3EXSA

Crystal structure of kgpdc from streptococcus mutans in complex with d-r5p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
208
Chain Sequence
LPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
molecule keywords RmpD (Hexulose-6-phosphate synthase)
total genus 77
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3exsA00
2V2HA 3NG3A 3FEMA 4WZHA 5IM51 1W0MA 2CLKA 4UMCA 4BI6A 2E6FA 1GVFA 1NEYA 4WJEA 5FEZA 1PHQA 3Q58A 2Y89A 3L5LA 4O1BA 3I7RA 3DENA 3CT7A 3NQDA 4ONVA 5FEXA 4JS3A 1M6JA 3LOTA 1P5BA 3W2NA 1O5KA 3EX6A 4N6FA 1W8SA 3MP4A 3QMRA 3W1NA 5HWNA 4RXGA 1W1ZA 1D3GA 4GJ1A 2ZA2A 3G0UA 3UWZA 3BGJA 3TW6A 5CGQA 5I3IA 5LSMA 3LM7A 1LZOA 3GXTA 1ZAJA 4JX5A 1GJPA 2E6AA 1KV5A 3GDMA 2EKCA 3W74A 1RV8A 1R30A 3MP5A 5SWUA 2QJHA 4ZMGA 2YPIA 4EVZA 3N14A 2RHGA 4JTSA 2V30A 2GUUA 1WAUA 1SO3A 2EPHA 1SSDA 3T4CA 2Y7DA 4ZQRA 1SO4A 3TNOA 1IXNA 3TE9A 3W7CA 4K6AA 1LORA 4MFDA 3W1AA 2QKFA 4A3UA 3MP3A 2X2GA 2QF7A 1GVRA 4ZQNA 2PRMA 2YZRA 2ZDRA 3G1AA 4WUIA 3WJSA 1I8JA 3W1UA 1LTDA 3CEUA 4UTMA 3G0SA 1YDVA 1TSIA 4IMEA 1G69A 4FNQA 1VCGA 1FWSA 1V5XA 2V2DA 4WD0A 2J27A 3FYOA 1W3IA 1OFQA 2YW4A 4MVAA 3W70A 4QM1A 1R47A 1H7RA 1S5WA 1KFLA 4E0CA 1C8VA 2QCLA 1RVGA 3EWWA 4JTIA 2ZYFA 4YL2A 3LCXA 1T96A 3PC0A 4JTUA 4N4PA 1ZCOA 4HT3A 1TPFA 1NF7A 3W75A 4LWWA 2FB3A 3VNDA 2JK2A 3DKJA 1QFEA 5ABTA 1TO3A 1DQXA 4OU1A 3RU6A 2NX3A 2X1TA 5AYYA 3THQA 4UIOA 4KWVA 2GVLA 2WSQA 2V8ZA 1THFD 4NX0A 5CZJA 1N55A 3NQ2A 3PY2A 5FF3A 1SZFA 4O13A 1W5NA 1NFBA 2AGKA 3T7VA 4GUHA 4Z1CA 1SU5A 1N8FA 3QFEA 5AC7A 1SSGA 3MHGA 1H51A 3R2GA 1FWRA 1TJPA 4N2YA 1ME9A 1FWTA 4UMBA 4IGHA 1OK6A 2C3ZA 2GQAA 4K38A 1LBFA 2V5BA 2NX9A 3W7IA 3LRMA 5DY3A 1BKSA 2C13A 3GAKA 4N6EA 4OV4A 3O1NA 1I45A 2WNQA 7TIMA 3QF0A 3WJZA 1GWJA 4WXYA 4RJEA 4UTWC 4Z0SA 3M5YA 3W23A 2BTMA 4ICNA 4PFMA 1J4EA 3PBWA 3MBDA 3UD6A 4RCXA 1QPNA 1OK4A 3HPXA 1F73A 2Y88A 2Y61A 3IGUA 3GDLA 4MFEA 3USBA 2VFEA 4U4MA 1V7YA 5AC6A 5BW6A 4CCEA 4UR8A 5KZEA 4DPQA 3FFSA 3M5ZA 3ATYA 4LU0A 3WJXA 1F05A 4NXSA 3ZWTA 2NUXA 1AL8A 1L6YA 1W5MA 3HG3A 1OG0A 1VRDA 3FYPA 5LNWA 3NPWA 1YYAA 2Y7GA 2DZWA 5C54A 4O50A 1TRIA 3RMJA 1PCWA 1ZAIA 4CNPA 4EF9A 2E6YA 5LHFA 2FPTA 2RFGA 1VCVA 3BW2A 1SQ7A 2B4GA 4WOQA 1H62A 4G1KA 3TJXA 4EOUA 1FWNA 1TTJA 3F4NA 3UWUA 3QYQA 3DHFA 3IIZA 5LKYA 1OYBA 2EGZA 3W7NA 1U83A 4GE8A 1Q3NA 5HUPA 3VI2A 3UXDA 5DXYA 3MWAA 5T26A 4LRTA 3MYOA 3NPXA 4JX6A 3S0CA 4AF0B 1GTEA 4S2BA 1L6WA 1X1OA 4O19A 4AWSA 1KM4A 4N9CA 4ZQMA 1I2PA 3C4UA 4MZYA 1A5BA 3LHTA 3W1QA 3PAJA 3TR2A 1L9WA 3QQ0A 3QMSA 4M7TA 1I2RA 1OFOA 1GVQA 3QH2A 2QJIA 3SJ3A 2ZRWA 4JTHA 2GVJA 1H50A 1WOBA 2FDSA 2EF9A 3G18A 5TQLA 3G3DA 2WNNA 1TQXA 5LNVA 1LRQA 5CPMA 3K30A 4PA8A 5HQEA 1I2OA 2JKPA 2ZTKA 1XCFA 3WK3A 1OYCA 2B7OA 3ANYA 3TK7A 3NZ1A 1B4EA 4XQ6A 3LV6A 1PIIA 2JGQA 2CLLA 4OHQA 4HNVA 1B57A 3M0ZA 3PWAA 2Y63A 4TIMA 1HG3A 3V75A 2P1FA 4ZQPA 2BZNA 2YR1A 1ME7A 2CZDA 4K7YA 4Z1AA 1Y0EA 1TCDA 5F1UA 4Q33A 2OT1A 4AHOA 3C8FA 2AQWA 3I7QA 1Z42A 3KRSA 1Z48A 2PE4A 3R5EA 1B3OA 4RK8A 4I7WA 2E5DA 1FWWA 1VR6A 3EWUA 1K8XA 1WBHA 4WQ6A 4IMFA 3TV8A 1OX6A 3TMQA 4NX5A 3CHVA 2ZBTA 2BX7A 1OX5A 4TU1A 3SECA 4JDBA 4RKAA 4HN4A 4GUGA 3M43A 4LTSA 1I4NA 1X1ZA 1G4PA 1LRNA 1W3NA 4L4MA 1KM3A 1ZNNA 3EXTA 3DI0A 4AAJA 1MZHA 2YFNA 3KFTA 2G97A 3UWYA 4BFAA 1K7EA 1ZJIA 2ZZ4A 3W7MA 1TPH1 3W72A 3LCIA 1L2UA 3BK0A 2GPTA 4WY0A 1QMLA 1EUAA 5FF2A 1H7OA 1VPXA 4IJBA 4IMCA 5HMSA 2CZEA 1I2QA 2DJXA 3MUXA 5D04C 3CWNA 4S1FA 2CLHA 5KZDA 1YDOA 4NVTA 1P0KA 1DOSA 4O54A 3M5XA 2FTPA 2A85A 3A5FA 3LV5A 3W7RA 4CCDA 2ABBA 1P1XA 3IV3A 3TC7A 1QDSA 4H6KA 2XFWA 1K8YA 3MI3A 3N9SA 4OV9A 4C1LA 3M5VA 4Z1BA 2ZZ1A 3N19B 3GZ3A 1KBIA 2ZRXA 4MYXA 2A7RA 3UYCA 3L68A 4RZ4A 1LOSA 4OWGA 3MI2A 4LUIA 1PE1A 3G1YA 5I3GA 3W7OA 4NZFA 2Y85A 3DAQA 3GK0A 4Z08A 4UFJA 4PL1A 3T78A 4TMCA 4RX0A 2GJNA 1ICSA 3TFCA 4FEZA 3NEVA 4WY0F 4QSHA 4K7VA 5HNRA 4MOZA 1XFBA 3O8AA 5D2WA 3TUUA 5C55A 2G5WA 2Y70A 3ZWSA 4BI5A 3VE7A 3I7SA 4I7UA 3TAOA 2D73A 3INPA 4K36A 1AMKA 4FXRA 3W7LA 1WBJA 1O60A 1XDMA 1JCMP 2YGYA 4GRSA 4N02A 1QO2A 3SSJA 5E1QA 5D2VA 4ML9A 1QOQA 5BMXA 5TIMA 1G7UA 3PR2A 1EWDA 2XN0A 4JNMA 4MZ8A 2V2CA 1SW0A 1PS9A 3M16A 4GNJA 4O16A 1KFEA 5IBXA 1S5TA 1MEHA 4WOZA 4OE7A 1ZENA 3PB0A 4O15A 3TAKA 3W73A 1JQXA 1HFBA 4O1CA 4Q32A 1F6KA 3QJAA 3R8RA 3GKAA 3L2IA 5HR6A 4RR4A 5D2YA 3TQKA 4GUFA 1JUEA 5E93A 1UJPA 3TXVA 3OVRA 4PL2A 3NDOA 2CZ5A 5K4ZA 2NV1A 3P61A 3NNTA 4H3DA 5CKSA 1FCQA 2ZA3A 2OT0A 4AB4A 4FNSA 3G1FA 4HNTA 1FDYA 1K7XA 1MXSA 4O1DA 5AYZA 3MHFA 1S3HA 2A4AA 5D30A 1KV8A 4JD4A 1W37A 3CIXA 3W2KA 4UTHA 4QNWA 2WNZA 4IMGA 4O4VA 2Q8ZA 4NNAA 2QCFA 1VYSX 3P8JA 3LI0A 2C15A 3TW7A 1TMHA 5AB3A 5F2MA 5C5YA 3BVJA 1YXCA 5EBUA 1PL9A 2HMCA 2IQTA 4M5PA 1GG1A 1QCWA 4UTKA 3BG3A 4O11A 3KVMA 2GVGA 3VKJA 4ZQCA 3LTYA 4QIUA 1DORA 1BWLA 1WOAA 3UY7A 4ADSA 1O5XA 3G24A 1OFEA 4Z0JA 5J5DA 2W79A 2V9DA 1IXPA 3LRLA 4JTGA 5D09A 3E0IA 4AF0A 3STCA 2WQPA 2YSWA 2QAFA 1OFPA 3S5ZA 1YTEA 3LLDA 1XUZA 3QW4B 5FEWA 4OGZA 3G8EA 3TH6A 4JTJA 3DU0A 1H60A 2VEKA 5AHNA 3KX6A 2R14A 5DLCA 1KFCA 3P7YA 2Z6IA 1R2TA 3JRKA 5AHEA 2CLOA 3LI1A 3FJ6A 2ZFAA 1IF2A 