3EY4A

Further studies with the 2-amino-1,3-thiazol-4(5h)-one class of 11-hydroxysteroid dehydrogenase type 1 (11-hsd1) inhibitors: reducing pregnane x receptor (pxr) activity and exploring activity in a monkey pharmacodynamic model
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Further studies with the 2-amino-1,3-thiazol-4(5H)-one class of 11-hydroxysteroid dehydrogenase type 1 (11-HSD1) inhibitors: Reducing pregnane X receptor (PXR) activity and exploring activity in a monkey pharmacodynamic model
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords 11-beta-Hydroxysteroid Dehydrogenase 1
total genus 77
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ey4A00
2OHXA 1DEHA 3MWEB 4EJ6A 4ITUA 3TFQA 1MXHA 2DTEA 4CM3A 3ITDA 1EUZA 4IDFA 4J2OA 3VTZA 4KQXA 5B4TA 4NG5A 1A9YA 4J91A 4YT8A 1N7HA 1GQYA 5A3JA 2B5WA 3AUTA 4PCVA 4R68A 1SPXA 1U3WA 4XDZA 3U4HA 3VPHA 1B3RA 3JQAB 3CSDA 4MVJD 1BXGA 4FD3A 4BNVA 1B7GO 1JWBB 3KYDA 4A0SA 4R1SA 4J4TA 1MG5A 1NR1A 2J5QA 3AOEC 4RLSA 5FYDA 2NWQA 3QJ5A 3Q1LA 2E4AA 2HUNA 2RAFA 2NM0A 3JTMA 1Y6JA 4RF5A 3KYDB 4OHUA 4M49A 2AQKA 4QEDA 5EERA 3PVZA 1KVTA 1N9GA 3KEOA 4Q9NA 2RBEA 2UV8A 4S1VA 1LDYA 3VH1A 1H2BA 1I32A 4K6FA 1LTHR 2OO5A 4II2A 3I4FA 1QSGA 1KVUA 3D64A 3PQFA 2AQHA 3RAJA 3WGQA 3K8ZA 1X0XA 4LRTB 3ONEA 3I9LA 1D4FA 2CVQA 2WD7A 4ZGWA 3FTPA 1YWGO 3B6ZA 3NJ4A 1T24A 4P8RA 1NASA 2GN8A 1HDZA 3AM3A 1C14A 3GPDG 3ZW9A 1RJWA 4CMJA 4II3A 1YVEI 1R4MA 1PZFA 5TT1A 3QA9A 4J9UE 3H4VA 1XKQA 3BMOB 3HZZA 2I9PA 4GKVA 4W9NC 2FPIA 3HFSA 3U3XA 3WIEA 3VPGA 5ITWA 4N5NA 3FSRA 1J0XO 4PLYA 1KEWA 4U6QA 3RC1A 4A2CA 4YAGA 4CQMA 2IZ1A 3ITKA 4RCVA 4DWVA 1E7RA 1UXIA 4IDCA 1PZGA 2I66A 3NKLA 2CDBA 4JJIA 1HE3A 2P91A 3ZWCA 4CMGA 1QYCA 5DP1A 3GVIA 1LQTA 1DC4A 2DBQA 5A9TA 5KWEA 1NWCA 2X23A 4WK6A 4WLVA 2EW8A 3HJAA 3OJFA 2BLLA 1KEUA 2YV3A 2J8ZA 1ORRA 2PKQP 4J43A 1QLHA 1ZXBA 2B5VA 4NBTA 1DO8A 3ABIA 4BNIA 2YDYA 4IIVA 3RQSA 4P38A 4A5OA 1ID1A 5A9SA 3JQBA 2VOEA 3JQFC 5A9RA 4CM6A 5CFZA 7MDHA 3JQGA 1HYGA 3F1KA 3KSUA 4J1SA 4BO2A 4B79A 1PJBA 3PLNA 4XYMA 5KKAA 1DJNA 2OGUA 4Q3CA 5CAEA 2EF1A 1EFLA 2YUTA 4D42A 4GVLA 4L4SA 4NU6A 3JD2A 2ILTA 2NU6A 3GZNB 4WEOA 5U1PA 3QQPA 4NNJA 3ROPA 1IUKA 3JYQA 5I9NA 3WGHA 1DPGA 4PG6A 5A4DA 4D45A 4NFSA 5T8KC 3Q9NA 3CPSA 3RWBA 4BO7A 2VZ9A 1XEAA 1F12A 4AJOA 4LRSB 1VKNA 2G17A 3OIFA 1ISMA 2FSSA 1LC3A 1E7QA 1ONNA 3F5QA 3F46A 4K26A 3KEQA 8ADHA 3IKVA 1X1EA 1R12A 3M6IA 5KNLA 4LMRA 2VCYA 1DAOA 4DIFA 1GADO 1EE9A 4LISA 1TT5B 1PR9A 2CFCA 4ZRMA 3TN7A 4AJNA 5KJFA 4A7PA 4J7XA 3RKRA 3B70A 3JQEA 3GUCA 5BSFA 3CMMA 2B83A 1O9BA 1NQTA 4RVHA 2ZB4A 1U9JA 4FJ1A 1K2WA 5CP8A 2UAGA 2AEFA 4CMCA 3ANLA 2G1UA 4L76A 2GUGA 4BO4A 3I4CA 4PIVA 5C7LO 4CLEA 2AHRA 4YB8A 1GPDG 4YRAA 2WWRA 4KZPA 4GL4A 3LYLA 1GYQA 3F5SA 4OOEA 3ZCXA 1ARZA 1ZJZA 3BYZA 3K30A 3WG9A 4CMEA 2Q3EA 5L7TA 4YJFB 5JPIA 1HLDA 5AYVA 1YKFA 5K9ZA 1B14A 3W8FA 5GY7A 4A27A 3H65A 4E5PA 1R6DA 4J0EA 4EUEA 2NLOA 4RLHA 3A06A 1P1FA 2OORA 2UUPA 1RM5A 2Q50A 1UUFA 5KVVA 4CM1A 2EV9A 2BMAA 2Y1CA 1T4DA 4J6FA 3EHEA 1DFIA 4I8XA 4TZKA 3D5QA 4BNGA 2OL4A 3DXFA 3PWZA 3PYLA 4BGVA 5C37A 2O50A 1NFQA 5ER9A 2F00A 3F47A 2CY0A 4GX1A 5HTOA 1WXDA 2AG5A 2PNFA 2O48X 4TRNA 5K0ZA 2VNAA 4IMRA 1ZK1A 3DFZA 4GGOA 1C0KA 4KDFA 4E5NA 5KIAA 1M6HA 2BFPA 2EWMA 3C1OA 1XU7A 4JNKA 1PR3A 5HWSA 2PZLA 2ZIZA 1QV7A 4H16A 3OF2A 5IJZA 4W82A 1KYQA 3GC6A 4YYZA 3JYNA 4KWIA 3WLEA 3C7DB 1PQPA 5CDGA 4IS2A 3W4JA 3SLGA 1KS9A 1DJQA 1GCUA 3JD4A 3QP9A 5COBA 4OXKA 2ZTVA 1ZMOA 1BVUA 3OFSA 3KRTA 2X5KO 3WJAA 