3EXSA

Crystal structure of kgpdc from streptococcus mutans in complex with d-r5p
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
217
structure length
208
Chain Sequence
b'LPNLQVALDHSNLKGAITAAVSVGNEVDVIEAGTVCLLQVGSELVEVLRSLFPDKIIVADTKCADAGGTVAKNNAVRGADWMTCICSATIPTMKAARKAIEDINPDKGEIQVELYGDWTYDQAQQWLDAGISQAIYHQSRGEKDLNKVKKLIEMGFRVSVTGGLSVDTLKLFEGVDVFTFIAGRGITEAKNPAGAARAFKDEIKRIWG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RmpD (Hexulose-6-phosphate synthase)
publication title Open-closed conformational change revealed by the crystal structures of 3-keto-L-gulonate 6-phosphate decarboxylase from Streptococcus mutans
pubmed doi rcsb
source organism Streptococcus mutans
molecule tags Lyase
total genus 77
structure length 208
sequence length 217
chains with identical sequence B, C, D
ec nomenclature ec 4.1.1.85: 3-dehydro-L-gulonate-6-phosphate decarboxylase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00215 OMPdecase Orotidine 5'-phosphate decarboxylase / HUMPS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3exsA00
1G4PA 4O1BA 2NXIA 2H8XA 5HINA 4HNTA 5IBXC 1H7XA 1RQHA 4MPQA 1PS9A 3MP4A 3U2OA 4MYAA 3N73A 3SJ3A 2AGKA 3EX1A 1L2UA 1F2JA 3S5OA 3LCFA 3I6RA 3BLIA 1FWWA 1T0OA 2VELA 2Y7FA 3W7JA 4O4VA 1EPXA 3DHDA 2XN2A 3JR2A 1KFEA 4WOQA 4NNBA 4A22A 1TPH1 2YW4A 3B05A 3L21A 2FQIA 2HTMA 3KHJA 2DJLA 1N8FA 2Q8LA 3S5NA 2EPHA 1Q45A 4Z1CA 3NDOA 2X1UA 3M47A 2Z2UA 1PL9A 3P8IA 1Q6QA 4K37A 3NR0A 4JIQA 1TV7A 3NZRA 3S8HA 1RZMA 3OA3A 4XQ6A 2C18A 2TRSA 4CLMA 3ELFA 3T7VA 2C13A 5AN7A 5AYXA 3WK0A 1WOBA 2ZZ2A 5D02A 3PC0A 1H1ZA 2E6FA 1YPIA 1OFDA 1ME8A 3MYPA 4JTKA 1CW2A 1FDYA 2G97A 1U5JA 3IIPA 4O54A 4Y9AA 3UXDA 3IRDA 3KRZA 1J4EA 3L5AA 4XKYB 2WSYA 3W7NA 2HS8A 1GOXA 3G1XA 3KVJA 3RFAA 1GVSA 2TMDA 4M5PA 3SR7A 2YZRA 2ATMA 3LCWA 4K8HA 5LHFA 3UPBA 3E9AA 1DBTA 3G1AA 2R8WA 2I9EA 5KZEA 4PTNA 1JCMP 3MWAA 2NUYA 1A5AA 4UTMA 3SIZA 4P2VA 4WUIA 5LKYA 1KFJA 1QO2A 5EL1A 4OT7A 4JYEA 1FCUA 5D2XA 1GQNA 3PG9A 3DKLA 2YR1A 3FIGA 3JRKA 3I65A 1C8VA 1R30A 1EX5A 3ABQA 4ZQNA 1VR6A 1WYIA 2VENA 1LOSA 5K2ZA 3G3MA 4OBTA 4IMGA 5EMUA 1KM4A 4ZVJA 5F1VA 2DU2A 4K38A 5CKSA 2YYTA 2VXNA 1YTKA 1QPRA 3MI2A 4JTIA 3W7RA 5AYYA 4OV4A 2ZFAA 1TTJA 4AVFA 2G5WA 2V2HA 4QISA 4AWUA 4P61A 4UTKA 1AL8A 4UC5A 1KFKA 1SZFA 3LHYA 3M5VA 1K03A 1I2PA 5FEWA 3MBDA 5EA9A 4HSNA 2ZRWA 4ALDA 4JYFA 1ZY9A 3QQ1A 3G1DA 8TIMA 2DZUA 3A5FA 4J9JA 1C9DA 3HIJA 1TQJA 3MYOA 3O6DA 3P5YA 3HG4A 3UXAA 3NQ6A 3CT7A 4NNCA 4HPXA 5CG7A 3W1TA 3ZR4A 1GG0A 3UYCA 3Q2DA 3W1XA 1R2RA 5A8GA 3P8JA 3P60A 1XBZA 3IGSA 4NZJA 1SQ7A 2QCMA 1KV8A 3IIVA 3L2IA 2QUVA 4FIRA 5D37A 1Q6OA 1H7OA 5LGXA 2JKAA 4LWWA 2X1RA 3WK1A 2CLOA 2YW3A 2DZXA 5EPDA 2WOQA 1IGSA 5CPNA 3MO7A 1KM6A 1A5CA 3W7CA 3USBA 1QMLA 5KINA 2QCDA 3W6YA 3G3DA 4EF8A 2V0TA 2W0UA 1YXCA 4MZ1A 3GXNA 3PBVA 4X3ZA 5BMXA 5E1QA 4XUGA 3E0IA 4WXZA 5FESA 3O05A 4U28A 4O28A 3LTPA 4M6QA 2CLMA 3W2LA 1ML1A 4EVZA 2X16A 3CU2A 4C1LA 2RKXA 5FEPA 3C2VA 1TQXA 2ZTJA 4IPJA 2Y88A 1ICSA 1FXPA 3TX9A 2JK2A 5LNSA 2CWNA 5DN1A 1FQ0A 1OYBA 4QAIA 5AHLA 1TTPA 3SFKA 2EAWA 2NUXA 3W1PA 3ATZA 3IGXA 4AHPA 3MMTA 3PG8A 4O10A 1W3IA 2X2GA 3OHIA 3P80A 3ANYA 1P5BA 1QO5A 3G1VA 2ZZ6A 3RK8A 1TPVA 4FB7A 4E38A 2AAMA 1OX6A 3PBUA 3G0XA 4Y6GA 4YCPA 1TRIA 1AL7A 3M6YA 2FFCA 1DHPA 4QITA 4HIBA 2CW6A 1M7OA 3NQ8A 2C6QA 1R46A 4Z1DA 3NAVA 1YXYA 3E96A 1QPNA 1VCGA 4WQ6A 4AH7A 5U7SA 1CI1A 2W79A 3BPWA 4I7VA 4RXGA 3LOTA 2YSWA 3ATYA 3B0UX 1JCLA 2DZVA 2FPVA 2JGYA 2BSLA 3W22A 3W1AA 1TB3A 1OX4B 4CNOA 3QF0A 1TCDA 1O95A 3FLUA 1IF2A 1TJRA 3KOFA 1ZJIA 1OK6A 3B03A 3W1NA 5AC6A 2ABAA 2GQ8A 1YDNA 4CNPA 1TJPA 1OF6A 4A2SA 4UTTA 2QCDB 1O60A 1K8YA 4IMEA 4AF0A 2BXVA 4GUIA 4N4QA 3E12A 2A1YA 2WNZA 3BG9A 1LM1A 4X2RA 2OZ0A 3KFTA 4O13A 1S5VA 2J27A 4ZMGA 3QJAA 5D32A 3UWZA 2YFOA 1G7UA 1XFBA 4K36A 2PC4A 4JNMA 4DPQA 1JQVA 2QAPA 3I7QA 3BLEA 5T26A 3NL5A 3FEMA 4M6PA 4EWND 3FJ6A 2F7FA 1R47A 2Y6ZA 4WD0A 3HF3A 3QMSA 4LY8A 2OJPA 3CM4A 4HT3A 1F73A 3UWQA 4YXGA 5K9CA 1LDCA 3C2OA 4PODA 3TIMA 5BW6A 2UV8G 4Z0JA 1LZOA 2R14A 2O7QA 1XI3A 3NQ2A 4JY8A 3W1LA 2WSQA 4Q32A 2CLKA 3DFNA 2C15A 4RLIA 2A6NA 1F5ZA 3UZ5A 1ME7A 3KVKA 1TREA 2ISSA 1XL9A 1KFLA 3DKJA 2V5LA 4DBEA 2V8ZA 3P67A 3HOJA 3B0VC 1M6JA 1C29A 2GQ9A 5CSSA 4X9SA 3GIYA 1QFEA 4LVDA 3GNNA 3G8EA 1KV5A 1ME9A 3LM7A 1YTEA 3IIOA 4DO6A 4NVTA 3B8DA 5DXXA 1SZEA 4JD4A 1FDZA 5FF7A 1JUEA 1KTCA 1TPC1 4RZ6A 3NQDA 3HO8A 3VCRA 1VGAA 2A2IA 3MBFA 1HO4A 3P62A 3G0UA 2RFGA 3QRHA 5DY2A 1DQXA 3NG3A 3N3MA 4S2CA 1OHLA 3W1MA 1D3GA 1P0NA 3GR7A 1KLYA 5BRBA 3NPWA 4JTFA 2NV1A 1H7RA 3KVMA 4NZFA 1QAPA 3CWNA 3Q94A 4PA8A 2VEMA 3M43A 1EP2A 3D0CA 2QF7A 2Z0IA 1EP1A 3H53A 2FTPA 4UTJA 4FXSA 1G67A 1G69A 4H4IA 3G18A 3HGJA 4E2DA 1F76A 3TSBA 5BOOA 1TSIA 4O17A 4IMDA 4DO5A 4JDBA 2A0NA 4JN6A 3UY7A 2ABBA 4A3UA 3KAOA 1B9BA 3WK3A 4UFHA 1FBAA 4FX7A 1HL2A 5DELA 2Y7EA 3QEZA 3QW3A 1W3NA 5AYZA 1CX9A 3O16A 4O52A 2JBMA 2ZZ5A 1SSGA 4AHQA 2TSYA 1VRDA 1DJNA 2ZRXA 3NXFA 3QYQA 2V30A 2ZA2A 4QIUA 2TPSA 4NXSA 1Z44A 5I3KA 3HGRA 4N9DA 3QMTA 5D2YA 3T40A 2QJHA 1F05A 1N7KA 1LLZA 3DH7A 4JTEA 1FUYA 2H8ZA 1K3UA 2ZCGA 2ZYFA 2EGZA 4H6KA 3LI1A 3W71A 5DCDA 3G1YA 3GVGA 2Y70A 3ABRA 