3MI6A 4QQ3A 5KINA 2W0UA 3TQ0A 1CI1A 1NAL1 3W86A 3BW3A 3P5ZA 3GXPA 2CW6A 1JCXA 2YDAA 3N2MA 4Y6GA 1KM0A 1AK5A 3ABSA 2E77A 4MLJA 3M9YA 2YYUA 2ZZ7A 4NJGA 3EWYA 3I68A 5K4XA 4LVDA 3CIWA 4UR7A 3LB0A 2ZCGA 1LBLA 2H8XA 2DZTA 1VHNA 2NLIA 3NXFA 2E6DA 4UTTA 2I14A 3QSRA 4NZJA 3DGRA 4GUIA 1LDCA 2GQ9A 2ISWA 2DORA 5HULA 1JQVA 4FNRA 1EP1A 1XC4A 4NU7A 4R34A 5K7JA 1F6PA 1G4SA 3MO7A 3E02A 3CTLA 1WA3A 3U2OA 5L6UA 3LHZA 4A22A 1JCNA 1XL9A 4UTJA 4UXDA 4S2CA 2ZRVA 3HBLA 4O18A 4Y90A 1SO6A 3TFXA 3H55A 1LBMA 1X6UA 3STGA 5BMWA 2YCEA 1Z41A 2VELA 1F7BA 2VFFA 3P82A 4YLWA 1DHPA 2VKZG 2EHHA 5BOOA 4HNNA 4KKXA 3B04A 1GEQA 4JR5A 3RFAA 3TSBA 2DZSA 1KA9F 3NM1A 1KM6A 1EP2A 3C2OA 3GVGA 3RLVA 4JICA 3L5AA 1OF8A 4HKPA 5CSSA 1M7PA 3B03A 3NA8A 1GQNA 1OFDA 2FJKA 1TB3A 4TO8A 3LBMA 2YYTA 2P0OA 2VEPA 1R2RA 3G3MA 3HPSA 5EYWA 1M7OA 4IWWA 2Y62A 5EPDA 1PVNA 3L66A 3NL3A 3TDFA 4IX0A 3CLMA 1MEWA 1KM2A 2ATMA 4JXCA 5BNKA 1XI3A 4MYAA 1TPUA 5J5RA 4FNPA 5KMYA 3PB2A 1XM3A 1UBSA 2NV2A 3KVJA 4A21A 3EKLA 3EB2A 3NQGA 3O06A 4Q4KA 4UNLA 1WV2A 2G96A 1EEPA 3RF9A 3SY5A 1SW7A 3C2FA 4HSOA 2ZRZA 5HWMA 1TV7A 2QDGA 2C16A 4QISA 2PURA 2Z1BA 3OIXA 3PF3A 1JCLA 3FLUA 3L5MA 3M47A 1TPWA 5FESA 2TRSA 1VHCA 3HQ1A 3TA6A 5D2TA 3W3OA 3UXAA 1H7PA 3W2JA 3P84A 2XN1A 4RXFA 1VYRA 2J9ZA 3W7DA 3B06A 2V81A 3PUEA 2VFHA 3EKZA 3NQFA 3BLIA 2OZ0A 2QUVA 1HO1A 1RQBA 4HNUA 3HGJA 3W07A 4FNUA 1M5WA 4XTDA 5D32A 5G4WA 4X2RA 3GB6A 2FB2A 5D03A 3MBFA 1WQ5A 4PEKA 5D02A 2A21A 2TYSA 3O6YX 1QPRA 4RV8A 4XBKA 2C19A 1GVSA 1ZFJA 3W76A 5FF0A 5U7SA 2C18A 1K8ZA 3BGGA 2VXNA 1TTPA 3IIPA 1LOQA 5G5IA 3T44A 4NNBA 1Q6QA 3KVKA 2V5LA 1KFBA 3W1RA 2RH9A 4JYFA 3VE9A 4UTIA 2AAMA 3R89A 2X1UA 1TPC1 3W7HA 3ELFA 2CLFA 4YXGA 4JTEA 4E2DA 3C52A 3NGJA 2Y7FA 3LCWA 5HJLA 4JY9A 1P0NA 4A2RA 4X22A 4IXXA 4LS0A 1PHWA 2A7PA 5AOUA 2OCZA 4UFMA 3GNNA 3BPWA 3W2LA 1LROA 3A9IA 1NSJA 4PC8A 4KFOA 1F2JA 4FF7A 3S1XA 5AFDA 2W6RA 3O6CA 2E5CA 2O7SA 2QAPA 3FKKA 3UPWA 3P81A 1U5JA 6ALDA 1GT8A 4IX2A 2ISSA 1DVJA 3P5YA 3DBPA 1HTIA 4B5NA 5FEPA 3NQVA 1G4TA 4JGDA 2Y7EA 1AL7A 4FX8A 3NL5A 3PSWA 1A5AA 3W2UA 4UUIA 4LT9A 1EPXA 4GXMA 4NJIA 2WPBA 3H53A 3SFKA 2C14A 4LUJA 2DZPA 4N9BA 5BRBA 5KTLA 4DO6A 4CQ9A 1QWGA 2QCEA 4FX6M 3O05A 3N34A 4X3ZA 3TKFA 4X9SA 4AXKA 2H6RA 4UFKA 3WK2A 1VZWA 1G7VA 4DPPA 1K3UA 2E5BA 1JUKA 1EP3A 3GIYA 1LLWA 4R33A 2QJGA 1VCFA 3NVTA 4MUZA 4LS2A 1S5VA 1D3HA 2J9XA 4JX4A 2QCNA 3GLCA 3E12A 4JIQA 3EXSA 3TJLA 2WV8A 4JY8A 3NQMA 3S1VA 4NQ1A 3NL6A 4BI7A 3RLUA 3LCLA 1DL3A 1IIHA 3KAOA 3UWVA 3NQCA 1QOPA 1I2NA 1H5YA 5EY5A 4UTLA 2I1OA 4I9AA 3UZ5A 3A22A 4AHQA 2NXGA 2J6XA 2ZA1A 1MEIA 2CLIA 4EWND 1GTHA 4Y9AA 3SGZA 1O95A 3SR7A 3WFAA 2FIQA 4M19A 2JKAA 1K7FA 3G1VA 1JCJA 1UCWA 3LRKA 3O15A 4A29A 3IVUA 3NOEA 1PV8A 3W2MA 1H61A 5CZSA 2BSLA 3HG4A 2PRLA 3R13A 4E38A 1OVDA 2E1DA 3AO0A 4RZ5A 1UASA 3V1PA 8TIMA 3KVLA 3W88A 3Q94A 4UMAA 3BARA 3LXAA 4FB7A 2ZQ0A 3GR8A 1YADA 3P60A 3NQ7A 3WK1A 3B0VC 1DBTA 1VYPX 3BLFA 1OFBA 3VFLA 1SW3A 4YCOA 1Q45A 2KZHA 3RNDA 5LGXA 2RDTA 3IVSA 1SPQA 2B7PA 2X30A 5IBXC 3ABRA 4BWLA 4M6PA 3GR7A 4ZZ9A 3S8HA 3FA5A 5AHFA 5GVJA 4A2SA 3HOJA 2YX0A 3EXRA 1R46A 3AJXA 4PCFA 3UPBA 5I3HA 1SO5A 1H7NA 2NZLA 1XBZA 4LNYA 2QEZA 2CLMA 3CB8A 1H1YA 4P61A 4HIBA 2YXGA 1OFRA 1IGSA 3PVFA 3OVQA 4ZVJA 1T8XA 4XWUA 2TPSA 4QJ1A 2ZRUA 3G1SA 5EA9A 3DH7A 4NUWA 3A23A 1W31A 4RLIA 3G1XA 4UNKA 4MJZA 2QCMA 3MJYA 3N2XA 4MY8A 1FXQA 1LOLA 1MO0A 3STFA 3PG8A 3W6YA 3LXBA 3B0UX 1KLZA 2VEIA 4I7VA 3E96A 3EWBX 3L65A 4PTNA 4DELA 3DHDA 1QAPA 4YMZA 4EIVA 3QC3A 2H8ZA 5E0KA 1WXJA 3KOFA 2CZFA 5U4NA 3GKFA 1FY6A 5DBUA 3PBYA 4O1AA 1ZALA 3ZS4A 2E68A 3L21A 2I9EA 3FIGA 5F4XA 4DXVA 1ZY9A 1CW2A 2UV8G 4JTLA 4JN6A 1SZNA 2BXVA 3THAA 4LY8A 1ONRA 4LVGA 4NT0A 3HF3A 1GYNA 2TSYA 2WJZA 3W1XA 3B0PA 2QUTA 4MPQA 3SW6A 4FNTA 4O8RA 3C2VA 5HR7A 2R94A 1SZEA 5FF4A 4NJJA 3TROA 1H1ZA 2TMDA 5K9DA 1BWKA 4DF0A 4TX9A 2J24A 2GJLA 2CU0A 4IMDA 1VC4A 2FFCA 3BW4A 1LLZA 3O63A 1T0OA 1FUYA 3DFOA 1SZGA 3CC1A 3QZEA 4N9EA 5L9FA 1KW1A 3N73A 4K8EA 4LOCA 3W7QA 3P62A 4J9JA 3N9RA 1BTMA 1T99A 2WOQA 3P74A 4IPJA 1AW1A 1DV7A 3S5NA 2NUYA 3MMTA 2A7NA 1XKYA 2H90A 1FCBA 1L6SA 3TIMA 3KRZA 4LV4A 3EX4A 1NVMA 1SR9A 2VFIA 1JRCA 4O0ZA 2QDHA 2Z0IA 3ABQA 4WY0B 5D33A 1CX9A 1ME8A 3L9CA 4IXHA 1EUNA 3ATZA 4N4QA 1OHLA 3C3NA 1VLIA 4N9DA 3CU2A 4TMBA 5DCDA 1C9DA 3NR0A 4UTTC 4QAIA 1TQJA 1TJRA 3W1TA 3IGXA 3TU9A 3ZR4A 2QCGA 3GAYA 2ZZ5A 2Q3OA 1TIMA 5C2XA 5AHLA 1A50A 1YXYA 3HGOA 3CPRA 3P80A 1XBVA 2J88A 4QITA 3TXZA 3MYPA 3A24A 3DKLA 4HPXA 4C1KA 3G1HA 1XXXA 5K9XA 4MY1A 4LS1A 4JYDA 4WXZA 4O14A 3PBUA 4Z1DA 4NNCA 1KBJA 1TV5A 3M6YA 1G4EA 4XUGA 3LCFA 2OJPA 3CEPA 3E49A 4D2JA 1TYGA 4AH7A 2PCQA 2A6NA 1FBAA 1OX4B 5CPNA 3SIZA 5K3VA 1XDLA 3S6DA 1QR7A 3IVTA 1WYIA 1LP6A 1IXOA 3LBCA 1H63A 3MW7A 5LNUA 3FS2A 3M41A 1GYLA 4UCGA 4OQVA 4AVFA 3PSVA 1KTBA 4NJKA 1W5QA 3OVPA 2LLEA 2XN2A 4P2VA 3WJYA 3M1ZA 4CLMA 3NPUA 1YLVA 4JEQA 1VLWA 3NPVA 2Z6JA 3NO5A 1J2WA 3OHIA 4GWEA 1B4KA 3G0XA 2QCDB 1QNVA 4AHPA 4NXKA 2WSYA 4Y8FA 3S1WA 5KITA 1JVNA 4ORIA 3IIVA 3EX3A 4XZ9A 3W83A 4UFLA 5DELA 2ALDA 4AMAA 4W9TA 4ADTA 1ALDA 3HJZA 5CSRA 