1AHIA 4BQPA 4CM5A 1UR5A 4CLRA 2Q99A 3BHIA 5IDQA 3DOJA 1A71A 3WTBA 5CPFA 4I5EA 5F5LA 3TOZA 2OP0A 2YQ5A 2YV2A 5I9MA 3UKOA 3HNPA 4CUJA 2R6JA 5TF4A 1E3JA 1HETA 3RKUA 2JHFA 1WDLA 4M8SA 3ZW8A 3VDQA 3GF4A 2GZ2A 2YZ7A 3RUFA 5TJ9A 1F0YA 1B8VA 5HBRA 4XYGA 1BVRA 5JO0A 1ML3A 4BKRA 4WNIA 4B3IA 3TOXA 1ZXLA 4E5YA 4AJLA 1D8AA 1I30A 2O2YA 3JSAA 1AXEA 3WYCA 4R5HA 3PDUA 5TRTA 2EEZA 1M75A 1GYPA 3ZNQA 4DREA 4YT2A 1BTOA 2Q4EA 1DHRA 1ZCJA 3AI3A 4KUEA 3WNVA 2EKPA 1F8GA 4ND1A 1B3BA 3GVHA 4XYEA 4WOKA 3QWHA 2VYVD 5K6AA 4GX2A 5A02A 1PL8A 4WUVA 1ULSA 2I76A 3RROA 1QLJA 1DFHA 3UXYA 1A72A 2AE2A 1Y1PA 5CG2A 1LBEA 1TEHA 2VUTA 5G2OA 4BO9A 4MP8A 1WP4A 4OKIA 4PLFA 4EJ0A 5JYDA 1WDMA 3GHHA 4R3NA 4WGGA 1Z82A 1LNQA 3GVCA 5T57A 1NVGA 1B26A 1U4OA 1VJTA 3KBOA 5I7VA 4BO8A 3RU7A 1HF3A 3IMFA 2HJRA 4Q3BA 1XHLA 2NVUB 4CV3A 1K89A 4CMIB 2EG9A 1EQUA 1PJSA 1SZJG 2EHDA 4IQ0A 3WQQA 4Z9XA 3VZRA 1MP0A 2HKIA 4PLHA 1I2BA 3WNQA 1MV8A 4K28A 4D3SA 2AMFA 3H9QA 3TRIA 2EJVA 3PZBA 4NFYA 3ZV6A 2H63A 2V6GA 2CDCA 2O3SA 2Y05A 3JQ9A 4O0LA 1LSOA 4IJKA 3G1TA 4UULA 2YFQA 5JO9A 2J3JA 4C7KA 4YPOA 2PLAA 1XIVA 2YYYA 3ZU5A 4BIIA 1R66A 3NT4A 3EAGA 3RC7A 3ORFA 4HFRA 3PIDA 3GN2A 4BUCA 3PDJA 1I3KA 3STHA 3O4RA 3AUAA 2P5UA 5CHEA 1T2AA 2C2YA 1KY5A 1P1IA 2IXBA 1OFGA 3U4IA 1T2EA 2EGGA 1EVZA 3WGGA 1PWZA 3M1AA 2PGDA 3JQ9C 5GZ1A 4R1NA 3X2EA 4EBFA 1DXYA 4IMPA 2BF7A 1HE5A 3GDFA 3R1IA 3EGOA 4UREA 2WYUA 4GI2A 1EVJA 2Y1FA 1ENZA 1VLLA 3W1VA 3HN2A 3DMTA 1I0ZA 1K6XA 2DT5A 2VNSA 1YE3A 3WQRA 2VUUA 4BO6A 5CG1A 1S7CA 4I5FA 1DRUA 3PYMA 4PG8A 4XX0A 3PHHA 4FQ8A 2V6FA 5AOVA 1X7DA 1NHWA 3S55A 2X4GA 2FZWA 1NM5A 3PRJA 2IODA 1Q0QA 3BTOA 3QW2A 1HE2A 2W90A 5A04A 3EVNA 4DQVA 1PTJA 5IG2A 1ENOA 3UHAA 3FPLA 5L40A 4FB5A 4BNNA 3IKTA 1R4NA 1WLYA 2W2KB 3H9UA 3QVWA 4KOAA 1G0OA 2JJYA 3FCOA 3E9NA 2D1YA 2R2GA 3EZYA 3GEDA 4JBIA 3TFOA 4MKRA 4ID9A 2DBZA 3E48A 4PZCA 4XQCA 1U28A 1U4SA 1BHSA 3PXXA 4ALLA 2A92A 2TMDA 2C29D 4CUKA 3W6ZA 3ZWBA 3AI2A 3PJGA 4IZHA 1VM6A 4XRGA 4BNLA 1W6UA 1HRDA 4JXKA 4N18A 4BNZA 2Q49A 4DGSA 1PZEA 4M86A 3TWOA 1VL6A 2HDHA 4FCCA 2DQ4A 3ROMA 4MVJA 3GG9A 1VI2A 4Y8VA 1BRMA 1NR7A 4ZQEA 2VQ3A 4D43A 4IDEA 5A1TA 2ZJ1A 4I9HA 1N7GA 4CMHA 4AG3A 3KXDA 1UXKA 2QQ5A 1C3VA 1QR6A 1U7TA 1H6DA 1YJ8A 4O63O 5GZ3A 2JAPA 2DUUA 2O4UX 1GUYA 4O5OA 3SLKA 2C2XA 4GMGA 4IUYA 4ND3A 2V7PA 4TKMA 3ONFA 1KEVA 5TT0A 4XQGA 2X8LA 1VJ1A 4PFJA 3U9LA 4BNFA 4I9NA 3PJFA 4UAGA 2OP1A 1QV6A 2JCXA 3K2EA 3ZWXA 3TZ6A 2P9CA 3BZUA 3DO5A 1IB6A 1GPJA 1ZIDA 2HJSA 2VYND 2ZQZA 3WBBA 4Z9FA 1JW9B 2FR8A 5THQA 2Q1SA 4EUFA 1KVSA 4DRYA 4L4XA 3D5TA 1UZNA 2DFVA 1Q2XA 1LDEA 2I65A 4RPGA 3U09A 4NBWA 1AXGA 5F1OA 3V2UA 2CD9A 5JW6A 3RJ5A 4BO5A 4RF2A 4L8VA 1IPEA 1L7DA 3RCBA 2WE7A 9LDBA 1YQGA 1KOLA 3RUAA 1IHXA 3QWIA 5C7IO 2P4QA 4QXMA 4QQRA 3GGGA 4CQMD 4BMVA 1E5LA 2BI8A 4BOYA 1YH3A 2CSUA 4YJGB 1J5PA 4YAJA 4NDNE 1PQWA 3L0DA 1U2DA 2QRKA 1GEGA 1JTVA 1FDTA 3QWBA 1P74A 2D2IA 4HNHA 2B4RO 2X22A 4EI2A 4MKZA 1HDOA 3FNGA 2QG4A 3B1FA 3RBZA 4CM8B 1SC6A 4CMIA 5A06A 3DB2A 3LF1A 2VOJA 4YA6A 4E2WA 3ENKA 4WPGA 2H1SA 3G3EA 1Q7BA 1O5IA 2ZYGA 4U8GA 2X7HA 3T4EA 4CJXA 1PWXA 3PK0A 5LDGA 4E32A 4UEKA 3A14A 4W7IA 4WCFC 1NBOA 2Y1GA 1C1DB 1R16A 1VE9A 2B4QA 1N5DA 3L07A 1DRVA 3BA1A 3DMTC 2NTJA 4E12A 3S2IA 3MOIA 1U3VA 4M54A 1HEUA 2CUKA 2LDXA 4TMFA 3JQCA 3RUCA 5KOIA 3QY9A 3IJRA 2WYVA 4ZRNA 3H8VA 5K6AC 4I9UA 3WQSB 3EUWA 1A7KA 3L9XA 1BDBA 3UUWA 1LRLA 1JLLA 1KEPA 3TZHA 1HT0A 3PZRA 2Y0CA 2X86A 4BV9A 2PKRA 2X9GA 4FFPA 3GNQA 3GR6A 1SEVA 4EYEA 1Z6ZA 3P2OA 4D0RA 2JD2A 3DBRA 4PRKA 3H3JA 