1FXQA 4ZL1A 3LRLA 4ONVA 3WJSA 1LROA 4QNEA 3BG5A 4FNQA 2IQTA 3IEBA 3NO5A 1A5BA 3HG3A 4EF9A 3TV8A 2PRLA 1NVMA 1E51A 1HTIA 3W7EA 2ZZ3A 1FWTA 4FO4A 1ZENA 3BARA 5L9FA 3HMJG 4UTIA 1KM1A 1LP6A 1WDWA 1GG1A 4M7TA 4UCGA 2OX1A 4AXKA 3DFTA 1OJXA 1P4CA 2NX9A 1WQ5A 1THFD 1FY6A 4UTWC 3EKZA 4M19A 3ABOA 4N2YA 2NV2A 3VKJA 3TXVA 4XBSA 4LU0A 5D33A 1I4NA 5HWNA 1T96A 1W5NA 3EX3A 1WBJA 1QWGA 2DJXA 3I7RA 2DZWA 1NFBA 1GWJA 1D3HA 1R2TA 5IM51 1DVJA 3MHUA 4E0CA 2D73A 2VEKA 4KWVA 5FF3A 1DQWA 3L0KA 4GNJA 1VJIA 2PURA 4LUIA 2A7PA 2Z6JA 1SFJA 4N02A 3EB2A 2GUUA 4NT0A 1ICPA 1OK4A 1OFEA 2NXGA 4IUOA 1G4SA 4PEKA 3QZEA 4RCXA 2V9DA 3A21A 1IXQA 3H55A 1MO0A 2V82A 3PWAA 3T78A 3EKLA 1MSSA 1WBHA 1X8FA 3TAKA 5LNWA 1KBIA 3W1QA 1J2WA 3LHTA 1LRTA 4OV9A 2GJNA 2BLEA 4DEFA 5MHBA 5AOUA 1VZWA 4LTSA 3TQ0A 5LSMA 3BLFA 5AHIA 3L9CA 3P7YA 2YCEA 3EXRA 1BWKA 5I3FA 3I7SA 1NEYA 1WV2A 3GDMA 1W5QA 3G1HA 2H6RA 2V5BA 2Y61A 5IBXA 5LGZA 2CLEA 2PE4A 3IV3A 4XZ9A 5F2MA 2ZQ0A 1H7WA 4O15A 3C4UA 2JGQA 5DLCA 4PH6A 4MIMA 3PAJA 1ZAIA 3NM3A 1N55A 1SSDA 1QOQA 2DP3A 3HG2A 3DFOA 4AHOA 2DORA 4TMCA 2E77A 3C2EA 5G5IA 6ALDA 1W3TA 4LVGA 3N14A 1QPOA 3VNDA 3W7IA 3E02A 1V7YA 3PS7A 1X1ZA 4EIVA 4JTJA 1H7NA 3QFEA 1TTIA 3HPSA 1IIHA 3DFPA 1G7VA 5HULA 1EP3A 2TYSA 4UTUA 4GUJA 2WNNA 1DJQA 2ZRYA 2RHGA 3O8AA 3S5ZA 3G22A 4TIMA 3L5LA 1ZFJA 4MJMA 3C8FA 2WPBA 3SZ8A 1I2QA 1NAL1 1FCVA 1GEQA 4MKNA 4UNLA 3FYPA 4O16A 1MEWA 4HPJA 4YMZA 2J6XA 3TDFA 4IGHA 1ZAJA 4JDYA 1FWSA 4N9BA 3N2MA 1LORA 1G4TA 4LC8A 1PCKA 4PC8A 1P1XA 2DZSA 1VLWA 3LXAA 2XN0A 4FNUA 4MVAA 5FF0A 1RPXA 2VC6A 5D38A 3LLDA 4HSOA 4Z08A 4DO4A 3KRSA 5F4SA 3EX2A 1YXDA 3SW6A 4MUZA 1LBMA 4ZQOA 3HPZA 2WJZA 3BO9A 2E68A 1TPWA 1AK5A 2J9YA 1LBLA 5C54A 3UQNA 1VLIA 2C19A 3OIXA 3TE9A 2A85A 4MFEA 4LUJA 1GTEA 2V81A 3M5ZA 1RQEA 4ZQCA 3OG3A 3LI0A 1H61A 4CCDA 2NWSA 4K7YA 3S1UA 4JX4A 3IIXA 2WV8A 2YDAA 2R91A 2GVLA 4XTDA 1S5WA 3DZ1A 2ZRVA 4PL1A 3W9ZA 4LVAA 3HPXA 2VKZG 1SUXA 4O8RA 2CZEA 3M16A 1I2OA 1XKYA 3SGZA 1SFLA 3TKFA 1SO6A 4NQ1A 4ZZ9A 2FPYA 4JTLA 4KWWA 5HR7A 3TK7A 2OT0A 5E0KA 1QNVA 1TPEA 2JKEA 3N34A 1JUKA 2CZDA 3LRKA 4QNWA 3EWXA 3IIZA 2X1TA 4ADSA 3RNDA 1PE1A 3FYOA 2B7OA 3QW4B 3SECA 2E6DA 2Y89A 2QCCA 3TH6A 4BR1A 1OFBA 4Y90A 2B4GA 3GLCA 2NX3A 2FDSA 2V2CA 4ZQMA 3LCGA 2CU0A 2EF9A 2E6YA 2GQAA 4Q4KA 1GPWA 3HGSA 2VOMA 3FKKA 1XBYA 4NJHA 4D2JA 3TSDA 3LTYA 1XC4A 4Z1BA 3DI1A 4IJBA 4MY8A 4UFIA 1Z41A 3PR2A 4PFMA 4K39A 3CPRA 5KTLA 5CPOA 4MOZA 2H90A 3GXPA 4QJ1A 1D9EA 2GPTA 3NA8A 2FPTA 1K8XA 1SO4A 4N9EA 1W37A 3M7WA 4O53A 3RLVA 3QC3A 1UUOA 4JS3A 4UIOA 3F03K 1O5KA 4IX0A 1TO3A 5AC7A 1DL3A 4CCEA 3NQFA 3ZWSA 2VFIA 1Q3NA 1KTBA 2E1DA 2YXGA 2EHHA 4GUGA 1Q6LA 3T4CA 3BW3A 3W2MA 3GYEA 3L68A 1DKWA 1OFAA 1GVQA 5KZMA 5HR6A 1W1ZA 1TYGA 1OYAA 4R53A 1VQTA 2P10A 4I7UA 2J24A 3LGEA 4DF0A 1G6CA 1GYNA 2FB3A 2I14A 1F7BA 3VI2A 5SWUA 1B4EA 3LXBA 4QM1A 4BI6A 3LCXA 4JR5A 3TFCA 1H63A 3PBWA 5I3IA 1L6YA 3NZ1A 1GZGA 3CHVA 5F4WA 3FS2A 4LV9A 2LLEA 2H3DA 3GNDA 1OFOA 3LBCA 4KFOA 1AMKA 1RV8A 2ISWA 3TFXA 3P74A 3P82A 4GRSA 4HKPA 1YDVA 4UMBA 4EOUA 3GAYA 4JXCA 3GXTA 3BVJA 4ML9A 1KW1A 2NXHA 4M6VA 3PVFA 2J9XA 4ADTA 3KRUA 4N4PA 1NF0A 3TMQA 3R13A 1JUBA 5H91A 3THQA 2C0AA 3F1QA 2QDHA 2ZRUA 4O1DA 2C1HA 3EXSA 1TRDA 4TMBA 2HS6A 3PSWA 3CIWA 3GZ3A 4MYXA 1AG1O 4NUWA 3OVRA 3W70A 3TSMA 4XWUA 3LCIA 3GX9A 5BNKA 3W74A 1PIIA 1GVFA 2XFWA 3DHFA 3W23A 1LRQA 2YPIA 3N2XA 3NPXA 4LW7A 4HNUA 4JTHA 4NJIA 3A22A 4GUHA 5KSWA 1JR1A 2VFDA 4O12A 4O11A 1L6WA 4IOTA 1TIMA 4DXVA 1YYAA 1BKSA 3UNDA 5U4NA 1X1OA 2V2DA 5ABTA 4LVFA 3G8RA 3WJZA 4WOZA 2VFFA 1PHQA 3W76A 3W75A 2QJIA 1WAUA 1T99A 3A9IA 3TQKA 3EWZA 1FCBA 3I68A 4G1KA 4E2BA 5BMWA 1SW3A 1KTNA 3YPIA 1V5XA 4FNRA 1Z48A 2QCLA 3PUOA 5KZDA 3W7KA 2VEPA 4L4LA 5H2ZA 3W3OA 1W56A 3N19B 1W5OA 3GKFA 3LHVA 3FKRA 3FJLA 3DXIA 4X22A 5EY5A 3ABSA 4LV4A 4O0ZA 4CQ8A 3TU9A 1YDOA 3C61A 5F4XA 2WKJA 2QEZA 4I7WA 4ORIA 5C6MA 3R5EA 5GVJA 2QUTA 3NNTA 1VHNA 3LHUA 1UBSA 4OGZA 5AFDA 3BW2A 4AF0B 3FFSA 4JTUA 1L9WA 3Q37A 1OF8A 1OABA 2Y63A 4JGDA 3W07A 1JRBA 4I9AA 1IXPA 1J5TA 3W85A 1XCFA 5TIMA 3QSRA 4K7VA 5DXYA 4AAJA 1W5MA 5D2WA 1TV5A 2C16A 3B06A 4TX9A 3TR2A 3NQMA 3W1UA 2R94A 4W9TA 3M44A 1Q6RA 4RKAA 3NPVA 5K7JA 3PULA 4FX6M 4GE8A 5D09A 1ZALA 5HMSA 1A5SA 3W7LA 3L65A 3TROA 4UR8A 1VPXA 1K7FA 4BWLC 2XN1A 3QMRA 4OQVA 4A29A 1JQXA 4NU7A 5D05A 4YLWA 4WJEA 3P81A 4UTHA 3T44A 3W7PA 4LRSA 3DFSA 4RXFA 1TMHA 3CTLA 2E5BA 1W8SA 1B4KA 1EA0A 1HUVA 1MZHA 3C2FA 4KKXA 3GB6A 4MLRA 3WK2A 5I3GA 1QR7A 3G1SA 1IXNA 3NQVA 3LDVA 2A6LA 2QUUA 3LXCA 4LRTA 3GAKA 2QAFA 4Y8FA 2G95A 4MY1A 1PV8A 2OT1A 3N9RA 3LTSA 2C3ZA 3S1XA 2NLIA 4O18A 4LS0A 2B7NA 1I2RA 5FEXA 3GDLA 5EYWA 3NQCA 2Q8ZA 2E09A 2YYUA 1LLWA 5HNRA 1DV7A 1VYPX 5I3JA 3CEPA 3NVTA 4LOCA 1QDSA 3UZJA 1W5PA 3K30A 3G24A 3NL3A 4MJZA 3QH2A 4BF9A 2Y62A 4NJGA 5DBTA 2WQPA 4MY9A 5G4WA 5C5YA 1KFBA 1BWLA 4JIPA 5G4EA 3WJYA 4NJKA 5I3HA 1B57A 3LBMA 4NNAA 3R89A 3O15A 4O57A 3R12A 3A24A 1H50A 5KITA 4FNSA 2HSAA 3UWUA 4GJ1A 3UWVA 1VYSX 3MW7A 2W6RA 1H60A 3NL2A 3MUXA 3CB8A 1S5TA 4O4WA 1R2SA 1LOLA 5G2WA 3U6WA 2Z6IA 2ZZ1A 3LERA 4RZ5A 3DI0A 3EXTA 3LHZA 4KFPA 1OFQA 3W7HA 3TA6A 5CPLA 1PCWA 2JKPA 4GC4A 4GWEA 4TU1A 2DZTA 5C55A 4O1AA 1JCYA 