4O18A 3HQOA 5CLWA 4LEFA 1GVQA 5JBEA 5XINA 3SY5A 2DGAA 4ZO7A 3S6OA 4ROQA 1EGZA 2RDUA 2ZC1A 4AZCA 5FJIA 3K4DA 1XF0A 4KCUA 3I4EA 2ALDA 3ITGA 4M51A 5CGQA 1ZTVA 4P8UA 1EJUC 4NYYA 3KEHA 4UOJA 3MU7A 4GWEA 3BJFA 3SCRA 3O07A 4MNMA 4UR7A 1X6UA 1J0JA 2OGYA 4G1NA 3OG2A 1NU5A 1IEXA 3TC6A 1X1ZA 4XIMA 4NI8A 2VC5A 2CLMA 4A21A 5GNYA 2J7DA 4LBUA 3LPFA 1DWGM 1ZCCA 1W9XA 2IPFA 5HNUA 2Y63A 3OLDA 3VNZA 2YDSA 2BY2A 4Y9AA 2J7GA 3QW4B 3KUMA 3LSCA 4WDWA 2Y5JA 2XH2A 4E38A 2ICSA 3AYTA 1MI3A 3H54A 5C9RA 1B1YA 1NY1A 1PWMA 4LRTA 2WMHA 3L4WA 4LVAA 4MFEA 1W3TA 3SECA 1UZHA 1J93A 3EEGA 1WA3A 4Q4KA 2Q01A 2IW0A 3QHMA 4JEJA 2OFJA 4DXVA 3E96A 4F9JA 3M0LA 5KZ6A 1W5QA 3WN6A 1UZ1A 3LA4A 4LNYA 3WJZA 4XZ9A 2J7EA 2P10A 4NNAA 3T6CA 3ARPA 4Q8WA 1D3HA 3UR2A 1B31A 3A47A 3E1F1 4UWMA 5FF7A 1VZWA 1DQXA 2G3JA 2QCCA 3RILA 1I0BA 1XLKA 2EJAA 2FDMA 2QF8A 4DX3A 1IXOA 1ISWA 4MIMA 3A4WA 2W9MA 1XBYA 1XINA 2B0MA 2O55A 4H8NA 3G0SA 4R5EA 2X2GA 3BSGA 4MWAB 3DERA 1NH6A 1I2PA 1EYEA 5F2LA 3AS3A 2VGIA 3E2SA 3WLOA 1SJBA 3BLEA 3OBAA 5F7UA 1R46A 3ABOA 3GIPA 4TV6A 3SCSA 3NWRA 4N4PA 4F48A 1GJWA 3G1FA 3UCCA 4EKJA 1R30A 4Q7NA 4NY2A 2A0NA 4WDUA 3QFEA 1KCKA 1VPQA 4GCXA 3R25A 2CWNA 3F5LA 1PZ1A 3H2AA 1G0CA 4UTWC 1CECA 3FN9A 2FB2A 1V6TA 4GYKA 3O06A 1XXXA 3MSYA 3GBEA 5E6ZA 4ECLA 3ZLGA 4AMAA 4Z2IA 1UKSA 1WDRA 1XV8A 2ESCA 2Z6IA 3NCOA 4ICCX 1GOWA 4Y9OA 2Y0FA 3T81A 3R8GA 1P0NA 2E9MA 2WWCA 3QRHA 3BV7A 3BZGA 3C56A 1KR0A 4XZLX 3AAMA 3M0KA 1AZ1A 4KH2A 2GDUA 1DJQA 4OVXA 2WSYA 3N29A 1MDRA 2PDGA 4CD4A 1ZAJA 4HNTA 4IQEA 4L7ZA 2XVKA 1E1EA 2XZ9A 2IQ0A 1K7EA 6REQA 1AJ0A 3CUHA 3RXZA 3QYQA 4KRTA 5FCZA 3GG1A 3B40A 3G24A 5H91A 5DMMA 5DLCA 3UZ5A 3HGJA 2W0UA 4N9BA 1Y0EA 2PWDA 2OVLA 3NQFA 3L12A 2X30A 4X61A 1KM5A 3ARYA 2WJEA 3LHZA 5A2AA 1ISZA 1P1XA 3P81A 1M6JA 1PKNA 2AL2B 1JI1A 4I6VA 2PD9A 1LTDA 5C7VA 2QQ6A 3U4FA 1FXPA 1FCQA 1KV5A 2PDXA 1BF2A 2CZ5A 1RBOB 3CL7A 3OLGA 2EEXA 1TQXA 3TZFA 1XFBA 2DY3A 4FEZA 4O28A 2IXVA 1NOUA 4Y9MA 4H6RA 4LH8A 3N2XA 1WNOA 5LNRA 2E25A 4JFTA 1MFVA 1JPDX 3SO7A 4H00A 4W8LA 1XUZA 1Z9AA 4IP7A 1LOSA 2RGMA 3G1YA 4CQCA 1F3TA 2CFFA 3HQ1A 1TE6A 1TV2A 4QQ3A 3SJNA 4XUYA 4NAFB 4O54A 4M6UA 5T91A 5U7SA 5C9WA 5IHRA 3A21A 3TYBA 1LWHA 1BYBA 3GE7A 4ZB2A 2YL6A 3PS7A 2AGKA 5F2MA 3PTQA 1AL7A 2OZTA 2NW0A 5CC6A 3T7VA 2PWHA 3HA1A 3UW6A 1Z89A 1GOKA 1XIIA 1UJPA 1KRAC 4OZOA 3GNOA 4HA3A 2DIKA 1W5PA 2WO5A 1VQTA 4HHPA 2XDFA 2CXGA 4GXPA 4A4AA 1REQA 4US5A 3W2UA 3CHVA 1W1A1 2OJPA 4PEEA 4ZBCA 1V79A 1M5WA 3GU9A 4JCMA 1I9CB 5DCDA 1V3MA 4RE3A 4O11A 4LEQA 2ZDRA 3WFAA 3R0KA 4CQ8A 3M44A 3W7DA 1UR1A 4ZE5A 4NL1A 4GZJA 1KBLA 1DJGA 1ZP3A 4HYWA 1A49A 3CJPA 1WXJA 3N9KA 3T2OA 4ZO9A 2GSJA 3PUOA 2HQAA 1RY8A 1B57A 1LRQA 2DZWA 4XG1A 3AS0A 4WF7A 3MMUA 3ATZA 1OF8A 3EB4A 4XK2A 4N9EA 1XC4A 1W1PA 3ONCA 3HU7A 5FEZA 3L2IA 3W7MA 1DQWA 3WEOA 3EDDA 4L1GA 4CD6A 4AEOA 5ABTA 3FOKA 1E3XA 3L5MA 4AD3A 3GHSA 2FFIA 2IPGA 5DT7A 1CT5A 2FHCA 3VZZA 1W5NA 4JTDA 3P14A 3WQCA 4QSFA 2GGGA 2W92A 3G8RA 1F76A 3NZGA 3IK2A 3OZPA 1N8WA 2X7VA 4W8AA 1J96A 5CBIA 1F3XA 2BGNE 1JJKA 4HJFA 3VKAA 2AAMA 4TTGA 3W24A 4IIGA 2W27A 3WJYA 1BG4A 1J5TA 4RV8A 3EDEA 1LUCA 4LTSA 1FWAC 5A8OA 2E1WA 2C16A 4MY1A 2LLEA 3KL3A 4ZOAA 4O0ZA 4TVDA 4Q33A 3AMKA 3AU2A 5CPLA 3GDBA 1EDGA 4MJMA 4QAWA 4FB7A 3WBYA 3JZEA 1JZ3A 1KFJA 1ZFJA 1EF2A 1N8FA 4W7VA 2ISDA 