3EY1A

A conformational transition in the structure of a 2'-thiomethyl-modified dna visualized at high resolution
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
137
structure length
137
Chain Sequence
b'AKEEIIWESLSVDVGSQGNPGIVEYKGVDTKTGEVLFEREPIPIGTNNMGEFLAIVHGLRYLKERNSRKPIYSNSQTAIKWVKDKKAKSTLVRNEETALIWKLVDEAEEWLNTHTYETPILKWQTDKWGEIKADYGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribonuclease H
publication title A conformational transition in the structure of a 2'-thiomethyl-modified DNA visualized at high resolution.
pubmed doi rcsb
source organism Bacillus halodurans
molecule tags Hydrolase/dna
total genus 40
structure length 137
sequence length 137
ec nomenclature ec 3.1.26.4: Ribonuclease H.
pdb deposition date 2008-10-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3ey1A00
4JS4A 2D0AA 3HYFA 4CJRA 1KTQA 2HHTA 1NK4A 1RCHA 3VQ5A 1WN7A 1JLCA 3HL8A 3DOLA 3ZT3A 3NE6A 4HTUA 1U4BA 3F9KA 1VRUA 3OJSA 1LAWA 2D5RA 4M3RA 4O0IA 1R0AA 2HHVA 1FKPA 3ZCMA 4I7FA 3OYBA 4KHNA 3MXMA 4C8KA 1UA1A 2YHAA 4CJTA 3U3YA 1L5UA 2ATQA 4B9MA 1IKWA 4FJMA 3AVAA 3IS9A 4CJPA 4E1NA 3HVTA 4KHQA 4PA1A 4ZTFA 2DTUA 1TKZA 4CJQA 1F21A 1UWBA 2A1SA 4O55A 4CIGA 2B5JA 3I8DA 3QNOA 1A5XA 1JL1A 3L3UA 3C95A 1YT3A 4BACA 3SZ2A 3V9XA 1ZBHA 3V9SA 2D0CA 2X6SA 2XY8A 4KB0A 1IO2A 4LSNA 4AHCA 4AHTA 4E3SA 4PY5A 2YV0X 5CY4A 4J2EA 3QEPA 2GBZA 4KTZA 3V9UA 4E7HA 4B9LA 4EZ9A 1QSYA 3SCXA 1T05A 5HROA 2Z1GA 4GMJB 2PYJA 3C94A 3KKSA 3MEGA 3B6OA 2D0BA 3AVFA 1JLBA 3O4NA 4E0DA 3JSMA 5EU7A 3PY8A 2R7YA 4FJXA 1RBRA 3OS1A 2BE2A 4OKEA 4W5TA 3A2FA 3AVCA 1TKTA 4CIFA 3OYHA 4B9SA 4HVJA 3F73A 3K5NA 4Y1DA 4DF4A 4FM0A 1T7PA 5JS1A 4MQ3A 1TK0A 1WNSA 3ZSQA 2XO7A 4CEAA 2XHBA 1Q9YA 4FJIA 4DF8A 4I2QA 1KSPA 2A1RA 1KFDA 1VK0A 1YVUA 2HB5A 3ZSOA 4ZTJA 5D3GA 1JXBA 1S6QA 3QEIA 1L3TA 1HYSA 3SJJA 2HVHA 4E19A 1TVRA 3SQ1A 1EETA 4JRPA 4IKFA 3DLRA 4E1MA 1JLGA 3TABA 4IDKA 1KVCA 2Y1JA 1D5AA 1C1BA 5J2PA 1C1AA 4GVMA 3AVHA 2OPPA 3E01A 2YNGA 3K2PA 3TARA 3O3GA 3EZ5A 1TK5A 3NBPA 4F4KA 4JLHA 3AA5X 3LALA 3HXMA 4DS4A 4M3ZA 4FW1A 4DSJA 4EP5A 4BDYA 3ZSXA 4FJKA 4KTQA 4KI4A 3DMJA 3OYCA 1KLNA 4M3XA 5SWMA 1YTUA 5HRNA 1ASUA 3V81A 4Z4FA 3P1GA 2JLEA 3PUFA 1WSEA 1QQCA 4CGIA 4DFKA 3KLHA 1BQMA 4CGFA 4E89A 1J5OA 4E7LA 2IC3A 3M8SA 3QEVA 3AVNA 1TV6A 3AVLA 1SV5A 1HNIA 1EX4A 1QE1A 1BI4A 4DQQA 3L2QA 3ITHA 3SV4A 4H8KA 3HJFA 1MU2A 2HNZA 5CZ2A 4CEDA 3ZSWA 4DTRA 1WLJA 1UA0A 1U45A 3ASMA 5SZTA 2HNDA 4KFBA 3OYMA 3C6UA 4CEEA 1SL0A 3WNHA 3C6TA 1SL1A 4M45A 3PO5A 1NK5A 4WE1A 4EZ6A 3V4IA 4TSXA 3AVIA 4BE0A 4CEOA 3LWLA 4DQSA 4NCBA 2I5JA 3AVMA 3CFOA 1ASVA 3VQEA 2FBVA 4ZHRA 5HRRA 2VG5A 3CFPA 2XY5A 2FC0A 4B8AB 1IG9A 4M3YA 3NF6A 4G1QA 4CE9A 4FLXA 3AA4A 4CCHA 3KLGA 4FLWA 4DTMA 3U3GA 4W5OA 3VQ9A 1HNVA 1J54A 1NJXA 3SUNA 4KHSA 4YNQA 1S1TA 2OPRA 3NH1A 4DSEA 4CJ5A 3KK3A 4IFVA 3AO1A 1NK6A 5T7BA 1DTQA 2PZSA 3HPGA 1Z26A 1C1CA 1BISA 2X78A 4RW9A 4Z0UA 1LW2A 4M3TA 3L2RA 4O4GA 4H4OA 2YHBA 4CJFA 4DWIA 2BGGA 4AH9A 4CF2A 3TANA 1SKWA 2KTQA 3NDKA 4B9TA 4RW4A 1IKVA 1NJYA 2RN2A 3K5OA 3NF9A 5CZ1A 3QNNA 2WONA 2FBTA 3PV8A 2HMIA 1S5JA 1RT3A 3M8QA 1RTIA 4I9QA 1VSJA 3L2WA 1NJZA 5J2NA 1SKSA 3V9WA 1CXUA 1U48A 3I0RA 3HPOA 3G10A 3V1QA 3QETA 4CFBA 2FBYA 1RT5A 1QSLA 4K8ZA 4O0JA 3T19A 4CJUA 3AO2A 2ITGA 3AA2A 4CGDA 3KK2A 1NKEA 4FXDA 4ELVA 3TAMA 4KRFA 4CFDA 1HQUA 3HP9A 1BI4B 3KKRA 5KTQA 5I42A 3SI6A 1A5VA 4N56A 4FK0A 1RBVA 1S1XA 2YNHA 4EP4A 1NOZA 4M42A 1ZBIA 4QCLA 4FJHA 4Z4GA 3TAEA 1IKYA 3VN5A 1JLAA 3OVNA 3SV3A 2P1JA 3DLEA 2Y1IA 1T8EA 2RPIA 4C8LA 2ZD1A 1BL3A 3NFAA 3KK1A 4AHVA 2O4GA 3ZT4A 3VA0A 4C8OA 4FK4A 1BIZA 1RTJA 1KVAA 3LPTA 3LP0A 4HUFA 1YTAA 3NGZA 4KHYA 2HHXA 1G15A 1RT2A 4CJLA 1N5YA 4FZYA 1JLFA 4NCAA 1LWCA 1SL2A 2XY6A 4DSKA 5FDLA 4CFCA 1FXXA 1VSHA 1DLOA 3PX6A 3BDPA 4OVLA 3ULDA 3AVGA 2ZQBA 2YNFA 5HRSA 3NH0A 1WAJA 4CGJA 2ZE2A 2E6MA 3QEWA 4CK1A 4H4MA 1RTDA 1NKCA 1Z25A 4W5QA 3G0ZA 3LZIA 4AHRA 2ETJA 5FRMA 3LPUA 5C24A 2XRIA 4UQGA 4Z4IA 1RDBA 1VRTA 5CYQA 3VQ6A 1XWLA 4KPYA 4PQUA 1K6YA 4FJGA 1UOCA 3AO5A 3VQCA 4B8CA 3K57A 4C8MA 4FW2A 1KLMA 3IRXA 3SPYA 1XI1A 4DMNA 2AJQA 1BGXT 1C0MA 3DRSA 4NYNA 2QKKA 4FJ8A 4CERA 1RBTA 4KTWA 3RMCA 4CHQA 3FFIA 1WSHA 4QAGA 4I9LA 4FLYA 2EX3A 4DU3A 4LSLA 4DTPA 1X9SA 2BDPA 3ZSZA 5HRPA 2O4IA 3MECA 4DG1A 3RMAA 1QS4A 3VQ7A 3SNNA 5HLFA 1WSGA 3DRPA 3HT3A 4BE1A 2VWKA 3U6FA 1NK7A 1X9WA 3AVJA 1BHLA 3DLKA 3NHGA 4OJRA 3S3NA 2LSNA 3ZT1A 1TL3A 5E41A 4KHUA 4FJ5A 2NUBA 3DLBA 3VQ8A 4N5SA 3HM9A 3TWHA 2HHUA 2G8FA 2B6AA 2X6NA 3LP2A 3QESA 3OYLA 1EXQA 4JRQA 1NKBA 3PO4A 3NGYA 4KB1A 5K14A 2G8HA 1I39A 2RF2A 3VQPA 3THVA 3EY1A 4FZZA 3VQBA 3VA3A 1J9AA 4Z4CA 3DLGA 3V1RA 1ASWA 1VSKA 2FBXA 4IG3A 4CHNA 4B9VA 4M41A 1DTTA 3VQAA 1HYZA 1LW0A 1A5WA 1C6VA 1RBUA 1S6PA 1BCOA 3LAKA 4OPKA 3OYIA 3KLFA 3SQ4A 2OPQA 2G8VA 4KHWA 3RRHA 1RT6A 1U49A 1RDCA 3CG7A 2IOCA 4JS5A 1NK8A 4BE2A 3QLHA 3UIQA 3ZSVA 1N6QA 2Z1HA 3DLHA 4CF9A 4CHYA 3LWMA 2QKBA 1HMVA 4Q5VA 3P83D 4OPJA 1FKOA 2F8SA 5HBMA 4NYFA 3S9HA 3TAQA 3WNFA 4DU1A 1HQEA 4HUEA 4CF1A 1SUQA 4OGCA 1XC9A 4CHPA 1Y97A 1RNHA 3AA3A 4Y1CA 4DTJA 4CEZA 4J2AA 3HP6A 1NK0A 4J2DA 4YFUA 1TKXA 4J2BA 1LWEA 1C0TA 2GUIA 4BDZA 2KW4A 1S1UA 4FM1A 4FZXC 2KZMA 1ZBFA 1REVA 2DFEA 5KGXA 4AHSA 4W5RA 1EKEA 4F3OA 1W0HA 1VSMA 5KGWA 3IG1A 4BWMA 4B3OA 3KTQA 4O5BA 2DFHA 4DU4A 3LANA 4DSLA 1O1WA 3OS2A 2OPSA 1KRPA 4ELUA 1HRHA 3SQ2A 4FJ7A 4FLUA 1U04A 1RT1A 4DTOA 4FK2A 3CM5A 4FM2A 1WSJA 3RMBA 5HP1A 1GOCA 3SUQA 2G8KA 1IH7A 1TAUA 2HW3A 4F8RA 5DMRA 4CGHA 1I3AA 2YNIA 4DFJA 4F2SA 3M8RA 2P5OA 4OKJA 4XIUA 4DTNA 3HPHA 3QINA 3ZT2A 3P5JA 1S9GA 3SUPA 3TR8A 4CECA 4FYDA 5KI6A 1S1VA 2VWJA 2PY5A 5CYMA 4FCYA 4CJ3A 4DS5A 1TAQA 3V9ZA 1KCFA 4FVMA 5FROA 4IFYA 4N76A 1HPZA 3DM2A 3QIOA 1JKHA 5KRTA 3L8BA 3LP1A 3LZJA 3OYKA 1ZBUA 3ZT0A 4OLBA 1L3SA 4IBNA 4DQRA 4LH4A 3M8PA 4CJSA 3AVBA 1VSIA 3MXJA 2E6LA 3BGRA 4CESA 5C25A 3CQ8A 4QOZB 3S3MA 2KFNA 4CK3A 4E7JA 1BCMA 4B9NA 3QERA 5I3UA 3OYNA 1ZYQA 4B9UA 3WNEA 3NF7A 1L3UA 2YKMA 4FLTA 2Z1IA 3H08A 3VQQA 1TGOA 2JGUA 1QSSA 1TK8A 4DQIA 3OJUA 4CIEA 4DTUA 4AILC 3TAPA 4FJNA 2WOMA 1NK9A 4KREA 1C0UA 2B4JA 3V6DA 3NH2A 2IDOA 3DI6A 4DSFA 4ID1A 2OZSA 3MEDA 4F3TA 4BWJA 3HVRA 4GW6A 3T3FA 3RR7A 5J2QA 2F96A 2P51A 4CF0A 1B9FA 5FRNA 1VSEA 4N47A 4OGEA 2OA8A 4AHUA 4Z4EA 1CZ9A 5J1EA 3MAQA 3OS0A 1EP4A 1LAVA 3QIPA 1B92A 2HNYA 3LAMA 4NCGA 4RW7A 3WNGA 4B08A 2HHSA 1WSIA 4LH5A 3KJVA 1ZBLA 3V1OA 4CJEA 1NJWA 4CJKA 4PUOA 1HJRA 5J2MA 1XHXA 1RT7A 1W9HA 4DLEA 3HO1A 4CJVA 3LP3A 3DRRA 3RWUA 1B9DA 2IGIA 1XHZA 1Q8IA 2IS3A 3L2UA 3D45A 5KRSA 1BQNA 2E4LA 3EYZA 3OYJA 3B6PA 2BANA 2Q3SA 5C42A 4FLZA 3O3FA 4LY7A 2G8WA 2GV9A 1CLQA 2W42A 4MFBA 4DTSA 4PWDA 2HHQA 3SQ0A 4ID5A 3TI0A 2HHWA 3JYTA 2EHGA 1CZBA 1D9DA 3KLIA 4Q0BA 3T1AA 1RT4A 4C8NA 4E7KA 3SPZA 1D8YA 4KAZA 4KO0A 3NF8A 1Q9XA 3RR8A 4CK2A 2G8UA 3ALYA 3AVKA 4KKOA 3NGIA 1VSFA 3OYFA 3RMDA 1RDDA 4CJWA 3SUOA 3DOKA 1RBSA 4ICLA 3AO4A 3CM6A 4DTXA 2PYLA 2Z1JA 1BIUA 3ZSYA 2X74A 3K58A 4W5NA 1RILA 2OYQA 3MXIA 1D9FA 1QHTA 1UAXA 2KQ2A 4CEBA 3MEEA 1KFSA 2VG6A 1JLQA 1X1PA 4CF8A 4E7IA 2XY7A 1LWFA 3K5MA 3ZSRA 1HYVA 2IAJA 3KIOA 1L3VA 3KLEA 3KD5E 4HUGA 4HCCA 2KFZA 4DLGA 4LD0A 1IKXA 5JS2A 4CGGA 1KVBA 2VG7A 2KZZA 1RDAA 4K8XA 2RKIA 3OYAA 1VSLA 1SKRA 3K5LA 3VQDA 3S3OA 1T03A 4CHZA 4DSIA 4M3WA 1QTMA 3OYGA 3DYAA 4I2PA 3O4QA 1VSDA 1JLEA 3L3VA 1S9EA 1TL1A 3HSTB 1X9MA 3L2VA 4HCBA 2DY4A 5DK5A 1JXEA 4OKKA 3ISNC 1U47A 4IG0A 4CEQA 2G8IA 3AO3A 4KV8A 4HHTA 2YKNA 3IAYA 3HK2A 2HVIA 3PX0A 3PX4A 3OYEA 3TAFA 3NAEA 3RTVA 4L8RB 3LDSA 3CYMA 1FK9A 3SYZA 4F2RA 4O44A 4CEFA 3D0PA 1GOBA 1CXQA 1J53A 2DFFA 1NOYA 2QXFA 4FLVA 4N41A 1ITGA 1WSFA 4OLAA 4M3UA 4CFAA 4RW6A 4FJ9A 4CJ4A 3QO9A 3VQ4A 2P5GA 4FJJA 1RTHA 1WAFA 3NCIA 4RW8A 3TAGA 4Z4HA 3QEXA 3OYDA 3O3HA 3RRGA 2F8TA 3KD1E 4ELTA 1GOAA 3CFRA 1TKDA 3I0SA 3K59A 3AV9A 4BDPA 4DQPA 2OZMA 4KI6A 2QK9A 1S1WA 4RG8A 4DFMA 3OY9A 1LV5A 4CHOA 4DFPA 1JL2A 4FJLA 4R5PA
chains in the Genus database with same CATH superfamily