3L0GA 3W86A 5FF2A 4UTWA 1MXSA 3TC7A 1GTHA 3GDTA 1I8JA 1TV8A 3O07A 3GDKA 4BI5A 4NX0A 5F2LA 2A5HA 1ZCOA 3B4UA 3ZFHA 5AHMA 1Y0EA 2ZDRA 2VFEA 3ZS4A 1UJPA 3C2RA 4LT9A 3BG3A 1EUNA 4H3DA 1KM2A 3BW4A 3P61A 4UR7A 1GJPA 1FCQA 3O1NA 1F74A 4MZ8A 2FIQA 1OX5A 1EB3A 3EWBX 3LB0A 4RV8A 2YX0A 4ICNA 1B3OA 2Y7DA 5K9DA 4A21A 4HNVA 2GOUA 4NX5A 4JTTA 3WFAA 5AC8A 2OCZA 5EKYA 1XUUA 4RZ4A 2ZTKA 5K9XA 4DBDA 5FF4A 1H1YA 3LHWA 5AHFA 3P84A 3PSVA 3NQAA 4IQLA 3HJZA 3PF3A 1UASA 3SI9A 1WA3A 2A21A 2YGYA 5HWMA 2QCFA 4ZQRA 1KFCA 1VH7A 3HG5A 3M9YA 3W83A 2WO5A 3CIXA 3NQEA 2HMCA 4XTIA 1NF7A 4HN4A 3OBKA 4RR4A 3FA5A 3T55A 4UFKA 3GKAA 4R33A 4YWIA 1U83A 4JX6A 3W7MA 1LYXA 1MEIA 1K7XA 3TQVA 1YTDA 3TC6A 4RJEA 3A5VA 1ONRA 5CZTA 1OVDA 5LNRA 4LNYA 3PM6A 2Q3RA 4ORMA 4AEOA 1VYRA 4OE7A 3QQ0A 1K8ZA 1TPUA 4OHQA 1WXJA 1DOSA 3NM1A 2Y85A 2CLIA 2G96A 1VS1A 3IVTA 1ZHAA 1UCWA 3LLFA 2A4AA 1JRCA 3W2KA 5HUPA 3OVQA 3IGUA 5CPMA 4WZHA 3PUEA 1M5WA 3S0CA 1YLVA 5J5RA 5F2IA 5HWJA 3TW6A 1HFBA 3LCLA 3SY5A 1JCJA 1O5XA 5F2GA 3UY8A 3W7GA 2QCGA 1LRNA 3TJXA 1JJKA 1KBJA 4OU1A 2EKCA 2ZZ7A 4Z0SA 4A2RA 3DENA 3DAQA 3TW7A 4IXHA 4GFSA 5G2HA 4QQ3A 5K3VA 4O1CA 1QCWA 3MP5A 1A50A 3O06A 1KLZA 1SO3A 3HB9A 3NQ7A 3UWYA 3JS3A 5FI8A 2FB2A 2I1OA 3B0PA 3DFQA 2GVGA 3N9SA 2J9ZA 5TQLA 3L5MA 4FNTA 4R34A 5DBUA 1YPFA 4IX2A 5C2XA 4UXDA 3UPWA 1JULA 1VCVA 2QKFA 4FHAA 1G4EA 1SW7A 1L6SA 5FEZA 2Z1BA 4ZQPA 3VE9A 3DBPA 5D03A 4O50A 5D04C 5CSRA 5D30A 5HUOA 4Z1AA 1VCFA 1OX4A 3GK0A 3THAA 3B04A 5DCBA 2P0OA 4N6FA 3W87A 3F4WA 4IMFA 2FLIA 3AO0A 3TAOA 2ISVA 4K8EA 4ADUA 1T8XA 3LCHA 3PY2A 3BGGA 3S5YA 3TNOA 1FWRA 1W31A 1F6KA 4PL2A 1IXOA 3O6CA 3BV4A 5DY3A 2QJGA 2RDTA 4UUIA 1SZNA 2BTMA 1HO1A 1WX0A 4DELA 1RQBA 3TMLA 3TJLA 1ZAHA 4WY0A 2CZ5A 3STFA 3UD6A 3RU6A 3R2GA 2VFHA 4Y96A 1ALDA 4DF2A 1ADOA 3EEGA 1SO5A 3EWWA 3NGJA 3Q58A 3QPYA 4WXYA 1SR9A 4UMAA 1RR2A 5CGQA 2CLLA 6TIMA 3W2JA 5LHEA 3W7OA 3OVPA 5EBUA 5D2TA 3LV6A 4JICA 4KFNA 1SW0A 1XM3A 3NOEA 2QCHA 2X1SA 3MI6A 2BZNA 5CZSA 5LZLA 3W88A 4FEZA 4AWTA 3C3NA 4JY9A 4UTTC 1GT8A 2QCEA 3W7QA 4MFDA 4MZYA 3UWWA 2P1FA 1IIGA 3STCA 5HJLA 2O7SA 5G1YA 1OFRA 7TIMA 1AW5A 3DU0A 3NPUA 4MLJA 4CCCA 3W7DA 2AQWA 1UUMA 3G1FA 1VC4A 3HQ1A 3MHFA 3O63A 4FIQA 4NXKA 4CNNA 1LTDA 3A23A 2BX7A 4YL2A 1SU5A 3GR8A 3W84A 4BFAA 3QSTA 2CFFA 1JVNA 4LC6A 2RDWA 1KA9F 4WX2A 3RLUA 5TBOA 4HHPA 3H54A 3IVUA 3M5YA 1K7EA 2NZLA 3NEVA 2ZRZA 4LVBA 3C6CA 3S9YA 2DZPA 4O19A 3M41A 1OFPA 2CLHA 1GVOA 1H5YA 3EX4A 2B0MA 3OEXA 1FX6A 1MEHA 1DORA 2ZA3A 1AW2A 5AB3A 2RDUA 2GVJA 4FXRA 2KZHA 4WY0B 3AJXA 2ZZ4A 1TTQA 4UFJA 2E6AA 3MJYA 4BK9A 4IPIA 2VFGA 1GVRA 4UMCA 2CZFA 5K4ZA 4UFLA 1GYLA 3INPA 2NUWA 1QOPA 4K6AA 5A5WA 4JTGA 3TXZA 4XBKA 2QR6A 4O14A 3PB0A 2QDGA 3PBYA 1KM0A 2QCNA 3KVLA 2E5DA 4POCA 1A53A 5HQEA 2ZA1A 4CQAA 3TUUA 1X6UA 3EWYA 2GJLA 4BI7A 3LRMA 4JYDA 2J88A 3NQGA 2RH9A 1XBVA 2PCQA 4R7JA 4C1KA 3IVSA 4S2BA 3R8RA 2PRHA 1P0KA 1XBXA 4TO8A 2NX1A 1XDMA 4L4MA 5L6UA 4TR9A 1PHWA 2H3BA 2Q3OA 4HNNA 1EEPA 1TPDA 1W0MA 5CZJA 3S1VA 4UTLA 3PUDA 3V75A 4FF7A 1H7PA 1H62A 5KMYA 3G0SA 1BEUA 1KM3A 4JX5A 4GBUA 3M1ZA 3CLMA 4OWGA 1JCXA 1ICQA 2B7QA 3TCEA 2ALDA 3HBLA 1JCNA 3FOKA 1AW1A 4FX8A 1H51A 4AWSA 5E93A 2A7RA 1W54A 3GDRA 3BK0A 5D2VA 4CQ9A 1TPFA 1SPQA 1XXXA 3STGA 4M7SA 3VFLA 3V1PA 2YFNA 5DCEA 2E5CA 1S3HA 1XDLA 3C0JA 1I45A 3CQ0A 3QPZA 3LX9A 1HG3A 3RF9A 5AHNA 1LOQA 2F84A 1BTMA 4GXMA 1EWEA 3BGJA 5K4XA 3LV5A 2X30A 2NWRA 2WSRA 3F4NA 4UNKA 4QSHA 4O0KA 4DF1A 4RX0A 4N9CA 4PCFA 3M0ZA 2PRMA 3W2UA 3L67A 1OYCA 3NL6A 3NYZA 2CLFA 1FWNA 1PVNA 3E49A 1TPB1 4GUFA 1LBFA 3S6DA 5G1TA 2WNQA 4YCOA 3S42A 2FJKA 5AHEA 3KXQA 4LS2A 4S1FA 4DPPA 3MP3A 1I2NA 1ZNNA 2ZBTA 1UB3A 1EUAA 4JTSA 1VHCA 1RVGA 3CWOX 1RD5A 1M7PA 4Q33A 2Y7GA 3SSJA 1QPQA 4NJJA 3HGOA 3P5ZA 4RK8A 3L66A 4AB4A 3W73A 5LNUA 3ZWTA 1EIXA 2B7PA 1NSJA 1FDJA 3CC1A 2VEIA 3EX6A 1K02A 4BWLA 3RMJA 3VE7A 1EWDA 1WOAA 3STEA 3MI3A 3QM3A 3S1WA 4LS1A 4XKYA 3DGRA 3L0NA 4FNPA 1KM5A 1Z42A 3WJWA 5LNVA 2C14A 1XUZA 1YADA 3W72A 3W2NA 3PB2A 4WY0F 5CZ0A 3C52A 1SZGA 3M5XA 3MHGA 1LCOA 3U8GA 4JEQA 4IWWA 3C56A 2A7NA 1O94A 1OG0A 3CEUA 3KX6A 1O4UA 2OMAA 2ATSA 4N6EA 5F1UA 5G2IA 3WJXA 4IXXA 4AMAA 3EWUA 4IMCA 4B5NA 5J5DA 2BWGA 3O6YX 3W1RA 1F6PA 1X7FA 4U4MA 4UFMA 4DQWA 3SGUA
chains in the Genus database with same CATH superfamily
3QOMA 2Y2WA 1NIUA 1H7XA 3STPA 1PS9A 4QJ4B 3RR1A 1PBGA 4L56A 1FWWA 1T0OA 1VRXA 1QHZA 2VELA 2DW6A 1EPXA 2RUSA 2ONEA 2J7EA 1H49A 4A22A 2Z1VA 3O2LA 4AEFA 1F8IA 1N8FA 1Q6GA 3S5NA 3QR1A 3VCCA 4MKSA 4ZFMA 3VFCA 4X0NA 3NDOA 2ZC8A 1HQTA 4IHCA 2Z2UA 3P8IA 3AU6A 1Q6QA 1CXIA 3NR0A 4FLSA 4JIQA 3MSGA 3M7SA 1UQYA 3NZRA 1M9HA 1YKWA 1RZMA 2O92A 1NDWA 2VNCA 3U2CA 5CCZA 1VPYA 1QTWA 3F7JA 2BHZA 2ZZ2A 1EKOA 1PJ9A 1X38A 4O0QA 1PO9A 2GGIA 5E9XA 2G97A 2AL2A 1U5JA 4Y9AA 4O54A 2EPKX 3KRZA 3KZPA 4QRNA 1J4EA 4XV0A 2XFFA 5IOBA 3SR7A 3OQ8A 4K8HA 2R8WA 5FD0A 1B31A 1XH1A 3MWAA 2DPEA 2PF0A 4P2VA 1MDLA 2HK0A 1XF0A 1EL3A 1V4YA 2ZADA 4Q8UA 3EDJA 1KFJA 3B8TA 2X7VA 1TV2A 1MXDA 4GYFA 3AS3A 1TVPA 4D6IA 1EQCA 1E4IA 2CZVA 3N2OA 1C8VA 3ITYA 1R30A 3L4ZA 3BDKA 1EX5A 3AIRA 1ZJBA 1VR6A 1WYIA 1LOSA 1RBLA 1KM4A 5F1VA 1PWMA 1QPRA 2ZFAA 4A8IA 3JZUA 2BXZA 4AVFA 3WQWA 1VEMA 3URNA 