3HHPA 3GFBA 2VRCD 3F4LA 4FPXA 3IJPA 1B15A 4HUJA 5TSDA 3OJLA 4CM8A 1ZK0A 4W6ZA 2Q4BA 5B4VA 1ZEMA 1BDMA 2O3RA 5JY6A 2GDZA 2Q45A 4HNGA 1O94A 3TL2A 4CV2A 3GMDA 4R3WA 3OQ6A 1LX6A 4INAA 2C5EA 3H9EO 2IRWA 2WD8A 3IP1A 4IJWA 4QUKA 3RUHA 4JQCA 1TVEA 2RHCA 3WFIA 2QRJA 2C0CA 1OZAA 2W8ZA 4R1UA 3ZV5A 4RF3A 3KOUA 5C3MA 3NDJA 4NBVA 4ALJA 2PH5A 3K2BA 2POQX 1E1KA 4R1TA 2R00C 3HE3A 4FFOA 2D8AA 3RU9A 3WB9A 3GLQA 2O2SA 4FGSA 2X0NA 4UEOA 1GD1O 4KTTE 1JVBA 1LLUA 3PFWO 3MOGA 4IDGA 1YONA 2HLPA 4RORA 5EQFA 3FRJA 4N54A 3FPCA 2RIRA 5JC1A 4Z3DA 2Z5LA 1ADBA 1E7YA 3I3OA 1Y8QA 1CERA 3KB6A 2Y93A 5F3RA 4F3YA 5A5FA 5MGBA 1F17A 3JCZA 4CR8A 1DC6A 4QO8A 2CVOA 4L75A 4JK3A 1U3UA 1DLIA 1PJTA 1I2CA 3ETDA 4F6LA 4B8WA 1ADCA 4DVJA 2HSDA 1UDBA 1QG6A 5DBFA 3DC2A 1E1NA 5CPBA 2H5LA 4CMKA 3K96A 3JQFA 4BS9A 3EVTA 4DLLA 3ZNPA 2ZKLA 3FNFA 1PL6A 3CXRA 3LQFA 2BGLA 4FS3A 5ENVA 1LQUA 2BKAA 2HK9A 1ONPA 3I1JA 1E3WA 2VHVA 3G49A 1QP8A 4J4HA 2YHIB 5CEEA 4JIGA 4XZ3A 4P22A 1CQIA 1KETA 2HCTA 4Q3NA 4Z3KA 4M89A 4XKJA 3DHEA 1VKOA 1Y8RA 4WJZA 1XYGA 3HUDA 3NT2A 4G5HA 5JDCA 5JBIA 5H83A 3K73O 1R0KA 2ZTMA 3DZHA 3KLPX 1NAHA 4FFNA 2JFGA 1GL3A 5I8ZA 1NPTO 2X5OA 3ADPA 4WKGA 1MG0A 2D5AA 2EKQA 1UZLA 1ZMTA 3ZWNA 4DYVA 2RH4A 3ZWPA 2ZATA 4XGNA 3UH1A 1PGPA 3WOHA 1V0JA 4FGWA 3RBXA 1NX6A 2FP4A 2VT3A 3PLRA 3I6QA 1HSZA 4BV8A 1F06A 1A4UA 3AUSA 2Q2VA 3HDHA 1B2LA 2HU2A 1CF2O 2JD0A 3AU9A 4OH1A 3C24A 5COQA 4BO0A 1NPDA 4DPKA 4RVGA 1LUAA 1MB4A 5EESA 1BWSA 1JWAB 4OSPA 3M2PA 2X9VA 4PLTA 2P2SA 4NI5A 2Q2QA 5DBIA 5JE8A 2YHUA 3R3SA 3ZWMA 1B8PA 4CQLB 3VKUA 3H5AA 4YAKA 1UP7A 1XCBA 5TGDA 4CR6A 1C0LA 3NUGA 2VN8A 2VT2A 5IDXA 4CLXA 3KZVA 1H6CA 2OMEA 2YFHA 3LU1A 1CIVA 3UVEA 1EBUA 2HMSA 5JDIC 3RUIA 3JYPA 1NAIA 1B0AA 4UVDA 3G0OA 3QE3A 3JQAD 4N7RA 1HZZA 2EIHA 3K31A 1PJQA 4PVCA 3WDSA 1SB9A 1Q0HA 1Z74A 2IZZA 3VC7A 5HM8A 2I67A 4ILKA 5L7WA 2BFMA 5EQDA 1X13A 4PLGA 3MCVA 3GZNA 4WLEA 4I5DA 2PK3A 5I7FA 1EK6A 1K6JA 4YCAA 3NX4A 2X6TA 4E31A 5FWNA 3MZ0A 3PWSA 3CZMA 4CM4B 1LLCA 4PVDA 3JQ6A 4L4RA 4P4GA 4RPHA 1MC5A 2LDBA 4XQ9A 2V65A 3CE6A 4AJ1A 4DBZA 4EJMA 4WOJA 3KYCA 1R4NB 5FI3A 2J3HA 3HFGA 1LDBA 3AW9A 3UGKA 4BL5A 5DN9A 4FJ2A 3D4OA 1CEQA 1LDGA 4NH4A 2A9FA 4FC6A 4Z6KA 2Y1EA 3Q9UA 3ZZNA 1IULA 4IY1A 2ZB7A 4QFCA 4XEHA 3CEAA 2O3TA 4JBGA 5F1PA 4LN1A 2B36A 4B4OA 1UXJA 5L3ZA 1P0FA 4AFNA 3FR7A 3ULKA 3EK2A 1C1DA 1T1RA 5KTKA 3JD3A 1PJ3A 4FOSA 1GU7A 4GMFA 1QYDA 3EW7A 3LF2A 3SXPA 2PZMA 3H9GA 3BHJA 1H9BA 2YHIA 1HLPA 5I9LA 2DU8A 1R37A 1V8BA 3JD0A 1EEHA 4UUNA 3L4BC 3GK3A 3NDRA 4HADA 5CDSA 4B4VA 1JKIA 1ZUD1 4WASA 4GQAA 1JU9A 3JQ7B 4IBOA 4RL6A 5DDIP 3MJTA 3OH8A 1P0CA 4NQZA 2GRAA 3VAZA 1ZVMA 4NBRA 2HRBA 2BELA 4LSWA 1WWKA 3VPSA 2QZ9A 4AJHA 2EXXA 4F45A 2WMDA 3DR3A 2CF5A 3UCFA 1ISIA 4JLWA 1A4IA 4I5GA 1ADGA 3B20A 4ALIA 3QHAA 2NQ8A 2GLXA 3CTMA 3ZV4A 2DPGA 3LT4A 3OA0A 3D4PA 4CM9D 1HDYA 2VHZA 4Y6PA 2QIOA 1QORA 3UW3A 3RC9A 3KLMX 5G4KA 5ADHA 3QIVA 1ISGA 5IZ4A 5ILGA 3ZHXA 3W4KA 4E2YA 3U4DA 4ONEA 4A73A 1Z45A 4K9DA 2Q2WA 3LC2O 1Y9EA 3UICA 2ET6A 4MVJH 1PGQA 5G0UA 1GAEO 2J5KA 1ZK4A 4HV4A 1N1GA 3LLVA 2I5PO 2V6BA 5KCZA 4UEJA 4AJ4A 5U9CA 3O8QB 4R5MA 3IOYA 1LC0A 2JD1A 1NPYA 1X15A 1DLJA 3F9IA 4I08A 3ZH2A 1TLTA 2G0TA 5G0TA 2I3AA 3IUPA 4DIBA 4ZJUA 5ER6A 2EERA 3DZBA 4XJSA 2X0RA 1PGNA 2E37A 4RPJA 2D0IA 2PGJA 3AY6A 5BQFA 1E7MA 3WSWA 4C7JA 1VC2A 1Q1NA 1AUPA 3V5NA 3QVXA 5TS3A 2FY8A 3T7EA 4HBGA 3RVDA 4R51A 1NQOA 4URFA 5L51A 3LK7A 2NQTA 1ZK3A 3GDGA 4P4NA 5J23A 3I5MA 1GFSA 1CQJA 2DC1A 4RVFA 3HDQA 4YTEA 1H2HA 3IUSA 4TKLA 1DSSG 1U1IA 5TLSA 1JN0A 