1HQTA 3AMGA 3PHAA 1ADDA 4J2PA 3WELA 4UMCA 4H6KA 4RW5A 2XFFA 2OO6A 1AMKA 3KS6A 4HNNA 2NQ5A 2ZWYA 3IJ6A 3OVRA 2CPUA 3WQEA 2HWGA 4C5ZA 1X8CA 5AECA 3DC8A 3NQ7A 3OLEA 1Z44A 3SURA 2E5DA 3LCWA 1W3IA 3KX6A 4LYPA 3MCNA 3CK5A 1PHQA 4ONVA 4GLEA 4M1BA 2IMRA 1QFEA 1FWFC 1QT1A 3GFXA 4YTSA 1V8EA 4JICA 1OGSA 4DUOA 5BCAA 4BI7A 4GIYA 2EG6A 2W6RA 4JN6A 1LT7A 1BVZA 3OBEA 3VKJA 3W1PA 1VEMA 4TIMA 4RNHA 2PF0A 1VBHA 2VFFA 4MYAA 3PZMA 1O6IA 5GJPA 3LUTA 1TWDA 1F3EA 3H22A 4KERA 2R24A 4NJGA 2C15A 3KOYA 3WF3A 7PTDA 4HBKA 6TAAA 1X39A 2H3DA 1J10A 1V6VA 1CEOA 3PSWA 3VM7A 1K6AA 3LG3A 1LM1A 1W31A 1KD0A 3MT1A 1YIXA 3UG5A 5AHLA 1FKXA 3KCOA 3WLTA 3WYZA 5F1VA 4DBDA 3E6EA 2ACUA 1J5SA 3THAA 2QNEA 4JPGA 4X0NA 1RCOB 3CWNA 3BLKA 2ODOA 3M07A 1DWJM 1W3JA 3P84A 5FD0A 3OODA 2DIEA 1PO9A 3IV8A 4ZXOA 7REQA 2Y7FA 3UG8A 3REQA 3SAZA 3ABSA 4PBFA 4N6FA 4P2VA 5A3HA 3A9IA 2R82A 2DZPA 2Y70A 1FCBA 4UQAA 5D02A 2VUYA 3KE0A 2VEFA 3W1AA 3ZSSA 1NEYA 2PGEA 3U5UA 1SR9A 1HP4A 4B2DA 1JIBA 3MI6A 3VZXA 3N17A 3AHVA 1KCLA 1JCXA 3W73A 1K8XA 2ISWA 3DDMA 3UXIA 5G2IA 3EKZA 4ZCWA 2OX1A 6TIMA 4P7RA 4I8YA 3VIMA 2AQVA 3A13A 3IAQA 4PL2A 1RK6A 1EJWC 1WP6A 3HFYA 2WVSA 1OVDA 5C70A 4H9ZA 1NVMA 4HMNA 3BK0A 5HJXA 4ADTA 1G4PA 2HDJA 4DYEA 2GQAA 1GHSA 4LANA 4D6IA 5I5RA 3RM9A 1TV8A 1MRQA 3W7LA 3NQ6A 1CLXA 2HVOA 4QLLA 3AHYA 1KXVA 2PGRA 1K9DA 1DWHM 4KQNA 3DHPA 4ADUA 3P6LA 2QJGA 3FDKA 1AQFA 5FEXA 3VM5A 1PHWA 3N3TA 1EC9A 1HO1A 5E9AA 4H8HA 3E9AA 1GGOA 2BLEA 2FQIA 3H4GA 5BZAA 1VJSA 1ZENA 3LXCA 4LAUA 3R12A 2P88A 4A2RA 4CU6A 2XWEA 3VMNA 2J7FA 3P80A 4JOMA 1W9UA 1W1B1 1P7TA 3FYOA 2WKJA 1VFTA 2BWGA 1O1ZA 1N7KA 2A21A 1FWBC 4GPNA 1B4KA 3IIOA 4MHBA 1JCLA 1N82A 2E3ZA 2E77A 3RM8A 3RAOA 2TRSA 5FJUA 3VAVA 4H2CA 1U1JA 4PCNA 2ZA1A 4LVBA 2WMFA 5A6BD 2GOKA 3GTHA 3I6TA 3AZSA 3TQVA 1UQZA 2GQ8A 2H9AA 3RCMA 4BS0A 1WZKA 1POKA 1VYPX 4PRWA 4RXFA 1S1PA 2G37A 2B7PA 3RK8A 1TSIA 3I65A 4JS3A 3RM4A 5LHFA 3BZJA 3MP5A 1QW8A 4ZR8A 2CWXA 4DO7A 4LX4A 1GWJA 1KM1A 3W7IA 2QAFA 2E6DA 2UY5A 3RGTA 5MKGB 1UWUA 2J6XA 9CGTA 4Q4SA 3EDFA 1YXDA 4JD4A 1XHGA 4O1AA 1QTWA 3CTTA 3U8GA 1BTMA 1VFUA 3BCDA 4NXSA 3TZNA 2ZICA 2G41A 4ICNA 2VWSA 4B5SA 4EPBC 1VPYA 4XZIA 4KT2A 1A4MA 2DT1A 1GVOA 3GIYA 2YDAA 2FZBA 3B8UA 3VD4A 3T0CA 1O95A 2PI6A 4JIQA 3S1XA 2FB3A 3W82A 3WNLA 3S1GA 2EHHA 2ZZ2A 4MF4A 3KHDA 1BXNA 4LCQA 3MHFA 5DX7A 2HCVA 4B9YA 2Y6ZA 3ES7A 4PB3A 1YLVA 5DBTA 4AEEA 3OYZA 1SW7A 1ZLPA 8XIAA 3W01A 4HCHA 4RDYA 3N25A 3A23A 3H8AA 1OY0A 4AY1A 4H4IA 4K8HA 1WKYA 3GK0A 1EJRC 2QDEA 1X7FA 1O7AA 3TN3A 4EAMA 5DO8A 4HB7A 1ECQA 1CB2A 1HJUA 1LBFA 1C91A 2P1FA 1EOMA 5CZ0A 2AKZA 5JH2A 3CO8A 4JIPA 5CLTA 5LYRA 3NOEA 5EFDA 4D6JA 5JBDA 1VBRA 3SQMA 3AIVA 3WKZA 1PE1A 3VFCA 5FJTA 1BD0A 2WZTA 3WCZA 4DF1A 1NDVA 1MDLA 3QGAC 1CBGA 3C52A 4IUOA 3ITCA 1KQZA 3U3HA 4CCEA 4GKTA 3K8KA 1EX5A 1QUMA 3G3MA 5HUPA 3GXIA 2IKJA 5D9MA 1OIFA 5LGZA 3EA2A 2CNCA 3UR5A 4QBXA 1TV3A 2ALRA 3O6CA 4MOZA 2FTYA 3L5AA 3B8IA 4HVXA 4RZ4A 1EF3A 1GQJA 4LGXA 1T0OA 1FH9A 4XBSA 3MCMA 1T96A 2QUUA 4HN8A 3HPFA 4L9ZA 2C1IA 1AMYA 1S3HA 2F2KA 2FTWA 3N2TA 5CGTA 3TAOA 2Y89A 3NL6A 1LT8A 1UUMA 8TIMA 3RLUA 4AF0A 2Y24A 1UD4A 2Y5EA 5C55A 5AZ0A 3SFWA 2RJHA 1QW9A 4AXNA 4GUGA 2VGBA 4DO4A 2AMGA 4FOKA 1ZBKA 2PDMA 2PD5A 2G0WA 3I6RA 3QJAA 4W87A 5HATA 5CJ5A 1TJ2A 3U5YA 3C2RA 1OT2A 3VPLA 2JALA 2PGWA 4RKAA 