3KXQA 4MJMA 1KFKA 3QM3A 2QCCA 3L0NA 5EL1A 3QPZA 1W5PA 2Q3RA 3HO8A 3W1PA 2G95A 4K39A 3WJWA 2DZUA 1W5OA 1DJNA 3EWXA 4IUOA 3F03K 1JR1A 4LVFA 2EAWA 3E9AA 1DJQA 3HGSA 1NF0A 1QO5A 3M7WA 4M6VA 1GPWA 4H4IA 4O57A 2JKEA 1A53A 1HUVA 1PCKA 3HMJG 3G22A 4DF2A 5A5WA 1JJKA 1YXDA 3W1LA 3W85A 2A6LA 3Q37A 2ZTJA 1F74A 3G1DA 4POCA 3C2EA 1HL2A 4DQWA 4DBEA 2FPVA 2A5HA 3EX1A 2DJLA 4GUJA 4BWLC 1F5ZA 3DZ1A 2HS8A 2DZXA 3BV4A 5LNRA 2F84A 5AYXA 1KTCA 5FI8A 3SI9A 1OABA 3C56A 1MSSA 3LTSA 3SGUA 5AHIA 4UFHA 3NZRA 3OA3A 4OBTA 3JS3A 4JTFA 3L0GA 3UWWA 3DFNA 1A5CA 4ADUA 1F76A 5F2LA 2JBMA 3NL2A 1FCVA 1K03A 5CZTA 1RPXA 1QPOA 1ZAHA 2B7NA 3S5OA 4UTWA 2X1RA 3PS7A 4CQAA 3W87A 1FXPA 2J9YA 1XUUA 3GDKA 1KM5A 5I3FA 1VH7A 4MY9A 2YW3A 3QSTA 1EA0A 5DCBA 3P8IA 1YTDA 4LRSA 4JDYA 3NAVA 1OYAA 1RR2A 2FPYA 4LC6A 1DKWA 5F1VA 4HSNA 5D38A 5F2IA 3S42A 2E09A 2B7QA 1B9BA 3QMTA 5I3KA 1GG0A 1OFAA 2H3BA 3QQ1A 5DCEA 2ATSA 2VEMA 4WX2A 1O94A 3W7KA 3PG9A 5F4SA 1HO4A 2NWRA 4R7JA 2Y6ZA 3WK0A 3BO9A 4K8HA 1Z44A 4FIRA 5AC8A 4ORMA 2A1YA 3OEXA 4LC8A 1OX4A 3UQNA 4GFSA 1UUOA 2BLEA 4IOTA 5EKYA 3LERA 3GX9A 3W7GA 3S9YA 3TX9A 3C6CA 3NQ8A 3IRDA 1ML1A 4R53A 5CPLA 5LNSA 2OX1A 1UB3A 2RDWA 1TTQA 4DF1A 4LW7A 3QPYA 4CCCA 1K02A 3W7PA 1TREA 5I3JA 2HS6A 4LV9A 4O52A 4XKYB 3HG2A 3BG9A 3BLEA 4M7SA 3TSDA 3M44A 3EX2A 3T55A 1GZGA 5F4WA 4YWIA 4FO4A 1RQEA 2V0TA 1TPVA 3NQAA 4BF9A 3I6RA 3ABOA 1ICPA 4O28A 4XTIA 3PUOA 4BK9A 3IIOA 1W56A 1AG1O 3O07A 4KFPA 1D9EA 1ADOA 1LRTA 4GBUA 3D0CA 2QCDA 2NXIA 5D2XA 1YPFA 1TTIA 3UZJA 2NWSA 1ZHAA 2DZVA 2ISVA 2JGYA 3GDTA 2GOUA 4XBSA 5G1YA 3IGSA 1LM1A 1H7XA 3RK8A 2YFOA 3W9ZA 2P10A 5KSWA 4K37A 4DBDA 3CWOX 5MHBA 4DO5A 3HGRA 2QCHA 3DFQA 3OG3A 1WDWA 5DXXA 5D05A 3FKRA 1OF6A 1KTNA 3DFPA 2VFDA 5LGZA 3S1UA 1RD5A 4AEOA 3QW3A 4Y96A 3STEA 3C2RA 5AN7A 1W54A 2PRHA 2ZZ3A 2WSRA 4PH6A 4DO4A 1W3TA 3C61A 5C6MA 1H7WA 4TR9A 5G1TA 3VCRA 1EX5A 5A8GA 4JTKA 3LGEA 2Q8LA 4ZL1A 4UC5A 1EWEA 1SUXA 3UWQA 3TC6A 3T40A 1Q6LA 3B4UA 5D37A 2R91A 3O16A 4IPIA 3SZ8A 2DU2A 3KHJA 1JUBA 1JULA 3B05A 3TMLA 1VGAA 3IEBA 2RDUA 4KWWA 3GYEA 3P67A 2ZZ2A 3F4WA 3UY8A 4ZQOA 3N3MA 3HPZA 3A21A 4FHAA 3LXCA 1R2SA 2HSAA 5CG7A 2R8WA 3LTPA 5DN1A 2BWGA 5G2WA 1XBXA 2Z2UA 3EWZA 1SFJA 1BEUA 3GNDA 4O12A 4O10A 1TPEA 3QRHA 4JYEA 1P4CA 4E2BA 1EIXA 3W1MA 5TBOA 3LLFA 1Q6OA 4LVBA 1SFLA 1JRBA 3HB9A 5F2GA 3W7EA 2NUWA 3NQ6A 1FCUA 1FX6A 3LHYA 1IXQA 3IIXA 1O4UA 4CNOA 5LHEA 4O17A 5K2ZA 3FOKA 1EB3A 2ABAA 1Q6RA 1GOXA 3C0JA 2C6QA 1ICQA 2CWNA 3F1QA 1A5SA 1VQTA 2X1SA 4FX7A 4EF8A 4AWTA 4O4WA 2WKJA 4O0KA 4UFIA 1FDZA 3PUDA 1E51A 1AW2A 2DP3A 1TV8A 1LCOA 3A5VA 1TPB1 3DFSA 1IIGA 2ZZ6A 3DFTA 4GC4A 4MLRA 5HWJA 3PULA 2VENA 3W71A 1RQHA 1AW5A 4M6QA 5HUOA 1FQ0A 1OJXA 4KFNA 3U8GA 4UTUA 3YPIA 4IQLA 1VJIA 4OT7A 1UUMA 5K9CA 5CZ0A 2VOMA 2C1HA 2CFFA 3G8RA 3DI1A 2QUUA 2GQ8A 3GXNA 3LCHA 4AWUA 4MKNA 4O53A 2QR6A 3S5YA 2H3DA 3LHWA 2B0MA 4CNNA 5DBTA 3LHVA 5G2HA 1KM1A 1X8FA 2X16A 5AHMA 2NXHA 5G2IA 2PC4A 5H2ZA 4NJHA 1DQWA 2A2IA 4YCPA 4JIPA 5LZLA 3HIJA 2FLIA 4HHPA 1YPIA 4CQ8A 4RZ6A 5HINA 3R12A 2A0NA 3CM4A 1FDJA 1C29A 5KZMA 1GVOA 1LYXA 3Q2DA 2ZRYA 2VFGA 3O6DA 3MHUA 3LDVA 3OBKA 2CLEA 3JR2A 4MIMA 3LHUA 2HTMA 3ZFHA 3FJLA 4L4LA 3U6WA 1YTKA 3W84A 4MZ1A 5EMUA 1RZMA 5DY2A 3L0KA 5FF7A 3B8DA 3L67A 1N7KA 4FIQA 2VC6A 1WX0A 3LX9A 2V82A 3LCGA 1KLYA 2WO5A 2O7QA 3PM6A 1X7FA 4FXSA 3W22A 3NM3A 3NQEA 5CPOA 3CQ0A 4DEFA 2FQIA 1VS1A 4XKYA 1G67A 4BR1A 1YDNA 3KRUA 1XBYA 3DXIA 5H91A 3PBVA 4LVAA 4U28A 1J5TA 3NYZA 2NX1A 3QEZA 4HPJA 3W7JA 1JCYA 4QNEA 3I65A 1TPDA 3HG5A 5G4EA 2RKXA 6TIMA 1TRDA 3BG5A 3H54A 1QPQA 4PODA 2OMAA 3TCEA 3TQVA 1G6CA 3EEGA 3UNDA 4ALDA 3GDRA 4JTTA 2C0AA 2F7FA 3TSMA 1KFJA
chains in the Genus database with same CATH superfamily
3K2GA 3MS8A 3NG3A 4GD0A 3N3TA 1XIGA 3FA4A 4UMCA 3PN8A 1NEYA 4PCTA 4WJEA 1CGTA 4G7EA 3IAPA 1H11A 2QJJA 4U5IA 4HA1A 3DENA 4ONVA 1M6JA 3B8SA 1KBLA 3QMRA 3W1NA 1J18A 4RXGA 2VRQA 2BG5A 3M4HA 2ZA2A 4QFUA 3WX7A 6XIAA 5A8OA 3UR5A 1RJPA 1HQTA 3TW6A 2W62A 3B9OA 4CKQA 3ARUA 3CH9A 4HQVA 1ZAJA 2E6AA 5CC5A 3W74A 4ZMGA 3T0CA 2RHGA 4YVPA 1RH9A 3CZLA 3LBOA 1SO3A 4L61A 5CCZA 2BY0A 4IL2A 4Q4SA 1K6WA 1LORA 4MFDA 3UCCA 3W1AA 4A3UA 3N4AA 3MP3A 2QF7A 2BY2A 3PNUA 1BF6A 1I8JA 4LYRA 1HNYA 3G0SA 4IMEA 4L65A 4RNIA 4FNQA 1V02E 4ZFCA 3VOIA 2J27A 1NOUA 1W3IA 2VOTA 2EJ1A 1OFQA 1A0EA 3EWCA 2X2YA 3W70A 2PPGA 4CU6A 4QM1A 1H7RA 1KFLA 2FVKA 3RPTA 3WH5A 2G8ZA 1X97A 4J4KA 1NF7A 4W8BA 1ODUA 3N6QA 4AFYA 1ADSA 4FLOA 1DQXA 4Y7EA 4HOWA 2DSUA 2NX3A 2X1TA 4DB7A 3KL5A 4ZB0A 4PRTA 4UIOA 2V8ZA 3WQPA 1S2WA 4NX0A 5CZJA 3WUFA 5FF3A 1W5NA 1F4HA 4GUHA 1SU5A 3HV8A 4ENLA 2J75A 1SSGA 1H51A 4MNKA 1FWTA 4GJIA 2C3ZA 1IT8A 3RM9A 1VPQA 1GNXA 3WEZA 2C13A 1AD4A 3O1NA 1I45A 3PAOA 1E0TA 2ACSA 3UZWA 3QF0A 1RBLA 2G3FA 1R3WA 4WXYA 2JEPA 3W23A 3LN3A 3TN6A 4ICNA 4GJJA 1J4EA 3PBWA 3MBDA 3UD6A 1HJWA 3HPXA 1F73A 3IGUA 1Q2RA 4O1EA 1UOZA 2VFEA 1CGUA 3CAQA 3LMZA 4QQUA 5CXPA 1F61A 3UCQA 3RCNA 3DBNA 3ALFA 4Z2JA 4C6MA 4O0QA 4DBSA 3FFSA 3PPGA 3WJXA 3MC5A 2O56A 3T0TA 4NXSA 3KL0A 1OG0A 1VRDA 1ZS2A 3FYPA 5LNWA 3NPWA 1U2YA 1CYGA 4GCAA 4IT1A 3HM7A 