1U3TA 3PQDA 1UP6A 2WDZA 5JY1A 4MVJF 3FNEA 4LK3A 4Y6SA 5JSFA 4D7AA 1ISHA 1DDOA 4EZBA 4BGUA 4CLRB 5IXYA 4CODB 1YJQA 3PJEA 1I3NA 3WGOA 4EW6A 1AE1A 2O3UA 1U5AA 3DZJA 1WVGA 3ST7A 3DMYA 1E7SA 2IE0A 2VUSA 4ZQBA 4JN6B 3NTRA 5DOZA 4RQUA 5JNLA 4JBHA 1FXSA 1FDWA 4CPDA 2FPGA 4KWHA 1J4AA 1ZBQA 3NTQA 1DIGA 1GQ2A 2RCYA 4WE3A 1EK5A 5T8KA 1BG6A 3D3WB 4CLOB 1X7GA 3GVXA 3IIEA 4LMPA 1ZSVA 1YB1A 2DLDA 1SNYA 1VSUA 4AICA 4AJEA 2HMWA 3M2TA 4QT0A 5KJEA 3FWZA 2DAPA 4GSKA 8LDHA 3BHMA 2YJZA 3OETA 1NTOA 1GUZA 4NR0A 3E03A 1XGKA 1RYDA 3OBBA 3VH2A 1FMCA 3AFNA 1SMKA 4O1MA 3FF4A 3WGIA 3LT2A 4G81A 1QYWA 1E1MA 3GRPA 4B3JA 1ENYA 5KKCA 3KUXA 5JCJA 4NIMA 3TJRA 1F8FA 3DAGA 4DUPA 4YRBA 4GPD1 3M1LA 4CL8A 1Z75A 3TSCA 4PLCA 2NVWA 3GOHA 2BHLA 2CZCA 3WMWA 5IN5A 1UH5A 5BNFA 4PG5A 2DBRA 1WAMA 2Z1NA 4H15A 4WCFB 4ZN6A 3ZGYA 1O89A 2AEJA 1QRRA 4B8ZA 3PHGA 1IY8A 2O4CA 5BNTA 4QECA 3HG7A 3O9ZA 1ZNQO 3DBLA 4IDAA 3ZU2A 1UAGA 3G1UA 1LDNA 1OC2A 3VTFA 3HWRA 4OOFA 2XPCA 1M6WA 1VRWA 3TZKA 4CMBA 1JKJA 3I52A 1DRWA 2GSDA 5JXWA 2QW8A 4MVJG 2I6TA 2HK8A 5L4LA 2GERA 3F1LA 3ZV3A 4MPDA 1LXCA 3E1KA 1OOEA 1JAYA 1I10A 4XYBA 5IZCC 1DIRA 5FEUA 4Y9DA 2B69A 3RFVA 4BNTA 3T4XA 4GX5A 4CM9A 5CEFA 5JYEA 4NZ9A 5TJHA 2A35A 3JYOA 3BMCB 4HKTA 1J6UA 3WMXA 5ICSA 2WEKA 3I9NA 2OXIA 4CUZA 3OP4A 3R6DA 2AXQA 1EE2A 3V2GA 3VHRA 3C8MA 4RDHA 3RI3A 3WWYA 4GLOA 1Y8RB 2A4KA 3ZWVA 4DLBA 4OXYA 3AUUA 5JAQA 1ADFA 1PIWA 2Y0EA 3P7MA 5JAMA 2FN7A 2Q1TA 3NAQA 4IDDA 4TVOA 5AVOA 4B7XA 5EPOA 1NWHA 4ZQHA 4EEXA 5L4SA 3KSZO 5I7EA 3A9WA 4N5MA 4GH5A 5AXAA 3WYBA 5CDTA 2O3QA 2DVMA 3GGPA 1LI4A 2ZB8A 3HB5X 3H6KA 1WPQA 3E9MA 3OJEA 4Z0HO 3PEFA 2VZ0A 5JMWA 2QHXA 3QVTA 2WD7B 1MLDA 2QZZA 3CKYA 1YGYA 3EY4A 2AW5A 2XXBA 1WDKA 1HYHA 1JKFA 3LC1O 1Y81A 1MFZA 3N7UA 3UFXA 4XWYA 4AVYA 5KJ1A 1MA0A 2IZ0A 2PD4A 4OO3A 1CJCA 2Z95A 1TI7A 3V8BA 3GZ4A 5G4KB 3DZKA 5G0WA 2C59A 1DC3A 1T1SA 3DOCA 1GZ4A 2GD1O 2BRUA 4J2HA 3PGXA 5IAAA 4MO2A 2ZB3A 3EDMA 2IEDA 3JV7A 2IYOA 3NYWA 4HXYA 3TDKA 3OIGA 4PG4A 1P33A 3RFTA 4B7UA 2H9IA 4FN4A 4XB2A 3ZWYA 2B35A 1J49A 3H9JA 4NJMA 1U7HA 1HZJA 5DF1A 3ZHYA 1IYZA 1E3IA 2VYVA 4JX8A 1LJ8A 4DTIA 5BT9A 1I5RA 1JA9A 3JYLA 3O8QA 1E7WA 4XA8A 4Y98A 2IXAA 4K6CA 4J49A 1UDCA 3I83A 4DXHA 2VZ8A 4GWKA 4O59O 3AY7A 5TIIA 5A9SB 4U0JA 3C1TA 5G0VA 3WGYA 4FFRA 2WM3A 4YXFA 1NQAO 3WICA 3OM9A 4G65A 3VKVA 3F3SA 3VVBA 5IDWA 3P2YA 5EN4A 2HMVA 1C0IA 1PGOA 3GNTA 1IZ9A 4CLDA 3U0BA 1P1JA 1LSJA 4YJFA 1JVSA 2XAAA 3BMNB 3RD5A 1O8CA 3W4IA 2OFPA 3WGTA 2Y67A 3O03A 2E48A 3OIDA 3U62A 2A94A 1T2FA 3GDOA 5EL0A 3VDRA 2C54A 4MDHA 5L95A 1EMDA 3PTZA 4HFJA 2B4TO 2JCYA 4HFMA 2UDPA 2J3KA 4GWGA 5HS6A 1OI7A 4A26A 3JQAA 2AG8A 1YOVB 2GGSA 3HSKA 4Q3AA 3KHUA 4NK4A 4XGIA 3GNSA 1HWYA 3L4BA 4ZD6A 3C7CB 1O0SA 1XQ1A 4Q39A 3A4VA 2X5JO 2ZQYA 1O95A 2CMDA 3K5PA 3QVOA 3MEQA 4IJUA 4A03A 3ZWWA 3EYWA 4RPLA 1L1FA 4DLAA 4XR9A 4ND4A 1MGOA 1H94A 2IDZA 3R0IA 3PPIA 2JHGA 1HYEA 3IDSA 1E92A 3JQ8B 4CM7A 4OIMA 2AQ8A 3L77A 1IZ0A 1WMBA 4EUHA 5ES3A 2GZ1A 2ZYAA 3MJSA 3MJ4A 2NSDA 3AY3A 4EDFA 2NNLD 5TC4A 2PTGA 2CF6A 1PQUA 1ZSNA 4D0SA 3GT0A 4IXTA 4IM7A 4YAEA 3U5TA 3BTSA 5JDCC 4J7CA 2OZPA 5DP2A 4Q3EA 4CQLA 2E6UX 3V2HA 4TSKA 3TNLA 4TZTA 1WW8A 1BXGB 4J7UA 1EBFA 1SB8A 5A05A 1OC4A 1XG5A 3VH4A 1OMOA 3OJ0A 1B8UA 4OM8A 5TNXA 4ZHSA 1XDWA 1BXZA 2C7GA 3X2FA 3H2ZA 3W8EA 1OBFO 4GLLA 3Q11A 4IQGA 4CLHA 2EGHA 2NU7A 3L6DA 5KJ6A 3D7LA 4HFNA 9LDTA 3WLFA 5GZ6A 2IYPA 1IL0A 4RDIA 4AJJA 3GEMA 2Y1OA 4AJPA 4WECA 4BNJA 4IPTA 1E3SA 1YL7A 5B4UA 1TA4A 3B1KA 1EUCA 4DIOA 1VPDA 1NFFA 3PYXA 4K1LA 4DQXA 2ZYDA 