3S5SA 2GGEA 1ODUA 3T08A 3VDHA 1UR2A 2DV0A 3M5YA 2ZRUA 3VNDA 3S3GA 3C2FA 1FFRA 5HK4A 4IM4A 2FJKA 3CNYA 4BY3A 4TTUA 2O4QA 2YB4A 4GQGA 1VLWA 1E0VA 4UZSA 3IVUA 4JTIA 5CQ1A 1AG1O 3PP7A 3W9ZA 1OK4A 4REQB 2NX3A 1F6KA 2WVVA 4DY1A 4QLJA 1AVAA 3TJ4A 1SYTA 2XGBA 2DFAA 1LROA 3QPYA 1YTDA 3R0DA 1BVNP 3E2VA 1YBQA 2FPVA 1FBAA 3HGRA 3TTEA 5DCBA 5C2XA 3OQ8A 4Q8NA 2AL2A 2WWDA 4ZB0A 3M0MA 2HPIA 4XB3A 4QHRA 5G2HA 4MWAD 2J9YA 3CLMA 1DJXA 4ZQOA 2OTDA 4MJ4A 2GQ3A 1XIDA 4F0SA 4FF7A 4DJDD 2G95A 3ZT6A 2GVJA 2DORA 1UPMB 4GQRA 1VH7A 4A05A 1FHDA 4PSPA 1UKPA 4OJYA 3LY0A 2XPKA 5L6UA 4XUGA 3VIIA 2DSWA 2NQLA 1EEPA 5EMMA 4MWAC 3AQUA 3WK3A 2PDUA 3GR8A 3L4VA 1IWAA 4WXYA 2QLYA 4DJDC 4M29A 5LXXA 5TBOA 4S39A 3GTFA 4YU1A 1K7XA 1P0BA 1H49A 1B54A 5ABFA 1Z48A 4D72A 1UR4A 4GO8A 1XIJA 1OHLA 4J3TA 4C1LA 3MY9A 4JFUA 3PNUA 2J8TA 1XYZA 1IXPA 3DFSA 1R38A 1I2QA 2FFCA 4CNSA 3WLJA 2G4FA 5E0FA 3E38A 1K8YA 3W2KA 2QUMA 3KZSA 4H04A 4UFJA 3VE9A 4GYFA 4LV4A 1KRBC 3CIVA 3LU2A 1K9TA 1H09A 1TPVA 4WDTA 3SUWA 3G1DA 3AIBA 4Z2HA 1LLWA 3AU6A 5AZ1A 2B4GA 4QX4A 3R89A 1JYVA 2A85A 2PFHA 3N12A 2BODX 1W9BM 1KFWA 3M5XA 1FA2A 3V5OA 1VP5A 1UOZA 2DVUA 4IXXA 4LB3A 4AISA 4Q4PA 1BXCA 3PAOA 4B92A 3ZS4A 2IXUA 1MUWA 4R85A 3IJ9A 4N9CA 3SB0A 2VR4A 2Y8VA 1P6WA 4FXSA 4UTTC 2VCAA 3W7HA 4PC8A 2WJFA 2W67A 4GIEA 3W1QA 1SJCA 2J66A 2V63A 1XH0A 1OCQA 2YSWA 3IVTA 3TTOA 3KXQA 2EJ1A 3UVAA 5MF5A 1TZ7A 1Q6CA 4FP1A 5EL1A 4N42A 4IMEA 1EO7A 3H7VA 5LA1A 3VOJA 4K3ZA 4ZQMA 4U31A 1EEXA 2V2HA 2C0AA 4XSLA 1SVDA 3A22A 1UKQA 3W2MA 1UD3A 1R3SA 3NOYA 2GVLA 4HK5A 4ORMA 2XIQA 2ZXDA 3C4UA 4GUJA 2XVLA 1R3TA 1ZAIA 3QEZA 4TU1A 2JK2A 4J2MA 4LAZA 3DYMA 3S2JA 3Q67A 3V4BA 3QYSA 3N4FA 3DI0A 2PLKA 2FZNA 2WNNA 2G50A 4XAFA 4JQ1A 2FVLA 1SFJA 3LBCA 3WBWA 4MZYA 1YW1A 3LGDA 4NILA 4O1CA 1A47A 3WDPP 1HL2A 4GI6A 1EJ7L 4B5VA 1ONEA 1H62A 4O16A 1FWEC 3WQWA 1GQNA 2NQJA 3CUZA 2BXYA 4GI9A 5B7YA 5BXSA 3VO0A 3WJSA 3VTRA 4YHEA 3ZR4A 1Y65A 3W23A 1PIGA 3EWCA 3RU6A 4WY0A 1Q4WA 3W7EA 5LA0A 1B5TA 5IXEA 3EDKA 3UZWA 3QLDA 3WLNA 3R11A 1FH8A 1JD9A 3G1RA 2CBVA 5G4HC 3CT7A 3UWQA 3GDKA 1X97A 4O4WA 2FPTA 3NEVA 3GDRA 2PWUA 1UG6A 4AXKA 1AW2A 2DU2A 4IMCA 2OG9A 3NVTA 5FA5A 1T40A 2WHMA 4MG4A 3LN3A 5E9XA 4TMCA 1X7IA 4CCDA 2A3AA 2EF9A 2REQB 4OU1A 1KM2A 2PDLA 5GQBA 4ACZB 4W5ZA 1TJRA 1E15A 3DHUA 2DZSA 1U5VA 2ZZ3A 2HK0A 3TSMA 1A53A 3N73A 3UXKA 4C6EA 5JUVA 2O9PA 4I6KA 1M9HA 4IGSA 1VBJA 4LY8A 4GC3A 3T0BA 2VURA 1ISVA 4PUKA 1FP9A 1UH3A 3ALGA 3M41A 4GJIA 2CHOA 4DWSB 3R94A 5H8PA 3PVFA 1GKRA 2OEJA 4YXGA 4E4FA 5LIWX 4MZ1A 1TMLA 1H2JA 2E6AA 1KFEA 3CZGA 3QKZA 4JTJA 3KTSA 4DWDA 3GH5A 2F38A 3RFAA 2RJGA 3BG9A 1DBTA 3F4VA 1A3WA 4FNPA 1AZ2A 5A8GA 1J2BA 2VWTA 3U2CA 4LT9A 1S5WA 2DUAA 1UASA 3LTYA 4MPKA 3FW6A 1D7KA 4GH1A 3WLHA 3STPA 5GNZA 4C90A 3PZOA 5CEWA 4GRSA 2WHKA 1BHGA 5FI8A 4AFYA 1US2A 4WKAA 4IMFA 3APTA 3HGOA 2GQ9A 2WKLA 1HJSA 1R86A 2Y7EA 4IX2A 1AH3A 2TMDA 3KFTA 3VGGA 1C92A 4HQVA 3K46A 1GG1A 3HJZA 1CXLA 4ENLA 4DF2A 1JQVA 3DECA 2H3BA 2V82A 5CPTA 2JKEA 1GVFA 1LYXA 1WV2A 3N2OA 1ONWA 4I7WA 1OM0A 1XPGA 4K1GA 2C7FA 3V5FA 1Z32X 1E5JA 3RR4A 1I0DA 1JCMP 4HTYA 3M0ZA 1QNQA 4S3KA 3ITYA 3W6MA 1VYRA 3W1LA 4W4QA 2ZRXA 2YDQA 1I45A 1B9BA 3C2EA 4WOQA 2I5GA 1ML1A 2J62A 2ABBA 3BOXA 2CHNA 1UPPA 3VDCA 4GZEA 1V3IA 3IV3A 2FZ8A 2FMNA 2Z6JA 4FF5A 3MUIA 3AZRA 2QS8A 