1U2VB 2D0AA 3R9PA 5BR9A 3BY5A 3VQ5A 3ZT3A 2I7NA 3F9KA 4DV1K 2D5RA 4XH5A 3ATUA 1FKPA 3OYBA 5IWAK 4C8KA 2HSTA 3CMAN 4ZTFA 2A41A 3T69A 3SZ2A 3L3UA 3C95A 3V9XA 2WFBA 5AQZA 4KB0A 2P9PA 1K9MO 4LSNA 2GBZA 3G25A 4CI6A 3E66A 5HROA 4JHDB 2PYJA 3KKSA 3I33A 4DUYK 3AVFA 1BOTO 5C2DA 2P9LB 2R7YA 4PKIA 3O9QA 3A2FA 3AVCA 1TKTA 3L6QA 4K43A 4FM0A 1T7PA 1WNSA 4KHPK 4H0TB 4FJIA 3EN9A 3P38A 4B1UB 1N8RO 1KSPA 5FLXO 4ZTJA 2NLXA 5D3GA 5LMUK 1S6QA 1L3TA 2HVHA 3C0BA 3BEXA 3IMXA 2GWJA 5MLCQ 1VQ8N 3TARA 5BRHA 1C0FA 3NBPA 3HXMA 4M3ZA 4FW1A 4DSJA 3ZSXA 3L4QA 4KTQA 1JCEA 3HI0A 1KLNA 1VQ5N 4M3XA 5SWMA 1YTUA 1ASUA 4JKCA 3P1GA 3VPZA 3PUFA 1QQCA 2E2PA 1BQMA 3WQUA 4CGFA 4DR2K 2E2OA 1EX4A 1K8KB 4CW7B 1V4SA 1MU2A 5CZ2A 1KC8O 4YOTA 2HNDA 4KFBA 5SZTA 3OYMA 3C6TA 1NK5A 2E5LK 1LCUA 4EZ6A 4FOIA 3AVIA 2IVNA 4DQSA 4NCBA 2I5JA 1ASVA 5AFUH 1IG9A 4M3YA 4CE9A 2WBNA 4JKDA 3AA4A 4FLWA 4DTMA 4W5OA 3SUNA 3NVKA 1NLVA 4DSEA 4CJ5A 2PZSA 1Z26A 4I6MA 4LF6K 4H4OA 2YHBA 4DWIA 3TANA 1SKWA 1IKVA 4BQLA 3NF9A 4QS7A 5BPNA 2WONA 2FBTA 3PV8A 4CZGA 2HMIA 1RT3A 1P90A 5JVGL 3L2WA 3SBTA 5J2NA 2DPNA 4JYAK 1NGFA 3FR0A 4WQ5C 1RT5A 5JLHA 4O0JA 4YOVA 4CJUA 2VQEK 3AO2A 3KK2A 3LDQA 4JD2B 3KKRA 5AJ3K 1RBVA 2NRZA 4NLCA 4EP4A 4JKHA 1R59O 4M42A 4FJHA 2OTLN 5TKWA 5BRDA 1HPMA 1ATNA 3PSIA 2P1JA 3DXKB 2Y1IA 1ATRA 3KK1A 1BG3A 4AHVA 4EAHD 3VA0A 5AQJA 3VTHA 1YTAA 3K9KA 1FW6A 1G15A 1RT2A 4CJLA 4FZYA 4NCAA 2NRWA 1LWCA 1SS6A 4FL9A 4ILHA 5FDLA 1FXXA 4OVLA 2ZQBA 4CGJA 4CK1A 4JI4K 3PIOL 3MWPA 1BWFO 3LZIA 2QWPA 3LPUA 4YOUA 1RDBA 1VRTA 5JLFA 3VQ6A 4KPYA 2Q2RA 1K6YA 2P9UB 3K57A 1QVFM 1KRPA 4CZLA 4C8MA 1XI1A 3IRXA 1BGXT 2ZJPL 4CERA 1RBTA 5BPMA 4U7BA 3FFIA 3BP8A 4QAGA 3OW2M 1YI2N 4I9LA 4DTPA 1KAXA 3RMAA 3U6FA 4WQ4A 2UXDK 3NHGA 3S3NA 3DLKA 2HF4A 2YHXA 4OJRA 4JKFA 4FJ5A 3HM9A 1NBWA 4MDAA 1IJJA 5AQPA 4BRGA 3LP2A 1NMDA 1EXQA 3PO4A 3MN9A 2CH5A 3NGYA 1HUXA 3EY1A 4BRHA 4A62A 4BRNA 4B9VA 1E4GT 3VQAA 1Q86O 1HYZA 1LW0A 1A5WA 1RBUA 3LAKA 2G8VA 3CJ7A 3RRHA 1QQNA 4JS5A 2IOCA 4JV5K 1NK8A 4YDUC 4QS8A 3VOVA 3CETA 3ZSVA 4BQZA 1N6QA 3DLHA 3THXB 4OPJA 1FKOA 5HBMA 4NYFA 2F4VK 3TAQA 1HQEA 1DKGD 4HUEA 4CF1A 1SUQA 4Y1CA 1HR0K 5C10A 4YFUA 1TKXA 4J2BA 4DV0K 1C0TA 2GUIA 1S1UA 3H1VX 3UE5A 4FZXC 5LMNK 2H3GX 2KZMA 1ZBFA 4BRFA 5KGXA 4W5RA 1EKEA 4BC2A 1W0HA 2CGLA 5KGWA 3TTCA 4B3OA 3CQYA 3QFUA 1O1WA 4IXCA 1VQ6N 3B8AX 2O8EB 4DTOA 3CM5A 4FM2A 4X64K 3RMBA 5HP1A 3J7YP 2G8KA 3H3NO 4F8RA 4CGHA 2P5OA 2P9SA 3EE9A 4CVNE 2BUPA 3SUPA 3TR8A 4CECA 5KI6A 2YX6A 1YXQA 1MWMA 4FCYA 3CIPA 4CJ3A 4DS5A 1TAQA 3R6MA 3O6WA 1HPZA 3OYKA 1ZBUA 1L3SA 4LH4A 3M8PA 1ILYA 1VSIA 3BGRA 3CQ8A 4QOZB 4CZFA 1BCMA 4BVPA 3VEXA 2HBKA 1L3UA 3QICA 2YKMA 1IBMK 3H08A 5AQQA 3RSEB 4YORA 3OJUA 3A5LC 1NK9A 4DR3K 5AZJB 4GW6A 4CF0A 4XH1A 1OKJA 4AHUA 2QWQA 3CF5L 1ZC6A 1NGAA 2HNYA 4NCGA 3WNGA 4BRDA 1WSIA 3ID8A 3V1OA 5BRFA 1NJWA 2YJFA 3FZFA 1KQSM 2PAVA 3D45A 5KRSA 2BANA 5C42A 3O3FA 4LY7A 3LDPA 4MFBA 2P9KA 2HHWA 4DV4K 3WXMB 1GLCG 1D8YA 3C7NB 1Q9XA 4IJAA 1HLUA 3AVKA 4KKOA 3OYFA 3RMDA 1YJNN 5AQIA 3ZETB 2F9TA 3LL3A 2PYLA 3ENHA 3CPWM 3MXIA 2KQ2A 3HTVA 3K5MA 5CE3A 2IAJA 2P9PB 3U9ZA 3KIOA 1L3VA 1TYQA 4HCCA 5AQXA 3EEQA 3VTIA 4DLGA 1W7AA 1WBDA 4K8XA 3O5BA 3VQDA 3MN6A 3ZX2A 3S3OA 3KWGA 3OYGA 3DYAA 1JLEA 1S9EA 3HSTB 1X9MA 3R1XA 4HCBA 1ZXOA 3JXUA 4CEQA 3CCEN 3AO3A 3VERA 2YKNA 4HHTA 4BGAA 3PX0A 1GLBG 4WQ5A 1FK9A 1GLFO 4ISGA 4CEFA 2DFFA 5AQYA 1X3NA 2E1ZA 2P5GA 1RTHA 1Y64A 3TAGA 4DCHA 2A3ZA 2FSJA 3O3HA 4ELTA 1GOAA 2J4RA 3CFRA 3K59A 3D2EB 5F1XA 4DFMA 1ESVA 1LV5A 1JL2A 2CH6A 5M1PA 3HYFA 1NK4A 3NE6A 1U4BA 3U8XA 1VQMN 1IBLK 4A5AA 3OJSA 4O0IA 2P9NA 5CR4A 5AR0A 1L5UA 4B9MA 2ATQA 3O9UA 4FJMA 4CJPA 4LF5K 3HVTA 1SQKA 2DTUA 1TKZA 3MWTA 1F21A 4CIGA 2A1SA 5KQ8A 3HZ6A 2D0CA 2XY8A 1WB9A 1IO2A 1TUYA 2E2QA 3LDOA 2AP1A 4DHYA 3C94A 3B6OA 2FF6A 1JLBA 5EU7A 4OKEA 3OYHA 3OBWA 4HVJA 3K5NA 1YUWA 3F73A 1BDGA 5JS1A 4MQ3A 4DF8A 3MCAB 2A1RA 1YVUA 2A40A 2HBJA 4GVEA 3QEIA 1HYSA 4E19A 3JS6A 3SQ1A 5BR8K 3THYA 4CZHA 3DLRA 4E1MA 3TABA 4IDKA 4FSVA 4IWVA 3AVHA 3W0LA 5AZIB 4DS4A 2CGJA 4H5TA 1J6ZA 1S3XA 4KI4A 4YDUA 4LF8K 3DMJA 3SBGA 4NXNK 1KXPA 4FVUA 3OYCA 2WUSA 2JWKA 1LOTB 4DFKA 3KLHA 4E89A 1NGHA 4B1ZA 4WF9L 3AVNA 1HNIA 4B3MK 1BI4A 5AQLA 4H8KA 3HJFA 3FZHA 3N4QA 4CEDA 3ZSWA 4DTRA 1UA0A 3T1YK 2HBMA 3C6UA 4CEEA 3WNHA 3PO5A 3MDQA 1OH8A 4DR7K 3LWLA 4DUZK 3CFOA 1YITN 2FBVA 2XY5A 5HRRA 4YY3K 3NF6A 4G1QA 4FLXA 1YJWN 4CZIA 3U3GA 3VQ9A 4XH4A 4KHSA 2OPRA 5AQTA 3DLLL 3KK3A 3AO1A 1NK6A 4BR9A 5T7BA 1DTQA 4UY8O 3HPGA 1C1CA 4Z0UA 1LW2A 4M3TA 4O4GA 5KPZA 1EQYA 5C15A 4CJFA 2BGGA 1NJYA 5CZ1A 2ZJQL 1C0GA 4U67L 4BRPA 3I0RA 3V1QA 1HJOA 4BC5A 2FBYA 1QSLA 4K8ZA 3T19A 4ELVA 4KRFA 2FSKA 3SI6A 3KVGA 4C1NI 3CCLN 2RE2A 2YNHA 4CJ7A 4PKGA 4Z4GA 3N4PA 1W2BM 3VN5A 1JLAA 3OVNA 1I94K 1T8EA 2ASPA 3R3LA 2RPIA 4C8LA 4LC9B 1BL3A 3NFAA 4C8OA 1YF5L 5AQGA 1X3MA 1ATSA 5GIOA 1NNEA 4KHYA 1N5YA 3EL2A 1Z05A 1SL2A 2A6AA 2QTDA 4GV9A 3LDLA 3VF6A 3ULDA 2YNFA 4PKHA 5HRSA 4B9QA 4B3RK 2ZE2A 2E6MA 4H5RA 5LJVA 1OH5A 3FGUA 2IIRA 3G0ZA 4IEEA 2GWKA 2ETJA 5FRMA 2XRIA 1VQ7N 5CYQA 3TTDA 1O13A 1UOCA 3VQCA 2E2NA 3AO5A 4B8CA 4FW2A 1KLMA 3DRSA 2QKKA 4KTWA 2E20A 2AA4A 4OO1J 3I55N 4IO8A 4FLYA 4LSLA 3CCJN 4FO0A 2BDPA 5HRPA 4ISEA 2O4IA 4DG1A 3U4LA 1QS4A 3SNNA 5AQVA 3HT3A 3DRPA 2VWKA 3C65A 4KHUA 4A2BA 1QQOA 3VGMA 2NUBA 3TWHA 2A42A 2X6NA 4NB4A 1NKBA 4KB1A 1I39A 3VQPA 4IO9L 3NMUA 3RVCA 2O8DA 3V1RA 1XNQK 4M41A 2QA4N 1S6PA 4GV3A 4JI0K 1EO1A 3OYIA 3VEVA 3SQ4A 2OPQA 2ZGZA 3F2KA 1RDCA 1HNXK 5CHIA 4BRAA 3EKSA 3LWMA 2HMPA 4KH4A 4Q5VA 3P83D 4DU1A 3JAMO 4JKEA 1XC9A 1RNHA 4MO5A 4H5NA 1MWKA 4NLBA 4DV2K 4J2DA 1LWEA 4FM1A 5BREA 2KW4A 3O80A 4AHSA 1QQMA 5KPTA 1VSMA 3IG1A 4WFBL 4LFCK 4FWNA 4DV3K 1Q82O 3LANA 4IOCL 3E9OA 3OS2A 2FF3B 3SQ2A 4BRCA 2QWNA 4FK2A 4RTFD 3ZEUA 3ENOA 3CC2N 1K8AO 1TAUA 2HW3A 2YNIA 3M8RA 3WEEA 4OKJA 3HPHA 3QINA 5GAEP 2VYPA 5AQMA 2QW9A 3ZLJA 4EIAA 4GV6A 3EZWA 1YJ9N 3OHRA 3DM2A 5KRTA 1FJGK 3BUZB 4CJSA 1DGKN 1E4FT 3MXJA 2E6LA 4FWQA 4CESA 4FWKA 4BR4A 5I3UA 4K25A 1ZYQA 1HNWK 3WNEA 3NF7A 3WXIA 2Z1IA 1TGOA 2JGUA 1TK8A 4DQIA 4DTUA 4IDHA 4CIEA 3TAPA 1C0UA 3NH2A 2IDOA 3DI6A 4ID1A 4F3TA 3HVRA 5BN9A 2HOEA 4B3SK 2F96A 3G6EN 1B9FA 4N47A 4Z4EA 3OS0A 4JKBA 4B08A 4RW7A 1BA1A 5DM7L 3AAQA 1K73O 4CJKA 1XHXA 4DLEA 4CJVA 3RWUA 1XHZA 3W3DA 3D6RA 4JKGA 3THWB 3LM9A 3UKRA 4JNEA 1CLQA 2HHQA 1GLAG 4ID5A 1XUPO 3K0SA 1RT4A 4C8NA 4JAXA 5H1SQ 3NF8A 2PFUA 3ALYA 4MDBA 3NGIA 3GG4A 3SUOA 4LFBK 3CM6A 1U2VA 2FLOA 4W5NA 2W6KA 2YI1A 2OYQA 1D9FA 1QHTA 1UAXA 1X1PA 4CF8A 4E7IA 2XY7A 4BG8A 4ILJA 1E3MA 3KD5E 5AQSA 2KFZA 2QI2A 1IKXA 5JS2A 4BRKA 1KVBA 2KZZA 1RDAA 4WFNL 3OYAA 1VSLA 4M63C 1T03A 1QTMA 1T6DA 3O4QA 4NXMK 1SAZA 3MX5A 3ISNC 4H0PA 4FWMA 4IG0A 3HK2A 3NAEA 3CYMA 4F2RA 4O44A 2YHWA 1ITGA 4CFAA 4FJ9A 1VQON 1HKGA 4FJJA 4K41A 1WAFA 4ILGB 4Z4HA 3OYDA 2GELA 3PSFA 4KH5A 2E8AA 1NGGA 4BDPA 3I0SA 4KH6A 4OX9K 3S41A 2F9WA 4CHOA 4PL8A 3DAWA 5JMVA 4M7YA 5A2QO 4JI7K 2ASOA 2HHTA 4L3QA 3CC4N 1WN7A 1JLCA 3HL8A 1VRUA 5B8HA 1LAWA 2HHVA 3ZCMA 1V4TA 4KHNA 1N36K 3MXMA 4O8UA 1UA1A 2YHAA 3U3YA 1IKWA 3AVAA 3IS9A 4CJQA 3I8DA 4BRIA 4BG9A 4AHTA 4PY5A 2YV0X 1HKBA 3QEPA 3SMSA 4C1NK 4E7HA 4EZ9A 1QSYA 3SCXA 1T05A 2Z1GA 4GMJB 4CZJA 3FFKB 3QBWA 4WFAL 4E0DA 3JSMA 4FJXA 3SAGA 1RBRA 3OS1A 2P9IA 4DR6K 4R79A 4CIFA 4B9SA 3IFRA 3AGRA 4Y1DA 4JEPA 4CEAA 3SMPA 4I2QA 3L4IA 5FPDA 3WUHA 4MLEA 2IVPA 3VGLA 4PHTX 1TVRA 3O1WA 3CJ9A 4IOAL 4IKFA 1JLGA 1BUPA 3SK3A 2Y1JA 1C1BA 3Q7BA 1C1AA 2OPPA 2YCHA 1TK5A 3O3GA 3EZ5A 3AA5X 3WQTA 2EWSA 4B1VA 1EWQA 2FXUA 3MN7A 4DQ8A 4FPBA 3O8MA 4EP5A 4BDYA 4FJKA 4GKJK 5HRNA 4Z4FA 2JLEA 2VGNA 4A5BA 2UUAK 1WSEA 4CGIA 3R8EA 4BR2A 1J5OA 2IC3A 3M8SA 3QEVA 4FOEA 4Y0WA 1SV5A 1QE1A 3M6GA 4DQQA 3L2QA 3SV4A 3GDQA 4JI2K 1VQ9N 2ZWHA 3CCSN 1RFQA 2GX9A 1WLJA 2OCEA 1SL1A 4M45A 1GLDG 5I9EB 4BE0A 3P4IA 1Z6RA 4ZHRA 4BVOA 2OTJN 5AQNA 3CFPA 2FC0A 4B8AB 4MLHA 4DV7K 2OANA 4CCHA 2BTFA 1KAYA 2V52B 2HHHK 4LF4K 5M1QA 4IFVA 1BISA 3UB5A 3SLCA 2KTQA 4CF2A 3E9PA 3NDKA 5EX5A 4RW4A 4DB3A 4FWRA 3K5OA 4A57A 4KBOA 1VQKN 3NVMA 3WXJA 1RTIA 3ATVA 5AQKA 4I9QA 1VSJA 3F9MA 1CXUA 1T3VA 1N33K 4CZEA 4CFBA 3G71N 2ZJRL 5LY3A 2QWLA 1NKEA 3TAMA 4A59A 4CFDA 1HQUA 3HP9A 2NRTA 5KTQA 1YAGA 5I42A 4N56A 3QMLA 5IT9O 2O8DB 3IUCA 1NOZA 4QCLA 3SV3A 3DLEA 2O8FA 1YHQN 2O4GA 3ZT4A 4A2AA 4FK4A 3VGKA 3LP0A 3DJCA 1RDUA 3P31A 5JVHL 1VAZA 2XY6A 3CMEN 4DSKA 4CFCA 3H45C 3CHWA 3M3ZA 4FWOA 1T6CA 3BDPA 3GE1A 4WCEL 4I6MB 1NM1A 3NH0A 1WAJA 3QEWA 3P39A 1SZ2A 4W5QA 1IG8A 4AHRA 3HOTA 5C24A 4UQGA 4K42A 1XWLA 4FJGA 5DM6L 2NRHA 3H3OB 3SPYA 3FLCO 3HOSA 2ITMA 1X9SA 2VGMA 3WEEB 3ZSZA 3MECA 2KKZA 2W6LA 3F5TA 5HLFA 3ID6A 3VEWA 4BE1A 1NK7A 2O8EA 3IDHA 2LSNA 1TL3A 5E41A 3VQ8A 5LJWA 2HHUA 4B1YB 3QESA 2CGKA 3OYLA 5K14A 1HNZK 2G8HA 3H46O 1U6ZA 3OBYA 1OVQA 3VQBA 4MO4A 4EHUA 4JN4A 1J9AA 4Z4CA 3D7EO 1ASWA 1VSKA 2D0PA 2FBXA 4IG3A 1DTTA 2UYTA 1WOQA 1C6VA 3KLFA 4FWLA 3VETA 3QLHA 4CF9A 5BPLA 1HMVA 2F8SA 3S9HA 4BR0A 2A5XA 3H1QA 1N34K 3AA3A 4DTJA 3HM8A 1DEJA 1KD1O 1RDWX 2UUBK 1VQLN 1X9JA 5AZJA 4OPHA 3FZMA 3ZYYX 4BRQA 3KTQA 4DU4A 2DFHA 4ELUA 1HRHA 4FJ7A 3TSQA 1U04A 4JKGB 2O8CA 3SUQA 3A5OC 3DXMA 4F2SA 2W41A 4XIUA 1G99A 4DTNA 1JCGA 1GLJO 3ZT2A 1M1KO 3P5JA 1S9GA 3CCRN 1XMQK 4FYDA 1H1VA 5GINA 1NGEA 2YJEA 3U9DA 5AQUA 1KCFA 4IFYA 1P8ZA 2WC9A 3L8BA 3QIOA 1JKHA 3LZJA 3LP1A 3FZKA 3ZT0A 4OLBA 4IBNA 2JWLA 5F0XA 3C7NA 5EOYA 5C25A 3S3MA 2V51B 4CK3A 5C12A 3QERA 3IKMA 3CCVN 3ZETA 5KQDA 3A5MC 4B9UA 3FZLA 1GLLO 1MDUB 4FLTA 3VQQA 1BU6O 4FWSA 3TSUA 4AILC 4FJNA 1WBBA 2B4JA 3V6DA 3MEDA 4O8KA 2P51A 1CZ9A 1EP4A 3QIPA 1B92A 3LAMA 4BRLA 2NRXA 2HHSA 4H0XB 3KJVA 3KHYA 4CJEA 4PUOA 1HJRA 5J2MA 1RT7A 1HKCA 1XNRK 1NGJA 2GUPA 2P9SB 4C23A 1J5EK 1B9DA 2IGIA 2ZF5O 1N32K 3L2UA 3EYZA 1BQNA 2E4LA 2Q3SA 4FLZA 1CZAN 3KWIA 3VMFB 4PWDA 3BF3A 4CD3A 3TI0A 3JYTA 4RWTA 3T1AA 3CI5A 4E7KA 4KAZA 4KO0A 3D2EA 3O9TA 1S72N 3RR8A 4CK2A 2O8BA 5EY4A 4CJWA 3DOKA 4HWIA 2FSNA 2Z1JA 1BIUA 3TSPA 1JJ2M 2X74A 1RILA 4CEBA 1KFSA 2VG6A 1LWFA 3E9LA 2GEMA 3KLEA 