4MP6A 3WJ7A 4JJGA 5KVSA 2O23A 1R0SA 4PLPA 4UVHA 1GEEA 3LSYA 4Z0TA 3H3FA 2OBNA 3ETGA 1A27A 2DBVO 5IZCA 1XELA 3GUYA 4L73A 1MXFA 3I23A 1FDVA 3IC5A 1K5HA 1JDJA 1PJLA 5U4QA 3FR8A 2GASA 1NVTA 1X14A 3KSDO 4ND2A 4FR5A 4EGFA 1YDEA 4BMSA 2PD6A 4U5QA 5ILOA 5DOVA 2GYYA 4GVXA 1SOWA 1C1XA 4BB5A 3CMCO 4RVDA 4F46A 1LDMA 2BGMA 4AJ2A 4ZQGA 4BB6A 1FF9A 1SO8A 1ZZEA 1GDHA 5AXDA 2NADA 4R69A 4U0KA 4WNCA 3KYCB 3AM4A 3CIFA 1YL6A 2J3IA 1QKIA 4PLZA 1Y8QB 1E5QA 5JMPA 5T64A 4ALKA 1E77A 4BHTA 1W0CA 5KVCA 4BO1A 1D1TA 4IJVA 5BSHA 4GSLA 2CDAA 3ZN2A 1HKUA 3ZWOA 2V6MA 3UOGA 4E33A 3QWFA 4IS3A 3COSA 3PHLA 4CV0A 3E5RA 3G17A 1GCOA 3CH6A 3FN4A 3IP3A 3E9QA 3TPCA 1OAAA 1DC5A 4J1QA 3WXBA 1R15A 1Y9AA 2YY7A 4R41A 1GQQA 4DMMA 1E6WA 3L4SO 3DDNA 2HRZA 3DOOA 4GKBA 4UVIA 5L53A 1M67A 2GO1A 2ZK7A 4HWKA 3BMOA 4M87A 1PX0A 1E3WB 1HL3A 2DM6A 1R4MB 1V9LA 4RV9A 2GN4A 4D41A 3GAFA 1YO6A 3GG2A 2J5RA 2VHWA 1E1LA 3EZLA 1C0PA 1ZSYA 4NJOA 3K92A 1LLDA 2VWQA 3WWZA 4MJLA 3WS7A 5JS6A 2EJWA 4AL4A 1BSVA 1MX3A 4OQZA 3WTCA 1MUUA 1EFKA 4YWJA 4RVSA 3DBRB 3E8XA 4YRDA 3BTVA 4A10A 2CVZA 5AXBA 1DIAA 4J16A 3NGXA 1IPFA 1QXSA 4NPCA 3D3WA 4OGWA 1VSVA 3AM5A 7ADHA 2Q46A 3E6AA 3KM0A 4MKXA 1XWFA 3ENNA 2BGKA 4JJFA 2UVDA 3G79A 1B16A 1GV0A 2EP5A 4FJ0A 2YQ4A 2XXJA 2I99A 4QTZA 5A3VA 1WMAA 1YB4A 2C20A 1BGVA 1U8FO 3AFMA 4W7HA 4FSHA 3PWKA 4IGFA 3RJ9A 1CYDA 4GAEA 3V1UA 1YQDA 3SC4A 1V3VA 5BNIA 4WCDA 3ROQA 3HADA 1YXMA 3RBVA 3GFGA 3BTUA 4AJKA 1E6EA 3GEGA 2CNBA 5JLAA 1KVQA 5TQVA 4NMHA 3N58A 3ASUA 3E82A 2NU8A 1XQ6A 4ZICA 4YQZA 4XRRA 4FC7A 3PHIA 4D46A 4XCVA 5H81A 4HP8A 2D59A 2VWPA 1IOLA 4JCOA 3TZCA 2XF8A 5CDYA 4U7WA 1BW9A 1HDGO 4PZEA 4Y67A 1WZEA 3MJCA 1ULUA 1M76A 1NHGA 3E18A 3AJRA 3KETA 4TROA 4LGVA 2J6IA 4XYLA 1ZEJA 3C1AA 4IINA 3ROKA 3MWDB 1YOVA 3NRCA 4KDEA 4N5LA 1T25A 3CUKA 4AJIA 6ADHA 1S6YA 1IHYA 1V3TA 5T5QA 1E3LA 3DONA 1EDOA 1I8TA 1R0LA 1UZMA 3AK4A 3L6EA 1ZFNA 2WE8A 3KO8A 2BFAA 3OQBA 1T2DA 1V35A 3UCXA 3OA2A 1H5QA 1ZH8A 1H93A 2VRCA 4JGBA 1X7HA 1N9GB 3HDJA 1YBVA 4CMAA 1H0KA 1N1EA 1JAXA 3ZHZA 3K9QO 2DPHA 3ADOA 1NYTA 1T4BA 4BNXA 4OMUA 3OSUA 1V6AA 4FBGA 1PS8A 5HS4A 3A1NA 4E5MA 3ZU4A 4FOOA 5DCWA 1PEDA 1XLTA 2G5CA 4BNKA 1AN9A 1UAYA 3CINA 5IXSA 3DQPA 5DNAA 4KUGA 3WIDA 1I01A 3MTJA 1YBMA 3NTOA 4E13A 3BIOA 3GGOA 3FD8A 1LRKA 2GNAA 2G82A 2G76A 4MVJI 4RZIA 3C3XA 3S2EA 4H3VA 3V1TC 4PZDA 1DHTA 1UXHA 4LW8A 5G4LA 1Z7EA 3BMQB 1UDAA 1DAPA 1QYXA 2UYYA 3D0OA 5AXCA 3S2FA 1LSSA 1PS9A 1H9AA 5F21A 4H7PA 4BQRA 1QYVA 4E2XA 1E6UA 4WCFA 5B1YA 1PJ4A 3Q3CA 2P5YA 4BVAA 4UVGA 1DIBA 5DCYA 1HE4A 3VZQA 4WEQA 4DPLA 4R01A 2X0IA 1N2SA 2B0JA 4NJMB 3RIHA 3VPFA 3WFJA 4B3HA 1IE3A 2JCVA 3PQEA 4FFLA 3JQ7A 3OQ1A 1LRJA 2HMUA 2Y99A 4LCEA 2PZJA 5CEJA 4RO0A 6LDHA 4IGEA 4EEZA 4E30A 4XDYA 2JKVA 4E5KA 3FHLA 1A9ZA 5CDUA 4OKNA 4WLNA 2E82A 2DFDA 1YS4A 2SCUA 4JP3A 3I9KA 4OXNA 3GVPA 1GZ3A 2X1HA 4YDRA 1O6ZA 4YT4A 4DBVO 4D3FA 5IN4A 4QFDA 4PRLA 2PH3A 4XJTA 4E6PA 2FZEA 5HA5A 1GUFA 4W99A 1I2ZA 2BD0A 4R54A 3S8MA 2ZCVA 2OUIA 3ZNNA 4OL9A 1I24A 2TMGA 4B4UA 1RPNA 2EP7A 1D3AA 2GZ3A 4UVEA 1LU9A 2YV1A 4J4BA 4R16A 2FR1A 1G1AA 3DWFA 4MP3A 3O38A 4J1NA 4Y6RA 3A28A 1NXQA 4E2ZA 3DBLB 5IDYA 2BI7A 1XSEA 1PSDA 3F6YA 3GPIA 4NK5A 3H5RA 5EJ2A 1T26A 2VHYA 4GX0A 4YJHB 1G6KA 3DTYA 1LEHA 1MC4A 1EVIA 3WR5A 4CM4A 4YJGA 5JCXA 3C85A 3DAFA 4XD2A 1GY8A 2D3TA 2PFGA 2QYTA 2O7SA 1XU9A 3ICPA 3UF0A 4QSMA 3INTA 3SX2A 2Y1DA 3BMCA 1WZIA 3QV1A 4DC0A 1I36A 3ICCA 4ZA2A 4BNHA 4WLUA 4IZIA 1CRWG 4E4YA 3GMSA 4LVUA 4BNUA 4DYDA 3TZQA 1K3TA 3LZ6A 2DTXA 2DTDA 4KUHA 2W2LD 2FOIA 4LSMA 