1NFGA 2J47A 4O0QA 3R0UA 1GVYA 1HZYA 1A3XA 4JYEA 5HPCA 3QGVA 4J4KA 3S5OA 3CXOA 1KLZA 4HP5A 3B9NA 3QSTA 4K8EA 2DT3A 1C7SA 4O57A 1UR8A 3VGDA 1CLKA 4PTMA 1VGAA 3CZKA 2QCFA 4HNCA 1OZMA 1MRAA 1EIBA 3L2LA 3T78A 3FXGA 4NSBA 1OYAA 3TEVA 2E6YA 1X8FA 5J5RA 1OX5A 3CL8A 1LL6A 1RJQA 2OO0A 3ABQA 1LL7A 2VDHA 5EMYA 2YZRA 1XBZA 4UQEA 1RBLA 5BROA 1UR3M 3LD5A 4JN8A 4L4MA 2CZDA 2XN1A 4L56A 4LRSA 3NG3A 2FH8A 3L0GA 4D8LA 2VFIA 3W85A 1GW1A 1L6YA 3BUVA 1KGWA 4HNVA 1L2UA 4PUNA 3NQ8A 2Z1VA 2OELA 4LFYA 2RFGA 1Q13A 4V2XA 2GSEA 5AN7A 4G2DA 4JBRA 1J18A 1FDYA 3PJWA 3F5JA 3C2OA 4XV0A 2VCCA 4H7CA 3RU8X 2XFRA 4JX6A 5BU6A 3LHUA 3MMTA 3IANA 1UOKA 3H2EA 3LM3A 5FL0A 2QMJA 2VEGA 3QQ0A 1EX1A 4QQUA 2ONEA 2R1LA 1EJVC 2VDGA 4JTRA 2P53A 4QDPA 4J40A 2CLIA 2V3GA 1TUFA 1R3QA 3ZJKA 3G18A 1Y5VA 5AC5A 3SGUA 2EO7A 3W6YA 2BFGA 1L6GA 3PBWA 2OT0A 4AIUA 1V08A 2YCJA 3AO0A 3FSUA 4WK9A 4BQ3A 3MHUA 1XUUA 2J9XA 4HKPA 3IJQA 3O3RA 5TD4A 2RHGA 3GKFA 3ITLA 4E6MA 4AQLA 4EWND 1U83A 3GX9A 1N8IA 4DELA 3L9CA 4B9ZA 4XKYA 1MEHA 3WY1A 2ATSA 3DH7A 1YDVA 5DANA 4EXBA 2C71A 3ZT7A 1MNZA 1AJ2A 2YXGA 3FDGA 4RV3A 5D05A 2CLHA 5HWMA 2YCEA 3KRUA 4X9SA 3NQMA 4KESA 5H8MA 1TV5A 2YW3A 4RE0A 3UYCA 4AZGA 3IJ7A 2V67A 4CQBA 3TMQA 3BICA 4MJ2A 1FWDC 3K2GA 4MLJA 5A6MA 3M6DA 2I56A 3TWBA 1W9VA 4O53A 1P0EA 4Q8VA 2VEKA 2ZRWA 3CIXA 4O15A 1MMFA 5K3VA 4XTIA 3B9OA 4XBKA 1IT0A 3CV6A 1TCMA 4ERIA 4A8LA 2EKCA 3WLKX 5HBFA 1B90A 1X1NA 4UFLA 1V0MA 3PNZA 3RITA 4E4UA 3N2MA 1TZZA 4YTRA 8CGTA 4R9XA 3ITOA 4PMDA 2H8XA 1LJYA 3HTWA 1KA9F 3B9EA 1OGGA 1GOQA 5DRCA 1JNEA 4U2ZA 3UJFA 2HK1A 1XGEA 5D4YA 3ISIX 4PULA 3UPWA 3WBEA 3GIQA 2BY0A 4E2BA 2GUUA 1V0LA 3SUSA 2D20A 2QJIA 5HAOA 2ASHA 2PLJA 1Q6FA 4L6DA 3WLPA 1KKOA 3MZNA 5AY7A 3UWUA 3LS9A 1AH4A 1O5XA 1FHVA 3LHVA 2FKPA 3WX7A 5HDRA 2AKMA 3APGA 1MXGA 4UMAA 1HVQA 4K7VA 3BANA 1I75A 2DW6A 4FNSA 2XHYA 3NO5A 3VIKA 4IH3A 2GJXA 4F0MA 3CZLA 2OQLA 1OT1A 2QUVA 1UD5A 2VEPA 3S4TA 5XIMA 1GONA 2Z1KA 2J7CA 3NURA 1KR1A 2F84A 4PBGA 3THDA 1THFD 3EXTA 1TWSA 3H2NA 5G4EA 5FKYA 3OPSA 2WZEA 1NWRA 3PZTA 3PZVA 3R8HA 1VJZA 5IOBA 4FOJA 3IK4A 4OECA 2WJDA 2POZA 1GPFA 4EAYA 4P61A 2QAPA 5A8NA 1XLFA 2R8WA 1EA9C 4GJJA 4GNVA 4LPCA 3AXHA 4IFOA 3DFPA 1LQ2A 3N9RA 3WEZA 1UP3A 1W9PA 3R5EA 1Z6KA 1RA5A 1RUSA 1HTIA 1VEOA 2RGLA 1R3YA 4YWSA 3NPVA 3NL2A 3M64A 2BB0A 1TPFA 5HNTA 3LK6A 3FYYA 1TJ1A 1JF5A 1XJBA 3NQAA 4AMCA 3QFWA 1KM3A 1H51A 2JE8A 4QS5A 1SSDA 2J8FA 3AOFA 3BMVA 3B97A 2X8RA 3GBDA 4HD5A 2GK1B 5DY3A 1JVNA 1GEHA 2V69A 2BOEX 1H1NA 4GVHA 4C6IA 3LCHA 5C2GA 3WL0A 1WBHA 4QRNA 5FJPA 2OXNA 1IEQA 3MMWA 4ATLA 3UWEA 2V5DA 3J7HA 4ZQPA 3F4CA 3V1PA 1QATA 2XN2A 1I8JA 3KP0A 4P7NA 1B3OA 3W1NA 3ANYA 2VEIA 5BRBA 1F6YA 2YYTA 4DJFD 4AIBA 2V38A 3MKKA 4J9JA 2PDIA 1VBUA 1P1MA 3THQA 5G5IA 2XH0A 3ZM8A 2FLIA 3BWWA 3SN4A 5LNVA 4Q7IA 3WQDA 2WKGA 2Z27A 2GDQA 3QV8A 1AQ0A 1CLVA 4Y9NA 5E09A 3EZ4A 3D3FA 1OFPA 4DHGA 1SW0A 5CSUA 1IR1A 4OKDA 3TTYA 4KF1A 4DJFC 3HBLA 5K4XA 4JTGA 4DPPA 4MKSA 2V5JA 2QJNA 3EDJA 1SZGA 4BQ4A 4PUEA 3WF0A 5IBXC 1RR2A 4YPJA 4W8BA 3NR0A 4J3UA 3UZXA 3STEA 4O4VA 1KLYA 1XRTA 2JFEX 3GTIA 4BQ5A 4JIIX 4EACA 2WMKA 3AALA 1PPIA 3TP4A 1T5AA 1WCGA 2WW5A 3KDNA 4AX6A 3EWDA 2MNRA 3GY1A 3URAA 1O5KA 2XYLA 2PS2A 2Y5SA 9RUBA 2V2CA 1U2YA 2Q09A 4BI5A 3WEMA 6ENLA 1AFSA 3SUTA 1UMLA 4JQAA 3M5ZA 5I03A 4NZ3A 1KW1A 