1XMOK 1IBKK 1SKRA 1JCFA 2QWOA 4A61A 3CJAA 4I2PA 1VSDA 3EKUA 2P9IB 4CD1A 2DY4A 5DK5A 4BRMA 1JXEA 2HVIA 3PX4A 1YVNA 3TAFA 3RTVA 2VQFK 3SYZA 3D0PA 1GOBA 1CXQA 4JK7A 1NOYA 4FLVA 5HL7L 1WSFA 1KAZA 4Z94A 3J80O 2RHKA 4M3UA 4OLAA 2YHYA 3ZX0A 3QO9A 5BN8A 4RW8A 2P9KB 3UKUA 3CXCM 2NNWA 3RRGA 3O4WA 3GL1A 1TKDA 3AV9A 4DQPA 4KI6A 3AGKA 4AQYK 3A8YA 1S1WA 3KK7A 4RG8A 4DFPA 4R5PA 1XC3A 4JS4A 4CJRA 1KTQA 5GADP 1RCHA 3DOLA 4HTUA 5AZIA 4M3RA 1R0AA 4OPAA 4I7FA 1TYQB 3O08A 4NO7A 1RGIA 4CJTA 5M1KA 2NRVA 4KHQA 2Q97A 4E1NA 2WTUA 4BR7A 4PA1A 4O55A 1UWBA 4CZMA 3QNOA 2B5JA 4N41A 1A5XA 1JL1A 5E26A 3WT0A 1YT3A 4BACA 1ZBHA 3ENBA 3V9SA 2X6SA 4B1WB 4AHCA 3QDKA 3ULEA 4E3SA 4J2EA 5CY4A 4BGBA 4HTLA 4KTZA 4BC3A 3V9UA 4B9LA 3D2FA 1VHXA 3MEGA 2D0BA 3O4NA 3PY8A 2D4WA 2BE2A 1D4XA 4XEIA 4W5TA 1Q7YO 4DF4A 3CJCA 3TU5A 3ZSQA 1TK0A 2XO7A 2XHBA 1Q9YA 4G9ZA 4AF1A 1QHAA 3L0QA 3J7ZO 1QZ5A 5AFUA 4IZ9A 1KFDA 1VK0A 2HB5A 3ZSOA 3OTOK 3OA9A 1JXBA 3SJJA 1NMNA 3DWLA 1EETA 4JRPA 4DR4K 1ZBSA 2QWRA 3AY9A 1KVCA 1D5AA 5ELZA 5J2PA 4GVMA 4B1XB 2HBLA 3E01A 3K2PA 2YNGA 2Q36A 3O9RA 2I7PA 4H0YB 5ADXH 3I56N 2F7TA 4F4KA 1NGDA 4JLHA 5EVZA 3LALA 3CC7N 1QZ6A 3A0IX 4BR5A 2P9NB 5C0YA 3V81A 3T7ZA 2E88A 1DT9A 3LM2A 3C6HA 3I8BA 4B3TK 4BROA 4EFHA 4E7LA 2O8FB 1TV6A 3AVLA 3CERA 5M1NA 3ITHA 3J81O 5EXWA 2Q0UA 2HNZA 2IVOA 1U45A 3ASMA 1SL0A 4WE1A 3V4IA 4TSXA 4CEOA 2BH1A 3AVMA 3BZKA 3VQEA 2VG5A 2NZTA 3KLGA 1MA9B 2W40A 4JHDA 1HNVA 1J54A 1NJXA 4YNQA 1S1TA 3NH1A 2P9LA 3MX2A 3MMVA 3HSCA 4RW9A 2X78A 3CCMN 4H03B 3L2RA 4M7XA 5AQRA 3THYB 4AH9A 3VENA 4B9TA 4E1JA 2RN2A 3QNNA 3VESA 1S5JA 3M8QA 3AAPA 2ZGYA 4JI8K 1NJZA 2PBDA 1SKSA 3J7AP 3V9WA 1YIJN 1U48A 3M5RA 2D0OA 3G10A 4X65K 3HPOA 3QETA 3QFPA 4JK8A 3MN5A 2NRRA 2ITGA 3AA2A 3E1YA 4CGDA 1VQNN 4FXDA 4DKWA 3CJ1A 1BI4B 1BO5O 4DV5K 1A5VA 3O1BA 4FK0A 5TKYA 2ZM6K 1S1XA 5ADXA 4X62K 1ZBIA 2QXLA 3TAEA 3VF4A 1IKYA 3ZX3A 3PLAA 2ZD1A 3CQXA 1K8KA 4GY2B 1BIZA 1RTJA 1KVAA 2KHOA 3LPTA 5GAGP 4HUFA 4IFEA 5KPRA 3NGZA 2HHXA 1JLFA 1NGBA 1VSHA 1DLOA 3EO3A 3PX6A 3AVGA 1NGCA 2QWMA 4DR1K 4H0OA 4H4MA 1RTDA 1NKCA 1Z25A 5C2FA 5HOOA 4Z4IA 4CBXA 4V19S 4PQUA 2UXCK 3O9SA 1NJIO 4FWPA 4DMNA 2AJQA 5AQFA 1C0MA 4FJ8A 4NYNA 2O8CB 3RMCA 4CHQA 1NWKA 3J8AA 1WSHA 3FE1A 3DXMB 1BA0A 1XQSC 2EX3A 4DU3A 1NGIA 3M1FA 5JICA 3VQ7A 1WSGA 3AVJA 1BHLA 4FPAA 3ZT1A 3DLBA 4N5SA 3Q7CA 2G8FA 2B6AA 3CJBA 4JRQA 4JD2A 3CCUN 2RF2A 3THVA 3CCQN 4FZZA 3VA3A 4BREA 4AM7A 3DLGA 4F9OA 4CHNA 2V7ZA 1BCOA 4OPKA 3DXKA 4KHWA 2UU9K 1RT6A 1U49A 3CG7A 1M90O 4BE2A 3UIQA 2Z1HA 5E84A 2HF3A 4H5VA 4CHYA 1OH7A 2QKBA 3WNFA 4OGCA 4ISFA 3WXKA 4CHPA 1Y97A 2VCPA 4CEZA 4RCHA 4J2AA 2Q1NA 3HP6A 1NK0A 4H0VB 2UUCK 2QEXN 4BDZA 2GTDA 4JKAA 1IV0A 3EE8A 1REVA 2DFEA 4F3OA 5M1FA 3BF1A 4BWMA 2D1KA 4BC4A 4O5BA 4DSLA 2OPSA 2P9UA 3CPEA 3C6AA 4FLUA 3QB0A 1RT1A 5LL6Z 1VQ4N 1WSJA 3G4SN 1VQPN 1GOCA 3AARA 1IH7A 1HX1A 1W97L 5DMRA 1I3AA 4DFJA 4LF7K 4O5FA 3LDNA 4DR5K 2VWBA 1S1VA 2VWJA 2PY5A 3TPQA 1EWRA 5CYMA 3THWA 2O8BB 3VEZA 3V9ZA 3WXLA 4FVMA 5FROA 4IOXA 4N76A 4DQRA 3AVBA 4JI3K 2KFNA 4QS9A 3PIPL 4E7JA 5GAHP 4B9NA 3MCPA 1Q81O 3OYNA 5GIPA 4CBUA 3SAFA 3HRGA 4JI5K 4X66K 1QSSA 4BY9C 2WOMA 4CBWA 5FPNA 4KREA 3THXA 4DSFA 2OZSA 4YOXA 4JI1K 4BWJA 3RR7A 3T3FA 5J2QA 2Q0RA 5FRNA 1VSEA 2OA8A 4OGEA 3SAHA 5J1EA 3MAQA 1LAVA 3H6EA 4AM6A 2KLAA 4JK9A 3ZEUB 2V7YA 2ASMA 4LH5A 1ZBLA 3CD6N 3K9JA 3UKUB 1W9HA 1QVGM 4CZKA 3GOIA 3HO1A 3LP3A 3DRRA 1NG9A 1Q8IA 2IS3A 3HBTA 5AQOA 3OYJA 3B6PA 2G8WA 2UXBK 2GV9A 4IEIA 5F2RA 2W42A 4DTSA 3SQ0A 2EHGA 1CZBA 1D9DA 3KLIA 3MK6A 4Q0BA 3SPZA 3SJHA 4YHHK 2G8UA 1Q18A 1VSFA 3BZCA 1RDDA 1RBSA 4ICLA 3AO4A 4DTXA 3ZSYA 5AQWA 5M1OA 3K58A 3VEYA 4WQ4C 3TTFA 3KD1E 3MEEA 1JLQA 4YOWA 1TUUA 3ZSRA 1HYVA 4DV6K 4PL7A 4GKKK 4HUGA 3ULEB 4EHTA 4LD0A 4CGGA 2VG7A 3D2FB 2RKIA 3K5LA 2Q31A 3VEOA 1GLEG 3RSEA 4CHZA 4DSIA 4M3WA 4YOYA 3VF2A 4J8FA 3L3VA 1TL1A 3L2VA 4IJNA 5AQHA 3KZBA 4OKKA 2G8IA 1U47A 4GNIA 4KV8A 3QBXA 3IAYA 1NU0A 3OYEA 4L8RB 3LDSA 4LF9K 1J53A 2QXFA 3T1HK 4JI6K 3UKRB 4RW6A 5FPEA 4CJ4A 3VQ4A 1S22A 3GBTA 3NCIA 1WUAA 3QEXA 1OVYA 2F8TA 2E1YA 4H5WA 2OZMA 2QK9A 4K0KK 2QM1A 3OY9A 1T44A 1OH6A 4LFAK 4WYBA 5FPMA 3A5NC 4FJLA 1X9WA
chains in the Genus database with same CATH topology
4JS4A 2D0AA 3HYFA 4CJRA 1KTQA 2HHTA 1NK4A 1RCHA 3VQ5A 1WN7A 1JLCA 3HL8A 3DOLA 3ZT3A 3NE6A 4HTUA 1U4BA 3F9KA 1VRUA 3OJSA 1LAWA 2D5RA 4M3RA 4O0IA 1R0AA 2HHVA 1FKPA 3ZCMA 4I7FA 3OYBA 4KHNA 3MXMA 4C8KA 1UA1A 2YHAA 4CJTA 3U3YA 1L5UA 2ATQA 4B9MA 1IKWA 4FJMA 3AVAA 3IS9A 4CJPA 4E1NA 3HVTA 4KHQA 4PA1A 4ZTFA 2DTUA 1TKZA 4CJQA 1F21A 1UWBA 2A1SA 4O55A 4CIGA 2B5JA 3I8DA 3QNOA 1A5XA 1JL1A 3L3UA 3C95A 1YT3A 4BACA 3SZ2A 3V9XA 1ZBHA 3V9SA 2D0CA 2X6SA 2XY8A 4KB0A 1IO2A 4LSNA 4AHCA 4AHTA 4E3SA 4PY5A 2YV0X 5CY4A 4J2EA 3QEPA 2GBZA 4KTZA 3V9UA 4E7HA 4B9LA 4EZ9A 1QSYA 3SCXA 1T05A 5HROA 2Z1GA 4GMJB 2PYJA 3C94A 3KKSA 3MEGA 3B6OA 2D0BA 3AVFA 1JLBA 3O4NA 4E0DA 3JSMA 5EU7A 3PY8A 2R7YA 4FJXA 1RBRA 3OS1A 2BE2A 4OKEA 4W5TA 3A2FA 3AVCA 1TKTA 4CIFA 3OYHA 4B9SA 4HVJA 3F73A 3K5NA 4Y1DA 4DF4A 4FM0A 1T7PA 5JS1A 4MQ3A 1TK0A 1WNSA 3ZSQA 2XO7A 4CEAA 2XHBA 1Q9YA 4FJIA 4DF8A 4I2QA 1KSPA 2A1RA 1KFDA 1VK0A 1YVUA 2HB5A 3ZSOA 4ZTJA 5D3GA 1JXBA 1S6QA 3QEIA 1L3TA 1HYSA 3SJJA 2HVHA 4E19A 1TVRA 3SQ1A 1EETA 4JRPA 4IKFA 3DLRA 4E1MA 1JLGA 3TABA 4IDKA 1KVCA 2Y1JA 1D5AA 1C1BA 5J2PA 1C1AA 4GVMA 3AVHA 2OPPA 3E01A 2YNGA 3K2PA 3TARA 3O3GA 3EZ5A 1TK5A 3NBPA 4F4KA 4JLHA 3AA5X 3LALA 3HXMA 4DS4A 4M3ZA 4FW1A 4DSJA 4EP5A 4BDYA 3ZSXA 4FJKA 4KTQA 4KI4A 3DMJA 3OYCA 1KLNA 4M3XA 5SWMA 1YTUA 5HRNA 1ASUA 3V81A 4Z4FA 3P1GA 2JLEA 3PUFA 1WSEA 1QQCA 4CGIA 4DFKA 3KLHA 1BQMA 4CGFA 4E89A 1J5OA 4E7LA 2IC3A 3M8SA 3QEVA 3AVNA 1TV6A 3AVLA 1SV5A 1HNIA 1EX4A 1QE1A 1BI4A 4DQQA 3L2QA 3ITHA 3SV4A 4H8KA 3HJFA 1MU2A 2HNZA 5CZ2A 4CEDA 3ZSWA 4DTRA 1WLJA 1UA0A 1U45A 3ASMA 5SZTA 2HNDA 4KFBA 3OYMA 3C6UA 4CEEA 1SL0A 3WNHA 3C6TA 1SL1A 4M45A 3PO5A 1NK5A 4WE1A 4EZ6A 3V4IA 4TSXA 3AVIA 4BE0A 4CEOA 3LWLA 4DQSA 4NCBA 2I5JA 3AVMA 3CFOA 1ASVA 3VQEA 2FBVA 4ZHRA 5HRRA 2VG5A 3CFPA 2XY5A 2FC0A 4B8AB 1IG9A 4M3YA 3NF6A 4G1QA 4CE9A 4FLXA 3AA4A 4CCHA 3KLGA 4FLWA 4DTMA 3U3GA 4W5OA 3VQ9A 1HNVA 1J54A 1NJXA 3SUNA 4KHSA 4YNQA 1S1TA 2OPRA 3NH1A 4DSEA 4CJ5A 3KK3A 4IFVA 3AO1A 1NK6A 5T7BA 1DTQA 2PZSA 3HPGA 1Z26A 1C1CA 1BISA 2X78A 4RW9A 4Z0UA 1LW2A 4M3TA 3L2RA 4O4GA 4H4OA 2YHBA 4CJFA 4DWIA 2BGGA 4AH9A 4CF2A 3TANA 1SKWA 2KTQA 3NDKA 4B9TA 4RW4A 1IKVA 1NJYA 2RN2A 3K5OA 3NF9A 5CZ1A 3QNNA 2WONA 2FBTA 3PV8A 2HMIA 1S5JA 1RT3A 3M8QA 1RTIA 4I9QA 1VSJA 3L2WA 1NJZA 5J2NA 1SKSA 3V9WA 1CXUA 1U48A 3I0RA 3HPOA 3G10A 3V1QA 3QETA 4CFBA 2FBYA 1RT5A 1QSLA 4K8ZA 4O0JA 3T19A 4CJUA 3AO2A 2ITGA 3AA2A 4CGDA 3KK2A 1NKEA 4FXDA 4ELVA 3TAMA 4KRFA 4CFDA 1HQUA 3HP9A 1BI4B 3KKRA 5KTQA 5I42A 3SI6A 1A5VA 4N56A 4FK0A 1RBVA 1S1XA 2YNHA 4EP4A 1NOZA 4M42A 1ZBIA 4QCLA 4FJHA 4Z4GA 3TAEA 1IKYA 3VN5A 1JLAA 3OVNA 3SV3A 2P1JA 3DLEA 2Y1IA 1T8EA 2RPIA 4C8LA 2ZD1A 1BL3A 3NFAA 3KK1A 4AHVA 2O4GA 3ZT4A 3VA0A 4C8OA 4FK4A 1BIZA 1RTJA 1KVAA 3LPTA 3LP0A 4HUFA 1YTAA 3NGZA 4KHYA 2HHXA 1G15A 1RT2A 4CJLA 1N5YA 4FZYA 1JLFA 4NCAA 1LWCA 1SL2A 2XY6A 4DSKA 5FDLA 4CFCA 1FXXA 1VSHA 1DLOA 3PX6A 3BDPA 4OVLA 3ULDA 3AVGA 2ZQBA 2YNFA 5HRSA 3NH0A 1WAJA 4CGJA 2ZE2A 2E6MA 3QEWA 4CK1A 4H4MA 1RTDA 1NKCA 1Z25A 4W5QA 3G0ZA 3LZIA 4AHRA 2ETJA 5FRMA 3LPUA 5C24A 2XRIA 4UQGA 4Z4IA 1RDBA 1VRTA 5CYQA 3VQ6A 1XWLA 4KPYA 4PQUA 1K6YA 4FJGA 1UOCA 3AO5A 3VQCA 4B8CA 3K57A 4C8MA 4FW2A 1KLMA 3IRXA 3SPYA 1XI1A 4DMNA 2AJQA 1BGXT 1C0MA 3DRSA 4NYNA 2QKKA 4FJ8A 4CERA 1RBTA 4KTWA 3RMCA 4CHQA 3FFIA 1WSHA 4QAGA 4I9LA 4FLYA 2EX3A 4DU3A 4LSLA 4DTPA 1X9SA 2BDPA 3ZSZA 5HRPA 2O4IA 3MECA 4DG1A 3RMAA 1QS4A 3VQ7A 3SNNA 5HLFA 1WSGA 3DRPA 3HT3A 4BE1A 2VWKA 3U6FA 1NK7A 1X9WA 3AVJA 1BHLA 3DLKA 3NHGA 4OJRA 3S3NA 2LSNA 3ZT1A 1TL3A 5E41A 4KHUA 4FJ5A 2NUBA 3DLBA 3VQ8A 4N5SA 3HM9A 3TWHA 2HHUA 2G8FA 2B6AA 2X6NA 3LP2A 3QESA 3OYLA 1EXQA 4JRQA 1NKBA 3PO4A 3NGYA 4KB1A 5K14A 2G8HA 1I39A 2RF2A 3VQPA 3THVA 3EY1A 4FZZA 3VQBA 3VA3A 1J9AA 4Z4CA 3DLGA 3V1RA 1ASWA 1VSKA 2FBXA 4IG3A 4CHNA 4B9VA 4M41A 1DTTA 3VQAA 1HYZA 1LW0A 1A5WA 1C6VA 1RBUA 1S6PA 1BCOA 3LAKA 4OPKA 3OYIA 3KLFA 3SQ4A 2OPQA 2G8VA 4KHWA 3RRHA 1RT6A 1U49A 1RDCA 3CG7A 2IOCA 4JS5A 1NK8A 4BE2A 3QLHA 3UIQA 3ZSVA 1N6QA 2Z1HA 3DLHA 4CF9A 4CHYA 3LWMA 2QKBA 1HMVA 4Q5VA 3P83D 4OPJA 1FKOA 2F8SA 5HBMA 4NYFA 3S9HA 3TAQA 3WNFA 4DU1A 1HQEA 4HUEA 4CF1A 1SUQA 4OGCA 1XC9A 4CHPA 1Y97A 1RNHA 3AA3A 4Y1CA 4DTJA 4CEZA 4J2AA 3HP6A 1NK0A 4J2DA 4YFUA 1TKXA 4J2BA 1LWEA 1C0TA 2GUIA 4BDZA 2KW4A 1S1UA 4FM1A 4FZXC 2KZMA 1ZBFA 1REVA 2DFEA 5KGXA 4AHSA 4W5RA 1EKEA 4F3OA 1W0HA 1VSMA 5KGWA 3IG1A 4BWMA 4B3OA 3KTQA 4O5BA 2DFHA 4DU4A 3LANA 4DSLA 1O1WA 3OS2A 2OPSA 1KRPA 4ELUA 1HRHA 3SQ2A 4FJ7A 4FLUA 1U04A 1RT1A 4DTOA 4FK2A 3CM5A 4FM2A 1WSJA 3RMBA 5HP1A 1GOCA 3SUQA 2G8KA 1IH7A 1TAUA 2HW3A 4F8RA 5DMRA 4CGHA 1I3AA 2YNIA 4DFJA 4F2SA 3M8RA 2P5OA 4OKJA 4XIUA 4DTNA 3HPHA 3QINA 3ZT2A 3P5JA 1S9GA 3SUPA 3TR8A 4CECA 