5JFOA 3PP8A 3FBTA 5F5NA 2X58A 2JFFA 3CZRA 4LVCA 3TF5A 3VVCA 3BMQA 3ZI0A 1PJ2A 5BSGA 3KV3O 4GGPA 2C07A 4MINA 4PLWA 5COAA 4DC1A 4O6VA 3AWDA 1I33A 1M66A 3AU8A 1ZKMA 5BSEA 2D4AA 1PJCA 3GN1A 1FDUA 2D5CA 1P1KA 5JAIA 4RJTA 1FJHA 3UAGA 2NU9A 5T6BA 5I7SA 4YAIA 1YQXA 4OAQA 5DCUA 4BNMA 3HN7A 1G0NA 1SAYA 1FDSA 3DBHA 5DULA 3ANMA 4E0BA 3QVSA 4YBZA 5JC8A 2HK7A 1A7AA 2VHXA 3W8DA 2Q1UA 3INGA 5MDHA 3IQDB 3EMKA 3DFUA 2AQIA 2WYWA 4RQTA 3JQ8A 4BO3A 4BNYA 1U5CA 1D7OA 3OHSX 3PFFA 3NV9A 2FSVA 1NVMB 4W4TA 2P4HX 3WBFA 2R00A 3SJ7A 2PGLA 3L6OO 1HDRA 3H2SA 5EIOA 3NT5A 4J9VA 2ZTLA 3WGZA 3LVFO 5T67A 4TQGA 5C5IA 4U6SA 1A5ZA 2RHRA 5BR7A 2FMUA 1EDZA 2WTBA 4FFMA 1E0DA 1I3MA 4YR9A 1P77A 2HQ1A 2B37A 4W9NA 1SBYA 3L9WA 2PZKA 4Z0PA 1GZ6A 3INRA 3QSGA 4DQUA 3GAZA 1TB4A 1VL8A 4DA9A 4WLFA 1HXHA 5DBGA 3EC7A 4MVJP 5C7OO 1N92A 4MOWA 4RVUA 1V3UA 3FI9A 1NP3A 4J0FA 3V1YA 4R9SA 2NACA 3ZU3A 1RKXA 1RYEA 4OSOA 1RM3A 3DHNA 4RGBA 4YJDA 3HB4X 4UUOA 3FWNA 2AE1A 3D4NA 4MIOA 1LA2A 3DHYA 4KQWA 5EINA 1YB5A 3E5MA 3LT0A 1XR3A 1DFGA 2VWGA 3B1JA 2PA3A 3VZPA 3ZNOA 3GQVA 5HRUA 3LT1A 4J1TA 3DBVO 4YQYA 3Q0EA 2GPTA 1AHHA 3P5SA 4YT5A 4KMSA 2X0JA 4M55A 1DOHA 3NDIA 3SEFA 1Z73A 5GMOA 5ENDA 4WLOA 2VYNA 4RZHA 4BKUA 4UUPA 2Y66A 4E21A 2FRDA 1JQBA 4KP7A 3S1LA 1GTMA 3N74A 3NJ8A 3QRWA 3TQHA 4MIEA 1CETA 3OMLA 2JAHA 3Q2KA 4RF4A 4XR4A 1P3DA 2NV6A 1YL5A 3OJOA 2ZJ0A 3D3EA 4DPMA 4ZQFA 4EITA 2GR9A 1GV1A 1HSOA 1W8DA 4D44A 1RWBA 1KIFA 1P44A 3HQ4O 5L45A 2WSBA 1UJMA 4F6CA 1GR0A 4BKQA 5H82A 3BAZA 3Q6IA 4XQEA 4IDBA 1LLQA 1BW9B 1NFRA 1KVRA 3DZIA 4ESOA 1FK8A 1PZHA 1P9LA 2H6EA 3DBHB 5I8WA 1F14A 3MTGA 4R4JA 2VTEA 3H5NA 4C4OA 3IL2A 3KTDA 4R9RA 2FR0A 3GY0A 3HDYA 3VPXA 1CDOA 1EVYA 3RASA 1UXGA 3FTNA 3RSHA 1BMDA 1N8KA 1ZJYA 4ROSA 2PD3A 2C82A 2BH9A 2BFOA 3I9MA 2E49A 4PG7A 5L7YA 1U8XX 3T7CA 3C7AA 3JD1A 1X1TA 3BXXA 4L9RA 2VTDA 3ZHBA 4OJNA 1NQ5A 3GHYA 3ANNA 1KERA 4FIZA 3QLJA 1PL7A 1TXGA 1Q0LA 4FW8A 4OQYA 3SBOA 1ISJA 4L0QA 5FFFA 1GYRA 4HY3A 4ND5A 5ICMA 3NEPX 2NUAA 2I3GA 2YDXA 4NFHA 3I9JA 3O26A 2O7QA 4X54A 5JAZA 3AOEA 4ZVVA 2P68A 3IS3A 4YVFA 3PIIA 4L74A 4XGKA 3D1LA 3H7AA 4P4LA 1SCUA 1VJ0A 1DB3A 4YACA 5A5EA 2EKLA 4MIYA 4CL3A 2Z1MA 1T2CA 2W4QA 3WYEA 4HX5A 4ALNA 2JFHA 3FNHA 3GA0A 5KJCA 1RM4A 4JP2A 3ONDA 2DUWA 2HAEA 2ZCUA 4TRRA 4Q3DA 2O3JA 4TWRA 4M1QA 1Q7GA 1HTBA 2IEBA 2W2KA 1KC1A 4YEDA 3RC2A 1ZW1A 3OEYA 4BNWA 3NGLA 1LSUA 1QMGA 1Y7TA 1L7EA 2PKQO 3IAHA 3JQBC 4MVJE 2OOSA 5THKA 1SEPA 1H6AA 1RM0A 1PGJA 1P1RA 3F4BA 1NNUA 3KVOA 4QX6A 3I6IA 1Z7BA 2QX7A 4IIUA 5JCJD 2F1KA 5FI5A 2W2LA 3PGJA 1YDWA 1I3LA 3OICA 1YBAA 4I1IA 3QWAA 3TL3A 3UCEA 2FWMX 2GCGA 3OEWA 4QO7A 1EQ2A 3DEYX 5IF3A 5DT9A 5IFLA 3Q2IA 2PR2A 2P9EA 1U2GA 2C7VA 3LC7O 4UUMA 3U49A 2Y68A 3ZWAA 2YW9A 1HDCA 5L9AA 1WNTA 4Z9YA 3DZFA 4TVBA 4D3DA 1DBVO 1HDXA 4ZU3A 3U4CA 5LC1A 3DAPA 3AI1A 5F1KA 1P45A 4E3ZA 5B37A 2FHSA 3DTTA 5B12A 3DL2A 3GH3A 3VOSA 2DKNA 2XOXA 3KYBA 1YRLA 4ALMA 3WSVA 2QRLA 1KC3A 3VZSA 4DMLA 5L4NA 1VL0A 2JL1A 1PS0A 3K6JA 4CV1A 5G0SA 2PWZA 3SC6A 1UP4A 5JDIA 4BGIA 3GRKA 1M2WA 2HO5A 1E3EA 1EZ4A 2UUOA 3ETEA 1ISFA 4YJHA 2PV7A 5KVQA 3S2GA 1Y5MA 3DZGA 2GN9A 3MJVA 4CLOA 1H6BA 2RH8A 2FPPA 2ZTUA 2HMTA 2PY6A 2P9GA 4JROA 3AOGA 3MJEA 3JQGB 3FBGA 4NU5A 1PU2A 1P31A 2NVUA 5FF9A 4BGEA 3SVTA 3UN1A 1K6IA 4LCJA 4XB1A 3W6UA 2AEMA 4TRJA 1SOVA 4J3FA 3LLSA 3RFXA 3WX0A 3I9OA 3PI7A 4G2NA 1Q7CA 5LDHA 4XIYA 3JQDA 3P19A 4MVJM 3VH3A 4CR7A 4PLVA 1Y5RA 4B7CA 1DIHA 3ASVA 1AGNA 3ON5A 3SJUA 1D1SA 1MFPA 4IQ8A 1ENPA 1C1XB 4S3MA 4BKOA 2GF2A 4FDAA 2GN6A 3BMNA 4B4WA 1ONOA 2QYSA 3LDHA 2WJPA 1KY4A 2C5AA 3R3JA 3RUEA 1K0UA 4RPKA 1P1HA 4DL9A 2Q1WA 1X0VA 1TT5A 4XIJA 3OECA 2NTNA 5AQ1A 3PJDA 4NHEA 4CQMB 1XA0A 4IXWA 4PGFA 2EW2A 1TT7A 2W98A 4D79A 4PN3A 1EUDA 1ZK2A 2OBYA 3PHJA 4J90A 5TX7A 5ITVA 1KBZA 1ZO8A 4NBUA 2VWHA 4OYRA 2NTVA 1W4ZA 1BXKA 5DZSA 2X9NA 4BMNA 5EMHA 2VRBA 4KTVE 4BKPA 2AA3A 3ZDFA 2NVBA 3RUDA 4CMEC 2Y0DA 5LCXA 4GBJA 1CWUA 4TRMA 5A03A 1W73A