2XFYA 5LIYX 3P5YA 2YFNA 1VHCA 4Z1DA 5CPMA 3VGEA 3TW6A 2YJQA 5DN1A 3L66A 3E2RA 3U7BA 1E4NA 4LUJA 5IFTA 4KGJA 2P0IA 3F4NA 1F5ZA 2I1OA 1RJRA 4WY0F 2E4TA 2J78A 2OSWA 5EBAA 3KBSA 1KTBA 3WMLA 3PF3A 2OLHA 1SUXA 3B06A 2E6FA 1MQPA 1NARA 3QPEA 4FXJA 3PWIA 2A7RA 3GU2A 4KEVA 4Q8QA 1UUQA 4R33A 1B2YA 3H53A 4ZB5A 5C2CA 1E0WA 3MP4A 5AKQA 3MPGA 3ABXA 3O2LA 4E2DA 4DN1A 3LRKA 3I3EA 1MEWA 2PU0A 3WLSA 5D2VA 3LXAA 1MVYA 2X41A 4LYKA 1OX4B 3AS2A 4JX5A 4OOZA 2YZ5A 3VD9A 3BOFA 1W1YA 5EFFA 2XSAA 4Y8FA 1DV7A 1H1ZA 2NQZA 3BAYA 2ZXBA 4YTUA 3BXWA 1WZMA 3MV11 4IIDA 3GXFA 1XP3A 6A3HA 5KSWA 4JKLA 2J25A 2ZQ0A 4DIAA 3SI9A 2WM0A 3PC0A 5DT5A 2J27A 2I5IA 4IPPA 4TMBA 1A5CA 3P7YA 4HMDA 1OFDA 3W86A 3GR7A 1IQ8A 1CDGA 2VELA 1VS1A 2FGBA 2Q8LA 5BMXA 3I7RA 2HBVA 2P3ZA 4KFNA 1GUVA 3JZUA 5AHMA 4EP8C 5C9ZA 4HU3A 4AYSA 4BEUA 2O7QA 3W3OA 2EPHA 3MUCA 3CPUA 1J11A 3BCJA 4JTLA 2ZTKA 4B4HA 4ACZA 2HISA 3VKKA 3GAYA 2DP3A 2DH2A 1OC6A 3M0VA 2XU2A 4DJED 3SQSA 4KEUA 3BOLA 4FNTA 1E72M 1EUNA 1TV4A 4GVIA 5I3KA 3W75A 1JD7A 1YDYA 1Y8BA 4CVUA 1HT6A 5FEPA 3CAVA 1EZWA 3UQNA 1YPFA 1XLCA 4Z0JA 2NLIA 4DJEC 4FLQA 4XKMA 3VKDA 4H19A 3IGUA 3APYA 1U1HA 4GX9A 3IVSA 4QEHA 3TH6A 3VFLA 4IHCA 1PSCA 4HSOA 4GE8A 3UNDA 4QE4A 3OVGA 5EKYA 4Z17A 2VO5A 1ENUA 1IXNA 2C0HA 2C3ZA 3WQPA 3UU0A 1XYBA 3K1GA 3QBUA 4B3KA 3LCGA 1D2KA 1ADOA 5BU9A 4K8GA 1IEWA 3MUXA 3NO3A 3BV4A 2EG7A 4I9AA 3O63A 4JZ5A 4N0RA 2Y1HA 4GNJA 3H12A 1JZ5A 3K4AA 1YQ2A 5E0KA 5U4NA 4C60A 1ZCOA 4OOUA 4B5WA 4AU0A 3SSJA 1RZMA 4P8WA 3RLHA 3V0SA 2Z29A 2HRWA 4UTUA 2C8NA 1JRCA 1FWSA 2D73A 1VFLA 2V2DA 4E8CA 4N2YA 4HYVA 3GR4A 3GXDA 1YXYA 2FMOA 2UY3A 4IX0A 2NVDA 3M5VA 3N6QA 4PTXA 2XTKA 3N3MA 1K4GA 3WBAA 4EIVA 4OIFA 5TQLA 1ISYA 4YHGA 4PEKA 2QCDA 4K36A 1S38A 3P62A 3TXZA 3GZAA 4QISA 3AJXA 2VT0A 1ZZMA 2TODA 3W27A 1POJA 1EZ2A 3HMCA 1G01A 1LRNA 3TK7A 5CC7A 2C1HA 1TIWA 3AUJA 2ZOXA 2ZUNA 1TWIA 1C8QA 4L4PA 3O6YX 4IL0A 4UC5A 3OIXA 4LJ3A 4C6LA 1YHTA 2GDVA 3LV5A 1ME8A 2ISFA 3B9AA 1G94A 3JUGA 3W1UA 3ARWA 5A6SA 5A8PA 1EIXA 1QNRA 1XYLA 1O4UA 2ZBTA 3SZ8A 2IKHA 3V18A 3KCLA 4L61A 2IPJA 3RJYA 2E09A 1XLEA 1UIOA 2VOMA 1M53A 3KOWA 4HMCA 3QM3A 4DWSD 4PMVA 3R79A 1HG3A 1UH4A 3KBMA 3URQA 2HS6A 4B3LA 5HOSA 3AYSA 3TJIA 4CQAA 4FLRA 5M03A 5F4WA 2A3BA 3UVIA 2XVPA 4JTEA 1MW0A 4HMEA 2UWFA 4A8IA 4WLCA 1W37A 1RLDA 3NVDA 3I7SA 3RMJA 1QPQA 3W7RA 4N02A 4OUIA 2G97A 4J3XA 4F2TA 4S3BA 2WCSA 8RUCA 4M6VA 2Z1BA 2WPBA 2NT1A 3ZR5A 1PIIA 1IEVA 3UXDA 4AVNA 1Q6LA 1CGYA 1B3YA 1TELA 5T8GA 3UNTA 1E0XA 3UCDA 3KBNA 1NQKA 2VTFA 4ZQNA 4ZEPA 3GG7A 3HM7A 2HVMA 5M3WA 3B8WA 5JQ9A 4HZ6A 2R1PA 2B7NA 1LWIA 4Z2JA 3I4KA 3QVQA 2X16A 1NJJA 4HU0A 1AQHA 1OG0A 3LCLA 4FAMA 3D0CA 4OGZA 3T0AA 4HOWA 1Q6DA 3L4YA 3FVDA 2D24A 2NLYA 3PZNA 2AQOA 1TTQA 4Z2LA 2HE8A 4RZBA 2W4XA 4FX8A 4RNIA 1M7XA 3WF2A 5BRPA 4D6HA 3DN5A 4LCSA 2BSLA 2WANA 2FJUB 2HTMA 5D03A 4QDWA 1CWYA 4ZQCA 3DFYA 4XVEA 5D38A 1HP5A 4MVAA 2BTMA 4F0HA 1BRLB 3GYCA 4JTTA 3NGJA 1CI1A 2NVCA 3NZRA 5IDZA 1XIGA 1DYSA 3A5FA 3CQKA 3IARA 2R1KA 3G8EA 3CQHA 4CN6A 3C2YA 3PZIA 2I7GA 4XO6A 3CHEA 1MQQA 1BWVA 2GYIA 3KBWA 2OOFA 3ZZ1A 3RPTA 2VMFA 2BVTA 4AZ5A 2VX4A 3T05A 3LV6A 4JTQA 1ZUAX 1OD0A 3UZJA 4PYSA 2ISVA 1DWAM 1QXLA 2DSZA 3HG2A 2P5NA 1AQMA 4ZL1A 1LLZA 4G7FA 4URIA 1ODZA 3TU9A 1EDQA 2L5HA 2H8ZA 1KV8A 3V16A 1KKRA 3DI1A 3PUDA 3MWAA 2GUYA 3PJTA 