1UC5A 1CXFA 1TRIA 3FDGA 1Q7MA 4Q6XA 4CNPA 2E6YA 4R27A 1PIFA 3V36A 3OJGA 2WC7A 1A80A 3TJXA 1TTJA 2O92A 3LZ3A 2PGFA 4F3HA 3KBNA 1OYBA 3W7NA 4AIEA 5H6HA 1U83A 1Q3NA 3E3HA 1GKQA 5T26A 1WUFA 2CKSA 3W26A 4S2BA 2OO6A 1K1DA 2ZX8A 4AWSA 2F9RA 4ZQMA 3LHTA 3W1QA 1KCZA 3TR2A 4HJFA 3VFCA 1L9WA 4PE8A 1I2RA 1PX8A 5T91A 4ZSUA 1RBAA 2ZRWA 3SJ3A 4HTBA 5FCZA 3CK5A 2VRJA 4AMCA 2EF9A 4Q8QA 3G3DA 1TQXA 1XLAA 2ZE3A 3WQOA 2IS7A 2QIIA 3K30A 3E0WA 4XD6A 4QE1A 3NZ1A 1NOWA 1LQ0A 4HNVA 1B57A 2Y63A 2BZNA 3SY1A 1ME7A 4K7YA 1Y0EA 2E67A 4IFKA 4Q33A 3I7QA 4KF1A 4HSHA 5TF0A 2PE4A 3R5EA 2WBKA 3WY1A 4HGXA 4FZIA 4NX5A 3HZ3A 1UMLA 3AIEA 5FAJA 2Z2BA 4ZFMA 3SECA 3RXZA 3TCSA 4QDWA 1M68A 4GG9A 3M43A 5FL1A 4L4MA 4YTQA 3EXTA 3CUGA 2ZUWA 2YFNA 4MKSA 2W3ZA 1RD6A 4JPGA 1CXLA 4BFAA 4M29A 3W7MA 1POJA 1RY0A 1TPH1 1S2CA 1YPXA 3E0VA 3LCIA 4CVUA 1L2UA 2JALA 5E0CA 1EUAA 5FF2A 1VBRA 3GSMA 4X63A 3CT2A 1I2QA 2DJXA 5T8GA 5D04C 4C6KA 3UERA 1WDRA 3M6DA 5CPTA 5KZDA 3TYZA 2FTPA 3CV1A 3LV5A 1NU5A 1QW9A 1IEQA 5FJUA 3IV3A 3TTEA 1QDSA 2XFWA 1K8YA 4MKVA 2AQVA 4Z1BA 1UR2A 4D6HA 4MHBA 3WNLA 4RZ4A 2ZXAA 2RDXA 4OWGA 4BF5A 1XLEA 3MI2A 4YIWA 1Q4WA 2YL5A 1XHGA 1UUQA 1MVYA 5I3GA 1HP4A 2VO5A 4JTCA 3AFBA 1TMLA 2ZWYA 2ZUNA 4QSHA 2V5CA 3VU2A 2P50A 3CMFA 3KTXA 4C5YA 4BI5A 4M8UA 1AMKA 3V18A 2NVCA 2PU0A 1QWKA 3CLWA 2GDUA 3WH7A 4MNJA 2YGYA 4HMCA 2CNCA 3EBVA 4A8NA 2EQDA 4N02A 2PDWA 5A94A 1W1VA 2YJQA 5BMXA 1UP0A 5C2CA 1OY0A 1ONWA 4KCUA 3URAA 1EWDA 2XN0A 3LA4A 6PTDA 3IS4A 3TEVA 1SW0A 3BTNA 3KDOA 3HFYA 1S5TA 4DZAA 4WOZA 1QTWA 3GO2A 3OBAA 1C8YA 1HFBA 1Y5VA 3R8RA 1XIFA 3AXHA 1GVYA 4LNCA 5D2YA 3TQKA 3V0TA 3R25A 3KLLA 1UJPA 1X6LA 3OVRA 5HJXA 4L56A 1FWDC 3ES7A 3P61A 4W84A 2ZA3A 4Q8OA 4PB5A 3B8VA 1UOKA 2GGEA 5M1TA 4HNTA 4BHYA 4ZO9A 1K7XA 4PRWA 1MDLA 3MWCA 3LPPA 1W3JA 1ITCA 4JD4A 2CBVA 1RK6A 5DX7A 2WNZA 2Q8ZA 4NNAA 4QE4A 1TUXA 3N29A 3C86A 3V0SA 1WKFA 5EBUA 1YXCA 1YKWA 4M5PA 2WW5A 1V6WA 4O11A 1UA7A 2GVGA 4DN1A 2V63A 3UF9A 5HJYA 4KGLA 4QIUA 1KCKA 3UY7A 3SJNA 2DT2A 3AXKA 1UJQA 4Z0JA 3B9NA 3QY7A 2W79A 2D0FA 3KZPA 3LRLA 3QGVA 2I56A 3STCA 3RILA 3VILA 1E6PA 4AZBA 2DUXA 1WE5A 5FEWA 4OGZA 3TH6A 1KB3A 1H60A 1VB9A 5FSEC 1KFCA 3P7YA 3PTKA 4B91A 1R2TA 5KINA 2W0UA 2QYGA 3P2VA 1WAWA 5BOFA 4LY4A 3KBMA 3N2MA 1KM0A 3M0IA 2CPUA 4RW3A 4NJGA 1XQLA 3UP8A 3CIWA 2ZCGA 5EFFA 4MNLA 1LBLA 4JHMA 2H8XA 3EB3A 4Z2LA 1UR0A 1DJHA 2E6DA 3RMEA 2BB0A 4EACA 4NZJA 5CG0A 2IPWA 1AA1B 4JCLA 3QTPA 3CHEA 5LXEA 4NRRA 1Q6FA 2WVTA 2DORA 1XFCA 1EP1A 4NU7A 5K7JA 1F6PA 3MO7A 3E02A 1C90A 3U2OA 4CN1A 5L6UA 3LHZA 2PDBA 3DIPA 4QP0A 1XL9A 3FK4A 3GH4A 4QX4A 3HBLA 4O18A 3ZZ1A 4LCRA 3UVIA 2C1IA 1X6UA 4I5UA 4L80A 1Z41A 4UCFA 3KBSA 3P82A 3ITYA 2CESA 2DSKA 2EHHA 4S3DA 2ISFA 1DXIA 3TSBA 1KA9F 1EP2A 5ECUA 1DIDA 3C2OA 1X6NA 1W91A 4HKPA 1P6WA 3I3DA 1I6NA 5CPQA 2DW6A 1PZ2A 2QVHA 1TB3A 4TO8A 3QZAA 2VEPA 5HAOA 5EYWA 1M7OA 1WZAA 5EPDA 4EANA 3V16A 1WNOA 4QEEA 3TWAA 3CV6A 1MNSA 4JXCA 1RLDA 3UXIA 1MZRA 4ATLA 1EJ7L 1P6BA 2VTFA 1XLHA 1HN1A 4KIRA 3KOYA 4UNLA 3AZRA 4W85A 3R58A 3GWQA 2ZRZA 1GK8A 1XYLA 2AL1A 1DWIM 4GVFA 4QISA 1TWWA 3RO6A 3PF3A 1EDTA 2TRSA 5D2TA 3W3OA 3H2OA 3WKZA 2VWSA 2D3LA 4KPLA 3DEQA 3FNDA 4D72A 4R88A 1MQPA 1GONA 4ZR8A 1Q7QA 3MV11 4UNIA 3WQWA 3V35A 1VBHA 1J0IA 1M5WA 2I57A 2WWDA 2MUCA 1ZU8A 4LX4A 1HF6A 4XBKA 4NAEA 3W76A 5FF0A 1JIBA 9CGTA 3B97A 1IT0A 4KEMA 4QXIA 2VXNA 1TTPA 3IIPA 3T44A 2VX6A 4NNBA 1Q6QA 3KVKA 4AQLA 1KFBA 4V1YA 2RH9A 3BAIA 5CC7A 2CLFA 2YA1A 3LCWA 3N2OA 1M53A 1CLXA 3TZNA 4JY9A 1B2YA 4LS0A 3VNKA 2A7PA 2WM1A 2HPMA 3BPWA 3UJFA 5DT7A 1EOKA 1UD4A 2A3HA 4FA3A 2DZBA 2YXOA 4OBRA 4KFOA 1F2JA 1VEOA 1E0WA 3HA1A 3VDGA 3A4JA 3S1XA 3APGA 2FTWA 4S3BA 2PF0A 2NV9A 2CBUA 6ALDA 3R8HA 4IX2A 2CEQA 4F0RA 2ISSA 4E3VA 4BA0A 1WO2A 1CBGA 5FEPA 3ZT7A 4NI3A 5HMDA 4C6PA 4MF4A 2WB5A 2PUZA 1EGZA 1D8CA 1XS2A 3E1F1 1AMYA 3GU2A 4NJIA 2XVPA 1ZJAA 5KTLA 4D6DA 1QWGA 3CUXA 4AZIA 3O05A 3N34A 4X3ZA 3TKFA 4F0MA 3HMCA 4JBRA 3DFHA 4UFKA 1VZWA 1XYAA 2IQDA 4DPPA 3IGHX 4P5UA 4CQCA 1LLWA 1UR4A 4XD4A 4FLSA 1GEHA 3GXIA 3CGTA 2J79A 4ZA0A 3GLCA 2WV8A 4JY8A 1WDQA 3BWWA 3NL6A 4BI7A 1DJIA 3ITTA 3KAOA 3NQCA 1QOPA 2G3IA 4B15A 3BH4A 4DUXA 1DJGA 1XIMA 1XF0A 2VX4A 4WGXA 5CPSA 3UZ5A 2PTDA 3A22A 1WDSA 2NXGA 5I7GA 3WUEA 3S6TA 4D6CA 4GZIA 1US2A 4I9MA 4U3AA 4M19A 2TAAA 1K7FA 1UCWA 3O15A 1QASA 1LT7A 3W2MA 3TQPA 1J0HA 3AS2A 5EGRA 3FHAA 2P0IA 1XIBA 3R13A 4E38A 1VBJA 2CIPA 3VGGA 4K3ZA 1O7AA 5ABEA 1X96A 4QJ4B 4JQ3A 3VGEA 3ARTA 3ZXWA 3V1PA 8TIMA 1ZB5A 3W88A 3W81A 1G94A 1CWYA 5JUVA 4E2OA 3P60A 3NQ7A 3FXGA 4JQ2A 1DHKA 1OFBA 2OWXA 2PDLA 1Q6CA 1Q45A 2KZHA 3OZYA 2PSNA 1IYXA 5LGXA 1SPQA 4C6JA 4C1NA 2HROA 3ABRA 4X0VA 3S8HA 5GVJA 2YX0A 3ZJ6A 5KEZA 3LQGA 3VMOA 4C6FA 5I3HA 2NZLA 1EZWA 1XBZA 1OT1A 4URIA 4P61A 1AZ1A 2HEJA 2I5IA 2XIIA 4W93A 1IGSA 1RJRA 4RE2A 3VIMA 4PMQA 4HVXA 5JU6A 1UMYA 3L4YA 4XWUA 2TPSA 4QJ1A 9RUBA 4H83A 2QPSA 3IJIA 1OG6A 4MY8A 3PZMA 3SCUA 3TR9A 1BD0A 4UBPC 3PG8A 4GY1A 4V1XA 3B0UX 1KLZA 2VEIA 4I7VA 3EWBX 2H9AA 4EXBA 5BXSA 1JF6A 3GH7A 4WHBA 1L8NA 3E2QA 3GXMA 3L4XA 3DCPA 2VVSA 1OCQA 4IGMA 4L6DA 4RDVA 2D3NA 