4QISA 2VEFA 4GA8A 1AL8A 4UC5A 3TYCA 1I2PA 3UR8A 4LALA 2VQTA 3R58A 1J2BA 2DZUA 3RX4A 4KS0A 1UQZA 1TQJA 4CQBA 1W6TA 4NNCA 1ZGDA 4JIHA 1XIDA 1KB3A 2WJEA 4NILA 2RJGA 3U9IA 1KCLA 3VIGA 5JH1A 1XBZA 4NZJA 1SQ7A 2BBFA 3IIVA 3L2IA 2QUVA 4FIRA 3IV8A 1Q6OA 1MQPA 4LWWA 1OZQA 2OR2A 3ANUA 2MUCA 1RJQA 3KLLA 2YW3A 1S2VA 1U5HA 3SIMA 1KM6A 1A5CA 3W7CA 3DESA 4RNJA 1UP0A 1IR2A 3USBA 3ES8A 2FGBA 4XAPA 1QHOA 3MO4A 4GXPA 2W0UA 1FP9A 1YXCA 4MZ1A 3PBVA 2ZVRA 4X3ZA 5E1QA 4R9XA 4Z2KA 3B8UA 3UXIA 2J79A 4WXZA 1LQ2A 3WDHA 4LB3A 5HNNA 4O28A 1ML1A 3E5PA 1V0MA 2R1PA 1W3HA 4C1LA 5FEPA 3ZSSA 2ZTJA 1J5SA 2ZXAA 4IPJA 2J75A 3TX9A 3VK5A 1CGYA 2ZUWA 3WNLA 5LNSA 1MVYA 9XIMA 1LUCB 3BJSA 3REQA 4QAIA 4LAZA 3DUGA 4Q8QA 1TTPA 3SFKA 4E2VA 3W1PA 6TAAA 4OBRA 3SUWA 4CD6A 2E9LA 3MMTA 3EEZA 2AQOA 4CN6A 3BZJA 3G1VA 1Z8AA 4S3KA 3QV9A 3VNYA 3FDKA 5CPTA 3PBUA 2A3EA 3OGRA 4WRHA 2XZ7A 4FR6A 3M6YA 1DHPA 2CW6A 3EYPA 2OZ3A 1BLIA 3VOIA 2V69A 1YXYA 1P0BA 1VCGA 4AH7A 5U7SA 3BPWA 4I7VA 4GNKB 3PZIA 4H9MA 3MPGA 2IXVA 4BZYA 2YXXA 4L65A 6A3HA 3BV7A 3L7RA 5AC6A 2D23A 1IWBA 5CGTA 1E1CA 2GQ8A 5I5RA 4IGNA 4IL0A 1TJPA 4EXQA 1RLDA 4UTTA 2ZDSA 2QCDB 1G5AA 1K8YA 1WKDA 1FKXA 2BXVA 4GUIA 4N4QA 5GJMA 3TLLA 4KRUA 5CAKA 3CV6A 1LM1A 4KEUA 3QHMA 4Q4PA 3KFTA 1S5VA 4GYPC 5A6LA 3R11A 3PZTA 1Z3NA 2PWUA 2ZWZA 5D32A 2GWNA 1G7UA 3M0XA 4DPQA 2WLZA 3H21A 2J25A 3NL5A 1V77A 3FEMA 2PWHA 1ISWA 2G3NA 1POKA 3HF3A 2G41A 4N0RA 2OJPA 4HZ8A 3UWQA 4S3AA 4XZMX 1CXFA 2A3AA 2PU1A 4PODA 1WDDA 4D8AA 4Q8TA 4FSAA 2VVSA 2UV8G 1BF2A 1XI3A 4CKQA 2WSQA 4Q32A 1ADSA 1IYXA 3VX0A 2CLKA 5BRQA 3DFNA 2C15A 5GPRA 2CYGA 3THUA 1XSIA 4TX8A 1XQLA 1KFLA 3NIYA 4ZOBA 4DBEA 3P67A 3HOJA 1P7TA 3VZZA 2PGEA 1M6JA 1TR1A 1BFNA 3OYXA 3ID7A 2E8ZA 1QFEA 1V3HA 3NZGA 1YTEA 2PEVA 4NVTA 3B8DA 4S3GA 1E9IA 5FF7A 1Q6DA 4G2DA 3ZR6A 4MKVA 4RZ6A 3NQDA 3HO8A 5CJ5A 4CVWA 4JKKA 5IDIA 1N8IA 4D71A 2V67A 5DY2A 4WDTA 2ACUA 4S2CA 2G8ZA 3F4DA 3KW3A 1KLYA 2Z29A 5CSUA 1J9YA 2DQXA 2VO5A 3E38A 1HJSA 3KVMA 4NZFA 1PKYA 1W9PA 3LYEA 1TA3B 2VEMA 3M43A 4H00A 2DSZA 3D0CA 2QF7A 1ZU8A 4L1WA 1BG4A 4KBXA 4E2DA 1XLLA 2PP3A 5JBEA 4D8LA 5BOOA 7CGTA 4JN6A 5BROA 2ABBA 3ITTA 4LEFA 4A3UA 3WK3A 5DQPA 5DELA 3QEZA 2GL5A 3TN6A 4HCDA 3PK7A 3TZFA 3CAQA 1SSGA 2TSYA 4F66A 4DWSC 1VRDA 2ZRXA 2ZA2A 3LU2A 3IRSA 4GVIA 2XSXA 3UJSA 3VABA 3VGHA 1Z44A 5I3KA 2CESA 2FZNA 2PDLA 4AIBA 3HGRA 1WZKA 2B31A 3QMTA 4Y2WA 3ALFA 1FWHC 1F05A 1N7KA 3DH7A 4XAGA 1X6LA 3VD5A 3EOLA 3DFHA 4H6KA 3N6JA 1NWUA 3N6QA 2RDXA 3W71A 3G1YA 4DJFD 4GIEA 3R4IA 3BOXA 3LRLA 3BAJA 1F07A 3BG5A 3TWAA 1XYZA 4UQEA 4EK7A 3D47A 4EP8C 3UZXA 1HTIA 3W7EA 3G6MA 4Q8OA 4M7TA 4AXKA 1J0KA 1HN1A 1P4CA 3F2BA 1TWZA 2NX9A 1WQ5A 3BANA 4RUBA 3ABOA 3UG4A 5KEZA 4QAWA 1S39A 1BF6A 3PJWA 2NV2A 5G4HC 3XIMA 4DZAA 1E6QM 4PTMA 2OO0A 3EX3A 2PBGA 3CHEA 1GUVA 2HVOA 4HK6A 1R2TA 3CT2A 3WMBA 1DQWA 1CYGA 4LUIA 4J28A 4NI3A 3TTQA 9CGTA 3GUWA 4NT0A 2OSXA 4HZ6A 4J3SA 1OGGA 3GC2A 3CMFA 1PYMA 3WY1A 3PWAA 4MNMA 1X8FA 3IUHA 2W61A 1KBIA 2BLEA 3WQCA 3T0DA 3R0DA 5AOUA 1VZWA 3TQ0A 5LSMA 4HCLA 1Y65A 5AHIA 3BMVA 4NAFA 1KWGA 5LIXX 1NEYA 2V5BA 2CLEA 2PE4A 3WEOA 1EHAA 1RJPA 4O15A 1PIFA 3CGTA 3S2JA 1QOQA 3HG2A 4NZCA 2IPGA 1AQ0A 4TMCA 4KEMA 6ALDA 3ORWA 4GHRA 1UZ4A 3JVAA 3RPDA 5FJOA 3VNDA 1RA5A 2YCIX 3PS7A 3LN3A 1X1ZA 1S2TA 2DY3A 2PC8A 3MUCA 1KCZA 2KAUC 4Z2GA 2NW0A 4AISA 2VT0A 4UTUA 2WHLA 4B2DA 1EJUC 2IXUA 3WLSA 1DJQA 2ZRYA 3S5ZA 3V0SA 3BOFA 3N2CA 3CQKA 5FL1A 1REQB 2P0IA 3UJRA 2C7FA 2WK2A 3CV1A 1OGSA 1FTXA 3FYPA 2FZBA 1MEWA 2J47A 4O16A 4YMZA 3CXOA 3EGJA 4GI6A 3TDFA 1EHNA 3QLLA 3WLRA 4LC8A 1Y5WA 3LXAA 1FP8A 3CH9A 3VNMA 4HSOA 4Z08A 3S3GA 1ZQ5A 1YXDA 3VZYA 3W6LA 2PDKA 3OZPA 3VCNA 2QJMA 1JD9A 4Q8WA 1V8EA 1HP4A 3VKKA 1TPWA 3EB4A 5FJIA 1UH2A 2J9YA 2NT0A 3WD0A 3UQNA 2C19A 4GINA 3OIXA 3TE9A 3GNRA 1EJSC 1E6ZA 4LYRA 4MFEA 2IQ0A 1E0VA 3L4TA 4LUJA 1M7JA 1QHPA 3ZOAA 3IJ6A 3M0YA 2QZRA 1Z89A 3OBEA 1XLHA 3LMYA 1DJXA 2QPUA 2WV8A 3TTSA 4OTKA 2XSAA 2R91A 2GVLA 4YS1A 4XTDA 3SCTA 3DZ1A 4JNZA 3W9ZA 1QASA 2OG9A 4PUJA 2CZEA 2R1LA 1I2OA 3SGZA 1SFLA 1SO6A 4H04A 3AZSA 3IJLA 4KWWA 5HR7A 2HISA 4JZ5A 5E0KA 1JL8A 2JKEA 5CEWA 1FWIC 1JUKA 2GVEA 3EWXA 1YEYA 1PE1A 4LAOA 2B7OA 2E6DA 3B9DA 4J35A 1OFBA 4Y90A 1H4PA 2V2CA 4A3RA 3CMJA 2XIMA 1GPWA 4P7LA 3HGSA 5JU6A 1AH3A 4XK2A 1SMDA 3ARUA 4NJHA 2WC3A 4P7NA 4Z1BA 3DI1A 1ONEA 4IJBA 4MY8A 1Z41A 3VKAA 3PR2A 3A13A 2WSPA 4TQTA 3GXPA 3ITXA 4PTVA 4AYSA 3M7WA 5CLTA 4BEUA 5A2CA 3VC6A 3QC3A 1M3UA 3U2EA 4JS3A 3F03K 5GJNA 4Z17A 4X0VA 1DL3A 4CCEA 1TWWA 2OWXA 2VRJA 2NVDA 4PUNA 2E1DA 4NAEA 2EHHA 3WH9A 4GUGA 2PODA 2RGLA 1TJ2A 4H83A 1EH9A 1W1ZA 2DUZA 2P10A 4MDOA 3LGEA 4DF0A 1XLCA 2GJRA 4ZB2A 2NSOA 4DY1A 1C93A 3LXBA 3PPCA 3DIPA 2HRWA 4CVUA 4JR5A 2HBVA 1H09A 5AZ0A 1L6YA 3NZ1A 5ABEA 2PTYA 3NDYA 3BAKA 3H2FA 3CHVA 4WKAA 1WP6A 1IT0A 2LLEA 4U2ZA 2HE8A 1S2UA 1NQKA 4A4AA 2AGTA 5FAGA 2QF8A 2XGZA 3BVJA 3GXTA 4M6VA 3PVFA 2J9XA 5G1MA 3RJXA 4EXAA 4N4PA 3R13A 4HMDA 2DVTA 2PS2A 5H91A 3THQA 2WWCA 1U22A 3O6AA 4O1DA 1JF5A 5BXRA 3PTQA 1TRDA 3CUHA 3PSWA 3RM9A 3LS9A 1AZ1A 3OPSA 1YNPA 3VNZA 4NZ3A 4NUWA 1BTCA 1HKVA 1V03A 2V5CA 4XWUA 1RCQA 1UD8A 3MMWA 4B3KA 3W74A 1PIIA 3DHFA 1LRQA 4M56A 2YPIA 2AMXA 4JTHA 