1E9LA 4NAEB 1TQJA 1JRBA 4F0LA 2PMQA 2BXVA 1E73M 1XRVA 3WD4A 1LDCA 3NDYA 5LIUX 3N4AA 2ADAA 5ABGA 2YLAA 5LNWA 3TQKA 4NP7A 3AS1A 4KIEA 3GXNA 1ECEA 3EA3A 3BVJA 2A3EA 4IGHA 3VGFA 1Q85A 4QS6A 2FVMA 4D9PA 5KTLA 3VIFA 2CC0A 3H26A 3V3WA 3BAKA 3TWAA 4PTVA 3PSVA 4OHQA 3RF9A 3ITXA 3PFMA 4IPNB 5AYBA 4RXGA 2PPGA 3IIPA 4HNLA 5A6LA 1NFPA 3KM8A 1OEPA 1HKVA 4ROPA 2PTYA 3TOYA 1XQLA 3QOKA 4DPQA 5F2IA 1E4IA 1PDYA 3SUUA 2SFPA 3MS8A 3S5NA 3S5ZA 4R7WA 3UA3A 3CPRA 1PAMA 4F66A 5EMLA 4UFIA 4QNWA 4PCFA 1ZQ5A 2BDQA 3MW7A 3URBA 1OK6A 2POTA 4LOCA 1KGXA 2P3EA 3C0QA 3TV8A 3K4WA 3A12A 5K7JA 5HR6A 1XDLA 3WIJA 3I3DA 1QBAA 3NFUA 1PTDA 3AI0A 3QKEA 3E12A 2PAJA 1W54A 4B5NA 3E2QA 3ZSTA 3AZTA 1G6CA 2DQWA 4C6FA 4AY7A 7ENLA 2WJZA 3BGGA 3G1HA 1E4MM 5AYIA 4PA8A 2OSYA 2D22A 1SO6A 3KLKA 4RCXA 1BLIA 4KCTA 3WNKA 1ZPTA 4PCSA 7ODCA 3MJYA 1F61A 5ABHA 2JIWA 3BLLA 4C5YA 2VJXA 3S1UA 2QIWA 3ZLHA 3FXYA 2Y62A 4EF8A 2VGGA 2GWNA 3DYOA 2WMIB 4W7UA 3DKLA 2GK1A 4U10A 4C1NA 4DAIA 2QMKA 3QR3A 4PMYA 3F03K 2XSXA 4LBSA 4MMWA 2WZIA 1C9DA 4XX6A 3KZPA 4IJCA 3VOHA 3L21A 1HVXA 4LC6A 1CXKA 2V9DA 4H9UA 1BXBA 1GKQA 2ZWZA 3E5BA 3OJGA 3GUWA 1M41A 4RPQA 3SQLA 3WH6A 4C6JA 2E68A 1T8QA 1SZRA 4O1DA 4W89A 2XUCA 1W1TA 3CASA 4S3AA 2AOSA 5BMWA 3VOIA 4RNFA 2BY3A 2XVNA 4K68A 3CAKA 1TFVA 1KGUA 4W9TA 1FTXA 1OIMA 3G1AA 2WB5A 4UTLA 3SM0A 3SR7A 2DSUA 3ITTA 1WYIA 4FLSA 4MUPA 5CSYA 2RUSA 3WD3A 1ZHAA 5AOUA 1HJXA 3R2GA 3UR8A 4FNUA 1ZSXA 4IMGA 3DGRA 3HQNA 1EDTA 4L1WA 4AD5A 4XZHA 1W8GA 3CGTA 2OCZA 1P0KA 1E1CB 1F74A 5T26A 4CCZA 1GQKA 5G1YA 1KCZA 4TO8A 4DO5A 1TCDA 3QGKC 3VINA 3IRSA 2PDJA 1D8WA 1OQFA 1R3WA 6ALDA 2EPMX 1NM9A 1AJZA 1WXZA 4JTCA 3I68A 1QO2A 1EBGA 3R58A 4NXKA 3W72A 2QHAA 5A6AA 3QXBA 2BHYA 2X42A 3W7OA 1JUEA 1TTPA 4XD6A 2V5LA 1V3LA 3U48A 1D7FA 1QRQA 3G6LA 3PR2A 2CBJA 4AZBA 5DMYA 3MUY1 2BOFX 3NYDA 3VNYA 5C71A 1ESWA 2HXTA 1H7WA 1DEDA 4HN4A 1BAGA 1W32A 1TPB1 3C86A 3T1GA 2TYSA 1RXOB 4DBWA 5FF2A 4XWUA 5CJMA 3ZJ6A 3BQ6A 3VIHA 2CERA 3RIKA 3FY1A 3GUGA 4PCTA 2EKGA 3GW3A 3ANVA 4KFOA 3N19B 1GOXA 1UD8A 5M1TA 2NUXA 1FWTA 2FH6A 4M8UA 3TNOA 1BQGA 3XISA 1KM0A 4N9DA 4WEVX 4FPSA 1LZOA 1FWHC 3WQ4A 3TE9A 3MCOA 3VGBA 1TWWA 1UCWA 5D9NA 3W7QA 1H41A 1UP0A 4CD8A 1TB3A 3FEQA 1Q6OA 3P93A 4IICA 5ENLA 2BHZA 3SCUA 3FLUA 3Q58A 3AMCA 1S2UA 5DXYA 3AHTA 1DXIA 2E9BA 5JVLA 4ES4A 3SW6A 1OX4A 1ZBWA 1SJAA 3TROA 3A3HA 3GXPA 1GT8A 4J35A 4JTAA 1XSIA 4Y8EA 1O5QA 4YLWA 3W53A 2FVKA 2AMXA 3O7UA 4QITA 3Q45A 5HQMA 3LB0A 3MI2A 4BHYA 1MW2A 4ZOEA 2VVSA 4GUIA 3LX9A 4JTFA 4YYCA 4PUWA 1CIUA 1FXQA 1ONRA 3W1RA 3IIVA 5D8WA 3ZVHA 4D6GA 3FA4A 1QI4A 3GD6A 3UEQA 1O94A 2V6AA 4HHLA 4PL1A 1IIGA 1T41A 4H2HA 1W56A 3LLDA 3FAWA 1H7OA 2OYLA 3ICJA 1SMDA 1GCYA 2PEVA 3B05A 5I07A 1D3GA 4F2UA 4W93A 3IUDA 3MWCA 5DMNA 1C8VA 1UWIA 3WH7A 1ITUA 3C3UA 5ECVA 3DFNA 6XIMA 3VDBA 3VIGA 3MO4A 1SFTA 4Q6JA 1RCQA 2CETA 4I5RA 1OABA 2WHJA 3P61A 1KCXA 1UWAA 3NQBA 3B8VA 4PMQA 1R5YA 4H8VA 3CTLA 1UUOA 3S9ZA 3I6EA 4IG2A 1K02A 2MANA 1E9YB 3SADA 4GK8A 4LYQA 4JDYA 2A7NA 4E5TA 4MGGA 4QM1A 3WUFA 3WJXA 4QNEA 1VR6A 1WDPA 3B0PA 3KVLA 3R1ZA 2F2HA 2P0OA 8A3HA 5EY5A 4GYPC 4X63A 3W2LA 3DXIA 2YCLB 2PDYA 2VD9A 4YS1A 3T9PA 4WOZA 2C14A 3DHFA 1EPVA 1TA3A 1LOQA 3VX1A 1PIFA 4R27A 3UP8A 1CXHA 1XG3A 3LPOA 2E40A 3IRDA 2YA1A 3LQGA 1KFLA 4Q8PA 4AVOA 3RCYA 1ZNNA 1RH9A 4Z0SA 