4O1AA 3ZS4A 3QR0A 3L21A 2INEA 3FIGA 5F4XA 1ZY9A 2TODA 5DANA 4JTLA 4JN6A 3S4TA 2WZTA 2BXVA 3THAA 4LY8A 1ONRA 3U4FA 3W1XA 2WJZA 3IJLA 4JIEA 3PZQA 1DYSA 4FNTA 2YB1A 3E6EA 4O8RA 2R94A 1SZEA 1NP2A 4NJJA 1WXYA 4GI8A 3AYSA 4B16A 2J24A 2OODA 4NYYA 1BRLA 3BSGA 1R9XA 4H1ZA 1T0OA 3DFOA 3ARYA 2NT1A 3SCSA 5L9FA 3ALGA 4R85A 4LOCA 3N9RA 2GGGA 1K6AA 1XC6A 3CBWA 3MMTA 4GH3A 3GM8A 2DGAA 1FCBA 3EDDA 1XLMA 2OWCA 4INFA 1NTHA 1SJAA 1BAGA 3TIMA 4H9TA 3GNRA 2PWVA 4KQNA 4LV4A 4AWEA 4WJ8A 3AHTA 4O0ZA 3BQ6A 1UZ4A 5D33A 3MDUA 1PWLA 4EAYA 1XLLA 3L9CA 1EUNA 1EC9A 5DCDA 1KKOA 1VLIA 1C9DA 3NR0A 4UTTC 2VUYA 3WBEA 2EPNA 4NZCA 3M0KA 5EB8A 2IMRA 3ZR4A 2ACQA 2ZZ5A 1NELA 2WKGA 1D7KA 2NW0A 3BZJA 1UHVA 1XBVA 3M07A 3TXZA 4C1KA 3HQNA 3GU1A 4YYFA 6REQA 2GGIA 1Z6KA 4WXZA 4US5D 1J10A 1ITQA 2Z4GA 3LCFA 4G6CA 4AH7A 2PCQA 1A0DA 3BC9A 1U1UA 3NGFA 1OX4B 1KGUA 4ZEPA 2G4JA 3GC4A 1LP6A 2OZTA 2NT0A 3QC0A 3FS2A 3KZSA 4AVFA 3PSVA 4HU4A 4NJKA 3VVGA 4W88A 4CLMA 1XW8A 3NPUA 4JEQA 1EHNA 1US3A 3XISA 3TYBA 3T4WA 3OHIA 3GTHA 3KBWA 1EEXA 2QUNA 1B4KA 2EG7A 2QCDB 2V3FA 4NXKA 2BOGX 3UETA 2OO0A 1JVNA 2Z26A 3IIVA 1FWJC 4XZ9A 4C6QA 2DT1A 1NWTA 4J3WA 2ALDA 3MZ2A 3AU2A 2PWGA 2ZADA 3AMKA 2ZIDA 4MJMA 1KFKA 3VIHA 2R1LA 2IKGA 5EL1A 3VOGA 3HO8A 1TE6A 4DI9A 1W5OA 1IHIA 1JR1A 2EAWA 4LUYA 1MW1A 3HGSA 4H8NA 2DV0A 2XSAA 3TC3A 3F5JA 1Q65A 5E9AA 3VGDA 2JKEA 5FJPA 2FZMA 1PCKA 3GXDA 1E55A 1FHUA 4NL1A 4PUWA 3W85A 2A6LA 2V3GA 4ZXLA 3Q37A 2ZTJA 4DJEA 1EZ2A 3G1DA 3C2EA 3VC5A 2WJDA 3R10A 3OW1A 4BWLC 1XLIA 1J79A 3QLDA 3VOHA 3WQ8A 2X41A 1X7IA 3TNBA 3FSTA 1KTCA 1AH3A 1OABA 1CXEA 1HKKA 1E56A 4OBTA 2OQHA 1TX0A 2E0PA 4JTFA 1R86A 3L0GA 2EG8A 3DFNA 2PLMA 3F2DA 4ADUA 2XINA 3NL2A 5HPCA 1WCGA 1QPOA 1ZAHA 3W0KA 2Q8XA 3GG7A 4GZJA 2X1IA 3VD9A 5HMFA 1MRAA 3E38A 1XUUA 3GDKA 3AJ7A 2P8CA 4PTDA 4MY9A 1QI5A 4EK7A 4JEJA 5M5DA 2WMFA 3QSTA 4LGXA 5DCBA 2PTZA 3P8IA 3IJDA 1YTDA 2P76A 4D6GA 3RJYA 4QS6A 1XIHA 4JDYA 1OYAA 4CU7A 1DIKA 3S9IA 2NVDA 2UWFA 4DHGA 1CPUA 1SYTA 1WUEA 1GG0A 1S39A 4IMAA 4LUTA 2VEMA 4B4FA 4LF2A 3A6OA 3PWIA 4D6IA 2Y1HA 4XAFA 4R7JA 3VIKA 3VIIA 4DXKA 3AIWA 3WK0A 4K8HA 3GTIA 3CMJA 4GZEA 4ACZA 1J0YA 3D3FA 4GFSA 2NQ9A 2BLEA 1GOIA 3W7GA 3S9YA 3MU7A 3T2OA 4R53A 5LNSA 1CZ1A 2GYIA 2RDWA 2CLPA 4LW7A 4CD6A 2HDJA 3VUPA 3SUUA 3T81A 3KOWA 4IISA 3GVQA 1O1ZA 4L64A 2JEQA 2OKOA 4F2UA 3M44A 2I9UA 1UWUA 3N15A 3EX2A 2ANUA 3T55A 1W1B1 4YWIA 4YTSA 2V0TA 4Q4RA 5DMNA 1X1NA 3BURA 4BK9A 3ZVHB 5PTDA 2PGEA 1FP9A 1SFSA 3QV9A 2GOKA 4WDWA 1TV4A 1HZYA 3PTDA 2GOUA 4UQ9A 4XBSA 5G1YA 3OGRA 3IGSA 1LM1A 1W3LA 3RK8A 2P10A 4CQBA 3CWOX 5MHBA 1JI2A 2PWDA 4DO5A 1V3LA 1DPMA 3DFQA 1I1WA 4C7DA 3FKRA 3I10A 3K8LA 3O3RA 3S1UA 3KM8A 4AVNA 3STEA 3PBMA 4GPNA 2ZZ3A 2R1PA 2WSRA 1FFQA 4JTKA 3U7BA 4HU3A 5C9UA 4WDTA 3TYUA 3UWQA 3VXGA 3JVAA 4KW2A 2YDQA 3O16A 1DWFM 1J9YA 4DYJA 2O4MA 1WXZA 3AHYA 1JULA 3B05A 4FF5A 1FP8A 3W82A 2PDIA 3GYEA 1RLCL 3SDOA 3F4WA 4HYVA 3N3MA 4G7FA 1NJJA 3HV9A 4FHAA 5CG7A 2HSAA 2B81A 3RHGA 5DN1A 3WF2A 2FJUB 2POZA 5G2WA 3VOJA 3ZMRA 3GNDA 3HJEA 4O12A 1P4CA 2XIQA 3RGTA 3S1GA 1BG9A 4H9XA 3ZLHA 1SFLA 2I5QA 2YBVA 3KL3A 1KXVA 5F2GA 4BQ4A 1V6TA 3T9PA 1DWAM 4UQAA 2NUWA 1FCUA 4AG0A 3CQKA 3LHYA 1V4YA 1HKMA 1T41A 3NSXA 4O17A 3BMWA 3C5QA 3C0JA 3MUCA 4L9YA 2CWNA 3VNMA 4B3ZA 1T40A 4M6UA 1VQTA 4FX7A 2ZC8A 4AWTA 4UFIA 3MSRA 1E9LA 4M80A 4GQGA 5BRPA 2ZZ6A 4GC4A 1JEZA 1KC7A 3TN4A 2VENA 4GQ0A 2XIOA 4KFNA 3YPIA 2QMKA 1E71M 1PTAA 5CZ0A 4REQA 2RJGA 4HPHA 5I79A 4W5ZA 2VZOA 1XWYA 1R87A 3LCHA 1KGWA 2FHCA 2QR6A 3H4GA 1A0CA 4Y9OA 3PZUA 7A3HA 1P6CA 4IIBA 2PC4A 2YCIX 2ZXDA 2D24A 3ZJ7A 2FLIA 1B3VA 1XRSA 4RZ6A 5E09A 5HINA 3AUJA 2BOFX 3CM4A 3KW3A 1GVOA 1LYXA 3Q2DA 2QPXA 3O6DA 2WZEA 2NQHA 4A3QA 1YE6A 4DJED 2C1GA 2VUNA 3L0KA 3PZIA 4P7RA 3KS5A 4XD3A 1E4LA 4U5KA 4FIQA 2VC6A 4GGBA 5D9PA 1M41A 1X7FA 3W22A 5BXTA 4LH8A 5CPOA 2VR4A 1VS1A 3FYYA 5HNNA 2GGJA 3OPSA 4XKYA 4BR1A 1BG4A 4WVXA 1XBYA 3DXIA 3MCOA 1KGXA 3NYZA 4UWMA 2NX1A 4KESA 4QNEA 4PZVA 1DWGM 2XVLA 5JBEA 4WCJA 3CUJA 3HG5A 4AUBA 1MQQA 4DWSB 2XFRA 3H54A 3IWPA 3UJSA 3VDBA 4Y9NA 4LCQA 3QBUA 3TQVA 3LD5A 2PD5A 1VFHA 2J7DA 2F7FA 3TSMA 4RPQA 1KFJA 1QU4A 4LFYA 2V2HA 1B3ZA 5FJOA 4MGGA 1T6MA 3V5CA 5IM51 1W0MA 4ZOBA 3UPMA 3NQBA 3PZNA 5FEZA 1PHQA 1VFLA 2Y89A 3DN5A 3L5LA 3CT7A 3NQDA 4IICA 2D0HA 1V3HA 3N2BA 1PTDA 4C7GA 3W2NA 1O5KA 4D8ZA 4N6FA 1W8SA 3PZ9A 2VD9A 2V3DA 3G0UA 4MG4A 3BSMA 1QW7A 4HNCA 1FWCC 4AZ5A 1Q85A 1LZOA 1GJPA 1KV5A 1TV2A 2EKCA 4NILA 4OIFA 4H7ZA 1R30A 2ZX9A 1XPGA 1FKXA 4ERIA 2GLKA 3N14A 3WLNA 2EPHA 1SSDA 3NXLA 4DNHA 1SO4A 3TE9A 5AC4A 3W7CA 2QIWA 3CO4A 2QKFA 3I6TA 3URQA 4QLJA 4DVOA 2X2GA 2PRMA 2YZRA 3G1AA 3U2EA 3WJSA 1QI3A 3CEUA 4HP5A 1G69A 4AD1A 2V2DA 1EGVA 4WD0A 1VF8A 3ZT6A 3MUZ1 1GJUA 1NY1A 2VURA 3OGSA 4AVOA 1H5VA 4J35A 1RVGA 2O4QA 1VFUA 3O6AA 1VP5A 4AU0A 4J3SA 4YL2A 1RSCA 4C6DA 3PC0A 4PCNA 2J7HA 2YL9A 3MUIA 4N4PA 1ZCOA 2GFTA 5BCAA 3A64A 3W75A 4W87A 4I8DA 1A4LA 4KWSA 2V5KA 1ZJHA 8XIMA 2QV5A 2JK2A 2OB3A 1SFTA 3IJ8A 8CGTA 1PDYA 3BOLA 4UQCA 5AYYA 3THQA 1WZKA 1BKHA 2GVLA 2WSQA 1GQLA 1LG2A 4E8GA 4Q4OA 3PY2A 4O13A 4DIAA 