4NJIA 3K8KA 5E0FA 2PWVA 5KSWA 3M6DA 2VFDA 1MUMA 2OGJA 4ZOCA 5C2GA 1U2YA 3N11A 3QZ6A 2YKKA 4LCRA 1NWSA 1X1OA 2XIOA 4DN1A 2G3MA 3UESA 3NFUA 2VFFA 5A8PA 1E40A 2QJIA 3EWZA 4G1KA 5BMWA 1KTNA 4KCUA 5JIWA 4FPSA 3UEQA 4CNTA 2VEPA 5CBJA 3UWEA 1W56A 4BF7A 4LYQA 4PEEA 1W5OA 3LHVA 4H6EA 1WCGA 3T0CA 3DXIA 4X22A 1R0MA 1HJXA 1V0LA 3KBNA 5F4XA 4I7WA 1K4GA 1E1CB 3B9EA 5GVJA 3NNTA 1XIGA 1UBSA 5DFAA 2BASA 3H22A 3GG7A 4Q4MA 1UOKA 2HROA 1H1NA 2YL8A 2Y63A 5JMUA 2R1KA 1JGMA 1JRBA 4I9AA 2CBJA 4MM1A 4C60A 3W85A 3T05A 4K7VA 1HXJA 4BCEA 2HXUA 3S6OA 3L2LA 1TV5A 3UZWA 4TX9A 3TR2A 3HPAA 3W1UA 1EJXC 1B5TA 1GKPA 1Q6RA 2EG7A 3RHGA 4NIRA 4GE8A 5HMSA 2WW5A 3L65A 4WR3A 3TROA 1VPXA 1UC4A 2BB0A 4XZNX 1UKOA 3QMRA 4OQVA 4YVPA 3ITVA 3SO7A 5I77A 1TMHA 2CBUA 1C8QA 4Q8NA 3OW1A 1MZHA 1BHGA 3C2FA 2CHOA 4MLRA 5ECVA 3WK2A 1QR7A 3S83A 4YTTA 3CAWA 1ZS2A 2NV9A 1XRSA 3LDVA 2WHKA 3LXCA 4ACZA 4LRTA 4GO8A 3GAKA 1P7TB 4Y8FA 3QBUA 2C79A 1XH0A 2CPUA 9RUBA 4ZCWA 2OT1A 3HJEA 3LTSA 5A6BD 1W32A 1RSCA 3NQCA 2Q8ZA 4CD7A 1DV7A 3T9PA 1F3WA 1W5PA 3G24A 3V18A 4MJZA 3QH2A 5AZ1A 3VIFA 1W1A1 1WB0A 4Z42C 1BWLA 4JIPA 3WJYA 2WANA 4NJKA 4IQJA 5I3HA 1YQ2A 1B57A 3R89A 4Z2IA 3A24A 1H50A 4BQ3A 4FNSA 4K1WA 3UWUA 1HJUA 3KOZA 2D0GA 3NL2A 1LL7A 4O4WA 3W27A 1R2SA 3U6WA 2OQLA 4KFPA 2PBOA 3TA6A 5CPLA 1Q6EA 4TU1A 2YDRA 3IK2A 4PTDA 1EJTC 1XV8A 2F6UA 1GTHA 1MDRA 1HJWA 3GDKA 3L4VA 4PRWA 2WB5A 2DT3A 1RCOB 2OYMA 1Y0EA 1VBJA 4ZEPA 2VFEA 1QRQA 3C2RA 2VX4A 4CNSA 1EZWA 3R8HA 2XVNA 5BCAA 4G8TA 3BLDA 3LB0A 3AUJA 3VIHA 4ICNA 1B3OA 3GFYA 4V27A 2Y7DA 4F79A 1UR0A 5AC8A 2CETA 2ZTKA 2F2KA 3LEPA 2EKGA 2XWEA 4DBDA 1E70M 5D9OA 4PE8A 1TG7A 5M1TA 3LHWA 5AHFA 4PYSA 3PSVA 3NQAA 3HJZA 4DJEC 3S2NA 4GOAA 2YGYA 5HWMA 3NXLA 3NQEA 1RCXB 4RR4A 3FA5A 3T55A 3UJEA 4YWIA 1U83A 5A6AA 3AXHA 4K8GA 2D0HA 3N18A 3GHUA 4HA0A 1ONRA 2WNWA 4ORMA 4AEOA 1AVAA 4OE7A 3QQ0A 3SUVA 1TPUA 1XLKA 4NKCA 2Y85A 1UCWA 3GZAA 5E0CA 1JRCA 1GJWA 3QN3A 3UP8A 7PTDA 3K46A 1Z6KA 5HUPA 1S1RA 2FMOA 1BVZA 1OIMA 2P8BA 5AY7A 3AMKA 5TNVA 1YLVA 2WCSA 3W4RA 3IJIA 4LUSA 3L4UA 4AQLA 5BWFA 3BMXA 2PDCA 1GZ1A 1M01A 3CZEA 2Y0FA 1VEOA 1UD5A 3UY8A 3TJXA 4D6GA 1KBJA 4PMYA 4DB7A 2WKLA 4KMQA 1RALA 2Q8XA 4A2RA 1XFCA 4PMXA 5CSYA 4GLEA 4NAFB 2Y4SA 1R8LA 3IJ8A 1GQJA 3O06A 1KLZA 1SO3A 3BMWA 3GBEA 3OODA 4HZ7A 3ITGA 3JS3A 3TOYA 5KZ6A 2GVGA 1R7AA 2IKIA 2H9AB 2J9ZA 2IPFA 5HANA 4R34A 4AC1X 4GQGA 4IX2A 3MZNA 1OADA 3WQFA 3AMGA 4YWSA 3UCQA 3TP4A 3B97A 2Z1BA 3VE9A 3KRBA 1E4LA 5CSRA 5D04C 4FLRA 5D30A 4Z1AA 1OX4A 3GW0A 5D8WA 3VM7A 8CGTA 5DT5A 2Y8VA 2P0OA 3W87A 3MU7A 2FLIA 2GZXA 4PSPA 3ZYZA 4Y8EA 1HF6A 2NQZA 3LCHA 3BGGA 5FJJA 3S5YA 1W31A 4UQBA 3QLDA 4RL3A 3O6CA 2VQUA 5IFTA 4D6DA 4L1GA 4QXIA 1HO1A 1VBGA 4OECA 1E1EA 1V6TA 1DPMA 4WY0A 3UD6A 3RU6A 3K5XA 4E8CA 4Y96A 3T2QA 2C91A 1ALDA 1BXNA 1UYQA 4DF2A 1HKIA 1CGTA 3E2VA 1KFWA 1KRMA 3NGJA 1UBPC 1Y5VA 2CXEA 2V3EA 4WXYA 4ZODA 2J7GA 2CLLA 6TIMA 4P7RA 3OVPA 5D2TA 3WH6A 3PZNA 2GSJA 4KFNA 3T2PA 1LT7A 2X1SA 5CZSA 3TN3A 3C0SA 2ZKMX 4AWTA 3C3NA 4EWJA 2ZWYA 4C6JA 1LL4A 1WZMA 2P1FA 4AD3A 3MDWA 3STCA 2IS7A 1OFRA 4AD0A 5H8MA 1XIIA 1M1BA 1AW5A 3POCA 2J66A 3NPUA 3G1FA 2PA6A 1VC4A 3HQ1A 4FIQA 4NXKA 3OLIA 3A23A 3BH4A 3MZ2A 1K9EA 4M81A 1MNZA 2WZIA 1KA9F 5TBOA 1QATA 2V63A 4HHPA 4WSHA 1M03A 3IVUA 3SUTA 1K7EA 2NZLA 3M4HA 3NEVA 3TYZA 1HKMA 3QHOA 2R9RA 1Z32X 2J6VA 3SCVA 3SM0A 1VIWA 1TFVA 2J4GA 2B0MA 1ITUA 4JQ3A 1DORA 2ZA3A 1OEPA 3ARSA 1E15A 4LQ1A 5AB3A 5T9BG 3MMUA 4X60A 3AIEA 1F6YA 4UFJA 3MJYA 3GXIA 4DO7A 1LL6A 2CZFA 1A3WA 2BY3A 1GYLA 3CJPA 3RCMA 4RE4A 3TYAA 3TXZA 1G9HA 1EJVC 2C71A 3NO3A 2BGSA 3LBOA 3LPPA 1KM0A 2QCNA 4W93A 2DVUA 3GTNA 1A53A 5HQEA 1VFOA 2ZA1A 4XBJA 3EWYA 1R7OA 1WXZA 4UCFA 1UZ1A 4GMEA 4JYDA 3VKCA 1Q63A 3QGKC 1UR3M 2PWGA 2VX6A 3CV7A 1W91A 2BMBA 4HOXA 2PRHA 4HYRA 4PMJA 2OEMA 2QULA 4HNNA 3EA2A 4R5EA 4V1XA 1J93A 3GSMA 1UR1A 3S1VA 5FOOA 1F9CA 4QG6A 2ZX8A 2ZX9A 1KM3A 4M3PA 4U31A 3CLMA 1MUCA 3UW6A 3C2YA 4U5KA 3VDGA 4GGHA 1XD1A 1JCNA 3FOKA 1IT7A 1NQ6A 3T8LA 1AW1A 1QUMA 1H51A 3EWCA 1XS2A 4NYUA 3HQPA 1JYWA 3BCDA 3BXWA 1XXXA 3BSMA 1MFUA 3QY7A 1I45A 3CQ0A 3WDPP 5DX7A 3QPZA 4D72A 2AMGA 5AHNA 1RXOB 2FZ9A 3AAMA 1C90A 2X1IA 4GXMA 5K4XA 3BGJA 3N9KA 2DSWA 2Z1WA 3CLWA 4JFVA 5JIPA 4ZO7A 3F4NA 4UNKA 2IQDA 3EOSA 1SVDA 4N9CA 4PCFA 3FA3A 3M0ZA 3W2UA 4EPDC 5ABFA 3TQPA 4FLQA 3VGBA 4Y9MA 1OYCA 5T9CE 3NYZA 2WZMA 1FWNA 1TPB1 3H2AA 1XIHA 1EOMA 4B9ZA 4IQEA 4S1FA 4DPPA 1KXHA 1V6XA 1VHCA 5ABGA 4JPGA 1M7PA 4Q33A 1QPQA 3APYA 3HGOA 3P5ZA 4RK8A 3L66A 3RCNA 2W9MA 3ZM8A 3WNOA 5MF5A 3ZWTA 1MZRA 1EIXA 3CC1A 5GQBA 1KKOA 3JU2A 1K02A 3RMJA 1EWDA 3WLKX 3HTWA 4GH1A 3CH0A 3AXKA 4REQB 3N3TA 4NZ1A 3QM3A 3S1WA 4LS1A 3DGRA 4FNPA 2BGNE 2C14A 1R9YA 4DI9A 3PB2A 4H19A 4AZ7A 4YHEA 1SZGA 3MHGA 3KBJA 1LCOA 3U8GA 4JEQA 3SUSA 4C6QA 3LSBA 3MJMA 2G0WA 1O94A 1OG0A 4WGHA 3W82A 1CTNA 2FDMA 5PTDA 3H2CA 1DWAM 4NY2A 3QY8A 2EJ1A 3HZ3A 3MSYA 1X7FA 2OEKA 3H2EA 3KTCA 2PDYA 3KOXA 3N73A 3BUVA 4BQ5A 4AD4A 3CO4A 3BLIA 3H2NA 5HATA 2PDUA 3E6EA 3W7JA 4O4VA 3DHDA 2GGJA 2XN2A 1KFEA 3GUGA 4WOQA 1TPH1 2YW4A 3PTDA 3L21A 2FQIA 2HTMA 1KNWA 2Q8LA 2EPHA 1Q45A 1TZZA 4HSHA 1E56A 3JW7A 3BTNA 4F4RA 4UNIA 3SCOA 2QUMA 3MCNA 3CPGA 