4KETA 3TR9A 4QJ4B 1LCOA 3RX2A 4H01A 1E0TA 2VQTA 4UNKA 2CXEA 1E55A 3RG6A 1JZ2A 4MNLA 3QC0A 4GBDA 3TN5A 1YADA 2VFHA 1DP0A 4JYDA 3RMEA 3L68A 4N7QA 2R1NA 4M82A 4BCEA 4FNQA 2YYUA 4I9TA 2DZUA 3HO8A 4AB4A 1BGAA 1S2WA 3F4WA 3BDKA 1D9EA 1K4HA 4LSBA 5FSEC 1N2VA 3CHFA 2NWRA 3MI3A 1NIUA 1QK0A 4CGTA 1BYAA 3UA4A 1XIBA 2RDXA 2Y8KA 5CJNA 1G4EA 1BGGA 1R2RA 2O9TA 3T09A 1TRDA 2OYMA 5FAGA 2NUWA 4RE4A 2PRLA 3SY8A 3VNIA 1OWQA 2GJNA 2QV5A 3WFZA 3MV01 2ZZ6A 3TFCA 4S3DA 4DVOA 1A3HA 5REQA 1E40A 4AZCB 4D1IA 3TJLA 4IL2A 2VC6A 4ZO6A 5I24A 2Y61A 1HJWA 2J75A 4P8XA 4RZ6A 3M0HA 3K5XA 1FWGC 3ARZA 4U5KA 5DQPA 3CMGA 4C6KA 3B8DA 3VC5A 1C8YA 4ZOBA 1JUBA 1RAKA 2OWCA 1U22A 3PPGA 4U33A 5I09A 1GG0A 3BGJA 4TUFA 4MJZA 3N2CA 2PZNA 5EB8A 3VNLA 3SFKA 3OEXA 2Z1WA 2YCKX 4IXHA 4LF2A 1YNYA 4JNYA 1W91A 4O1BA 3P8JA 2DQXA 2WNWA 2GVEA 3WL1A 3W38A 1C7TA 2C19A 4O10A 1G4SA 2XIJA 1QVBA 1L8PA 1ZGDA 4C65A 4ZZ9A 3GB6A 2QV4A 2FHBA 1Q2SA 1P0DA 4YN5A 1QMLA 1TJ0A 1P5BA 2HE5A 2VP8A 4ML9A 3E49A 4J7RA 1B0IA 3GZ3A 4QP0A 2OLSA 2ZX5A 2GJPA 2INEA 2CESA 4GQBA 5E93A 4B16A 3POCA 3WLQA 1WKFA 1HNYA 1F05A 1JCTA 1M03A 3HGSA 2R91A 1KRCC 4AIOA 1E9ZB 3A3XA 4GY7A 1EB3A 4UR9A 2WQDA 2HNHA 3CV1A 3NQEA 1VC4A 2V30A 2PDBA 4ORIA 2VRJA 4X60A 1EJXC 1W1IE 2EAWA 4I8DA 1W8SA 4G56A 7A3HA 2PBOA 4LQ1A 1XIEA 3WH8A 1LF1A 2CIPA 1MW1A 3VD5A 4Z1CA 1H4PA 3NPWA 2WCGA 4TX6A 4WCJA 4XQ6A 4UUIA 3N18A 2ZUSA 3DENA 4S3GA 4GJ1A 2XG9A 2G5WA 1ELSA 5H8UA 1MUCA 2XIIA 4MWAE 1IE7C 3MA8A 2VR2A 3AC0A 1FQ0A 2DVXA 4ZQRA 1RLCL 1A0DA 1HKIA 3JRKA 1OCJA 1WDWA 3TTSA 1S5MA 2QT3A 5TIMA 1G4TA 4CN1A 3AIWA 2YBVA 5AHNA 3AWNA 1HX0A 3GSMA 2WLZA 4NAEA 1PEZA 1XDJA 3SRHA 2VYOA 1GNXA 3FGCA 4F3HA 3W07A 3TIMA 1MWOA 4ZVJA 1RQHA 4JQ4A 3W84A 3GNDA 2WSRA 4CKQA 4XD3A 3A4JA 4Z08A 3NEHA 1V03A 2QUNA 1A5OC 4RDWA 4JNMA 4CVWA 4XVDA 5IDIA 4JX4A 1DORA 3F1QA 3E0FA 4OUEA 4DLMA 2G3MA 4JN7A 4D6FA 3ARRA 5F1UA 4OBSA 5I3FA 1XPYA 4ZA0A 1KFKA 3UD6A 5FOOA 3EOUA 3T0TA 3N2BA 3KBVA 2IS7A 3C0SA 3HPXA 1VCFA 1EXBA 1PX4A 3CQIA 6REQB 1BYDA 2VUNA 4KIRA 5BXRA 3DUGA 3PUEA 1CTNA 3MDUA 5LNSA 2CLPA 5I77A 1AW5A 1HN1A 4C7FA 2ZVIA 3UWYA 1FCUA 3ES8A 1SFLA 3HJEA 1I4NA 2E1DA 3RLGA 3W7PA 1V6WA 3HMJG 1J0HA 4LUSA 3W7CA 3QTPA 5HNNA 4G8TA 2XWDA 4JTKA 3PBUA 1FH7A 3S2CA 2OODA 2RKXA 3IWPA 3PULA 2NV2A 4Q7BA 4NRRA 5FF4A 1RPXA 2YA0A 2QVHA 4AZ7A 1H0IA 2VKZG 1R85A 1QHZA 3DFOA 3WZ0E 1V4YA 5PTDA 5A6BA 1R6WA 3EAUA 1GOMA 4OV4A 4B90A 2ABAA 5K2ZA 3F2CA 3VK5A 2VZVA 1CGTA 1ADSA 3NPUA 3MSGA 2V5CA 4F8XA 1OFBA 4O8AA 3AISA 2Z24A 5I02A 5C7HA 4G7EA 1US0A 5EMUA 4UFKA 1G69A 1EA0A 1Y5XA 1KNWA 2E5BA 3JS3A 4GACA 1WKDA 4NYUA 1NDWA 4LCRA 4M7SA 3UETA 2X1TA 3TLLA 3INPA 3M47A 4W88A 1O1HA 3GU1A 3HG3A 1RK5A 4GYJA 3EWBX 2YOCA 3WBXA 2HS8A 4F2BA 1REQB 5BYWA 4LALA 2E7FA 3OZOA 2W91A 3GH4A 4NQ1A 3WNOA 3C5QA 2A3HA 4K2SA 1OCNA 1Q6EA 1KRMA 4RR4A 1WDQA 1WQ5A 1BQCA 2XH4A 3NA8A 5D2TA 4AH7A 1CB7B 2CZVA 2Q8ZA 1XBXA 3MB9A 1KB3A 3L4XA 3M7WA 4H7ZA 4O1EA 3K30A 4ZXLA 1W3HA 4QE5A 1TZ9A 1E1FA 1TVNA 3KRSA 2NXIA 3CUIA 1H63A 1MO0A 3IGHX 4AW7A 1TR9A 1KBKA 3FAXA 4FXRA 2NWSA 1BYCA 4CN4A 3TNBA 1RCXB 2YBUA 2P8BA 3AMLA 2GZXA 4C6PA 5CC3A 3M0YA 3BLFA 1EQCA 2OSXA 1K8CA 5K4ZA 4AC7C 1XLMA 1XLJA 3IAPA 4U3CA 2YLLA 3EWYA 1ZBCA 3M9YA 1CPUA 2PUZA 3GXMA 3W4RA 4LS1A 3M0JA 3NZPA 4E3TA 3CQJA 1GHRA 5EU9A 4LUTA 3OA5A 4AZHA 4QG6A 