5A95A 1VD6A 2ZOXA 3T7VA 2PB1A 3GNPA 3OZMA 5GJNA 1O12A 1QVBA 3NDYA 4Q4MA 2E28A 2X7VA 4AEFA 4R3UA 3CZEA 3GUWA 3UJEA 1ME9A 5A8PA 2Z1SA 1GGOA 1LBFA 2V5BA 3W7IA 3LRMA 1PKNA 3GAKA 4P7OA 3WELA 4N6EA 5M17A 1GQKA 2WNQA 3KLKA 4BJHA 1IV8A 4PTMA 2BDQA 2BS9A 3FN9A 2DEPA 3WJZA 1ITXA 4HK5A 4J28A 3OYXA 1UKTA 3M5YA 4Q8VA 3STPA 3ITXA 1UIPA 4IG2B 4AD0A 3M0MA 2HBXA 3USBA 1QT1A 1V7YA 1G5AA 5AC6A 1EQPA 7TAAA 3A4AA 4MAVA 2WLYA 5KZEA 3FXYA 3MY9A 3ATYA 4LU0A 5LXXA 3OU8A 4JL2A 1U33A 2GJPA 4WKHA 2Q02A 1IZKA 5CGMA 3MSDA 2DQWA 2QQ6A 3RMJA 2GWGA 1GHSA 2RJHA 2OVLA 3E0LA 3SCTA 4KERA 4EF9A 5LHFA 1SQ7A 4WOQA 1F9CA 1H62A 1TWZA 2WMIB 1RCQA 3DHFA 3PNZA 3RPMA 3QY6A 5LKYA 2EGZA 4Q8WA 1XSJA 3VI2A 4ICMA 5DXYA 3MYOA 3NPXA 3S0CA 4AF0B 1NIUA 3MCNA 3EOUA 2OLHA 1WPCA 2F6XA 5C9RA 3XINA 3QMSA 4DWSA 1OFOA 3T09A 2QJIA 1H50A 2FDSA 4L6OA 1J5SA 4ZODA 1O68A 1OSEA 3GIPA 3AWNA 4OOZA 5LNVA 4H41A 1I2OA 3FGCB 2JKPA 1ZZMA 2BODX 2VYOA 2Y24A 4X61A 3ANYA 4PFHA 5CC3A 4QLLA 2JGQA 3LUTA 2OYMA 3M0ZA 3CV2A 4GH1A 4YHGA 1HG3A 3V75A 4ZQPA 2PDHA 4NZ5A 2VJXA 5FJJA 5F1UA 2OT1A 4JQAA 2AQWA 1A4MA 4D6EA 1NFPA 1Z42A 3KRSA 3A9BA 3A12A 1Z48A 3N2TA 4S3CA 1B3OA 2BXZA 4US5A 1W9UA 4WQ6A 4IMFA 5JBFA 1A3WA 3N2CA 3TMQA 1PKMA 2ZBTA 2DVTA 2PBGA 3H4XA 5BROA 1FHVA 3KCLA 4CNSA 3LG3A 3H2AA 4CNTA 4NIRA 4GUGA 4LTSA 1X1ZA 1ZBKA 3WMSA 1W3NA 1KM3A 1MZHA 1EC8A 2G97A 3FVDA 2V5JA 1LL6A 3TOYA 1K7EA 3P14A 1TG7A 1XIIA 2J7FA 3CL6A 3WNPA 4WY0A 4QGCA 1H7OA 3LYEA 4IMCA 3B9DA 1YX1A 2VC7A 3GW0A 1UH3A 5FJTA 2PWUA 3MUXA 2YLAA 2WHLA 4FK9A 1VENA 4JN8A 2CLHA 2YA2A 1YDOA 4PB4A 4NVTA 1XCWA 1DOSA 1JL8A 1LQ2A 3BCDA 1CECA 4MPKA 2YZ5A 5T9CE 4EE9A 3WD3A 3V0UA 3UBPC 3MI3A 4XO7A 5IFPA 3M5VA 4IFRA 3N19B 1XYZA 3GZ3A 3WD0A 1KBIA 3R6IA 1WKYA 5AY7A 2E3ZA 3P0XA 1D3CA 3CTTA 2XIJA 2D1ZA 1R3RA 3W7OA 3GK0A 2Y2WA 4E3TA 1Q8JA 4JTAA 1JFXA 3IJQA 4WY0F 2PODA 1XCXA 4K7VA 2A3BA 3WUBA 1OGGA 1XFBA 1XSIA 1NWSA 2Y70A 4GX9A 3FW6A 3GNOA 3VE7A 3Q45A 2Z1WA 3I7SA 1F3XA 2F61A 3W7LA 1QJWA 1WBJA 1AQ0A 1XDMA 3OLEA 1BHGA 1CLKA 4OFCA 1UR9A 4GRSA 1QO2A 3H2FA 3SSJA 5E1QA 1FH9A 5HNUA 4F8XA 2ZKMX 5TIMA 3CZJA 4GFIA 1XD0A 1UA3A 1K4GA 4H01A 3B4YA 3MO4A 1PS9A 3GR4A 2J8GA 4GNJA 3GC2A 1MW3A 1MEHA 3G5EA 3SCQA 4OE7A 4QLKA 4M82A 1KBBA 1G01A 4XK2A 3EPMA 3GBDA 1ZENA 4G8TA 2BHZA 4O15A 1PDZA 3W73A 4GKTA 2EPKX 4O1CA 4QCEA 1F6KA 3QJAA 3R0DA 3GKAA 4WDUA 1YNQA 2EKGA 4P8UA 2HE8A 4GUFA 2HV5A 3UZZA 2SFPA 3ICJA 4J3XA 3WZ0E 3TXVA 2VDHA 4GX8A 2CBJA 3WLPA 5CKSA 3THDA 4UQBA 3QQWA 2HE5A 1CNVA 4FNSA 1FDYA 1EH9A 4A05A 1UD5A 1S3HA 4ERAA 1HGWA 2PU1A 3F5KA 4M1BA 1JPHA 3UCDA 1BQCA 3MKCA 2E9BA 3BANA 3CIXA 4E2VA 1S38A 4J1OA 2QCFA 3BAWA 1VYSX 4PULA 4B90A 4D1IA 3LI0A 4H2HA 1XG4A 2PWEA 4XVDA 2E8YA 3TW7A 1MXDA 4NY2A 4IUGA 3QKEA 3OOQA 5AB3A 5F2MA 3HQPA 4AZGA 2IQTA 3KRBA 2CHNA 4HBKA 3KVMA 3LPGA 4ZQCA 1TWSA 3LTYA 4KCWA 1BWLA 4Q22A 3IACA 4LJ3A 1W32A 4Z1YA 1XINA 4RE4A 4KT2A 4I6VA 4JTGA 2WVUA 3E0IA 4AF0A 8RUCA 4MUPA 2YSWA 3AOFA 1OFPA 3GHTA 3S5ZA 2OELA 1YTEA 2GJXA 5CJMA 4HK7A 3QW4B 1OINA 2OZ8A 1KXQA 3G8EA 3DG6A 2FVMA 2VEKA 2Z1VA 4H9MA 2X0SA 5HDRA 3URBA 4PYSA 5DLCA 3SO7A 1YRRA 2VC9A 3JRKA 1EBHA 3FJ6A 4PUNA 1VJSA 2VX5A 1CI1A 1YDYA 2OZ3A 4MWAB 1BWVA 4P7QA 3WF4A 4LAKA 3L4ZA 2QXWA 3KE0A 2G3MA 2YCLB 5K4XA 4UR7A 1VJZA 4X2PA 3K8MA 2DZTA 5GNXA 5GNZA 4GY7A 3CHCA 3PHAA 4GUIA 1LDCA 2PTXA 4KETA 2CETA 4JFTA 3QGAC 1A5KC 4P8XA 4EX4A 2UZ9A 1CXKA 3KDNA 1G4SA 1VFFA 1WA3A 3MMUA 1B90A 4A22A 2D20A 4S2CA 2EG6A 3CHDA 2Z2AA 3T0BA 1XD1A 4GXWA 3STGA 5A3HA 5BMWA 2VFFA 3ZT5A 1WDPA 4YTRA 1PXGA 3BLPX 5FIPA 2XVNA 4RNHA 3KP1A 4HNNA 2BY3A 2DZSA 4ICCX 3F2BA 4YTTA 3GVGA 3NYDA 2Z1KA 1OCNA 4XG1A 4JCMA 4KIEA 1UKSA 3TP4A 3F4VA 5CSUA 3G3MA 4UB9A 4IWWA 2Y62A 2OSXA 4PCPA 2XISA 2DQXA 3DG3A 3M0YA 4RDZA 2ATMA 8A3HA 1XIDA 1JZ5A 1TZ9A 5KMYA 3PB2A 1XM3A 2XVGA 5EFDA 3SN0A 2HCVA 3KVJA 3EKLA 3EB2A 3O06A 4Q4KA 2AAAA 3A47A 5GQBA 4XZWA 2G96A 2ADAA 3WD2A 3SY5A 4L4PA 3C2FA 3CUFA 1DE6A 1JNEA 4C6OA 2FYMA 3BSHA 1TWIA 5FESA 4PUEA 1AFSA 3UXAA 3P84A 1VYRA 1W3KA 2J9ZA 3GVWA 5CLWA 3VIGA 1J12A 2KX9A 2QS8A 4CD7A 3JZEA 1HO1A 1QXLA 3H8AA 1FFRA 2CITA 3W07A 5G4WA 4C5ZA 5D32A 1KXHA 4X2RA 1JDCA 4BQ5A 3MBFA 2BVTA 1WQ5A 5D02A 5E9XA 2A21A 1QPRA 2BXYA 4RV8A 2XIMA 2C19A 2A79A 2DH2A 3SEPA 1LJYA 1KWGA 1JDAA 1M01A 1K8ZA 5A6LA 3TTSA 2BGSA 2XH7A 4V33A 2HNEA 2V5LA 3W1RA 4JYFA 3KBJA 3VE9A 4UTIA 4P8WA 2AAMA 3R89A 1JAKA 3W7HA 3ELFA 4JTEA 4TXEA 4E2DA 2INFA 5CC6A 1P0NA 1POKA 4BZYA 1UD8A 5REQA 4IXXA 3VIOA 1NM9A 7REQA 4UFMA 3AXIA 2R24A 4PC8A 4FF7A 2VHLA 3BAJA 1GHRA 3WBWA 3WQGA 2O7SA 3J7HA 1J2BA 3UPWA 4FLRA 3P81A 3VNLA 1U5JA 2RAGA 4DZIA 2PI6A 1VBGA 1DVJA 3R79A 3SRDA 4XX6A 4NZ4A 4IQDA 4C6BA 1V6XA 1G4TA 3PSWA 1A5AA 4UUIA 2GWNA 1V79A 1B3YA 2X05A 4L1WA 4GXMA 3S6OA 3D46A 4KRUA 3SFKA 4NAFB 2PC8A 4B5XA 4H6RA 4CQ9A 3RDKA 1MFUA 2IPJA 1Q13A 2CWXA 3D3AA 4AXKA 5BOEA 3WK2A 1G7VA 3WLHA 1JDFA 1K3UA 1KQYA 4OTKA 4MUZA 2DIKA 3NVTA 1S5VA 1QK2A 3H2NA 3EXSA 3TJLA 3NQMA 3S1VA 2JFEX 2OPJA 3WDRA 2XGIA 3UG3A 3RLUA 1IIHA 5M3WA 3B40A 4IFOA 4IPNB 3JU2A 3BE7A 2E9LA 4NSBA 4Q4QA 2FIQA 1F6YA 2JKAA 3VZXA 3SM0A 3G1VA 1JCJA 4A29A 