1PL9A 4OUIA 1QBBA 1FVPA 4ACZB 4NRRA 1RK6A 4GY0A 1TVLA 2QUNA 2DT1A 2PPGA 2GJPA 4IIFA 4GIAA 3T7VA 1WOBA 2W27A 2WVUA 3SCQA 4HJWA 1CW2A 1FDYA 2DZBA 3NZPA 2EG6A 3ZVHA 3IIPA 4A3YA 1NDVA 3L5AA 4XKYB 4IIGA 2WSYA 2HS8A 3G1XA 4CN4A 3RFAA 1GVSA 3QY6A 2YZRA 2ATMA 3AWNA 1GVEA 1XPGA 2OU4A 3E9AA 4DAIA 2QNEA 3WZ0E 4E6MA 4AWEA 3WH7A 3PZOA 2D1ZA 2NUYA 1UZDA 4Q8VA 1H11A 4U33A 4HPHA 1GNXA 4A3HA 2VRQA 1QO2A 2ZUUA 3GWQA 4JCMA 1MW2A 3DKLA 5GNXA 2YR1A 1CBGA 3JRKA 1AZ2A 3CZGA 4HMCA 3GBDA 4ZQNA 2AOSA 3RITA 4M0XA 3W24A 1JZ2A 3G3MA 4BKNA 5EMUA 4ZVJA 2DU2A 2UY5A 5CKSA 3MS8A 1KXTA 2VXNA 1YTKA 4JTIA 1VJSA 1AD4A 2FHFA 3DN5A 3AISA 1TTJA 2G5WA 2XH2A 2V2HA 2YL5A 2G37A 2C1GA 4AWUA 3BQ6A 4DLMA 2GQ3A 4G1NA 1KFKA 1SZFA 1J0IA 3LHYA 5E9AA 3M0MA 2QLYA 1CPUA 3SCPA 3L4XA 4ZE4A 2VTFA 5DMYA 5C70A 2NQ5A 5LXEA 8TIMA 4J9JA 3HIJA 3O6DA 3P5YA 3GFXA 1VB9A 3HG4A 4XKMA 1HT6A 4X61A 3VD4A 4L7ZA 3UYCA 3Q2DA 3U7VA 3W1XA 1R2RA 3P8JA 8XIAA 5J8LA 4PRTA 4WJXA 4P5UA 3D5HA 2OLAA 1X97A 5H8PA 4MWAC 1QT1A 3WK1A 1EJWC 3P0XA 2DZXA 2HV5A 3BLOA 2WOQA 3LPFA 3HN3A 1RHCA 2Z24A 1NP0A 4GIYA 1OC6A 4NG3A 3W6YA 4AVOA 2V0TA 4W87A 3GXNA 2VZOA 5HPCA 1ZPTA 3DC0A 4F3HA 3E0IA 3MTWA 3WNMA 4U28A 2XIBA 2YBVA 1XDJA 2X16A 2Y24A 1A3HA 1TQXA 5ENLA 4U5IA 1ICSA 2WMJA 4GO9A 2JK2A 3P3BA 4FMVA 1GQLA 1T6MA 1FQ0A 5EMJA 3NSMA 1XCWA 3WKZA 3EA3A 2EAWA 2NUXA 3N13A 5DEZA 4GGBA 1PKLA 3MDUA 2Z28A 4H6RA 3OHIA 1Q2SA 1GPFA 3PUGA 3AI0A 3T0TA 3ZIZA 4E38A 2AAMA 3G0XA 1CNVA 4INFA 3AXIA 2OKTA 2QIWA 2FFCA 2VEGA 3VTRA 2AKMA 1XG3A 4PTXA 4Z1DA 1QPNA 4WQ6A 1VIZA 4IP7A 2W79A 2Y5EA 4H2HA 3ATYA 2DUXA 3W1AA 2BVWA 4QSFA 1OX4B 4CNOA 3ZVIA 1O95A 4CD8A 3ZR5A 1IF2A 1XQKA 1TJRA 4EPBC 4HZMA 3QKZA 2E3ZA 1J12A 4AZBA 5I09A 5M17A 1XG4A 2J7CA 1YDNA 4CNPA 5E5CA 1TKKA 3GY1A 1OF6A 3G1RA 2VOTA 2ZICA 1XPYA 2J8TA 1O60A 3F5KA 4JN7A 4B15A 4AF0A 4IP4A 4C6OA 4IPNB 1GZJA 3SY8A 4PZVA 1K1DA 3E12A 3ONCA 2A1YA 2WJFA 2WNZA 4FLOA 4X2RA 2OZ0A 4MAVA 2R24A 2J27A 4B90A 2I5QA 1SJDA 4PBEA 2YFOA 1XFBA 4K36A 2VDIA 4Z2LA 1OC7A 3LK6A 1XIJA 1K6AA 3FJ6A 1FWBC 3KM8A 2Y6ZA 1M68A 4HT3A 4YPJA 4YXGA 2XM1A 1LDCA 3C2OA 3TIMA 5BW6A 1PSCA 3SQSA 3UZYA 2XG9A 3OLEA 4QR6A 3S47A 1LG1A 4JY8A 3W1LA 1J0JA 1C7SA 2A6NA 3ZLFA 2PDHA 2E8YA 4GYJA 3CAVA 4HB7A 4YTSA 5EMYA 1GOMA 1C29A 1CGXA 3QFWA 1VFMA 2GQ9A 3K1DA 4X9SA 1XYAA 2ZUNA 2VGBA 1KKRA 4LVDA 4QLLA 2R6OA 1KV5A 1ME9A 1EEXA 5BXTA 3FAXA 3OGVA 3ZLHA 4KWOA 1TPC1 4HU4A 2A2IA 3SFWA 1HO4A 3TYBA 3LPGA 4WSJA 3G0UA 2RFGA 2J13A 5C9UA 3W1MA 2VYOA 4C6NA 4L6OA 2WVVA 4GPNA 2CITA 1D3GA 1D8CA 1UMYA 3H70A 1QAPA 1VJZA 1UWRA 4WSKA 3SN0A 2Z25A 1EP2A 4IFRA 2WPGA 1ZJHA 4UTJA 3V0TA 1G67A 1G69A 1F4AA 2Q01A 4H4IA 4XZBA 4O17A 1RP9A 1MI3A 2A0NA 2EPNA 1B9BA 3KAOA 4UFHA 4IIHA 4HTBA 1HL2A 2G3JA 2VP8A 4AXNA 4J2MA 4M6UA 1UP2A 3CTTA 3RGTA 3O16A 4AHQA 1GGOA 2F6KA 1DJNA 2V30A 3P0WA 2D2GA 2ZUSA 2TPSA 3R7MA 1GVYA 1KCXA 2PLMA 4N9DA 4EACA 5M5DA 3OIHA 2QJHA 1LLZA 1FUYA 1K3UA 2QDEA 3IAPA 3F5JA 3WUGA 4LJ3A 2EGZA 2WMIA 2FH8A 5DO8A 2Y70A 3ABRA 3GG1A 1ODUA 2GWGA 4DNMA 4ZL1A 4E4UA 4QCEA 4ONVA 2P76A 1AODA 4FNQA 3T08A 1A5BA 2PRLA 4DJFA 1E51A 3GVWA 1KR1A 2ZZ3A 3GM8A 2G4FA 5AC5A 2JF6A 3HMJG 2J7DA 4FZIA 3KS6A 4UTIA 4UCGA 3GW3A 2OX1A 3AMLA 3WELA 2J8FA 2PD9A 3R0KA 1LJYA 2L5HA 2Z1KA 1FY6A 2VGFA 4UTWC 4M19A 3Q45A 4R27A 4N2YA 4BQ4A 4QDWA 3E1F1 3VKJA 2JEPA 3RCYA 4LU0A 3R10A 5D33A 5HWNA 1T96A 1WBJA 1QWGA 4H9XA 4LX4A 2DJXA 5A95A 4XAZA 2VDGA 4D1JA 3PWGA 1GJUA 5IHSA 5FF3A 3SRKA 2DUAA 4GNJA 2O0TA 4QE5A 1EC8A 1VJIA 4TVUA 3I4EA 3GU9A 2A7PA 3WQEA 2JQXA 4GISA 1F4HA 2VURA 4N02A 1ICPA 1OK4A 1MQRA 4EANA 1G4SA 4PEKA 4RCXA 2V9DA 4HNCA 3MB9A 1XX1A 4PULA 3MSRA 2XH0A 2PTZA 3H55A 1CXHA 5ABFB 1MSSA 1C91A 4D9PA 1V6WA 1C7TA 1F8MA 4C91A 5LNWA 1LRTA 2XH7A 1GEHA 4H8VA 5MHBA 3UA3A 2OOFA 3ARYA 3WDJA 1BWKA 1FWDC 2OEJA 2PZ0A 1WV2A 2FZMA 2Y61A 5IBXA 1VKFA 1ZP3A 1HGWA 3TVAA 5F2MA 2ZQ0A 2JGQA 5DLCA 1VFLA 4PH6A 3H12A 1ZAIA 5LIKX 2FVMA 2DP3A 3DFOA 3R79A 1S1PA 2E77A 3C2EA 3CUJA 5G5IA 3JUGA 3AMDA 3N14A 1QPOA 1EPVA 2INFA 4JQ1A 3E02A 1H7NA 4AZ5A 4XO6A 5I78A 1G7VA 1V08A 2ACSA 4Q8MA 1UWQA 4IJRA 1WZAA 4ZXOA 4GQRA 4I90A 4Q3MA 2PF8A 4BQ2A 3B8VA 3KP0A 1ZFJA 1XSKA 4PMUA 3C8FA 4R7WA 2NQJA 2WPBA 5I24A 3RILA 3GVVA 2DSKA 3SZ8A 1W1TA 1I2QA 3SCRA 1GEQA 4MKNA 4UZUA 1J0YA 4HPJA 1E4NA 2J6XA 4PN2A 1JYNA 1ZAJA 2QW5A 3CMGA 4N9BA 5CJMA 4G7EB 3MA8A 4FOUA 1PCKA 1P1XA 2DZSA 4FNUA 5A6MA 2VC6A 4KCVA 4L61A 3J7HA 3LLDA 4DO4A 2POTA 3BOLA 3EX2A 4MUZA 3LZ5A 3OO2A 1EBGA 2E68A 5EBAA 1AK5A 5FSEC 1CLKA 1K9TA 1UMLA 3DGBA 1XIBA 3TTOA 3TYUA 1GTEA 4L9ZA 4FF5A 1EYEA 3GU1A 4W8AA 1MXGA 3TOPA 1A5OC 2RGMA 3LD5A 4D6CA 3BAYA 3LI0A 1H61A 1TX2A 1UWTA 5GNZA 4JX4A 3QTGA 2YDAA 4PL1A 1IEXA 4IG2B 5CG0A 3CQHA 1SUXA 2YLLA 2YA0A 4O8RA 4WDUA 5B7ZA 3M16A 3PFRA 3FW6A 1TWSA 3BSGA 4NQ1A 1XC6A 2WBKA 3TK7A 1TPEA 3I6TA 4GVFA 3LRKA 1CB2A 2ZOXA 3IIZA 2P5NA 3UR7A 3TH6A 1K8CA 2CKRA 2YB4A 2VD9A 3RRAA 2NX3A 4AZCA 4PTWA 1EF2A 4GIRA 7ENLA 3LCGA 4Q4KA 2GK1A 4YIWA 2VOMA 3MUAA 3FKKA 4CGTA 3TSDA 3LTYA 1RBAA 3SQLA 4UFIA 4US5D 3KOWA 4A8NA 3WLQA 3CPRA 3WQOA 1B9ZA 4MOZA 3KCJA 2GPTA 1K8XA 4TXEA 1VFHA 2XH4A 2YA2A 3USZA 4UIOA 3QXBA 4P7OA 3NQFA 4U3AA 3OBAA 2HWGA 3CASA 1UP3A 4PMZA 3OA5A 3EPOA 