4FYDA 5KI6A 1S1VA 2VWJA 2PY5A 5CYMA 4FCYA 4CJ3A 4DS5A 1TAQA 3V9ZA 1KCFA 4FVMA 5FROA 4IFYA 4N76A 1HPZA 3DM2A 3QIOA 1JKHA 5KRTA 3L8BA 3LP1A 3LZJA 3OYKA 1ZBUA 3ZT0A 4OLBA 1L3SA 4IBNA 4DQRA 4LH4A 3M8PA 4CJSA 3AVBA 1VSIA 3MXJA 2E6LA 3BGRA 4CESA 5C25A 3CQ8A 4QOZB 3S3MA 2KFNA 4CK3A 4E7JA 1BCMA 4B9NA 3QERA 5I3UA 3OYNA 1ZYQA 4B9UA 3WNEA 3NF7A 1L3UA 2YKMA 4FLTA 2Z1IA 3H08A 3VQQA 1TGOA 2JGUA 1QSSA 1TK8A 4DQIA 3OJUA 4CIEA 4DTUA 4AILC 3TAPA 4FJNA 2WOMA 1NK9A 4KREA 1C0UA 2B4JA 3V6DA 3NH2A 2IDOA 3DI6A 4DSFA 4ID1A 2OZSA 3MEDA 4F3TA 4BWJA 3HVRA 4GW6A 3T3FA 3RR7A 5J2QA 2F96A 2P51A 4CF0A 1B9FA 5FRNA 1VSEA 4N47A 4OGEA 2OA8A 4AHUA 4Z4EA 1CZ9A 5J1EA 3MAQA 3OS0A 1EP4A 1LAVA 3QIPA 1B92A 2HNYA 3LAMA 4NCGA 4RW7A 3WNGA 4B08A 2HHSA 1WSIA 4LH5A 3KJVA 1ZBLA 3V1OA 4CJEA 1NJWA 4CJKA 4PUOA 1HJRA 5J2MA 1XHXA 1RT7A 1W9HA 4DLEA 3HO1A 4CJVA 3LP3A 3DRRA 3RWUA 1B9DA 2IGIA 1XHZA 1Q8IA 2IS3A 3L2UA 3D45A 5KRSA 1BQNA 2E4LA 3EYZA 3OYJA 3B6PA 2BANA 2Q3SA 5C42A 4FLZA 3O3FA 4LY7A 2G8WA 2GV9A 1CLQA 2W42A 4MFBA 4DTSA 4PWDA 2HHQA 3SQ0A 4ID5A 3TI0A 2HHWA 3JYTA 2EHGA 1CZBA 1D9DA 3KLIA 4Q0BA 3T1AA 1RT4A 4C8NA 4E7KA 3SPZA 1D8YA 4KAZA 4KO0A 3NF8A 1Q9XA 3RR8A 4CK2A 2G8UA 3ALYA 3AVKA 4KKOA 3NGIA 1VSFA 3OYFA 3RMDA 1RDDA 4CJWA 3SUOA 3DOKA 1RBSA 4ICLA 3AO4A 3CM6A 4DTXA 2PYLA 2Z1JA 1BIUA 3ZSYA 2X74A 3K58A 4W5NA 1RILA 2OYQA 3MXIA 1D9FA 1QHTA 1UAXA 2KQ2A 4CEBA 3MEEA 1KFSA 2VG6A 1JLQA 1X1PA 4CF8A 4E7IA 2XY7A 1LWFA 3K5MA 3ZSRA 1HYVA 2IAJA 3KIOA 1L3VA 3KLEA 3KD5E 4HUGA 4HCCA 2KFZA 4DLGA 4LD0A 1IKXA 5JS2A 4CGGA 1KVBA 2VG7A 2KZZA 1RDAA 4K8XA 2RKIA 3OYAA 1VSLA 1SKRA 3K5LA 3VQDA 3S3OA 1T03A 4CHZA 4DSIA 4M3WA 1QTMA 3OYGA 3DYAA 4I2PA 3O4QA 1VSDA 1JLEA 3L3VA 1S9EA 1TL1A 3HSTB 1X9MA 3L2VA 4HCBA 2DY4A 5DK5A 1JXEA 4OKKA 3ISNC 1U47A 4IG0A 4CEQA 2G8IA 3AO3A 4KV8A 4HHTA 2YKNA 3IAYA 3HK2A 2HVIA 3PX0A 3PX4A 3OYEA 3TAFA 3NAEA 3RTVA 4L8RB 3LDSA 3CYMA 1FK9A 3SYZA 4F2RA 4O44A 4CEFA 3D0PA 1GOBA 1CXQA 1J53A 2DFFA 1NOYA 2QXFA 4FLVA 4N41A 1ITGA 1WSFA 4OLAA 4M3UA 4CFAA 4RW6A 4FJ9A 4CJ4A 3QO9A 3VQ4A 2P5GA 4FJJA 1RTHA 1WAFA 3NCIA 4RW8A 3TAGA 4Z4HA 3QEXA 3OYDA 3O3HA 3RRGA 2F8TA 3KD1E 4ELTA 1GOAA 3CFRA 1TKDA 3I0SA 3K59A 3AV9A 4BDPA 4DQPA 2OZMA 4KI6A 2QK9A 1S1WA 4RG8A 4DFMA 3OY9A 1LV5A 4CHOA 4DFPA 1JL2A 4FJLA 4R5PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JS4 A;  2D0A A;  3HYF A;  4CJR A;  1KTQ A;  2HHT A;  1NK4 A;  1RCH A;  3VQ5 A;  1WN7 A;  1JLC A;  3HL8 A;  3DOL A;  3ZT3 A;  3NE6 A;  4HTU A;  1U4B A;  3F9K A;  1VRU A;  3OJS A;  1LAW A;  2D5R A;  4M3R A;  4O0I A;  1R0A A;  2HHV A;  1FKP A;  3ZCM A;  4I7F A;  3OYB A;  4KHN A;  3MXM A;  4C8K A;  1UA1 A;  2YHA A;  4CJT A;  3U3Y A;  1L5U A;  2ATQ A;  4B9M A;  1IKW A;  4FJM A;  3AVA A;  3IS9 A;  4CJP A;  4E1N A;  3HVT A;  4KHQ A;  4PA1 A;  4ZTF A;  2DTU A;  1TKZ A;  4CJQ A;  1F21 A;  1UWB A;  2A1S A;  4O55 A;  4CIG A;  2B5J A;  3I8D A;  3QNO A;  1A5X A;  1JL1 A;  3L3U A;  3C95 A;  1YT3 A;  4BAC A;  3SZ2 A;  3V9X A;  1ZBH A;  3V9S A;  2D0C A;  2X6S A;  2XY8 A;  4KB0 A;  1IO2 A;  4LSN A;  4AHC A;  4AHT A;  4E3S A;  4PY5 A;  2YV0 X;  5CY4 A;  4J2E A;  3QEP A;  2GBZ A;  4KTZ A;  3V9U A;  4E7H A;  4B9L A;  4EZ9 A;  1QSY A;  3SCX A;  1T05 A;  5HRO A;  2Z1G A;  4GMJ B;  2PYJ A;  3C94 A;  3KKS A;  3MEG A;  3B6O A;  2D0B A;  3AVF A;  1JLB A;  3O4N A;  4E0D A;  3JSM A;  5EU7 A;  3PY8 A;  2R7Y A;  4FJX A;  1RBR A;  3OS1 A;  2BE2 A;  4OKE A;  4W5T A;  3A2F A;  3AVC A;  1TKT A;  4CIF A;  3OYH A;  4B9S A;  4HVJ A;  3F73 A;  3K5N A;  4Y1D A;  4DF4 A;  4FM0 A;  1T7P A;  5JS1 A;  4MQ3 A;  1TK0 A;  1WNS A;  3ZSQ A;  2XO7 A;  4CEA A;  2XHB A;  1Q9Y A;  4FJI A;  4DF8 A;  4I2Q A;  1KSP A;  2A1R A;  1KFD A;  1VK0 A;  1YVU A;  2HB5 A;  3ZSO A;  4ZTJ A;  5D3G A;  1JXB A;  1S6Q A;  3QEI A;  1L3T A;  1HYS A;  3SJJ A;  2HVH A;  4E19 A;  1TVR A;  3SQ1 A;  1EET A;  4JRP A;  4IKF A;  3DLR A;  4E1M A;  1JLG A;  3TAB A;  4IDK A;  1KVC A;  2Y1J A;  1D5A A;  1C1B A;  5J2P A;  1C1A A;  4GVM A;  3AVH A;  2OPP A;  3E01 A;  2YNG A;  3K2P A;  3TAR A;  3O3G A;  3EZ5 A;  1TK5 A;  3NBP A;  4F4K A;  4JLH A;  3AA5 X;  3LAL A;  3HXM A;  4DS4 A;  4M3Z A;  4FW1 A;  4DSJ A;  4EP5 A;  4BDY A;  3ZSX A;  4FJK A;  4KTQ A;  4KI4 A;  3DMJ A;  3OYC A;  1KLN A;  4M3X A;  5SWM A;  1YTU A;  5HRN A;  1ASU A;  3V81 A;  4Z4F A;  3P1G A;  2JLE A;  3PUF A;  1WSE A;  1QQC A;  4CGI A;  4DFK A;  3KLH A;  1BQM A;  4CGF A;  4E89 A;  1J5O A;  4E7L A;  2IC3 A;  3M8S A;  3QEV A;  3AVN A;  1TV6 A;  3AVL A;  1SV5 A;  1HNI A;  1EX4 A;  1QE1 A;  1BI4 A;  4DQQ A;  3L2Q A;  3ITH A;  3SV4 A;  4H8K A;  3HJF A;  1MU2 A;  2HNZ A;  5CZ2 A;  4CED A;  3ZSW A;  4DTR A;  1WLJ A;  1UA0 A;  1U45 A;  3ASM A;  5SZT A;  2HND A;  4KFB A;  3OYM A;  3C6U A;  4CEE A;  1SL0 A;  3WNH A;  3C6T A;  1SL1 A;  4M45 A;  3PO5 A;  1NK5 A;  4WE1 A;  4EZ6 A;  3V4I A;  4TSX A;  3AVI A;  4BE0 A;  4CEO A;  3LWL A;  4DQS A;  4NCB A;  2I5J A;  3AVM A;  3CFO A;  1ASV A;  3VQE A;  2FBV A;  4ZHR A;  5HRR A;  2VG5 A;  3CFP A;  2XY5 A;  2FC0 A;  4B8A B;  1IG9 A;  4M3Y A;  3NF6 A;  4G1Q A;  4CE9 A;  4FLX A;  3AA4 A;  4CCH A;  3KLG A;  4FLW A;  4DTM A;  3U3G A;  4W5O A;  3VQ9 A;  1HNV A;  1J54 A;  1NJX A;  3SUN A;  4KHS A;  4YNQ A;  1S1T A;  2OPR A;  3NH1 A;  4DSE A;  4CJ5 A;  3KK3 A;  4IFV A;  3AO1 A;  1NK6 A;  5T7B A;  1DTQ A;  2PZS A;  3HPG A;  1Z26 A;  1C1C A;  1BIS A;  2X78 A;  4RW9 A;  4Z0U A;  1LW2 A;  4M3T A;  3L2R A;  4O4G A;  4H4O A;  2YHB A;  4CJF A;  4DWI A;  2BGG A;  4AH9 A;  4CF2 A;  3TAN A;  1SKW A;  2KTQ A;  3NDK A;  4B9T A;  4RW4 A;  1IKV A;  1NJY A;  2RN2 A;  3K5O A;  3NF9 A;  5CZ1 A;  3QNN A;  2WON A;  2FBT A;  3PV8 A;  2HMI A;  1S5J A;  1RT3 A;  3M8Q A;  1RTI A;  4I9Q A;  1VSJ A;  3L2W A;  1NJZ A;  5J2N A;  1SKS A;  3V9W A;  1CXU A;  1U48 A;  3I0R A;  3HPO A;  3G10 A;  3V1Q A;  3QET A;  4CFB A;  2FBY A;  1RT5 A;  1QSL A;  4K8Z A;  4O0J A;  3T19 A;  4CJU A;  3AO2 A;  2ITG A;  3AA2 A;  4CGD A;  3KK2 A;  1NKE A;  4FXD A;  4ELV A;  3TAM A;  4KRF A;  4CFD A;  1HQU A;  3HP9 A;  1BI4 B;  3KKR A;  5KTQ A;  5I42 A;  3SI6 A;  1A5V A;  4N56 A;  4FK0 A;  1RBV A;  1S1X A;  2YNH A;  4EP4 A;  1NOZ A;  4M42 A;  1ZBI A;  4QCL A;  4FJH A;  4Z4G A;  3TAE A;  1IKY A;  3VN5 A;  1JLA A;  3OVN A;  3SV3 A;  2P1J A;  3DLE A;  2Y1I A;  1T8E A;  2RPI A;  4C8L A;  2ZD1 A;  1BL3 A;  3NFA A;  3KK1 A;  4AHV A;  2O4G A;  3ZT4 A;  3VA0 A;  4C8O A;  4FK4 A;  1BIZ A;  1RTJ A;  1KVA A;  3LPT A;  3LP0 A;  4HUF A;  1YTA A;  3NGZ A;  4KHY A;  2HHX A;  1G15 A;  1RT2 A;  4CJL A;  1N5Y A;  4FZY A;  1JLF A;  4NCA A;  1LWC A;  1SL2 A;  2XY6 A;  4DSK A;  5FDL A;  4CFC A;  1FXX A;  1VSH A;  1DLO A;  3PX6 A;  3BDP A;  4OVL A;  3ULD A;  3AVG A;  2ZQB A;  2YNF A;  5HRS A;  3NH0 A;  1WAJ A;  4CGJ A;  2ZE2 A;  2E6M A;  3QEW A;  4CK1 A;  4H4M A;  1RTD A;  1NKC A;  1Z25 A;  4W5Q A;  3G0Z A;  3LZI A;  4AHR A;  2ETJ A;  5FRM A;  3LPU A;  5C24 A;  2XRI A;  4UQG A;  4Z4I A;  1RDB A;  1VRT A;  5CYQ A;  3VQ6 A;  1XWL A;  4KPY A;  4PQU A;  1K6Y A;  4FJG A;  1UOC A;  3AO5 A;  3VQC A;  4B8C A;  3K57 A;  4C8M A;  4FW2 A;  1KLM A;  3IRX A;  3SPY A;  1XI1 A;  4DMN A;  2AJQ A;  1BGX T;  1C0M A;  3DRS A;  4NYN A;  2QKK A;  4FJ8 A;  4CER A;  1RBT A;  4KTW A;  3RMC A;  4CHQ A;  3FFI A;  1WSH A;  4QAG A;  4I9L A;  4FLY A;  2EX3 A;  4DU3 A;  4LSL A;  4DTP A;  1X9S A;  2BDP A;  3ZSZ A;  5HRP A;  2O4I A;  3MEC A;  4DG1 A;  3RMA A;  1QS4 A;  3VQ7 A;  3SNN A;  5HLF A;  1WSG A;  3DRP A;  3HT3 A;  4BE1 A;  2VWK A;  3U6F A;  1NK7 A;  1X9W A;  3AVJ A;  1BHL A;  3DLK A;  3NHG A;  4OJR A;  3S3N A;  2LSN A;  3ZT1 A;  1TL3 A;  5E41 A;  4KHU A;  4FJ5 A;  2NUB A;  3DLB A;  3VQ8 A;  4N5S A;  3HM9 A;  3TWH A;  2HHU A;  2G8F A;  2B6A A;  2X6N A;  3LP2 A;  3QES A;  3OYL A;  1EXQ A;  4JRQ A;  1NKB A;  3PO4 A;  3NGY A;  4KB1 A;  5K14 A;  2G8H A;  1I39 A;  2RF2 A;  3VQP A;  3THV A;  3EY1 A;  4FZZ A;  3VQB A;  3VA3 A;  1J9A A;  4Z4C A;  3DLG A;  3V1R A;  1ASW A;  1VSK A;  2FBX A;  4IG3 A;  4CHN A;  4B9V A;  4M41 A;  1DTT A;  3VQA A;  1HYZ A;  1LW0 A;  1A5W A;  1C6V A;  1RBU A;  1S6P A;  1BCO A;  3LAK A;  4OPK A;  3OYI A;  3KLF A;  3SQ4 A;  2OPQ A;  2G8V A;  4KHW A;  3RRH A;  1RT6 A;  1U49 A;  1RDC A;  3CG7 A;  2IOC A;  4JS5 A;  1NK8 A;  4BE2 A;  3QLH A;  3UIQ A;  3ZSV A;  1N6Q A;  2Z1H A;  3DLH A;  4CF9 A;  4CHY A;  3LWM A;  2QKB A;  1HMV A;  4Q5V A;  3P83 D;  4OPJ A;  1FKO A;  2F8S A;  5HBM A;  4NYF A;  3S9H A;  3TAQ A;  3WNF A;  4DU1 A;  1HQE A;  4HUE A;  4CF1 A;  1SUQ A;  4OGC A;  1XC9 A;  4CHP A;  1Y97 A;  1RNH A;  3AA3 A;  4Y1C A;  4DTJ A;  4CEZ A;  4J2A A;  3HP6 A;  1NK0 A;  4J2D A;  4YFU A;  1TKX A;  4J2B A;  1LWE A;  1C0T A;  2GUI A;  4BDZ A;  2KW4 A;  1S1U A;  4FM1 A;  4FZX C;  2KZM A;  1ZBF A;  1REV A;  2DFE A;  5KGX A;  4AHS A;  4W5R A;  1EKE A;  4F3O A;  1W0H A;  1VSM A;  5KGW A;  3IG1 A;  4BWM A;  4B3O