1H61A 1DTNA 4JIHA 1ITUA 3PPFA 3HG4A 1RA0A 1XYFA 9XIAA 3QR1A 1DTUA 5I06A 4O8AA 4HMEA 1UASA 3V4BA 3KVLA 3Q94A 4UMAA 4GI9A 3U2ZA 4FB7A 3TW9A 3KS6A 2E40A 3GR8A 1WZLA 3B0VC 3TJ4A 3SCWA 2XVKA 1VYPX 1J93A 3FAXA 3FY1A 3AI0A 4S3FA 4AY7A 3RNDA 2RDTA 3N12A 4V2XA 2J7GA 2RUSA 1E6QM 4WKAA 4M6PA 3GR7A 4M0XA 4E4UA 3U2CA 2E7FA 4AYSA 2CXGA 3W25A 1H7NA 1OCBA 4GNVA 3MB9A 1PUDA 4IH3A 4JFVA 1QPKA 4HIBA 2YXGA 1OFRA 5FL0A 2HWGA 3E0FA 4J3ZA 3G1SA 5EA9A 4NUWA 3A23A 4RLIA 3G1XA 2VDGA 3N2XA 4I9JA 4M3PA 1GZJA 1MO0A 3HFTA 6TAAA 3W6YA 3SCOA 2QLYA 3E96A 4IQJA 1UZ1A 4MWAC 4PTNA 1LWIA 4YMZA 2XJ7A 1L2QA 1NOFA 5AZ0A 3IK4A 1XYBA 3DESA 2R82A 3PBYA 4XBJA 3APYA 2XG9A 4JKMA 2E68A 5D8ZA 2P3ZA 1CW2A 1J6PA 5FJRA 3AMDA 4AD2A 5ABFB 5CZKA 4OKDA 2PCEA 2UY2A 3EPNA 1PKYA 1PAMA 3UG5A 3D5HA 1BSIA 2WJEA 4M56A 4DUVA 5HR7A 4U33A 3TROA 3SQMA 2TMDA 5HNTA 2J13A 1BWKA 1VRXA 4DF0A 4DZ5A 4JFSA 4K1GA 4HHMA 4FP1A 5LYRA 4IMDA 4IF2A 2FFCA 1HKJA 3GE7A 1FUYA 1SZGA 3QZEA 4N9EA 1KW1A 4DLFA 2QVNA 1T99A 2WOQA 3AS0A 1AW1A 2PD9A 1DV7A 3LU2A 3AROA 3VTRA 3HPAA 2RGLA 3SN4A 2WC3A 3USZA 2H90A 2WVSA 1LT8A 3PTMA 1EJVC 1JDEA 3C2YA 2Y8VA 3T2PA 2FFIA 4Q3MA 3WNOA 2QDHA 4WY0B 1UR1A 3BGAA 1BTCA 3PANA 4IXHA 1A49A 4N4QA 3C3NA 3CU2A 5TAOA 1TQJA 3TU9A 2QCGA 3CB3A 3IUHA 3NO1A 5AHLA 1ZJBA 5IFTA 2JF7A 1YXYA 5DEZA 4LAUA 3MYPA 3A24A 1PWMA 2WCAA 5K9XA 4MY1A 3REQA 4O14A 3PBUA 1DP0A 1YHTA 1KBJA 3R11A 4XUGA 2OJPA 3OODA 1R38A 3E49A 1TYGA 2PLCA 4K1WA 3R4IA 1N2VA 3N6HA 2WPGA 5GPRA 3S6DA 1QR7A 3F4CA 3POCA 3RR4A 3G77A 1H63A 4FSAA 3M41A 2WZHA 1KTBA 3NEHA 4HJWA 2LLEA 1MNZA 4KRZA 3M1ZA 3Q67A 1F4AA 4GO8A 3NPVA 1J2WA 3FJNA 3VIFA 4GWEA 2PDGA 5A6BA 4GKLA 4C6EA 1GQIA 1Z89A 4KS0A 3NWRA 4ORIA 2AQOA 1H3GA 3K5XA 3MKKA 3ECQA 3EDFA 3W38A 1YQ2A 5DELA 3CASA 4AMAA 4ADTA 1ALDA 3EDKA 3L0NA 1W5PA 3WJWA 4K39A 1J8VA 2DZUA 4NRSA 1DJNA 3T0DA 1JAEA 2P88A 4GXPA 5E5CA 1NF0A 2FZDA 3PP7A 3S2JA 3CV7A 2YDRA 5DRCA 1R6WA 2QUMA 4O57A 3VD7A 1A53A 3PZTA 2D0GA 4QTGA 3G22A 4DF2A 1TIWA 1EBGA 1YXDA 2BFGA 4W7VA 4W5UA 1F74A 3FA3A 4DBEA 2FPVA 3EX1A 2DJLA 1M65A 1F5ZA 3DZ1A 3BV4A 5LNRA 3NDZA 4HOXA 1PSCA 3RN6A 5FI8A 3C0LA 3SI9A 1WDDA 1MSSA 1XLFA 3SGUA 5AHIA 3NZRA 3OA3A 1EO7A 3JS3A 3ARQA 1C3FA 4W86A 3ARVA 1C93A 5BXRA 3PFMA 1F76A 4ACYA 3L4VA 5CZTA 1RPXA 4C6IA 2B7NA 4LXFA 3S5OA 4AD5A 1QNQA 3VNIA 3CJPA 3CS2A 2D22A 1FRBA 3W87A 4HOZA 3WQ5A 5C9ZA 2J9YA 4HA0A 4J2MA 4WJXA 4E5TA 3JZUA 4ZE4A 4R7WA 5BRQA 4CCZA 1VH7A 1DWHM 1PX4A 1UD6A 2OQYA 1EA0A 4KH2A 3W4RA 3LPFA 4LC6A 3ERPA 4HSNA 5D38A 1A5UA 2Z27A 3B8WA 5F2IA 1XH0A 2E09A 2G0WA 3F7JA 1EIBA 4OZOA 4GVGA 2B7QA 4F40A 3QMTA 4G2DA 2O9TA 2I5GA 2H3BA 5DCEA 4A3RA 4FR6A 1AQFA 1O94A 3AHZA 4WX2A 3W7KA 1CB2A 5JBDA 3WMBA 4C6CA 2Z1XA 3E2RA 2PDUA 3ARRA 1H0GA 3CZKA 4LBRA 1Z44A 1BGAA 4FIRA 4LSBA 3T6CA 1OX4A 1HKIA 1V3KA 4PMNA 2UY4A 4FAMA 4J27A 2IPGA 1EJTC 3TX9A 2OLSA 1BXCA 1ML1A 1DJXA 2OX1A 3WLJA 4V27A 1TTQA 3QPYA 2PLKA 1TREA 5ABGA 5I3JA 2VT0A 4QS5A 3BLEA 4GIYA 3C3UA 1OZMA 3EMQA 3ITOA 3UG8A 4PMUA 3KWSA 4YTUA 5F4WA 2UY3A 4FXFA 4BF9A 4C90A 1ICPA 2GVEA 2BVDA 3AAMA 4HCHA 3PUOA 1CGXA 3CZGA 1JZ2A 3KOXA 3IIOA 2ZVRA 4KFPA 5AECA 1ADOA 2FDMA 3D0CA 4ZENA 3O2LA 5D2XA 3SFWA 2VR5A 3ZSSA 2NWSA 3G6MA 2WMJA 2ISVA 2JGYA 5I00A 3GDTA 1E5NA 5LIUX 3U3HA 4AD4A 1H7XA 1NDYA 2WVVA 1B3WA 4K37A 4DBDA 4H04A 4XO6A 1US0A 4TQTA 1HT6A 3K1GA 1OF6A 3AHVA 3CQJA 1O6IA 2QZRA 3GD6A 1RD5A 2PRHA 5A6TC 3E5BA 4DO4A 2XZ7A 3C61A 3N11A 1H7WA 4TR9A 3WSUA 4PRRA 4PMZA 5JH2A 3CIVA 2Q8LA 5A8MA 3LEPA 4UC5A 4MB1A 1SUXA 4AX6A 2PZ0A 1RCXB 1Q6LA 2WZMA 4IPIA 4AIOA 3AMCA 1BQGA 3KHJA 3LZ5A 4YJ5A 1GZ1A 1VGAA 3IEBA 5BZAA 3URNA 1BYAA 4PUKA 1XICA 5HQLA 2ZZ2A 3UY8A 4ZQOA 2CC0A 2PDKA 3HPZA 2GQ3A 4PMDA 5DMYA 3LTPA 5C0QA 2BWGA 3LS9A 3UNTA 3GHUA 2Z2UA 3EWZA 2OLAA 3T07A 4O10A 4BKNA 3QRHA 1IEWA 4JYEA 4E2BA 3E74A 1Q5MA 4GQRA 2GJRA 3VC6A 4LVBA 3WDIA 3HB9A 1B9ZA 3AC0A 3BCJA 3W7EA 3W27A 1FX6A 1RAKA 1EL3A 1AQMA 3DUGA 4KGJA 4CNOA 5LHEA 3UGVA 1EB3A 1GOXA 1QI0A 8XIAA 3AZSA 3QLLA 1C7TA 3P3BA 1UPPA 4O4WA 2WKJA 1ZRQA 3PUDA 3AXMA 3VX1A 1C91A 1TV8A 1V3JA 1LCOA 2GSEA 3AHXA 3DFSA 4MLRA 3DFTA 3VABA 3PULA 4UZSA 1GKRA 5AYBA 3W71A 3UZYA 5HUOA 1AW5A 1MQRA 3ANVA 1FQ0A 3DERA 4DBUA 2VEGA 3AICA 4IQLA 1QHZA 4OT7A 1GVEA 4PMVA 3G8RA 1NWRA 3IUIA 2GQ8A 3GXNA 3OQ8A 2ESCA 4O53A 5A8NA 5I0DA 3LHWA 4QRNA 4B5UA 3S2CA 4CNNA 4H9ZA 5DBTA 5JXQA 5G2HA 2F2HA 2X16A 5AHMA 5I77A 2BNJA 2NXHA 5G2IA 3L7RA 4AD3A 2BOEX 5FJIA 3H7VA 4UQDA 3WBYA 4ASTA 1TE1A 1ISXA 4JTQA 1PEZA 5IXEA 3H26A 2A0NA 1CCWB 2ZRYA 2VFGA 2ZDSA 3MHUA 4L5ZA 3CXOA 3JR2A 4R7OA 5ECVA 1E0VA 4L4LA 5FA5A 1YTKA 3W84A 4MZ1A 5C70A 4AIUA 5DY2A 1CXHA 3VIJA 2W5FA 1WX0A 3MVTA 2GUBA 1KLYA 4HYWA 1RY8A 2E4TA 3CQ0A 1RALA 2L5HA 1G67A 1V8EA 4RV3A 3PBVA 4Y8EA 1Y5XA 2IKIA 4HA3A 3W7JA 3AIUA 1OCJA 1HP5A 1B31A 2RKXA 1TRDA 1KR0A 1XPYA 4BQ2A 1QPQA 1XGEA 3S2NA 2OMAA 3VD4A 1EF2A 1G6CA 3UNDA 4XB3A 4JZ5A 1K8CA 4KBXA 3OLGA 4EXQA 4BY3A 6XIMA 3FEMA 1YIXA 4WZHA 4EPBC 4QDPA 4GISA 2CLKA 1NH6A 1PYMA 2VI0A 2WNWA 3WO8A 3ZJ8A 4O1BA 1ONXA 2NQ5A 2ZC1A 4TUFA 1P5BA 3EX6A 5HWNA 1W1ZA 1W17A 1R3YA 4GJ1A 5I78A 1JFHA 3H7RA 