chains in the Genus database with same CATH superfamily
5AK6A 4EJ6A 2Z6QA 5BNZA 4UDYX 4ITUA 1EB9A 5BW8A 1KYZA 5LQKA 1LW6E 4CM3A 3SKVA 4OPMA 4MA4A 3VTZA 1R8YA 4KQXA 3BH0A 1HOTA 2ZT7A 3N6RA 3CNBA 4TXLA 2CHUA 4HPWA 3U31A 4ADSG 3ER6A 5JS7A 4G0UA 4YT8A 5B2ZA 1GQYA 2ZIWB 4Q7QA 2UUAB 1ZKDA 2B5WA 3AUTA 4OHMA 3BS4A 4PCVA 1T8YA 2IXFA 3F6CA 4PNPA 4R68A 4YROA 3VPHA 4C6TA 4D82A 2G25A 4QQ8A 1RSZA 1ORDA 2OZLB 4O4IA 1B7GO 2FSPA 4BNVA 1JWBB 3A3NA 3E9YA 3KYDA 3MC1A 1BDIA 4J4TA 1Y4ZA 3EDQA 2J5QA 3NBKA 3DLHA 1CY0A 3BCHA 3KWJA 1OXBB 2VJOA 4AECA 2PSSA 2VAMA 5JXIA 3GLSA 3F2VA 3QJ5A 3Q1LA 2E4AA 2I2DA 2NM0A 2RAFA 1Y6JA 1S3SA 4C2AA 1G2IA 4YJ3F 4OHUA 1RABA 2HLHA 4IDOA 2AQKA 4ER7A 5J47A 4LWZA 1SUPA 1UDXA 1KVTA 1YCGA 2XNDA 3WHPA 1J8FA 2OT3B 4Q9NA 3WGJA 2COUA 3ZHUA 4JT9A 2XEDA 4X7BA 621PA 5JISA 3JAWA 3VH1A 1ESNA 1U7PA 1H2BA 1I32A 3GFFA 2I2CA 3ESRA 4II2A 5REQA 1YJBA 3RAJA 2GVNA 1BXRB 4I2NA 2ETXA 4M99A 1W49A 5J40A 1D4FA 3PC8A 4KYUA 3E58A 2WD7A 2YW2A 4N3AA 2EZTA 4KSCA 1ELOA 4ZGWA 3IH5A 2Z8YA 2GO7A 4AG5A 1LPNA 2VNJA 3HBAA 1NLUA 4F5DA 5HKLA 3B6ZA 4XUDA 4MV1A 3PR1A 1L5KA 3KCNA 2ZJ2A 2GN8A 5K0JA 4D9GA 2R68A 1DUVG 5HNKA 4YAWA 4PTLA 3HPQA 1YZNA 4LE0A 1MT3A 3QKTA 3CRZA 3ZW9A 4EFKA 5JASA 4LF8B 2DUMA 1YVEI 2QNBA 4ZOLA 2SECE 1R4MA 5TT1A 3FYSA 3WGIA 3NBXX 1P0PA 5CVDA 5H68A 3WIEA 3HFSA 2FXVA 1PQ4A 3HV0A 3ZV4A 3MQFA 4YMWA 5ALPA 4D26A 1GSAA 3TJZA 3FSRA 4U6QA 1TTTA 1RLOA 3OEEA 3ZG6A 4RWEA 5F3WB 3O1HB 3ITKA 4DCTA 3CPEA 3WK4A 2P6NA 2B0CA 5AFSA 4BAGA 3JPWA 5D5HA 5HMLA 4ZC8A 3BCSA 5DXFA 1Z17A 4RWZA 3SM9A 5IKXA 2CDBA 2OV3A 1OFHA 1HE3A 5CW2A 2Q3HA 2ZPTX 5DP1A 4PICA 3GVIA 2IU0A 1LQTA 1IG3A 2YXBA 2IHVA 5KWEA 3IP6A 5LQAA 3M6FA 4U7PB 3KQNA 2GK3A 1BFDA 4DR5B 1Y63A 2BLLA 3SZOA 3VX3A 4F3TA 2MSDB 1GPNA 2JJQA 2PKQP 1QLHA 2B5VA 1WF3A 3HCBA 3N3BC 4NBTA 4E1VA 4RK6A 4B7ZA 1SK8A 2ZULA 3RQSA 1X1CA 3HFJA 4LG1A 3OFJA 4ZI5A 4A5OA 3CRRA 4OHZA 1PUIA 1ST3A 1JEDA 1Y1SA 2BBTA 2IZ6A 1K7XB 5FOUA 3Q12A 5A6VA 3OQNA 2IBSA 5E9WA 3JQFC 5A9RA 4CM6A 3CKMA 4PGGA 3R75A 3F1KA 3QU2A 3UKDA 1U3DA 4J1SA 5HKOA 3HGQA 4GZ5A 4XGQA 4NAHA 3WRVA 3DTNA 4JKYA 4EWLA 2EF1A 1EFLA 2GHRA 2B8NA 3FRHA 4FNGA 3OHPA 1JAHA 2WOOA 4L4SA 4NU6A 1V5IA 2GETA 4RSGA 4WEOA 5U1PA 3RHFA 3QQPA 1YIAA 4R81A 4UJ5A 1OPRA 2AZTA 3ROPA 5L3VA 3P71T 3LT5A 1OXXK 4NFSA 3T12A 4MS4B 3CPSA 1JHOA 4YASA 3RWBA 3CZ4A 4BO7A 3HGMA 2JZCA 4MEJA 4KBFA 4LRSB 2ZDQA 3FZEA 1CY7A 1PR2A 2G17A 3HJHA 1GLGA 1ISMA 1M10A 1JLMA 2FSSA 2GD2A 2W6ZA 3NG1A 5HIMA 3W34A 4BV3A 4EAQA 2CC2A 3KEQA 4K3VA 4I50B 1RCFA 3M6IA 4K9OA 5GONF 3S0JA 3FCCA 1ZYUA 4EVIA 4MB2A 4RTMA 1EE9A 4LISA 4OLBA 2XGJA 1PR9A 3HCAA 3HKCB 5KJFA 4A7PA 1JEJA 4ACBA 2VXYA 3B70A 1N2IA 3JQEA 1E61A 1QJ4A 1TIKA 3CMMA 3L7OA 5BPHA 2B83A 4PBRA 4P7GA 1NQTA 2IXTA 4CKEA 2R1ZA 4QFBA 4RVHA 5LA6B 1BHO1 4FJ1A 3T1OA 2ZRQA 4PV7A 3P96A 3CW9A 3AR3A 2AEFA 4WV3A 2OLEA 4ZVRA 4F97A 3LTEA 1ZNWA 4ETMA 3ISTA 4BO4A 2SHKA 2QLTA 1QR2A 2CCGA 2H1VA 4CLEA 3WB1A 1GPDG 8GPBA 3R44A 4FFDA 4D6XA 4OQLA 4CIWA 3EVBA 3A37A 2JGDA 3ZE8A 4YP6A 1ZM4A 3BYZA 1ZJZA 3K30A 3QYFA 4AY6A 1VG0B 1MN6A 2JGDB 3TTVA 4YI3A 1PR1A 4QOIA 2V74B 5JPIA 2OFFA 1YR2A 