A;  3KTQ A;  4O5B A;  2DFH A;  4DU4 A;  3LAN A;  4DSL A;  1O1W A;  3OS2 A;  2OPS A;  1KRP A;  4ELU A;  1HRH A;  3SQ2 A;  4FJ7 A;  4FLU A;  1U04 A;  1RT1 A;  4DTO A;  4FK2 A;  3CM5 A;  4FM2 A;  1WSJ A;  3RMB A;  5HP1 A;  1GOC A;  3SUQ A;  2G8K A;  1IH7 A;  1TAU A;  2HW3 A;  4F8R A;  5DMR A;  4CGH A;  1I3A A;  2YNI A;  4DFJ A;  4F2S A;  3M8R A;  2P5O A;  4OKJ A;  4XIU A;  4DTN A;  3HPH A;  3QIN A;  3ZT2 A;  3P5J A;  1S9G A;  3SUP A;  3TR8 A;  4CEC A;  4FYD A;  5KI6 A;  1S1V A;  2VWJ A;  2PY5 A;  5CYM A;  4FCY A;  4CJ3 A;  4DS5 A;  1TAQ A;  3V9Z A;  1KCF A;  4FVM A;  5FRO A;  4IFY A;  4N76 A;  1HPZ A;  3DM2 A;  3QIO A;  1JKH A;  5KRT A;  3L8B A;  3LP1 A;  3LZJ A;  3OYK A;  1ZBU A;  3ZT0 A;  4OLB A;  1L3S A;  4IBN A;  4DQR A;  4LH4 A;  3M8P A;  4CJS A;  3AVB A;  1VSI A;  3MXJ A;  2E6L A;  3BGR A;  4CES A;  5C25 A;  3CQ8 A;  4QOZ B;  3S3M A;  2KFN A;  4CK3 A;  4E7J A;  1BCM A;  4B9N A;  3QER A;  5I3U A;  3OYN A;  1ZYQ A;  4B9U A;  3WNE A;  3NF7 A;  1L3U A;  2YKM A;  4FLT A;  2Z1I A;  3H08 A;  3VQQ A;  1TGO A;  2JGU A;  1QSS A;  1TK8 A;  4DQI A;  3OJU A;  4CIE A;  4DTU A;  4AIL C;  3TAP A;  4FJN A;  2WOM A;  1NK9 A;  4KRE A;  1C0U A;  2B4J A;  3V6D A;  3NH2 A;  2IDO A;  3DI6 A;  4DSF A;  4ID1 A;  2OZS A;  3MED A;  4F3T A;  4BWJ A;  3HVR A;  4GW6 A;  3T3F A;  3RR7 A;  5J2Q A;  2F96 A;  2P51 A;  4CF0 A;  1B9F A;  5FRN A;  1VSE A;  4N47 A;  4OGE A;  2OA8 A;  4AHU A;  4Z4E A;  1CZ9 A;  5J1E A;  3MAQ A;  3OS0 A;  1EP4 A;  1LAV A;  3QIP A;  1B92 A;  2HNY A;  3LAM A;  4NCG A;  4RW7 A;  3WNG A;  4B08 A;  2HHS A;  1WSI A;  4LH5 A;  3KJV A;  1ZBL A;  3V1O A;  4CJE A;  1NJW A;  4CJK A;  4PUO A;  1HJR A;  5J2M A;  1XHX A;  1RT7 A;  1W9H A;  4DLE A;  3HO1 A;  4CJV A;  3LP3 A;  3DRR A;  3RWU A;  1B9D A;  2IGI A;  1XHZ A;  1Q8I A;  2IS3 A;  3L2U A;  3D45 A;  5KRS A;  1BQN A;  2E4L A;  3EYZ A;  3OYJ A;  3B6P A;  2BAN A;  2Q3S A;  5C42 A;  4FLZ A;  3O3F A;  4LY7 A;  2G8W A;  2GV9 A;  1CLQ A;  2W42 A;  4MFB A;  4DTS A;  4PWD A;  2HHQ A;  3SQ0 A;  4ID5 A;  3TI0 A;  2HHW A;  3JYT A;  2EHG A;  1CZB A;  1D9D A;  3KLI A;  4Q0B A;  3T1A A;  1RT4 A;  4C8N A;  4E7K A;  3SPZ A;  1D8Y A;  4KAZ A;  4KO0 A;  3NF8 A;  1Q9X A;  3RR8 A;  4CK2 A;  2G8U A;  3ALY A;  3AVK A;  4KKO A;  3NGI A;  1VSF A;  3OYF A;  3RMD A;  1RDD A;  4CJW A;  3SUO A;  3DOK A;  1RBS A;  4ICL A;  3AO4 A;  3CM6 A;  4DTX A;  2PYL A;  2Z1J A;  1BIU A;  3ZSY A;  2X74 A;  3K58 A;  4W5N A;  1RIL A;  2OYQ A;  3MXI A;  1D9F A;  1QHT A;  1UAX A;  2KQ2 A;  4CEB A;  3MEE A;  1KFS A;  2VG6 A;  1JLQ A;  1X1P A;  4CF8 A;  4E7I A;  2XY7 A;  1LWF A;  3K5M A;  3ZSR A;  1HYV A;  2IAJ A;  3KIO A;  1L3V A;  3KLE A;  3KD5 E;  4HUG A;  4HCC A;  2KFZ A;  4DLG A;  4LD0 A;  1IKX A;  5JS2 A;  4CGG A;  1KVB A;  2VG7 A;  2KZZ A;  1RDA A;  4K8X A;  2RKI A;  3OYA A;  1VSL A;  1SKR A;  3K5L A;  3VQD A;  3S3O A;  1T03 A;  4CHZ A;  4DSI A;  4M3W A;  1QTM A;  3OYG A;  3DYA A;  4I2P A;  3O4Q A;  1VSD A;  1JLE A;  3L3V A;  1S9E A;  1TL1 A;  3HST B;  1X9M A;  3L2V A;  4HCB A;  2DY4 A;  5DK5 A;  1JXE A;  4OKK A;  3ISN C;  1U47 A;  4IG0 A;  4CEQ A;  2G8I A;  3AO3 A;  4KV8 A;  4HHT A;  2YKN A;  3IAY A;  3HK2 A;  2HVI A;  3PX0 A;  3PX4 A;  3OYE A;  3TAF A;  3NAE A;  3RTV A;  4L8R B;  3LDS A;  3CYM A;  1FK9 A;  3SYZ A;  4F2R A;  4O44 A;  4CEF A;  3D0P A;  1GOB A;  1CXQ A;  1J53 A;  2DFF A;  1NOY A;  2QXF A;  4FLV A;  4N41 A;  1ITG A;  1WSF A;  4OLA A;  4M3U A;  4CFA A;  4RW6 A;  4FJ9 A;  4CJ4 A;  3QO9 A;  3VQ4 A;  2P5G A;  4FJJ A;  1RTH A;  1WAF A;  3NCI A;  4RW8 A;  3TAG A;  4Z4H A;  3QEX A;  3OYD A;  3O3H A;  3RRG A;  2F8T A;  3KD1 E;  4ELT A;  1GOA A;  3CFR A;  1TKD A;  3I0S A;  3K59 A;  3AV9 A;  4BDP A;  4DQP A;  2OZM A;  4KI6 A;  2QK9 A;  1S1W A;  4RG8 A;  4DFM A;  3OY9 A;  1LV5 A;  4CHO A;  4DFP A;  1JL2 A;  4FJL A;  4R5P A; 
#chains in the Genus database with same CATH topology
 1U2V B;  2D0A A;  3R9P A;  5BR9 A;  3BY5 A;  3VQ5 A;  3ZT3 A;  2I7N A;  3F9K A;  4DV1 K;  2D5R A;  4XH5 A;  3ATU A;  1FKP A;  3OYB A;  5IWA K;  4C8K A;  2HST A;  3CMA N;  4ZTF A;  2A41 A;  3T69 A;  3SZ2 A;  3L3U A;  3C95 A;  3V9X A;  2WFB A;  5AQZ A;  4KB0 A;  2P9P A;  1K9M O;  4LSN A;  2GBZ A;  3G25 A;  4CI6 A;  3E66 A;  5HRO A;  4JHD B;  2PYJ A;  3KKS A;  3I33 A;  4DUY K;  3AVF A;  1BOT O;  5C2D A;  2P9L B;  2R7Y A;  4PKI A;  3O9Q A;  3A2F A;  3AVC A;  1TKT A;  3L6Q A;  4K43 A;  4FM0 A;  1T7P A;  1WNS A;  4KHP K;  4H0T B;  4FJI A;  3EN9 A;  3P38 A;  4B1U B;  1N8R O;  1KSP A;  5FLX O;  4ZTJ A;  2NLX A;  5D3G A;  5LMU K;  1S6Q A;  1L3T A;  2HVH A;  3C0B A;  3BEX A;  3IMX A;  2GWJ A;  5MLC Q;  1VQ8 N;  3TAR A;  5BRH A;  1C0F A;  3NBP A;  3HXM A;  4M3Z A;  4FW1 A;  4DSJ A;  3ZSX A;  3L4Q A;  4KTQ A;  1JCE A;  3HI0 A;  1KLN A;  1VQ5 N;  4M3X A;  5SWM A;  1YTU A;  1ASU A;  4JKC A;  3P1G A;  3VPZ A;  3PUF A;  1QQC A;  2E2P A;  1BQM A;  3WQU A;  4CGF A;  4DR2 K;  2E2O A;  1EX4 A;  1K8K B;  4CW7 B;  1V4S A;  1MU2 A;  5CZ2 A;  1KC8 O;  4YOT A;  2HND A;  4KFB A;  5SZT A;  3OYM A;  3C6T A;  1NK5 A;  2E5L K;  1LCU A;  4EZ6 A;  4FOI A;  3AVI A;  2IVN A;  4DQS A;  4NCB A;  2I5J A;  1ASV A;  5AFU H;  1IG9 A;  4M3Y A;  4CE9 A;  2WBN A;  4JKD A;  3AA4 A;  4FLW A;  4DTM A;  4W5O A;  3SUN A;  3NVK A;  1NLV A;  4DSE A;  4CJ5 A;  2PZS A;  1Z26 A;  4I6M A;  4LF6 K;  4H4O A;  2YHB A;  4DWI A;  3TAN A;  1SKW A;  1IKV A;  4BQL A;  3NF9 A;  4QS7 A;  5BPN A;  2WON A;  2FBT A;  3PV8 A;  4CZG A;  2HMI A;  1RT3 A;  1P90 A;  5JVG L;  3L2W A;  3SBT A;  5J2N A;  2DPN A;  4JYA K;  1NGF A;  3FR0 A;  4WQ5 C;  1RT5 A;  5JLH A;  4O0J A;  4YOV A;  4CJU A;  2VQE K;  3AO2 A;  3KK2 A;  3LDQ A;  4JD2 B;  3KKR A;  5AJ3 K;  1RBV A;  2NRZ A;  4NLC A;  4EP4 A;  4JKH A;  1R59 O;  4M42 A;  4FJH A;  2OTL N;  5TKW A;  5BRD A;  1HPM A;  1ATN A;  3PSI A;  2P1J A;  3DXK B;  2Y1I A;  1ATR A;  3KK1 A;  1BG3 A;  4AHV A;  4EAH D;  3VA0 A;  5AQJ A;  3VTH A;  1YTA A;  3K9K A;  1FW6 A;  1G15 A;  1RT2 A;  4CJL A;  4FZY A;  4NCA A;  2NRW A;  1LWC A;  1SS6 A;  4FL9 A;  4ILH A;  5FDL A;  1FXX A;  4OVL A;  2ZQB A;  4CGJ A;  4CK1 A;  4JI4 K;  3PIO L;  3MWP A;  1BWF O;  3LZI A;  2QWP A;  3LPU A;  4YOU A;  1RDB A;  1VRT A;  5JLF A;  3VQ6 A;  4KPY A;  2Q2R A;  1K6Y A;  2P9U B;  3K57 A;  1QVF M;  1KRP A;  4CZL A;  4C8M A;  1XI1 A;  3IRX A;  1BGX T;  2ZJP L;  4CER A;  1RBT A;  5BPM A;  4U7B A;  3FFI A;  3BP8 A;  4QAG A;  3OW2 M;  1YI2 N;  4I9L A;  4DTP A;  1KAX A;  3RMA A;  3U6F A;  4WQ4 A;  2UXD K;  3NHG A;  3S3N A;  3DLK A;  2HF4 A;  2YHX A;  4OJR A;  4JKF A;  4FJ5 A;  3HM9 A;  1NBW A;  4MDA A;  1IJJ A;  5AQP A;  4BRG A;  3LP2 A;  1NMD A;  1EXQ A;  3PO4 A;  3MN9 A;  2CH5 A;  3NGY A;  1HUX A;  3EY1 A;  4BRH A;  4A62 A;  4BRN A;  4B9V A;  1E4G T;  3VQA A;  1Q86 O;  1HYZ A;  1LW0 A;  1A5W A;  1RBU A;  3LAK A;  2G8V A;  3CJ7 A;  3RRH A;  1QQN A;  4JS5 A;  2IOC A;  4JV5 K;  1NK8 A;  4YDU C;  4QS8 A;  3VOV A;  3CET A;  3ZSV A;  4BQZ A;  1N6Q A;  3DLH A;  3THX B;  4OPJ A;  1FKO A;  5HBM A;  4NYF A;  2F4V K;  3TAQ A;  1HQE A;  1DKG D;  4HUE A;  4CF1 A;  1SUQ A;  4Y1C A;  1HR0 K;  5C10 A;  4YFU A;  1TKX A;  4J2B A;  4DV0 K;  1C0T A;  2GUI A;  1S1U A;  3H1V X;  3UE5 A;  4FZX C;  5LMN K;  2H3G X;  2KZM A;  1ZBF A;  4BRF A;  5KGX A;  4W5R A;  1EKE A;  4BC2 A;  1W0H A;  2CGL A;  5KGW A;  3TTC A;  4B3O A;  3CQY A;  3QFU A;  1O1W A;  4IXC A;  1VQ6 N;  3B8A X;  2O8E B;  4DTO A;  3CM5 A;  4FM2 A;  4X64 K;  3RMB A;  5HP1 A;  3J7Y P;  2G8K A;  3H3N O;  4F8R A;  4CGH A;  2P5O A;  2P9S A;  3EE9 A;  4CVN E;  2BUP A;  3SUP A;  3TR8 A;  4CEC A;  5KI6 A;  2YX6 A;  1YXQ A;  1MWM A;  4FCY A;  3CIP A;  4CJ3 A;  4DS5 A;  1TAQ A;  3R6M A;  3O6W A;  1HPZ A;  3OYK A;  1ZBU A;  1L3S A;  4LH4 A;  3M8P A;  1ILY A;  1VSI A;  3BGR A;  3CQ8 A;  4QOZ B;  4CZF A;  1BCM A;  4BVP A;  3VEX A;  2HBK A;  1L3U A;  3QIC A;  2YKM A;  1IBM K;  3H08 A;  5AQQ A;  3RSE B;  4YOR A;  3OJU A;  3A5L C;  1NK9 A;  4DR3 K;  5AZJ B;  4GW6 A;  4CF0 A;  4XH1 A;  1OKJ A;  4AHU A;  2QWQ A;  3CF5 L;  1ZC6 A;  1NGA A;  2HNY A;  4NCG A;  3WNG A;  4BRD A;  1WSI A;  3ID8 A;  3V1O A;  5BRF A;  1NJW A;  2YJF A;  3FZF A;  1KQS M;  2PAV A;  3D45 A;  5KRS A;  2BAN A;  5C42 A;  3O3F A;  4LY7 A;  3LDP A;  4MFB A;  2P9K A;  2HHW A;  4DV4 K;  3WXM B;  1GLC G;  1D8Y A;  3C7N B;  1Q9X A;  4IJA A;  1HLU A;  3AVK A;  4KKO A;  3OYF A;  3RMD A;  1YJN N;  5AQI A;  3ZET B;  2F9T A;  3LL3 A;  2PYL A;  3ENH A;  3CPW M;  3MXI A;  2KQ2 A;  3HTV A;  3K5M A;  5CE3 A;  2IAJ A;  2P9P B;  3U9Z A;  3KIO A;  1L3V A;  1TYQ A;  4HCC A;  5AQX A;  3EEQ A;  3VTI A;  4DLG A;  1W7A A;  1WBD A;  4K8X A;  3O5B A;  3VQD A;  3MN6 A;  3ZX2 A;  3S3O A;  3KWG A;  3OYG A;  3DYA A;  1JLE A;  1S9E A;  3HST B;  1X9M A;  3R1X A;  4HCB A;  1ZXO A;  3JXU A;  4CEQ A;  3CCE N;  3AO3 A;  3VER A;  2YKN