4GI8A 4PR4A 3ARQA 3GYEA 1BSIA 3CZJA 5JVLA 2WAGA 1GVQA 3ZXWA 5KZMA 5HR6A 1KC7A 1TYGA 4ZENA 1VQTA 4I7UA 2J24A 3E0WA 4LAUA 1G6CA 4Z2HA 1F7BA 1R87A 3IPWA 5SWUA 1B4EA 1OB0A 2W92A 4QM1A 3LCXA 2W67A 1PB0A 1UH3A 2WKGA 1CB7B 3ONBA 3PBWA 5I3IA 1J0ZA 3WH8A 3SCNA 1S2WA 4NSBA 3FS2A 1Y5XA 3GNDA 4H1ZA 1AMKA 2ISWA 3TFXA 2J7HA 4HKPA 4UMBA 1JCTA 3OZYA 4JXCA 5DRIA 4ML9A 1KW1A 4ADTA 5D9PA 4DYJA 1NF0A 3HV8A 4Q6JA 4H7ZA 3F1QA 2QDHA 1EZ2A 1PX3A 3HMCA 1W9UA 3VXGA 4W7WA 3TN4A 1E55A 3CIWA 3RN6A 1AG1O 2GDUA 4WK9A 3W70A 5LYRA 3PNZA 5BNKA 5I03A 2XFWA 2VCCA 3GC5A 4EAYA 3W23A 3NPXA 1BWVA 2XPKA 4LW7A 3MCMA 3MSDA 1JR1A 3ZJ7A 3CUZA 4O12A 4O11A 2WVSA 4D6EA 3HFTA 1RPKA 1UOZA 4OBSA 1TIMA 2VWTA 1JGIA 2QMKA 2F8QA 1FWAC 3FCPA 4HP5A 8A3HA 1E72M 5I2UA 4M80A 5U4NA 2V2DA 5ABTA 2OWWA 1LLOA 1VPQA 3G8RA 1DEDA 1PHQA 3W76A 1HX0A 1WAUA 5BWAA 2W62A 3TQKA 1FCBA 1SW3A 1X8CA 3YPIA 2V3DA 1KD0A 3NYDA 4FNRA 5AECA 5HXMA 3KL0A 2GJXA 3PBMA 3U5YA 2QCLA 5KZDA 3W7KA 5H2ZA 4RPPA 3VDCA 3VILA 4FXJA 3IJDA 2V5JA 3FJLA 3FKRA 4G9PA 1R86A 5EY5A 1OCJA 4CQ8A 4ZBCA 2PGFA 1NDZA 2DSUA 1PZ3A 5C6MA 2O4MA 3W29A 2DSVA 1VHNA 3LHUA 1QJWA 3WMSA 3CIVA 3FXYA 4B5SA 4AF0B 3CO8A 3FFSA 2ICSA 1JDCA 1L9WA 3BSHA 3Q37A 4W89A 1OABA 4JGDA 3VOFA 2E9BA 1J5TA 1NWTA 1XCFA 5FKYA 4AAJA 4ZO6A 1R3QA 5D2WA 3DHPA 3BE7A 3LUTA 1PAMA 2QVHA 4XZIA 4H8NA 1Q7ZA 4B4HA 5FCZA 4NRSA 4YU1A 3NPVA 3PULA 5D09A 1FHVA 3W7LA 2WWDA 5A8NA 4LY4A 4ROQA 4BWLC 4FI4A 4NU7A 4WJEA 5BU6A 4UTHA 3W7PA 1IT8A 3H6OA 5T8GA 1EA0A 2JF7A 2OB3A 2WVTA 5HPOA 3GTHA 3WQGA 5I3GA 4GNVA 4DWSD 3G1SA 3B9NA 1XGDA 2BOEX 3T42A 3NQVA 2OYLA 1EF3A 1PZ2A 1LWIA 3ZJKA 3O0KA 2NLIA 4ZOEA 4LS0A 1I2RA 1OINA 4E5TA 3GDLA 5A6KA 5REQA 3IK4A 1LLWA 4IH3A 4TVDA 5I3JA 3CEPA 3NVTA 5AYBA 3N6HA 3K30A 5A6BA 4XB3A 5EMLA 4BF9A 2Y62A 3WENA 4NJGA 5DBTA 2WQPA 4MY9A 5G4WA 4V15A 4HOWA 4H8HA 1WDQA 4KCWA 5G4EA 5A6JA 2XZ9A 4F2TA 1T5AA 2IUZA 3LENA 4NNAA 4YYFA 1TE6A 4O57A 4DRSA 4IF2A 5KITA 2A3LA 2BVYA 1GYMA 3UWVA 2W6RA 1H60A 3G77A 4WLCA 1XR2A 3MUXA 3FY1A 4GX8A 3T0BA 2Z6IA 2ZZ1A 3NTYA 2ANUA 3Q4DA 2KX9A 3BZGA 2OWCA 5C55A 4O1AA 2P3ZA 1JCYA 1V79A 4A8RA 3EOOA 2YDQA 2BOGX 1MXSA 4DHGA 3O0FA 1KQZA 3O07A 4BI5A 1ZCOA 2ZDRA 3WF0A 1N82A 1W9VA 4LT9A 3BG3A 1EUNA 3V5OA 4Q4SA 2V5DA 3BW4A 3P61A 4J4KA 4UR7A 1GJPA 1F74A 5HQLA 4QGCA 2INEA 1UKPA 3V35A 1I75A 3WO8A 4A6GA 5K9DA 4A21A 2GGEA 3WFAA 1E73M 2ON3A 2WCGA 5D9NA 5EKYA 1XUUA 5K9XA 3GNPA 1H1YA 4IQLA 3RG6A 2A21A 3T4WA 1ELSA 3Q67A 3ABZA 4H8UA 2WO5A 3CIXA 4LNCA 2X8RA 2ZE0A 1XLJA 2XFRA 1DTNA 4UFKA 3D3FA 4HA1A 3FDGA 1DIKA 3TC6A 3A5VA 1U33A 5HNTA 4LNYA 3VMNA 3PM6A 1YRRA 2Q3RA 2ZUVA 4B5VA 4OHQA 1QI3A 1ZRQA 1DOSA 3UT0A 3NM1A 4ZFCA 2DW7A 2CLIA 3MCOA 3CS2A 3FJ4A 4JEJA 3IGUA 5CPMA 3KWXA 3MT1A 1JZ3A 4W88A 2HK1A 1M5WA 2INZA 4RNFA 1ONXA 4OKDA 5HWJA 3TW6A 1HFBA 3ICJA 3SY5A 3K4WA 5F2GA 3W7GA 4OU1A 3VGGA 1C92A 1ZP4A 4RE0A 4KERA 4L9YA 1VBHA 3DENA 2ALRA 4QEEA 1A0DA 3FYYA 4TV5A 5G2HA 1E71M 4O1CA 4PUKA 3MP5A 2NQ9A 2VUYA 5FI8A 5HMDA 4B16A 4H6QA 1UPPA 2WSKA 4WKFA 3DFQA 4HNLA 3N9SA 5TQLA 1J96A 4HMEA 1V7AA 3D3AA 5CJNA 2VX7A 1JULA 1VCVA 3EDKA 4FHAA 1DJZA 1W2VA 5A8MA 1L6SA 1EC7A 3LSCA 3R25A 3S4TA 1BGGA 4O50A 5HUOA 1VCFA 2GLKA 3THAA 5DCBA 3F4WA 4GJJA 3TAOA 2ISVA 4ADUA 1T8XA 1HL8A 3VD3A 4C6BA 3TNOA 2VZVA 1KO0A 1IXOA 1MFVA 2TAAA 3BV4A 4HD5A 2QJGA 4UUIA 3EMQA 4E3TA 1WX0A 1N8WA 1UWSA 3TMLA 1BQCA 1Y7VA 4Q7BA 1ZBCA 1W9XA 2CZ5A 1M04A 1M53A 2VFHA 1R3YA 4DAFA 1R38A 5IFPA 3VGEA 4HA3A 1HZYA 2PDNA 3PWIA 4IPLA 4UQAA 1ISZA 2V3FA 4S39A 4TTGA 3OYZA 4OVXA 3KTXA 2E4TA 3QHNA 3KZSA 5A6SA 1WZLA 1SJBA 3MV11 1RR2A 5CGQA 3DYPA 5BYWA 1H2JA 5EBUA 3DG3A 4JICA 1JI1A 3A47A 3NOEA 1JF6A 2QCHA 3MI6A 4B5XA 3W88A 1CXEA 4UTTC 1JPIA 4JHMA 1FHUA 2W4XA 4GZJA 4MFDA 3KLKA 5HJLA 3WLLA 4AZHA 3DU0A 1AH0A 1JIBA 4CCCA 2ESCA 3MKCA 3W7DA 1UUMA 4L64A 1P6WA 1XLMA 1E9ZB 3WBYA 1LTDA 4YL2A 3AYSA 1QNQA 1SU5A 3GR8A 4NI8A 4BFAA 1R3VA 1GW9A 1LWHA 2VWSA 4LYPA 4S3BA 5LXXA 4LC6A 4WX2A 3RLUA 2PZNA 3QYSA 3TZNA 4PMVA 3H54A 4Z1YA 3M5YA 2ZRZA 3C6CA 3S9YA 4MNLA 2QGYA 4GVHA 2CLHA 3AQUA 1HKJA 3OEXA 2GVYA 3A4XA 3SJNA 1AW2A 2GK1B 3VU2A 5IXEA 3GH7A 3AXXA 1JZ7A 2GVJA 2PLCA 4FXRA 3AJXA 2ZZ4A 3IACA 1TTQA 3F4CA 2VFGA 4WIWA 4UFLA 2DFAA 2Z1SA 1QOPA 5A5WA 5JBDA 3NEHA 3VDHA 2QR6A 3VNKA 4I5RA 2BV9A 1AQHA 2CCRA 4AX6A 3O9NA 2YBTA 3ARZA 4LAMA 3A4JA 5RUBA 1E6RA 3KVLA 4POCA 2Z1XA 1DE5A 4LUTA 2P3EA 3TUUA 3EB3A 4BI7A 3LRMA 3BJTA 1BSLA 3FK4A 2RH9A 2F6XA 3OLDA 2V38A 1DJWA 1TJ0A 4C1KA 4J3UA 3RYSA 4TO8A 4I6KA 5FJUA 3AMCA 2DH2A 1PHWA 2H3BA 2Q3OA 3T0AA 2WZTA 1TPDA 4UTLA 3V75A 4FF7A 5KMYA 1L0PA 1BEUA 1V3KA 2OFJA 1B54A 2CXGA 4OWGA 2W63A 4KGLA 3TCEA 3UGVA 3WQ6A 4K1GA 1QW7A 3B8SA 3AHYA 3WFZA 5JQ9A 5LIUX 4FX8A 4AWSA 5HAOA 2A7RA 1K4HA 1SPQA 4C7DA 3WQ4A 3AHVA 2YFNA 1S3HA 3GG0A 3C0JA 3AU2A 3WH5A 1XLAA 2F84A 1BTMA 1EWEA 1J8VA 3WBXA 2X30A 1P0DA 4LF1A 4RE2A 4QSHA 4O0KA 4DF1A 4ENLA 1YDYA 1XIMA 3BAWA 1E0WA 2CLFA 3E49A 4IMAA 4GUFA 3S6DA 3TJIA 2FZDA 1PKMA 4YCOA 2CIPA 4LS2A 1I2NA 3A64A 1UB3A 4JTSA 1TUXA 3TNBA 4HYVA 1EDQA 2PLKA 4F40A 1Q65A 3PP7A 1UR9A 3VPLA 1BRLB 5KETA 1FDJA 3EX6A 1B2YA 2GJXB 3VE7A 1D7FA 4E3VA 4Q7IA 3CYVA 1BVWA 2ACRA 1MWOA 3L0NA 1KM5A 4OJYA 3WBWA 4WY0F 4MJ4A 3AICA 