2DZTA 4L6OA 5D37A 1UZDA 4LS0A 4KW2A 3W02A 1DIDA 4I90A 1X6LA 4IZGA 1T8XA 3B9DA 4M0XA 2FTPA 3GG8A 1HXJA 1XGZA 1RA0A 3OO2A 2WXDM 1M3UA 5LA2A 1LUCB 1XC6A 1ZBVA 1WZLA 2KX9A 4EPDC 2OWWA 2VX6A 1VENA 5I6SA 4IFKB 3STCA 2ZZ4A 5GJNA 4R53A 3VOGA 2YL5A 1F6PA 4EE9A 4WHBA 3BTNA 3U2ZA 2PGFA 1WOAA 4NJKA 1ZJAA 3L4UA 3QV9A 1S46A 5CBBA 5CKSA 3ORWA 4L9YA 2WK2A 4IOTA 1UC4A 3M4HA 4JFWA 1GJPA 4KRZA 1HL9A 2VCBA 3P2VA 4FOUA 3SCQA 2X1UA 2IUZA 1FCVA 1MNSA 1NOWA 3CBWA 1P43A 2WVUA 1XSKA 1TO3A 1EGVA 1SSGA 3NZQA 3WNMA 1HFBA 2PDPA 4H9MA 4S3FA 2XIMA 1GVRA 1IZCA 5AC7A 4JHOA 5C6MA 1K3UA 1TPH1 2GLKA 3WLMA 4QG9A 5I3JA 3A24A 3VABA 3LZ3A 4B3ZA 1W0MA 2JGQA 4ZO8A 3GVQA 3WK0A 3EPOA 3TYDA 4CD5A 1JXKA 1Q66A 5M17A 5HMSA 3WH5A 2J88A 4IQJA 3TYAA 1HJVA 2X0YA 1D3CA 3QMRA 1HGYA 1Q8JA 2YFOA 4D2JA 4HZ8A 4C7DA 3ID7A 1K77A 1OF6A 1H7PA 1E9IA 3DG3A 5FF3A 3M0XA 3MANA 4HNOA 3HG5A 3RRXA 4P7OA 3PZQA 3QPZA 4MWAA 1SFSA 1V93A 4FS9A 2GWGA 4RW3A 2VR5A 1K1DA 1XG4A 2C18A 4ZODA 3MP3A 1F7BA 4UOQA 2P76A 3SEPA 4DJDA 4B5UA 4C1KA 1NAL1 1WAUA 7REQB 4IIHA 4RDVA 3FHAA 1BKSA 3M6YA 5JBFA 3REQB 3ZLFA 4JTSA 3SCVA 4QE1A 2XGZA 1I6NA 4DI8A 1Q3NA 2BNJA 1Q5MA 3LCIA 2O9OA 1K9FA 3GNXA 4AWTA 3IJIA 2I9EA 1R9XA 4FO4A 4BJHA 2ZA3A 1CZ1A 1R3RA 4DF0A 3WF4A 1VKFA 1V3JA 1PB0A 1QR7A 3BLIA 4DXXA 4MZ8A 3LHWA 6XIAA 3DFTA 3ONBA 3LOTA 1VCGA 1BF6A 1IT8A 3G0UA 4ZSTA 1CXEA 2ACRA 3ABRA 5G4WA 3NDOA 3DU0A 3SN0A 2O4MA 1TWZA 2AGTA 4CEXC 4G5DA 3U9IA 4J3WA 4U28A 3T2QA 3W25A 5H6HA 4D6DA 4AD1A 2V8ZA 4CNPA 5EMJA 2QDHA 3VIJA 2J8GA 4A29A 3QF0A 4INFA 2ZUUA 4C6OA 5CBJA 4H9TA 3GM8A 1QPRA 1XR2A 3WJWA 2IQDA 5I7GA 3Q2DA 4JR5A 3V36A 4HPHA 5CAKA 1ZS2A 4NX0A 2PTDA 1EOKA 4UTTA 3CZJA 2D2OA 4S3JA 4M3PA 1EO5A 5CG0A 4L6HA 3H2CA 3RO8A 3TSDA 3EXSA 1VJIA 2CW6A 4QEEA 3O6DA 4HPJA 5E1QA 5DCEA 4BEQA 4HHHA 2WZHA 5DELA 2YR1A 4I7VA 2PDNA 4C91A 1Q6QA 3S8HA 2I5QA 4OQVA 2OGJA 4IP4A 1FFQA 3MMDA 1X38A 4NUWA 2DW7A 3CHDA 3HPZA 1IZJA 4M56A 2TSYA 1A4LA 1TUXA 2VGFA 3EA1A 3LZ5A 3SIMA 5D09A 3EX4A 2H9AB 3EOSA 2IKIA 4ERAA 4M5PA 3C8FA 1R2TA 3PZUA 4YJ5A 1XYMA 1P6BA 1YYAA 5T9CE 1RQEA 4I5UA 4O50A 4ML4A 4NAFA 2ACQA 4IIEA 1FY6A 2WSKA 4C6BA 3IJ8A 4KFPA 3LCXA 3W76A 2QCHA 3OVQA 4V1YA 1YNPA 3SBFA 1XI3A 3G22A 4KKXA 8XIMA 1XLIA 3G1VA 4U2YA 1J0ZA 4UTHA 3WK1A 3FJ6A 1F4AA 3V7PA 2YXXA 4POCA 3LTSA 4AVFA 1XH1A 4BF7A 1OC5A 4DZHA 3NL3A 1A5AA 3NTYA 1Y5WA 1QWKA 4NX5A 2W66A 3P0WA 2PCQA 1MXDA 1J0YA 3NAVA 1JDAA 3W0KA 2DSKA 4LF1A 4UQCA 3L0NA 3NQDA 4HIBA 1ZAHA 4L4OA 5EPDA 3WG6A 1JAEA 3OLIA 3R8RA 9XIMA 1IEIA 4HA1A 5E70A 4MDPA 2VM8A 1L9WA 3H55A 3CUFA 1E6ZA 4B91A 4GQQA 3OHMB 3BAIA 1NWSA 3NQGA 1L6FA 1E0UA 3TKFA 1QPNA 3ANUA 4JIEA 3THCA 3CMJA 1JYNA 5JIWA 3O0FA 2Z4GA 3S1VA 1E5NA 5MHBA 2HPMA 1JPHA 1XCFA 1T6MA 1PS9A 2G3IA 1BSIA 5D33A 3LBMA 3VKCA 2G96A 5SWUA 3B8SA 1UIPA 4GFSA 4O17A 4JNZA 1ONXA 3BARA 5LIKX 4CU8A 1UHVA 4JEQA 3SRDA 3PTKA 3DKJA 1I1WA 2WBKA 1VFSA 1ZJBA 1CGVA 3VILA 3VVGA 1JGMA 3G3DA 1TV7A 2VX7A 3ZO9A 1SZFA 2PDCA 3N15A 3T40A 2WYSA 1H7XA 1MYRA 3NJ3A 3BL3A 4QJ1A 3VIPA 2A1YA 4WJEA 4EOUA 3N6JA 1GQIA 1IGSA 3FCPA 1WX0A 2MUCA 4AX7A 4IUGA 2JGYA 4LAOA 3NNTA 3BCFA 3E0LA 4IT1A 3BH4A 3THUA 1U5JA 1F2JA 3UPBA 1DKWA 1RPKA 3T55A 2JEPA 3KWSA 3PUGA 4JIHA 1XYFA 4NF7A 4Y96A 5XIAA 1UP2A 4BF5A 4AF0B 5HPOA 4UR8A 1KWGA 4NZCA 4H9YA 2PC8A 5F2GA 4NZ5A 4C6DA 2HROA 4MB5A 3AJ7A