A;  4HHT A;  4BGA A;  3PX0 A;  1GLB G;  4WQ5 A;  1FK9 A;  1GLF O;  4ISG A;  4CEF A;  2DFF A;  5AQY A;  1X3N A;  2E1Z A;  2P5G A;  1RTH A;  1Y64 A;  3TAG A;  4DCH A;  2A3Z A;  2FSJ A;  3O3H A;  4ELT A;  1GOA A;  2J4R A;  3CFR A;  3K59 A;  3D2E B;  5F1X A;  4DFM A;  1ESV A;  1LV5 A;  1JL2 A;  2CH6 A;  5M1P A;  3HYF A;  1NK4 A;  3NE6 A;  1U4B A;  3U8X A;  1VQM N;  1IBL K;  4A5A A;  3OJS A;  4O0I A;  2P9N A;  5CR4 A;  5AR0 A;  1L5U A;  4B9M A;  2ATQ A;  3O9U A;  4FJM A;  4CJP A;  4LF5 K;  3HVT A;  1SQK A;  2DTU A;  1TKZ A;  3MWT A;  1F21 A;  4CIG A;  2A1S A;  5KQ8 A;  3HZ6 A;  2D0C A;  2XY8 A;  1WB9 A;  1IO2 A;  1TUY A;  2E2Q A;  3LDO A;  2AP1 A;  4DHY A;  3C94 A;  3B6O A;  2FF6 A;  1JLB A;  5EU7 A;  4OKE A;  3OYH A;  3OBW A;  4HVJ A;  3K5N A;  1YUW A;  3F73 A;  1BDG A;  5JS1 A;  4MQ3 A;  4DF8 A;  3MCA B;  2A1R A;  1YVU A;  2A40 A;  2HBJ A;  4GVE A;  3QEI A;  1HYS A;  4E19 A;  3JS6 A;  3SQ1 A;  5BR8 K;  3THY A;  4CZH A;  3DLR A;  4E1M A;  3TAB A;  4IDK A;  4FSV A;  4IWV A;  3AVH A;  3W0L A;  5AZI B;  4DS4 A;  2CGJ A;  4H5T A;  1J6Z A;  1S3X A;  4KI4 A;  4YDU A;  4LF8 K;  3DMJ A;  3SBG A;  4NXN K;  1KXP A;  4FVU A;  3OYC A;  2WUS A;  2JWK A;  1LOT B;  4DFK A;  3KLH A;  4E89 A;  1NGH A;  4B1Z A;  4WF9 L;  3AVN A;  1HNI A;  4B3M K;  1BI4 A;  5AQL A;  4H8K A;  3HJF A;  3FZH A;  3N4Q A;  4CED A;  3ZSW A;  4DTR A;  1UA0 A;  3T1Y K;  2HBM A;  3C6U A;  4CEE A;  3WNH A;  3PO5 A;  3MDQ A;  1OH8 A;  4DR7 K;  3LWL A;  4DUZ K;  3CFO A;  1YIT N;  2FBV A;  2XY5 A;  5HRR A;  4YY3 K;  3NF6 A;  4G1Q A;  4FLX A;  1YJW N;  4CZI A;  3U3G A;  3VQ9 A;  4XH4 A;  4KHS A;  2OPR A;  5AQT A;  3DLL L;  3KK3 A;  3AO1 A;  1NK6 A;  4BR9 A;  5T7B A;  1DTQ A;  4UY8 O;  3HPG A;  1C1C A;  4Z0U A;  1LW2 A;  4M3T A;  4O4G A;  5KPZ A;  1EQY A;  5C15 A;  4CJF A;  2BGG A;  1NJY A;  5CZ1 A;  2ZJQ L;  1C0G A;  4U67 L;  4BRP A;  3I0R A;  3V1Q A;  1HJO A;  4BC5 A;  2FBY A;  1QSL A;  4K8Z A;  3T19 A;  4ELV A;  4KRF A;  2FSK A;  3SI6 A;  3KVG A;  4C1N I;  3CCL N;  2RE2 A;  2YNH A;  4CJ7 A;  4PKG A;  4Z4G A;  3N4P A;  1W2B M;  3VN5 A;  1JLA A;  3OVN A;  1I94 K;  1T8E A;  2ASP A;  3R3L A;  2RPI A;  4C8L A;  4LC9 B;  1BL3 A;  3NFA A;  4C8O A;  1YF5 L;  5AQG A;  1X3M A;  1ATS A;  5GIO A;  1NNE A;  4KHY A;  1N5Y A;  3EL2 A;  1Z05 A;  1SL2 A;  2A6A A;  2QTD A;  4GV9 A;  3LDL A;  3VF6 A;  3ULD A;  2YNF A;  4PKH A;  5HRS A;  4B9Q A;  4B3R K;  2ZE2 A;  2E6M A;  4H5R A;  5LJV A;  1OH5 A;  3FGU A;  2IIR A;  3G0Z A;  4IEE A;  2GWK A;  2ETJ A;  5FRM A;  2XRI A;  1VQ7 N;  5CYQ A;  3TTD A;  1O13 A;  1UOC A;  3VQC A;  2E2N A;  3AO5 A;  4B8C A;  4FW2 A;  1KLM A;  3DRS A;  2QKK A;  4KTW A;  2E20 A;  2AA4 A;  4OO1 J;  3I55 N;  4IO8 A;  4FLY A;  4LSL A;  3CCJ N;  4FO0 A;  2BDP A;  5HRP A;  4ISE A;  2O4I A;  4DG1 A;  3U4L A;  1QS4 A;  3SNN A;  5AQV A;  3HT3 A;  3DRP A;  2VWK A;  3C65 A;  4KHU A;  4A2B A;  1QQO A;  3VGM A;  2NUB A;  3TWH A;  2A42 A;  2X6N A;  4NB4 A;  1NKB A;  4KB1 A;  1I39 A;  3VQP A;  4IO9 L;  3NMU A;  3RVC A;  2O8D A;  3V1R A;  1XNQ K;  4M41 A;  2QA4 N;  1S6P A;  4GV3 A;  4JI0 K;  1EO1 A;  3OYI A;  3VEV A;  3SQ4 A;  2OPQ A;  2ZGZ A;  3F2K A;  1RDC A;  1HNX K;  5CHI A;  4BRA A;  3EKS A;  3LWM A;  2HMP A;  4KH4 A;  4Q5V A;  3P83 D;  4DU1 A;  3JAM O;  4JKE A;  1XC9 A;  1RNH A;  4MO5 A;  4H5N A;  1MWK A;  4NLB A;  4DV2 K;  4J2D A;  1LWE A;  4FM1 A;  5BRE A;  2KW4 A;  3O80 A;  4AHS A;  1QQM A;  5KPT A;  1VSM A;  3IG1 A;  4WFB L;  4LFC K;  4FWN A;  4DV3 K;  1Q82 O;  3LAN A;  4IOC L;  3E9O A;  3OS2 A;  2FF3 B;  3SQ2 A;  4BRC A;  2QWN A;  4FK2 A;  4RTF D;  3ZEU A;  3ENO A;  3CC2 N;  1K8A O;  1TAU A;  2HW3 A;  2YNI A;  3M8R A;  3WEE A;  4OKJ A;  3HPH A;  3QIN A;  5GAE P;  2VYP A;  5AQM A;  2QW9 A;  3ZLJ A;  4EIA A;  4GV6 A;  3EZW A;  1YJ9 N;  3OHR A;  3DM2 A;  5KRT A;  1FJG K;  3BUZ B;  4CJS A;  1DGK N;  1E4F T;  3MXJ A;  2E6L A;  4FWQ A;  4CES A;  4FWK A;  4BR4 A;  5I3U A;  4K25 A;  1ZYQ A;  1HNW K;  3WNE A;  3NF7 A;  3WXI A;  2Z1I A;  1TGO A;  2JGU A;  1TK8 A;  4DQI A;  4DTU A;  4IDH A;  4CIE A;  3TAP A;  1C0U A;  3NH2 A;  2IDO A;  3DI6 A;  4ID1 A;  4F3T A;  3HVR A;  5BN9 A;  2HOE A;  4B3S K;  2F96 A;  3G6E N;  1B9F A;  4N47 A;  4Z4E A;  3OS0 A;  4JKB A;  4B08 A;  4RW7 A;  1BA1 A;  5DM7 L;  3AAQ A;  1K73 O;  4CJK A;  1XHX A;  4DLE A;  4CJV A;  3RWU A;  1XHZ A;  3W3D A;  3D6R A;  4JKG A;  3THW B;  3LM9 A;  3UKR A;  4JNE A;  1CLQ A;  2HHQ A;  1GLA G;  4ID5 A;  1XUP O;  3K0S A;  1RT4 A;  4C8N A;  4JAX A;  5H1S Q;  3NF8 A;  2PFU A;  3ALY A;  4MDB A;  3NGI A;  3GG4 A;  3SUO A;  4LFB K;  3CM6 A;  1U2V A;  2FLO A;  4W5N A;  2W6K A;  2YI1 A;  2OYQ A;  1D9F A;  1QHT A;  1UAX A;  1X1P A;  4CF8 A;  4E7I A;  2XY7 A;  4BG8 A;  4ILJ A;  1E3M A;  3KD5 E;  5AQS A;  2KFZ A;  2QI2 A;  1IKX A;  5JS2 A;  4BRK A;  1KVB A;  2KZZ A;  1RDA A;  4WFN L;  3OYA A;  1VSL A;  4M63 C;  1T03 A;  1QTM A;  1T6D A;  3O4Q A;  4NXM K;  1SAZ A;  3MX5 A;  3ISN C;  4H0P A;  4FWM A;  4IG0 A;  3HK2 A;  3NAE A;  3CYM A;  4F2R A;  4O44 A;  2YHW A;  1ITG A;  4CFA A;  4FJ9 A;  1VQO N;  1HKG A;  4FJJ A;  4K41 A;  1WAF A;  4ILG B;  4Z4H A;  3OYD A;  2GEL A;  3PSF A;  4KH5 A;  2E8A A;  1NGG A;  4BDP A;  3I0S A;  4KH6 A;  4OX9 K;  3S41 A;  2F9W A;  4CHO A;  4PL8 A;  3DAW A;  5JMV A;  4M7Y A;  5A2Q O;  4JI7 K;  2ASO A;  2HHT A;  4L3Q A;  3CC4 N;  1WN7 A;  1JLC A;  3HL8 A;  1VRU A;  5B8H A;  1LAW A;  2HHV A;  3ZCM A;  1V4T A;  4KHN A;  1N36 K;  3MXM A;  4O8U A;  1UA1 A;  2YHA A;  3U3Y A;  1IKW A;  3AVA A;  3IS9 A;  4CJQ A;  3I8D A;  4BRI A;  4BG9 A;  4AHT A;  4PY5 A;  2YV0 X;  1HKB A;  3QEP A;  3SMS A;  4C1N K;  4E7H A;  4EZ9 A;  1QSY A;  3SCX A;  1T05 A;  2Z1G A;  4GMJ B;  4CZJ A;  3FFK B;  3QBW A;  4WFA L;  4E0D A;  3JSM A;  4FJX A;  3SAG A;  1RBR A;  3OS1 A;  2P9I A;  4DR6 K;  4R79 A;  4CIF A;  4B9S A;  3IFR A;  3AGR A;  4Y1D A;  4JEP A;  4CEA A;  3SMP A;  4I2Q A;  3L4I A;  5FPD A;  3WUH A;  4MLE A;  2IVP A;  3VGL A;  4PHT X;  1TVR A;  3O1W A;  3CJ9 A;  4IOA L;  4IKF A;  1JLG A;  1BUP A;  3SK3 A;  2Y1J A;  1C1B A;  3Q7B A;  1C1A A;  2OPP A;  2YCH A;  1TK5 A;  3O3G A;  3EZ5 A;  3AA5 X;  3WQT A;  2EWS A;  4B1V A;  1EWQ A;  2FXU A;  3MN7 A;  4DQ8 A;  4FPB A;  3O8M A;  4EP5 A;  4BDY A;  4FJK A;  4GKJ K;  5HRN A;  4Z4F A;  2JLE A;  2VGN A;  4A5B A;  2UUA K;  1WSE A;  4CGI A;  3R8E A;  4BR2 A;  1J5O A;  2IC3 A;  3M8S A;  3QEV A;  4FOE A;  4Y0W A;  1SV5 A;  1QE1 A;  3M6G A;  4DQQ A;  3L2Q A;  3SV4 A;  3GDQ A;  4JI2 K;  1VQ9 N;  2ZWH A;  3CCS N;  1RFQ A;  2GX9 A;  1WLJ A;  2OCE A;  1SL1 A;  4M45 A;  1GLD G;  5I9E B;  4BE0 A;  3P4I A;  1Z6R A;  4ZHR A;  4BVO A;  2OTJ N;  5AQN A;  3CFP A;  2FC0 A;  4B8A B;  4MLH A;  4DV7 K;  2OAN A;  4CCH A;  2BTF A;  1KAY A;  2V52 B;  2HHH K;  4LF4 K;  5M1Q A;  4IFV A;  1BIS A;  3UB5 A;  3SLC A;  2KTQ A;  4CF2 A;  3E9P A;  3NDK A;  5EX5 A;  4RW4 A;  4DB3 A;  4FWR A;  3K5O A;  4A57 A;  4KBO A;  1VQK N;  3NVM A;  3WXJ A;  1RTI A;  3ATV A;  5AQK A;  4I9Q A;  1VSJ A;  3F9M A;  1CXU A;  1T3V A;  1N33 K;  4CZE A;  4CFB A;  3G71 N;  2ZJR L;  5LY3 A;  2QWL A;  1NKE A;  3TAM A;  4A59 A;  4CFD A;  1HQU A;  3HP9 A;  2NRT A;  5KTQ A;  1YAG A;  5I42 A;  4N56 A;  3QML A;  5IT9 O;  2O8D B;  3IUC A;  1NOZ A;  4QCL A;  3SV3 A;  3DLE A;  2O8F A;  1YHQ N;  2O4G A;  3ZT4 A;  4A2A A;  4FK4 A;  3VGK A;  3LP0 A;  3DJC A;  1RDU A;  3P31 A;  5JVH L;  1VAZ A;  2XY6 A;  3CME N;  4DSK A;  4CFC A;  3H45 C;  3CHW A;  3M3Z A;  4FWO A;  1T6C A;  3BDP A;  3GE1 A;  4WCE L;  4I6M B;  1NM1 A;  3NH0 A;  1WAJ A;  3QEW A;  3P39 A;  1SZ2 A;  4W5Q A;  1IG8 A;  4AHR A;  3HOT A;  5C24 A;  4UQG A;  4K42 A;  1XWL A;  4FJG A;  5DM6 L;  2NRH A;  3H3O B;  3SPY A;  3FLC O;  3HOS A;  2ITM A;  1X9S A;  2VGM A;  3WEE B;  3ZSZ A;  3MEC A;  2KKZ A;  2W6L A;  3F5T A;  5HLF A;  3ID6 A;  3VEW A;  4BE1 A;  1NK7 A;  2O8E A;  3IDH A;  2LSN A;  1TL3 A;  5E41 A;  3VQ8 A;  5LJW A;  2HHU A;  4B1Y B;  3QES A;  2CGK A;  3OYL A;  5K14 A;  1HNZ K;  2G8H A;  3H46 O;  1U6Z A;  3OBY A;  1OVQ A;  3VQB A;  4MO4 A;  4EHU A;  4JN4 A;  1J9A A;  4Z4C A;  3D7E O;  1ASW A;  1VSK A;  2D0P A;  2FBX A;  4IG3 A;  1DTT A;  2UYT A;  1WOQ A;  1C6V A;  3KLF A;  4FWL A;  3VET A;  3QLH A;  4CF9 A;  5BPL A;  1HMV A;  2F8S A;  3S9H A;  4BR0 A;  2A5X A;  3H1Q A;  1N34 K;  3AA3 A;  4DTJ A;  3HM8 A;  1DEJ A;  1KD1 O;  1RDW X;  2UUB K;  1VQL N;  1X9J A;  5AZJ A;  4OPH A;  3FZM A;  3ZYY X;  4BRQ A;  3KTQ A;  4DU4 A;  2DFH A;  4ELU A;  1HRH A;  4FJ7 A;  3TSQ A;  1U04 A;  4JKG B;  2O8C A;  3SUQ A;  3A5O C;  3DXM A;  4F2S A;  2W41 A;  4XIU A;  1G99 A;  4DTN A;  1JCG A;  1GLJ O;  3ZT2 A;  1M1K O;  3P5J A;  1S9G A;  3CCR N;  1XMQ K;  4FYD A;  1H1V A;  5GIN A;  1NGE A;  2YJE A;  3U9D A;  5AQU A;  1KCF A;  4IFY A;  1P8Z A;  2WC9 A;  3L8B A;  3QIO A;  1JKH A;  3LZJ A;  3LP1 