3MMDA 1G01A 4O1FA 2FGLA 4IWWA 8RUCA 1XISA 2VZTA 3K4DA 1WPCA 3KX6A 4C6FA 4M24A 2POZA 1TR9A 3M64A 4JQ2A 3NSNA 5F1UA 5G2IA 3WX7A 2I57A 3W38A 1V6UA 4R9OA 3EWUA 3KBVA 3M0LA 2BWGA 1F6PA 4MMWA 4U4MA 4IGMA 2E0PA 1G4PA 4MHBA 4URIA 3BICA 4O1BA 1W3JA 1SM9A 4CQCA 4HNTA 3QVQA 1RQHA 4LPCA 3MP4A 4NL1A 3OZOA 4GI9A 3SJ3A 2AGKA 3C0QA 1U1JA 3S5OA 5JH2A 4ZO8A 2Y7FA 3JR2A 4J40A 4W5ZA 4ATWA 2ZX5A 4I9JA 4Y9PA 2DJLA 1S2AA 2VR2A 3EDFA 1Q85A 1WO2A 1W1YA 3TTYA 4L5ZA 1BQGA 4IT1A 4K37A 4GI4A 1F61A 2TODA 2HQAA 1ZZMA 3S8HA 3OA3A 7XIMA 5I06A 4XQ6A 2C18A 2TRSA 4CLMA 5ECUA 5AN7A 5AYXA 3WK0A 5D02A 1X96A 1H1ZA 1YPIA 2EBNA 1BYAA 3GNXA 1G1YA 5JBFA 3OTRA 1JAEA 3IRDA 4A3QA 4PCNA 1UWUA 3W7NA 4DXXA 2TMDA 3WDRA 3LCWA 1V6VA 3IS4A 5C9ZA 2PDMA 1DBTA 3KTSA 3G1AA 2I9EA 5KZEA 1DXIA 3FVDA 4UTMA 4DJED 1Q66A 4WUIA 3S1GA 4M8UA 4F0MA 2VZUA 3H8AA 1YX1A 1CZ1A 3KBSA 4DM1A 1K9DA 4D6FA 3AXMA 1UIPA 2WZEA 3I65A 1QI2A 3GQYA 7REQA 3RXZA 2VENA 4DUXA 4DBSA 4A8LA 3ZQ9A 4OBTA 4K38A 4RW5A 2R82A 4W8BA 3W7RA 4JIIX 5AYYA 4OV4A 3UGRA 3GFZA 1H0GA 3OOQA 1I9CB 2ZXQA 1IZJA 5BXPA 4KEVA 4P61A 5EU9A 1V3IA 2FH6A 3CUFA 1UA3A 7TAAA 5FEWA 5EA9A 4HSNA 4DUOA 2ZRWA 4LAKA 3QQ1A 3G1DA 3VIOA 2I9UA 1AJ0A 3DBNA 3UXAA 2I16A 3CT7A 3W1TA 4AFYA 1GOOA 3ANVA 3A3WA 5A8GA 3MANA 3DOPA 3IGSA 3S46A 3GHRA 1QNRA 4IP5A 2QCMA 1OQFA 1XLEA 5D37A 1I0BA 1PX4A 2AL2B 2JE8A 1UG6A 4AIUA 5DT7A 3U4AA 5EPDA 1SFSA 5CPNA 2PTXA 4L1XA 1QMLA 3TLQA 5KINA 2QCDA 4EF8A 4Q4OA 2OODA 4EKJA 5A8OA 3NWRA 5BMXA 1JPMA 4PMOA 3FN9A 2VGIA 4ZSUA 3NUKA 3NJ3A 3LZ3A 1OCQA 4M6QA 3UZZA 3PPFA 3W2LA 4EVZA 3PZVA 1X98A 2BP1A 2VI0A 2RKXA 3RJYA 1QBAA 4J3VA 1Q6CA 4ECLA 2CWNA 6REQA 4YJ5A 1OCBA 4HCHA 4DBWA 4LCSA 1FWEC 3IGXA 3UCDA 4AHPA 1IZKA 4R85A 2WM1A 3PG8A 4O10A 4H9UA 5I00A 3GE7A 2O9PA 3ANYA 3TYDA 2ZZ6A 3RK8A 1TPVA 4FB7A 4Y6GA 3ZO9A 4YCPA 2PMQA 4LGXA 1A0CA 4XSLA 1TCMA 3KBMA 4HIBA 1M7OA 6XIAA 1E0XA 3V4BA 3NQ8A 1G94A 1R46A 3S2CA 2Q6ZA 1GONA 3ECQA 5A3HA 3ES7A 5B7YA 1CIUA 3ZSTA 4RXGA 4MF4A 5HNUA 2WMGA 4CN1A 1OD0A 4J3ZA 2JGYA 4FAMA 3F4VA 1TB3A 3GH5A 1EQPA 3FLUA 2EEXA 3V36A 1E5NA 4ASTA 1B3YA 1K9FA 3W1NA 4QE4A 4HN8A 2ABAA 1TA3A 1ITXA 4XVDA 3CYJA 4A2SA 5M3WA 4Y7EA 1FOBA 4CCZA 2PUZA 1XLGA 4QDPA 1DP0A 4I6VA 3H2MA 4AZGA 3I4KA 3C86A 3ISIX 3W37A 4ZMGA 3QPEA 2ISFA 2BY0A 4UZSA 4JNMA 2QAPA 3I7QA 3I10A 3CQJA 1UKSA 4B9YA 4EWND 1E43A 5M03A 3QR0A 3WFLA 5CC3A 4LY8A 3CM4A 2V6AA 4PUUA 4JL1A 5K9CA 4R88A 1E0TA 2UZ9A 3BAIA 4LXFA 4GX9A 3REQB 1B0IA 1ITQA 1RK5A 1XLFA 4IL2A 3WDIA 4Z0JA 3MC5A 1LZOA 2R14A 2O7QA 2IKGA 4W7VA 3BWWA 3UYIA 4KW2A 2VD8A 2QPXA 4RLIA 1F5ZA 1XW8A 3KVKA 3RMEA 2ISSA 2V5LA 3B0VC 3SSZA 1P1MA 4UQ9A 2NQLA 3LM7A 3A6OA 3IIOA 4GH3A 5DXXA 4F0KA 1ITCA 2YCJA 1KTCA 3QGAC 5LA1A 3VCRA 1NFPA 1A5MC 2BVDA 3MWCA 3U2ZA 4WCJA 4ZTXA 4FK9A 1UPMB 2EQDA 4CU6A 4RPQA 4FA3A 1OY0A 3MKKA 3ARWA 4H9YA 4GQQA 1IEQA 1PZ1A 3PTMA 5BRBA 3NPWA 4JTFA 2PSNA 2NV1A 1H7RA 3CWNA 4PA8A 4J7RA 3OZMA 3H53A 4FXSA 3HGJA 4IZGA 3ERPA 1F76A 1VAHA 1O5RA 3L4WA 2ODOA 1TSIA 3WMLA 1A4MA 2OX4A 4DO5A 4WJ8A 1PX8A 4JDBA 1HL9A 2ZE3A 3K13A 4FX7A 4GC3A 1IR1A 1KCKA 3CHDA 3PZ9A 1W3NA 5AYZA 3S6TA 1IQ8A 5I6SA 4O52A 2ZZ5A 3E0VA 3XINA 3VMPA 3QYQA 1AFSA 4MG4A 3AALA 2X41A 4FOKA 4LBSA 4QCFA 2BNJA 4NXSA 3ARVA 1FH7A 5D2YA 4HNOA 3T40A 3FAWA 2YIHA 1OSEA 4S3CA 2H8ZA 4H9VA 2ZCGA 4V28A 1RP8A 4LUTB 1XYCA 3TJ4A 4C6LA 1Q13A 2EPMX 3WLMA 1OIFA 2X09A 3WDQA 2PDXA 3WJSA 1LROA 4QNEA 2IQTA 3IEBA 2GDQA 3DYMA 3T81A 1NVMA 3A12A 1ZENA 3BARA 3WBAA 1KM1A 1WDWA 3MVTA 1NFGA 3DCPA 1B90A 4ERGA 4C5YA 5C8BB 4HK7A 3O3RA 3HPFA 3EKZA 1NDYA 1EX1A 3TEVA 3TXVA 1VP5A 3JZEA 4F0LA 4XBSA 2J8GA 1I4NA 4HHHA 1W5NA 3CZKA 2FTYA 2YL6A 2EJAA 2WYSA 1REQA 4Y9OA 1DWFM 4TV6A 2R1MA 3CL8A 3WNPA 3SBFA 4E0CA 2VEKA 4KWVA 3L0KA 3URAA 1SFJA 3EB2A 2GUUA 2PGRA 3URQA 3IJ7A 5BRPA 4LSBA 2NXGA 3VNJA 1CGUA 2VVNA 3QZEA 3V5CA 1ENUA 1MO0A 2V82A 1H41A 2VC7A 3WQVA 4Q6XA 2CHNA 3CZLA 1JPHA 3W1QA 1J2WA 4OV9A 3RDKA 3VVGA 3RIKA 3L9CA 1BVNP 3B3DA 2J7BA 2WXDM 5I3FA 3I7SA 4MB3A 3GDMA 3G1HA 2H6RA 5AC4A 4B3LA 3UVIA 1XRVA 3IV3A 1Q8AA 1H7WA 4M29A 4XD4A 3FSTA 3G6LA 4MIMA 3NM3A 1N55A 2CNCA 1UUQA 1ZB5A 3URBA 2V5KA 4AHOA 2X2YA 1ESWA 4IUGA 1W3TA 4KH2A 1AQFA 4YVVA 1V7YA 4EIVA 1C9WA 3GXMA 3QFEA 4CD4A 1TTIA 3AROA 3HPSA 5BZAA 1UROA 1Q4WA 4S3DA 5HULA 2WBGA 1JAKA 3RM8A 2TYSA 1TJ1A 1XRFA 2QXWA 1WDPA 1NOWA 3PZUA 3SRHA 4L80A 3U7BA 1NJJA 2WNNA 1BAGA 2DH3A 3U0HA 1C3FA 3O8AA 1AJ2A 3L5LA 2G50A 3AIWA 4KT2A 3ARPA 1NAL1 1FCVA 4UNLA 4HYWA 3H2OA 3WQPA 3KL5A 5JUVA 5CPQA 2HPMA 3BJFA 4NZ5A 1LORA 1NM9A 3KP1A 3UJFA 3MV01 4TUFA 4L4OA 4MVAA 3LPOA 1RPXA 2OPJA 4KF1A 2DV0A 4AD2A 2E28A 1I6NA 4XD5A 2GSHA 2OSWA 5F4SA 3SW6A 1LBMA 4ZQOA 2AKZA 3HPZA 3CK5A 2BHUA 4FOJA 3BO9A 3QV7A 3GIQA 3AIUA 5C54A 1RY8A 1XYFA 1VLIA 3POHA 3VIKA 4QLJA 1NH6A 3M5ZA 3D46A 1RQEA 4ZQCA 1MUWA 1DWIM 3K8MA 3OG3A 4QS6A 1PTGA 4CCDA 2NWSA 2Y8UA 4K7YA 3QC0A 3S1UA 3VNIA 1GQKA 4I9MA 4GZIA 3L4YA 1HIZA 3WNNA 4UR9A 3UXLA 1XKYA 1R5YA 1PKNA 2GGHA 4JTDA 1ECEA 1HP5A 3N04A 2FPYA 2BS9A 1B1YA 1XICA 3II1A 1BYDA 4H7CA 2OT0A 2FVLA 1QNVA 1FHDA 4ROPA 2CZDA 4AY7A 4QNWA 1U1HA 2X1TA 3BL3A 4R7OA 1BYCA 3FYOA 2VM8A 4MWAD 1LF1A 3SECA 2Y89A 4X2PA 4BR1A 2EPOA 1UJQA 1Y8BA 4UTFA 3IARA 2A3BA