4AX7A 1S5MA 3BDKA 3SCPA 3BV7A 1O5RA 1FH8A 5CGQA 5I3IA 2D2HA 3R0KA 3LM7A 5D9NA 3GXTA 1V6VA 3QGKC 4JX5A 1GPFA 1JZ4A 5J04A 2MANA 1RV8A 3HQOA 2QJHA 3GVRA 1E3XA 3W37A 3CPGA 4JTSA 4TOQA 2V30A 2ZWZA 2NVAA 4XV0A 3T4CA 2Y7DA 1W3HA 4ZQRA 2WSPA 3TNOA 3VGHA 1IXNA 4JFUA 2JQXA 1K9EA 2ZUVA 1M9HA 1E1EA 5JQ9A 2C8NA 4ZQNA 5MKGB 5CBJA 2PFHA 3WH9A 1U1HA 3W1UA 4UTMA 3H7UA 3KTCA 5A6AA 1V5XA 3QV7A 4A8IA 3WH8A 4IIHA 4OVXA 3FYOA 1JCTA 1MDRA 1NFGA 1W2PA 2YW4A 1R47A 1S5WA 1C8VA 2QCLA 3E5PA 4HB7A 3LCXA 4Y9PA 3QXBA 1GCYA 3LNMA 4FOKA 3GFXA 3UXLA 4EXAA 3WLQA 3KEHA 2PDCA 3B0XA 2Z7KA 3DKJA 1J0ZA 1ECEA 5ABTA 3RU6A 4X9YA 3B8IA 3LPOA 4XZIA 3CYJA 4MB4A 4F0LA 3SRKA 1THFD 1E5JA 2E9MA 1N55A 2PGRA 3NQ2A 2FKPA 3ENLA 4HPGA 1SZFA 1NFBA 2AGKA 2UBPC 1IR1A 3I6EA 1EFZA 4Z1CA 4IIEA 1H4PA 2PS2A 3OG2A 3OO2A 3ARXA 3MSGA 3WQDA 3R2GA 1FWRA 3VNJA 1TJPA 1Q4NX 4UMBA 2D2JA 2GQAA 4K38A 3SCNA 2NX9A 5CGTA 3TJIA 2ACRA 1BKSA 2HZGA 3Q65A 4OV4A 4EPEC 5C7HA 4RE0A 4Z2GA 3GDBA 4RE3A 7TIMA 1GWJA 4AXNA 2A3LA 4RJEA 4UTWC 1W9BM 4Z0SA 4G5DA 1A47A 3BQ5A 4PFMA 4RCXA 1OK4A 2PDNA 2Y88A 5A6KA 3GDLA 4MFEA 1XX1A 4U4MA 1N82A 4ILSA 2CKRA 5BW6A 3HTWA 4UR8A 4CCEA 1DIOA 2X42A 1IEVA 3VDHA 3M5ZA 1F05A 3QV6A 1W5MA 1ONEA 2Y8KA 2DFAA 4ECLA 1ZLPA 5XIAA 2Y7GA 3A4WA 1XLDA 4U2ZA 1W9PA 4BEQA 2DZWA 5C54A 1EDQA 4O50A 1CDGA 4HA4A 2PEVA 1MI3A 1PCWA 2OG9A 4L6HA 3SB0A 4JKLA 2FPTA 1VCVA 4CD8A 3NSNA 3NUKA 4US6A 2JE8A 4G1KA 4EOUA 3F4NA 1UKOA 1MW2A 3UWUA 1E4IA 4G7EB 3WLLA 3IIZA 4TX8A 3M0XA 1KXTA 1HL8A 4CVWA 1JNDA 1GOQA 1K70A 1QBBA 4LRTA 5CSYA 4IPLA 3A3XA 1L6WA 4O19A 4JAWA 4DO7A 4N9CA 1YMYA 1I2PA 3OP2A 1SR0A 3T8QA 5FOOA 1PYFA 4M7TA 2NQLA 1GVQA 1QNSA 3WNNA 1X39A 1NARA 3QHNA 1LG1A 4IFKB 4E8CA 2OGYA 3R43A 3G18A 5TQLA 2WNNA 3AU6A 1JD7A 2PDFA 1LRQA 2X7WA 4PA8A 5HQEA 3SUWA 1XCFA 3WK3A 2EJAA 3GVVA 3TK7A 1P7TA 2WBGA 1A3XA 3EYPA 3LV6A 3K4DA 1KWKA 4EWJA 1V08A 1M7JA 2J6VA 3PWAA 4MADA 2OSWA 3CL7A 2WMGA 4TIMA 2YR1A 4Z1AA 2CZDA 3BJTA 4NAFA 3VMPA 1DXEA 3N6JA 5I09A 1XLKA 1RJQA 1VR6A 3EWUA 4HD5A 1S5NA 1TVLA 1GW9A 4NP7A 2BX7A 1M04A 4TU1A 2CZVA 4HN4A 4S3KA 1UP3A 3LM3A 4AAJA 3DI0A 1V0NA 2BGQA 3KFTA 4ROPA 5AC5A 4ZOCA 4PUJA 4TVCA 1L6FA 4KWOA 3W72A 1XRVA 4IP7A 1OC6A 3ZM8A 2GPTA 4DNMA 1QMLA 1RBOB 4JN7A 1VPXA 4IJBA 2YXXA 1M7XA 4GYFA 4JTDA 2OYLA 5HMSA 1Y65A 2Y5EA 3VKKA 2VMFA 2PZNA 1B0IA 1ZP3A 3RX2A 1KFWA 3VUSA 4F0HA 1P0KA 4O54A 4CQDA 3M5XA 3QYSA 3GW3A 3GFZA 3GS6A 3NFUA 1HJQA 3IAQA 4HNOA 4B5TA 1PZ0A 5CH9A 4CCDA 1P0BA 2DZAA 1P1XA 1G0CA 1CEOA 3N9SA 4C1LA 1TKKA 3EB4A 2ZZ1A 2GGHA 4QAWA 3LY0A 1E43A 2A7RA 3UYCA 5HPOA 3K4AA 2QGHA 3AQUA 3L68A 4Y2WA 3BICA 4LUIA 4EP8C 2J7EA 2OEKA 3Q4DA 1EPVA 3TOPA 4Z08A 3DAQA 5AZ1A 4UFJA 1VIZA 2GJNA 2V69A 3TFCA 4FEZA 3NEVA 3OVGA 1KRBC 1SMDA 2ZE0A 3KWXA 4MOZA 3VZYA 5D2WA 2G5WA 3VINA 2GSJA 4YHEA 3TAOA 2D73A 3DDMA 3TTYA 4FXRA 4TVDA 1O60A 3EWDA 1O66A 1JCMP 4YPJA 2VZUA 1VAHA 1A5OC 1HVXA 4R9XA 3HPFA 5D2VA 1QOQA 3RRAA 1G7UA 4ATDA 4JNMA 3V5FA 2DT0A 1XV8A 1HJSA 4P8VA 4O16A 1KFEA 5B7ZA 3FX4A 3R7MA 1IR2A 2IKHA 2W63A 2ZICA 3VYLA 4XAPA 3PB0A 2ZUTA 3TAKA 1JQXA 4AZHA 1CT5A 3L2IA 5HR6A 4PMYA 3SBFA 3B9AA 2AGTA 1JUEA 5E93A 5GJPA 1UQYA 1ISVA 1E6ZA 4IJRA 2WC4A 1CXIA 2CZ5A 1PPIA 3BL3A 4YU1A 1KR1A 1FCQA 2YIHA 3G1FA 1MXSA 4DWDA 3MHFA 4E4PA 1DJYA 1I1XA 1D8WA 5BYWA 2XIBA 3SUTA 4GABA 4MNMA 5LA1A 3W2KA 4QNWA 3WQCA 4V15A 2WM0A 1Z8AA 3P8JA 1QNPA 4WK9A 4GZ7A 1W6TA 1W9XA 2CXEA 3PZOA 4WR3A 2HMCA 2DH3A 1GG1A 3OBEA 2XGZA 3BG3A 3H22A 3TTOA 1DORA 1XP3A 1WKEA 4ADSA 5M2FX 3S47A 3G24A 5CBBA 1OFEA 3OLDA 3UW6A 1IXPA 2AL2B 3CH0A 2W91A 3UZXA 4M81A 3LGGA 2WQPA 1TZZA 4OOUA 3SUVA 4PTXA 5H1WA 3LLDA 3C0QA 1OD8A 1SZRA 5M03A 4JTJA 1SJDA 4G56A 5CBIA 3AALA 4IP5A 2CLOA 3LI1A 1IF2A 3MI6A 1I75A 4XZMX 3MPGA 3BW3A 3P5ZA 3MSYA 1JCXA 2YDAA 4KEVA 3DHUA 3ABSA 3XIMA 2E77A 4XAGA 1JPKA 4DJFC 3M9YA 1SVDA 1D7FA 4LVDA 5A6MA 2Z28A 2VGGA 1JGIA 1VHNA 1P48A 3CAWA 4UTTA 3QSRA 3S2LA 1V6YA 2O9OA 2ISWA 1E1CB 4F9DA 2IKJA 5AYIA 4QJ3B 4FNRA 1XC4A 4R34A 1PIGA 3U7VA 1P1MA 3CTLA 3RRXA 1U1JA 1A5NC 3REQB 4GYKA 4D6JA 4DJDA 1JCNA 3TFXA 3H55A 1LBMA 2J66A 2VELA 1F7BA 1S2VA 5EBAA 3TWBA 3GTNA 4YLWA 1IWAA 4KWUA 1DHPA 4KKXA 4JR5A 1GEQA 3NM1A 1KM6A 4LYQA 4DM1A 2PGWA 3OLIA 3RLVA 3L5AA 1M7PA 2YCLA 3N13A 3B03A 2BHUA 1JI1A 1T7LA 1GQNA 2O55A 3UEQA 4F79A 3LBMA 2YYTA 4CN4A 3HPSA 3AWOA 4BS0A 1PVNA 5C9WA 3L66A 3NL3A 4IX0A 3CLMA 1SGJA 1MEWA 5BNKA 3H2EA 1M03A 1TPUA 4FNPA 4E8DA 3AYRA 1QI4A 1NDZA 3D47A 3PFRA 2NV2A 3M64A 2GJXB 2QMJA 4MWAD 1XKJA 3LLXA 3N9KA 1WV2A 4ML4A 3WF1A 4AISA 2YB4A 1U5HA 1FWGC 2XM2A 1TV7A 2QDGA 2X0YA 2C16A 2Z25A 4D71A 2PURA 4MTVA 3FLUA 3M47A 1TPWA 3ZR6A 3HQ1A 1VHCA 5GNYA 3A4XA 1FWHC 1VEPA 3RPDA 4RXFA 2Y5JA 3VK5A 1UWQA 1E0UA 1XJBA 4W8AA 3B06A 2VFHA 3EKZA 4B3KA 4Z42C 1S2AA 3BLIA 2OZ0A 2ZVIA 3F5LA 3CAKA 1RQBA 4HNUA 3RM8A 3PBGA 4C60A 4XTDA 1EA9C 5IHRA 4PEKA 2TYSA 2XWDA 3O6YX 1IQ8A 2IW0A 1GVSA 1ZFJA 1BGGA 5U7SA 4RDWA 1OC5A 1BVWA 3BGGA 3T08A 3WDHA 3T2QA 5EMJA 3NOYA 3TYCA 3ZOAA 2ICSA 4YXGA 5AVNA 3C52A 3NGJA 2Y7FA 1UW9A 3C8NA 4A2RA 4W8LA 4PBEA 1H1NA 1TELA 2PDJA 2OCZA 2FZNA 2F2KA 2D23A 3GFYA 3W2LA 2WLZA