A;  3FZK A;  3ZT0 A;  4OLB A;  4IBN A;  2JWL A;  5F0X A;  3C7N A;  5EOY A;  5C25 A;  3S3M A;  2V51 B;  4CK3 A;  5C12 A;  3QER A;  3IKM A;  3CCV N;  3ZET A;  5KQD A;  3A5M C;  4B9U A;  3FZL A;  1GLL O;  1MDU B;  4FLT A;  3VQQ A;  1BU6 O;  4FWS A;  3TSU A;  4AIL C;  4FJN A;  1WBB A;  2B4J A;  3V6D A;  3MED A;  4O8K A;  2P51 A;  1CZ9 A;  1EP4 A;  3QIP A;  1B92 A;  3LAM A;  4BRL A;  2NRX A;  2HHS A;  4H0X B;  3KJV A;  3KHY A;  4CJE A;  4PUO A;  1HJR A;  5J2M A;  1RT7 A;  1HKC A;  1XNR K;  1NGJ A;  2GUP A;  2P9S B;  4C23 A;  1J5E K;  1B9D A;  2IGI A;  2ZF5 O;  1N32 K;  3L2U A;  3EYZ A;  1BQN A;  2E4L A;  2Q3S A;  4FLZ A;  1CZA N;  3KWI A;  3VMF B;  4PWD A;  3BF3 A;  4CD3 A;  3TI0 A;  3JYT A;  4RWT A;  3T1A A;  3CI5 A;  4E7K A;  4KAZ A;  4KO0 A;  3D2E A;  3O9T A;  1S72 N;  3RR8 A;  4CK2 A;  2O8B A;  5EY4 A;  4CJW A;  3DOK A;  4HWI A;  2FSN A;  2Z1J A;  1BIU A;  3TSP A;  1JJ2 M;  2X74 A;  1RIL A;  4CEB A;  1KFS A;  2VG6 A;  1LWF A;  3E9L A;  2GEM A;  3KLE A;  1XMO K;  1IBK K;  1SKR A;  1JCF A;  2QWO A;  4A61 A;  3CJA A;  4I2P A;  1VSD A;  3EKU A;  2P9I B;  4CD1 A;  2DY4 A;  5DK5 A;  4BRM A;  1JXE A;  2HVI A;  3PX4 A;  1YVN A;  3TAF A;  3RTV A;  2VQF K;  3SYZ A;  3D0P A;  1GOB A;  1CXQ A;  4JK7 A;  1NOY A;  4FLV A;  5HL7 L;  1WSF A;  1KAZ A;  4Z94 A;  3J80 O;  2RHK A;  4M3U A;  4OLA A;  2YHY A;  3ZX0 A;  3QO9 A;  5BN8 A;  4RW8 A;  2P9K B;  3UKU A;  3CXC M;  2NNW A;  3RRG A;  3O4W A;  3GL1 A;  1TKD A;  3AV9 A;  4DQP A;  4KI6 A;  3AGK A;  4AQY K;  3A8Y A;  1S1W A;  3KK7 A;  4RG8 A;  4DFP A;  4R5P A;  1XC3 A;  4JS4 A;  4CJR A;  1KTQ A;  5GAD P;  1RCH A;  3DOL A;  4HTU A;  5AZI A;  4M3R A;  1R0A A;  4OPA A;  4I7F A;  1TYQ B;  3O08 A;  4NO7 A;  1RGI A;  4CJT A;  5M1K A;  2NRV A;  4KHQ A;  2Q97 A;  4E1N A;  2WTU A;  4BR7 A;  4PA1 A;  4O55 A;  1UWB A;  4CZM A;  3QNO A;  2B5J A;  4N41 A;  1A5X A;  1JL1 A;  5E26 A;  3WT0 A;  1YT3 A;  4BAC A;  1ZBH A;  3ENB A;  3V9S A;  2X6S A;  4B1W B;  4AHC A;  3QDK A;  3ULE A;  4E3S A;  4J2E A;  5CY4 A;  4BGB A;  4HTL A;  4KTZ A;  4BC3 A;  3V9U A;  4B9L A;  3D2F A;  1VHX A;  3MEG A;  2D0B A;  3O4N A;  3PY8 A;  2D4W A;  2BE2 A;  1D4X A;  4XEI A;  4W5T A;  1Q7Y O;  4DF4 A;  3CJC A;  3TU5 A;  3ZSQ A;  1TK0 A;  2XO7 A;  2XHB A;  1Q9Y A;  4G9Z A;  4AF1 A;  1QHA A;  3L0Q A;  3J7Z O;  1QZ5 A;  5AFU A;  4IZ9 A;  1KFD A;  1VK0 A;  2HB5 A;  3ZSO A;  3OTO K;  3OA9 A;  1JXB A;  3SJJ A;  1NMN A;  3DWL A;  1EET A;  4JRP A;  4DR4 K;  1ZBS A;  2QWR A;  3AY9 A;  1KVC A;  1D5A A;  5ELZ A;  5J2P A;  4GVM A;  4B1X B;  2HBL A;  3E01 A;  3K2P A;  2YNG A;  2Q36 A;  3O9R A;  2I7P A;  4H0Y B;  5ADX H;  3I56 N;  2F7T A;  4F4K A;  1NGD A;  4JLH A;  5EVZ A;  3LAL A;  3CC7 N;  1QZ6 A;  3A0I X;  4BR5 A;  2P9N B;  5C0Y A;  3V81 A;  3T7Z A;  2E88 A;  1DT9 A;  3LM2 A;  3C6H A;  3I8B A;  4B3T K;  4BRO A;  4EFH A;  4E7L A;  2O8F B;  1TV6 A;  3AVL A;  3CER A;  5M1N A;  3ITH A;  3J81 O;  5EXW A;  2Q0U A;  2HNZ A;  2IVO A;  1U45 A;  3ASM A;  1SL0 A;  4WE1 A;  3V4I A;  4TSX A;  4CEO A;  2BH1 A;  3AVM A;  3BZK A;  3VQE A;  2VG5 A;  2NZT A;  3KLG A;  1MA9 B;  2W40 A;  4JHD A;  1HNV A;  1J54 A;  1NJX A;  4YNQ A;  1S1T A;  3NH1 A;  2P9L A;  3MX2 A;  3MMV A;  3HSC A;  4RW9 A;  2X78 A;  3CCM N;  4H03 B;  3L2R A;  4M7X A;  5AQR A;  3THY B;  4AH9 A;  3VEN A;  4B9T A;  4E1J A;  2RN2 A;  3QNN A;  3VES A;  1S5J A;  3M8Q A;  3AAP A;  2ZGY A;  4JI8 K;  1NJZ A;  2PBD A;  1SKS A;  3J7A P;  3V9W A;  1YIJ N;  1U48 A;  3M5R A;  2D0O A;  3G10 A;  4X65 K;  3HPO A;  3QET A;  3QFP A;  4JK8 A;  3MN5 A;  2NRR A;  2ITG A;  3AA2 A;  3E1Y A;  4CGD A;  1VQN N;  4FXD A;  4DKW A;  3CJ1 A;  1BI4 B;  1BO5 O;  4DV5 K;  1A5V A;  3O1B A;  4FK0 A;  5TKY A;  2ZM6 K;  1S1X A;  5ADX A;  4X62 K;  1ZBI A;  2QXL A;  3TAE A;  3VF4 A;  1IKY A;  3ZX3 A;  3PLA A;  2ZD1 A;  3CQX A;  1K8K A;  4GY2 B;  1BIZ A;  1RTJ A;  1KVA A;  2KHO A;  3LPT A;  5GAG P;  4HUF A;  4IFE A;  5KPR A;  3NGZ A;  2HHX A;  1JLF A;  1NGB A;  1VSH A;  1DLO A;  3EO3 A;  3PX6 A;  3AVG A;  1NGC A;  2QWM A;  4DR1 K;  4H0O A;  4H4M A;  1RTD A;  1NKC A;  1Z25 A;  5C2F A;  5HOO A;  4Z4I A;  4CBX A;  4V19 S;  4PQU A;  2UXC K;  3O9S A;  1NJI O;  4FWP A;  4DMN A;  2AJQ A;  5AQF A;  1C0M A;  4FJ8 A;  4NYN A;  2O8C B;  3RMC A;  4CHQ A;  1NWK A;  3J8A A;  1WSH A;  3FE1 A;  3DXM B;  1BA0 A;  1XQS C;  2EX3 A;  4DU3 A;  1NGI A;  3M1F A;  5JIC A;  3VQ7 A;  1WSG A;  3AVJ A;  1BHL A;  4FPA A;  3ZT1 A;  3DLB A;  4N5S A;  3Q7C A;  2G8F A;  2B6A A;  3CJB A;  4JRQ A;  4JD2 A;  3CCU N;  2RF2 A;  3THV A;  3CCQ N;  4FZZ A;  3VA3 A;  4BRE A;  4AM7 A;  3DLG A;  4F9O A;  4CHN A;  2V7Z A;  1BCO A;  4OPK A;  3DXK A;  4KHW A;  2UU9 K;  1RT6 A;  1U49 A;  3CG7 A;  1M90 O;  4BE2 A;  3UIQ A;  2Z1H A;  5E84 A;  2HF3 A;  4H5V A;  4CHY A;  1OH7 A;  2QKB A;  3WNF A;  4OGC A;  4ISF A;  3WXK A;  4CHP A;  1Y97 A;  2VCP A;  4CEZ A;  4RCH A;  4J2A A;  2Q1N A;  3HP6 A;  1NK0 A;  4H0V B;  2UUC K;  2QEX N;  4BDZ A;  2GTD A;  4JKA A;  1IV0 A;  3EE8 A;  1REV A;  2DFE A;  4F3O A;  5M1F A;  3BF1 A;  4BWM A;  2D1K A;  4BC4 A;  4O5B A;  4DSL A;  2OPS A;  2P9U A;  3CPE A;  3C6A A;  4FLU A;  3QB0 A;  1RT1 A;  5LL6 Z;  1VQ4 N;  1WSJ A;  3G4S N;  1VQP N;  1GOC A;  3AAR A;  1IH7 A;  1HX1 A;  1W97 L;  5DMR A;  1I3A A;  4DFJ A;  4LF7 K;  4O5F A;  3LDN A;  4DR5 K;  2VWB A;  1S1V A;  2VWJ A;  2PY5 A;  3TPQ A;  1EWR A;  5CYM A;  3THW A;  2O8B B;  3VEZ A;  3V9Z A;  3WXL A;  4FVM A;  5FRO A;  4IOX A;  4N76 A;  4DQR A;  3AVB A;  4JI3 K;  2KFN A;  4QS9 A;  3PIP L;  4E7J A;  5GAH P;  4B9N A;  3MCP A;  1Q81 O;  3OYN A;  5GIP A;  4CBU A;  3SAF A;  3HRG A;  4JI5 K;  4X66 K;  1QSS A;  4BY9 C;  2WOM A;  4CBW A;  5FPN A;  4KRE A;  3THX A;  4DSF A;  2OZS A;  4YOX A;  4JI1 K;  4BWJ A;  3RR7 A;  3T3F A;  5J2Q A;  2Q0R A;  5FRN A;  1VSE A;  2OA8 A;  4OGE A;  3SAH A;  5J1E A;  3MAQ A;  1LAV A;  3H6E A;  4AM6 A;  2KLA A;  4JK9 A;  3ZEU B;  2V7Y A;  2ASM A;  4LH5 A;  1ZBL A;  3CD6 N;  3K9J A;  3UKU B;  1W9H A;  1QVG M;  4CZK A;  3GOI A;  3HO1 A;  3LP3 A;  3DRR A;  1NG9 A;  1Q8I A;  2IS3 A;  3HBT A;  5AQO A;  3OYJ A;  3B6P A;  2G8W A;  2UXB K;  2GV9 A;  4IEI A;  5F2R A;  2W42 A;  4DTS A;  3SQ0 A;  2EHG A;  1CZB A;  1D9D A;  3KLI A;  3MK6 A;  4Q0B A;  3SPZ A;  3SJH A;  4YHH K;  2G8U A;  1Q18 A;  1VSF A;  3BZC A;  1RDD A;  1RBS A;  4ICL A;  3AO4 A;  4DTX A;  3ZSY A;  5AQW A;  5M1O A;  3K58 A;  3VEY A;  4WQ4 C;  3TTF A;  3KD1 E;  3MEE A;  1JLQ A;  4YOW A;  1TUU A;  3ZSR A;  1HYV A;  4DV6 K;  4PL7 A;  4GKK K;  4HUG A;  3ULE B;  4EHT A;  4LD0 A;  4CGG A;  2VG7 A;  3D2F B;  2RKI A;  3K5L A;  2Q31 A;  3VEO A;  1GLE G;  3RSE A;  4CHZ A;  4DSI A;  4M3W A;  4YOY A;  3VF2 A;  4J8F A;  3L3V A;  1TL1 A;  3L2V A;  4IJN A;  5AQH A;  3KZB A;  4OKK A;  2G8I A;  1U47 A;  4GNI A;  4KV8 A;  3QBX A;  3IAY A;  1NU0 A;  3OYE A;  4L8R B;  3LDS A;  4LF9 K;  1J53 A;  2QXF A;  3T1H K;  4JI6 K;  3UKR B;  4RW6 A;  5FPE A;  4CJ4 A;  3VQ4 A;  1S22 A;  3GBT A;  3NCI A;  1WUA A;  3QEX A;  1OVY A;  2F8T A;  2E1Y A;  4H5W A;  2OZM A;  2QK9 A;  4K0K K;  2QM1 A;  3OY9 A;  1T44 A;  1OH6 A;  4LFA K;  4WYB A;  5FPM A;  3A5N C;  4FJL A;  1X9W A; 
#chains in the Genus database with same CATH homology
 4JS4 A;  2D0A A;  3HYF A;  4CJR A;  1KTQ A;  2HHT A;  1NK4 A;  1RCH A;  3VQ5 A;  1WN7 A;  1JLC A;  3HL8 A;  3DOL A;  3ZT3 A;  3NE6 A;  4HTU A;  1U4B A;  3F9K A;  1VRU A;  3OJS A;  1LAW A;  2D5R A;  4M3R A;  4O0I A;  1R0A A;  2HHV A;  1FKP A;  3ZCM A;  4I7F A;  3OYB A;  4KHN A;  3MXM A;  4C8K A;  1UA1 A;  2YHA A;  4CJT A;  3U3Y A;  1L5U A;  2ATQ A;  4B9M A;  1IKW A;  4FJM A;  3AVA A;  3IS9 A;  4CJP A;  4E1N A;  3HVT A;  4KHQ A;  4PA1 A;  4ZTF A;  2DTU A;  1TKZ A;  4CJQ A;  1F21 A;  1UWB A;  2A1S A;  4O55 A;  4CIG A;  2B5J A;  3I8D A;  3QNO A;  1A5X A;  1JL1 A;  3L3U A;  3C95 A;  1YT3 A;  4BAC A;  3SZ2 A;  3V9X A;  1ZBH A;  3V9S A;  2D0C A;  2X6S A;  2XY8 A;  4KB0 A;  1IO2 A;  4LSN A;  4AHC A;  4AHT A;  4E3S A;  4PY5 A;  2YV0 X;  5CY4 A;  4J2E A;  3QEP A;  2GBZ A;  4KTZ A;  3V9U A;  4E7H A;  4B9L A;  4EZ9 A;  1QSY A;  3SCX A;  1T05 A;  5HRO A;  2Z1G A;  4GMJ B;  2PYJ A;  3C94 A;  3KKS A;  3MEG A;  3B6O A;  2D0B A;  3AVF A;  1JLB A;  3O4N A;  4E0D A;  3JSM A;  5EU7 A;  3PY8 A;  2R7Y A;  4FJX A;  1RBR A;  3OS1 A;  2BE2 A;  4OKE A;  4W5T A;  3A2F A;  3AVC A;  1TKT A;  4CIF A;  3OYH A;  4B9S A;  4HVJ A;  3F73 A;  3K5N A;  4Y1D A;  4DF4 A;  4FM0 A;  1T7P A;  5JS1 A;  4MQ3 A;  1TK0 A;  1WNS A;  3ZSQ A;  2XO7 A;  4CEA A;  2XHB A;  1Q9Y A;  4FJI A;  4DF8 A;  4I2Q A;  1KSP A;  2A1R A;  1KFD A;  1VK0 A;  1YVU A;  2HB5 A;  3ZSO A;  4ZTJ A;  5D3G A;  1JXB A;  1S6Q A;  3QEI A;  1L3T A;  1HYS A;  3SJJ A;  2HVH A;  4E19 A;  1TVR A;  3SQ1 A;  1EET A;  4JRP A;  4IKF A;  3DLR A;  4E1M A;  1JLG A;  3TAB A;  4IDK A;  1KVC A;  2Y1J A;  1D5A A;  1C1B A;  5J2P A;  1C1A A;  4GVM A;  3AVH A;  2OPP A;  3E01 A;  2YNG A;  3K2P A;  3TAR A;  3O3G A;  3EZ5 A;  1TK5 A;  3NBP A;  4F4K A;  4JLH A;  3AA5 X;  3LAL A;  3HXM A;  4DS4 A;  4M3Z A;  4FW1 A;  4DSJ A;  4EP5 A;  4BDY A;  3ZSX A;  4FJK A;  4KTQ A;  4KI4 A;  3DMJ A;  3OYC A;  1KLN A;  4M3X A;  5SWM A;  1YTU A;  5HRN A;  1ASU A;  3V81 A;  4Z4F A;  3P1G A;  2JLE A;  3PUF A;  1WSE A;  1QQC A;  4CGI A;  4DFK A;  3KLH A;  1BQM A;  4CGF A;  4E89 A;  1J5O A;  4E7L A;  2IC3 A;  3M8S A;  3QEV A;  3AVN A;  1TV6 A;  3AVL A;  1SV5 A;  1HNI A;  1EX4 A;  1QE1 A;  1BI4 A;  4DQQ A;  3L2Q A;  3ITH A;  3SV4 A;  4H8K A;  3HJF A;  1MU2 A;  2HNZ A;  5CZ2 A;  4CED A;  3ZSW A;  4DTR A;  1WLJ A;  1UA0 A;  1U45 A;  3ASM A;  5SZT A;  2HND A;  4KFB A;  3OYM A;  3C6U A;  4CEE A;  1SL0 A;  3WNH A;  3C6T A;  1SL1 A;  4M45 A;  3PO5 A;  1NK5 A;  4WE1 A;  4EZ6 A;  3V4I A;  4TSX A;  3AVI A;  4BE0 A;  4CEO A;  3LWL A;  4DQS A;  4NCB A;  2I5J A;  3AVM A;  3CFO A;  1ASV A;  3VQE A;  2FBV A;  4ZHR A;  5HRR A;  2VG5 A;  3CFP A;  2XY5 A;  2FC0 A;  4B8A B;  1IG9 A;  4M3Y A;  3NF6 A;  4G1Q A;  4CE9 A;  4FLX A;  3AA4 A;  4CCH A;  3KLG A;  4FLW A;  4DTM A;  3U3G A;  4W5O A;  3VQ9 A;  1HNV A;  1J54 A;  1NJX A;  3SUN A;  4KHS A;  4YNQ A;  1S1T A;  2OPR A;  3NH1 A;  4DSE A;  4CJ5 A;  3KK3 A;  4IFV A;  3AO1 A;  1NK6 A;  5T7B A;  1DTQ A;  2PZS A;  3HPG A;  1Z26 A;  1C1C A;  1BIS A;  2X78 A;  4RW9 A;  4Z0U A;  1LW2 A;  4M3T A;  3L2R A;  4O4G A;  4H4O A;  2YHB A;  4CJF A;  4DWI A;  2BGG A;  4AH9 A;  4CF2 A;  3TAN A;  1SKW A;  2KTQ A;  3NDK A;  4B9T A;  4RW4 A;  1IKV A;  1NJY A;  2RN2 A;  3K5O A;  3NF9 A;  5CZ1 A;  3QNN A;  2WON A;  2FBT A;  3PV8 A;  2HMI A;  1S5J A;  1RT3 A;  3M8Q A;  1RTI A;  4I9Q A;  1VSJ A;  3L2W A;  1NJZ A;  5J2N A;  1SKS A;  3V9W A;  1CXU A;  1U48 A;  3I0R A;  3HPO A;  3G10 A;  3V1Q A;  3QET A;  4CFB A;  2FBY A;  1RT5 A;  1QSL A;  4K8Z A;  4O0J A;  3T19 A;  4CJU A;  3AO2 A;  2ITG A;  3AA2 A;  4CGD A;  3KK2 A;  1NKE A;  4FXD A;  4ELV A;  3TAM A;  4KRF A;  4CFD A;  1HQU A;  3HP9 A;  1BI4 B;  3KKR A;  5KTQ A;  5I42 A;  3SI6 A;  1A5V A;  4N56 A;  4FK0 A;  1RBV A;  1S1X A;  2YNH A;  4EP4 A;  1NOZ A;  4M42 A;  1ZBI A;  4QCL A;  4FJH A;  4Z4G A;  3TAE A;  1IKY A;  3VN5 A;  1JLA A;  3OVN A;  3SV3 A;  2P1J A;  3DLE A;  2Y1I A;  1T8E A;  2RPI A;  4C8L A;  2ZD1 A;  1BL3 A;  3NFA A;  3KK1 A;  4AHV A;  2O4G A;  3ZT4 A;  3VA0 A;  4C8O A;  4FK4 A;  1BIZ A;  1RTJ A;  1KVA A;  3LPT A;  3LP0 A;  4HUF A;  1YTA A;  3NGZ A;  4KHY A;  2HHX A;  1G15 A;  1RT2 A;  4CJL A;  1N5Y A;  4FZY A;  1JLF A;  4NCA A;  1LWC A;  1SL2 A;  2XY6 A;  4DSK A;  5FDL A;  4CFC A;  1FXX A;  1VSH A;  1DLO A;  3PX6 A;  3BDP A;  4OVL A;  3ULD A;  3AVG A;  2ZQB A;  2YNF A;  5HRS A;  3NH0 A;  1WAJ A;  4CGJ A;  2ZE2 A;  2E6M A;  3QEW A;  4CK1 A;  4H4M A;  1RTD A;  1NKC A;  1Z25 A;  4W5Q A;  3G0Z A;  3LZI A;  4AHR A;  2ETJ A;  5FRM A;  3LPU A;  5C24 A;  2XRI A;  4UQG A;  4Z4I A;  1RDB A;  1VRT A;  5CYQ A;  3VQ6 A;  1XWL A;  4KPY A;  4PQU A;  1K6Y A;  4FJG A;  1UOC A;  3AO5 A;  3VQC A;  4B8C A;  3K57 A;  4C8M A;  4FW2 A;  1KLM A;  3IRX A;  3SPY A;  1XI1 A;  4DMN A;  2AJQ A;  1BGX T;  1C0M A;  3DRS A;  4NYN A;  2QKK A;  4FJ8 A;  4CER A;  1RBT A;  4KTW A;  3RMC A;  4CHQ A;  3FFI A;  1WSH A;  4QAG A;  4I9L A;  4FLY A;  2EX3 A;  4DU3 A;  4LSL A;  4DTP A;  1X9S A;  2BDP A;  3ZSZ A;  5HRP A;  2O4I A;  3MEC A;  4DG1 A;  3RMA A;  1QS4 A;  3VQ7 A;  3SNN A;  5HLF A;  1WSG A;  3DRP A;  3HT3 A;  4BE1 A;  2VWK A;  3U6F A;  1NK7 A;  1X9W A;  3AVJ A;  1BHL A;  3DLK A;  3NHG A;  4OJR A;  3S3N A;  2LSN A;  3ZT1 A;  1TL3 A;  5E41 A;  4KHU A;  4FJ5 A;  2NUB A;  3DLB A;  3VQ8 A;  4N5S A;  3HM9 A;  3TWH A;  2HHU A;  2G8F A;  2B6A A;  2X6N A;  3LP2 A;  3QES A;  3OYL A;  1EXQ A;  4JRQ A;  1NKB A;  3PO4 A;  3NGY A;  4KB1 A;  5K14 A;  2G8H A;  1I39 A;  2RF2 A;  3VQP A;  3THV A;  3EY1 A;  4FZZ A;  3VQB A;  3VA3 A;  1J9A A;  4Z4C A;  3DLG A;  3V1R A;  1ASW A;  1VSK A;  2FBX A;  4IG3 A;  4CHN A;  4B9V A;  4M41 A;  1DTT A;  3VQA A;  1HYZ A;  1LW0 A;  1A5W A;  1C6V A;  1RBU A;  1S6P A;  1BCO A;  3LAK A;  4OPK A;  3OYI A;  3KLF A;  3SQ4 A;  2OPQ A;  2G8V A;  4KHW A;  3RRH A;  1RT6 A;  1U49 A;  1RDC A;  3CG7 A;  2IOC A;  4JS5 A;  1NK8 A;  4BE2 A;  3QLH A;  3UIQ A;  3ZSV A;  1N6Q A;  2Z1H A;  3DLH A;  4CF9 A;  4CHY A;  3LWM A;  2QKB A;  1HMV A;  4Q5V A;  3P83 D;  4OPJ A;  1FKO A;  2F8S A;  5HBM A;  4NYF A;  3S9H A;  3TAQ A;  3WNF A;  4DU1 A;  1HQE A;  4HUE A;  4CF1 A;  1SUQ A;  4OGC A;  1XC9 A;  4CHP A;  1Y97 A;  1RNH A;  3AA3 A;  4Y1C A;  4DTJ A;  4CEZ A;  4J2A A;  3HP6 A;  1NK0 A;  4J2D A;  4YFU A;  1TKX A;  4J2B A;  1LWE A;  1C0T A;  2GUI A;  4BDZ A;  2KW4 A;  1S1U A;  4FM1 A;  4FZX C;  2KZM A;  1ZBF A;  1REV A;  2DFE A;  5KGX A;  4AHS A;  4W5R A;  1EKE A;  4F3O A;  1W0H A;  1VSM A;  5KGW A;  3IG1 A;  4BWM A;  4B3O A;  3KTQ A;  4O5B A;  2DFH A;  4DU4 A;  3LAN A;  4DSL A;  1O1W A;  3OS2 A;  2OPS A;  1KRP A;  4ELU A;  1HRH A;  3SQ2 A;  4FJ7 A;  4FLU A;  1U04 A;  1RT1 A;  4DTO A;  4FK2 A;  3CM5 A;  4FM2 A;  1WSJ A;  3RMB A;  5HP1 A;  1GOC A;  3SUQ A;  2G8K A;  1IH7 A;  1TAU A;  2HW3 A;  4F8R A;  5DMR A;  4CGH A;  1I3A A;  2YNI A;  4DFJ A;  4F2S A;  3M8R A;  2P5O A;  4OKJ A;  4XIU A;  4DTN A;  3HPH A;  3QIN A;  3ZT2 A;  3P5J A;  1S9G A;  3SUP A;  3TR8 A;  4CEC A;  4FYD A;  5KI6 A;  1S1V A;  2VWJ A;  2PY5 A;  5CYM A;  4FCY A;  4CJ3 A;  4DS5 A;  1TAQ A;  3V9Z A;  1KCF A;  4FVM A;  5FRO A;  4IFY A;  4N76 A;  1HPZ A;  3DM2 A;  3QIO A;  1JKH A;  5KRT A;  3L8B A;  3LP1 A;  3LZJ A;  3OYK A;  1ZBU A;  3ZT0 A;  4OLB A;  1L3S A;  4IBN A;  4DQR A;  4LH4 A;  3M8P A;  4CJS A;  3AVB A;  1VSI A;  3MXJ A;  2E6L A;  3BGR A;  4CES A;  5C25 A;  3CQ8 A;  4QOZ B;  3S3M A;  2KFN A;  4CK3 A;  4E7J A;  1BCM A;  4B9N A;  3QER A;  5I3U A;  3OYN A;  1ZYQ A;  4B9U A;  3WNE A;  3NF7 A;  1L3U A;  2YKM A;  4FLT A;  2Z1I A;  3H08 A;  3VQQ A;  1TGO A;  2JGU A;  1QSS A;  1TK8 A;  4DQI A;  3OJU A;  4CIE A;  4DTU A;  4AIL C;  3TAP A;  4FJN A;  2WOM A;  1NK9 A;  4KRE A;  1C0U A;  2B4J A;  3V6D A;  3NH2 A;  2IDO A;  3DI6 A;  4DSF A;  4ID1 A;  2OZS A;  3MED A;  4F3T A;  4BWJ A;  3HVR A;  4GW6 A;  3T3F A;  3RR7 A;  5J2Q A;  2F96 A;  2P51 A;  4CF0 A;  1B9F A;  5FRN A;  1VSE A;  4N47 A;  4OGE A;  2OA8 A;  4AHU A;  4Z4E A;  1CZ9 A;  5J1E A;  3MAQ A;  3OS0 A;  1EP4 A;  1LAV A;  3QIP A;  1B92 A;  2HNY A;  3LAM A;  4NCG A;  4RW7 A;  3WNG A;  4B08 A;  2HHS A;  1WSI A;  4LH5 A;  3KJV A;  1ZBL A;  3V1O A;  4CJE A;  1NJW A;  4CJK A;  4PUO A;  1HJR A;  5J2M A;  1XHX A;  1RT7 A;  1W9H A;  4DLE A;  3HO1 A;  4CJV A;  3LP3 A;  3DRR A;  3RWU A;  1B9D A;  2IGI A;  1XHZ A;  1Q8I A;  2IS3 A;  3L2U A;  3D45 A;  5KRS A;  1BQN A;  2E4L A;  3EYZ A;  3OYJ A;  3B6P A;  2BAN A;  2Q3S A;  5C42 A;  4FLZ A;  3O3F A;  4LY7 A;  2G8W A;  2GV9 A;  1CLQ A;  2W42 A;  4MFB A;  4DTS A;  4PWD A;  2HHQ A;  3SQ0 A;  4ID5 A;  3TI0 A;  2HHW A;  3JYT A;  2EHG A;  1CZB A;  1D9D A;  3KLI A;  4Q0B A;  3T1A A;  1RT4 A;  4C8N A;  4E7K A;  3SPZ A;  1D8Y A;  4KAZ A;  4KO0 A;  3NF8 A;  1Q9X A;  3RR8 A;  4CK2 A;  2G8U A;  3ALY A;  3AVK A;  4KKO A;  3NGI A;  1VSF A;  3OYF A;  3RMD A;  1RDD A;  4CJW A;  3SUO A;  3DOK A;  1RBS A;  4ICL A;  3AO4 A;  3CM6 A;  4DTX A;  2PYL A;  2Z1J A;  1BIU A;  3ZSY A;  2X74 A;  3K58 A;  4W5N A;  1RIL A;  2OYQ A;  3MXI A;  1D9F A;  1QHT A;  1UAX A;  2KQ2 A;  4CEB A;  3MEE A;  1KFS A;  2VG6 A;  1JLQ A;  1X1P A;  4CF8 A;  4E7I A;  2XY7 A;  1LWF A;  3K5M A;  3ZSR A;  1HYV A;  2IAJ A;  3KIO A;  1L3V A;  3KLE A;  3KD5 E;  4HUG A;  4HCC A;  2KFZ A;  4DLG A;  4LD0 A;  1IKX A;  5JS2 A;  4CGG A;  1KVB A;  2VG7 A;  2KZZ A;  1RDA A;  4K8X A;  2RKI A;  3OYA A;  1VSL A;  1SKR A;  3K5L A;  3VQD A;  3S3O A;  1T03 A;  4CHZ A;  4DSI A;  4M3W A;  1QTM A;  3OYG A;  3DYA A;  4I2P A;  3O4Q A;  1VSD A;  1JLE A;  3L3V A;  1S9E A;  1TL1 A;  3HST B;  1X9M A;  3L2V A;  4HCB A;  2DY4 A;  5DK5 A;  1JXE A;  4OKK A;  3ISN C;  1U47 A;  4IG0 A;  4CEQ A;  2G8I A;  3AO3 A;  4KV8 A;  4HHT A;  2YKN A;  3IAY A;  3HK2 A;  2HVI A;  3PX0 A;  3PX4 A;  3OYE A;  3TAF A;  3NAE A;  3RTV A;  4L8R B;  3LDS A;  3CYM A;  1FK9 A;  3SYZ A;  4F2R A;  4O44 A;  4CEF A;  3D0P A;  1GOB A;  1CXQ A;  1J53 A;  2DFF A;  1NOY A;  2QXF A;  4FLV A;  4N41 A;  1ITG A;  1WSF A;  4OLA A;  4M3U A;  4CFA A;  4RW6 A;  4FJ9 A;  4CJ4 A;  3QO9 A;  3VQ4 A;  2P5G A;  4FJJ A;  1RTH A;  1WAF A;  3NCI A;  4RW8 A;  3TAG A;  4Z4H A;  3QEX A;  3OYD A;  3O3H A;  3RRG A;  2F8T A;  3KD1 E;  4ELT A;  1GOA A;  3CFR A;  1TKD A;  3I0S A;  3K59 A;  3AV9 A;  4BDP A;  4DQP A;  2OZM A;  4KI6 A;  2QK9 A;  1S1W A;  4RG8 A;  4DFM A;  3OY9 A;  1LV5 A;  4CHO A;  4DFP A;  1JL2 A;  4FJL A;  4R5P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...