2BR5A 2HQBA 3G88A 4QOHA 5AYVA 5ISMA 5K9ZA 3W8FA 3DOEA 1A04A 1OTHA 3BE6A 2BKEA 5B58T 4QPPA 5J5AA 1SU6A 1V1JA 5U4XA 1B6TA 2IP4A 4URXR 1BJRE 4LDZA 3KTOA 2JCGA 3F74A 2J87A 3GLKA 3GT4A 3Q2OA 4CE6A 1NXPA 1VHLA 3LHIA 3DUFA 4UBJA 5H02A 3AW8A 1OQAA 2YWCA 2G70A 4MUHA 4X0EA 4F2DA 1HMPA 2P6UA 5C1BA 3RYHB 2HD4A 1UUFA 3G0CA 4UBIA 1M8FA 2BMJA 3S8YA 4YCNA 4Z3OA 3UGJA 2UUBB 3ZV7A 2N3ZA 2Y1CA 3MHPA 3GEPA 4J6FA 2CGEA 4RETA 5KOJA 3EHEA 3R2JA 5B2FA 3AMVA 3NIFB 2XTNA 4I8XA 3VYUB 5AJZA 1FNBA 4TZKA 3D5QA 2R5FA 2QR2A 5FR2A 2O50A 1XWWA 3TAUA 1DZ3A 1PT9A 2PJDA 3F47A 5F2OA 1GLVA 1XTKA 2FZGA 2MSEB 4JI1B 3DWEX 4DSZA 2C96A 1GCGA 2PNFA 4TRNA 3RBAA 4KPUA 4MNTA 5ALNA 5CFLA 3QKUA 2RKBA 3P45A 2BFPA 1JNXX 2R85A 2Q0QA 4ZKDA 2BHTA 1W7AA 1CJUC 1Q22A 3B89A 1KE2A 1ONSA 2XB4A 4V3CA 2E55A 5ICCA 3DULA 2WSSD 2ZIZA 4FZRA 5A6SA 5K8CA 4Q4AA 4H16A 4HDMB 1SELA 2QK4A 1ZU5A 3GC6A 1EUYA 2IYVA 4YYZA 5JZSA 3N28A 4RL4A 3I9V1 1DCTA 1BDJA 3GLVA 2J45A 3LL7A 1GGEA 3DQQA 5CFRA 2DUNA 2YCBA 3SK0A 3SDBA 3JWEA 4WMLA 3D02A 3TZEA 5L6MB 2Q5OA 4EFLA 5K5EA 4NZNA 5LBUA 1RWOA 4KACA 1QO0D 4RD4A 5ALJA 1N6KA 4I4LA 1CF9A 5CX4A 2XODA 5BN3B 7AT1A 4GOOD 2X5KO 2OAEA 3PT5A 3HKBA 3WJAA 1FYVA 1AKQA 1MH9A 4ID3A 4CM5A 3TLYA 4QVIA 1CIPA 2Q99A 2XRYA 5IDQA 1A71A 3EWIA 5C52B 1WHSA 2WJGA 3NFRA 3LI2A 1E1DA 1YGPA 2YQ5A 3UKOA 4C08A 4KW7A 5TF4A 2C61A 1HETA 1WCWA 2B61A 3DEHA 3OX4A 1JH8A 4YDQA 2FFRA 1JSCA 1NVAA 1WDLA 2A9VA 2BF4A 1AKEA 2DWUA 2G9QA 2JHFA 3N6XA 3A04A 4M8SA 3WLLA 3NYQA 4BWYA 4UMDA 3WIDA 2GZ2A 3DMPA 3M4JA 1XA4A 2YZ7A 3BERA 4GUAA 2R66A 3LX6A 5HTKA 4EATA 3EQ6A 1BS9A 1GZ7A 4DSUA 3DE1X 3GO4A 4OUDA 1J9ZA 5KPDA 4TV9F 2HMYB 4B3RB 3TNDA 3TOXA 1AQNA 4QU0A 3THYA 1NVXQ 4OCZA 2K5UA 1GGFA 3JSAA 1JEEA 4GMKA 1WDWB 4V0SA 2PUWA 3SHFA 2GJ4A 2AKAB 3E2PA 2FX5A 3ZNQA 3ZR4B 3K20A 1Z4PX 2Q4EA 1DHRA 1ZCJA 1CD5A 2XNSA 2W2QA 3IQIX 1F8GA 3A4IA 4ND1A 4TTJA 2QQ0A 2F1IA 1DV1A 2KHZA 4INOA 3QWHA 4JUCA 1G5FA 2VYVD 1U9CA 1IVNA 4PC3A 3EFBA 1KZHA 1PL8A 3I4LA 3RROA 1YKGA 4QBHA 3OEED 3QVGB 1QLJA 1DFHA 3ZWQA 1A72A 5BSVA 3ZZTA 3HYLA 1W19A 1Y1PA 3FYCA 1KO5A 4YDSA 4CTNA 1T5OA 5G2OA 2BDUA 4BO9A 4BB9A 1P2TA 2PRSA 2XYPA 5E6UB 2F3RA 4PLFA 4S1PA 1MX9A 3EBLA 2JAOA 5H59A 5L3SB 3KU1A 1LNQA 1X7YB 3KWFA 3X1XA 5BV2P 3KKKA 1IN4A 2R7LA 2IYYA 1JIKA 3G85A 1E1QD 4FGUA 4LQ4A 2HZBA 4EF6A 2HJRA 4KLCA 4Q3BA 1N4AA 1N0VC 3SDSA 1AQ6A 2V4MA 4YJ3A 4E7OA 3VVLA 4BATA 3Q9SA 2WJZB 4IICA 2EG9A 4TV9A 4HEHA 4RBNA 4F9FA 4IQ0A 4MCJA 3CN7A 5IABA 2ADOA 1IB0A 1UC8A 1NXOA 1V6SA 2QL7A 3HA5A 1IXKA 4QJ4A 3SR4A 3UT5B 4B6GA 3VHLB 5CNIA 3H9QA 2KW5A 2WUWE 3E53A 3PZBA 1RXSA 4NFYA 2V6IA 2HOQA 2H63A 2IDJA 3DUWA 3ELYA 3V46A 5BWNA 2CDCA 2Y9MB 1FXWA 2Y05A 4O0LA 3ZYCA 1LSOA 4NBSA 3WNCA 2ID7A 2WA1A 2YWDA 5JSKA 5AIBA 1P9RA 2PLAA 1TJYA 4Z54A 3UPDA 3ZU5A 1XV5A 2CLEB 2VDLB 2W5UA 3NT4A 4R8SA 4BC0A 6PFKA 3KR9A 4I3GA 4DV3B 2D3WA 3MJDA 5JNWA 1WULS 5FBWB 1SKYB 1WBBA 4BUCA 2P9ZA 4ZIRA 5BXYA 3STHA 4DMRA 4N40A 2JFUA 5F5XA 1KJYA 2P5UA 1QK4A 5CHEA 1T2AA 2DE0X 2C2YA 1VDZA 2XQIA 4Q5IA 4CTKA 1KY5A 4QOGA 4ZDIA 1KA9H 1V1RA 4O8ZA 1KH2A 1JEOA 1RR6A 3OFKA 2VLIA 1T6BY 1PF7E 2NX2A 2XUHA 1W6RA 5DBEX 1PJZA 1Z6GA 5PNTA 3WGGA 1YS2X 5GZ1A 1GT91 1U11A 4MVWA 4R1NA 3X2EA 1UKVY 1TO1E 4G37A 2EVWX 4EABA 1K8QA 4YRKA 5CK5A 3JWIA 1TC2A 1FRZA 2OHHA 4IMPA 4TL8A 2KLHA 3GLHB 4ZYZA 1HE5A 3IX7A 3EGOA 3GFPA 3EOAI 1RQLA 3L7CA 3QKIA 3HEMA 1EP3B 1GTVA 4XM0A 2II6A 3EPHA 5EMNA 2DPYA 1VLLA 2E6KA 2KWIA 3DMTA 1I0ZA 2DT5A 2QE6A 3ABQB 3BD9A 1NY5A 4ARSA 3WQRA 5CG1A 2ZE6A 3KKZA 1XQXA 2IDMA 3PHHA 4RH0A 3PFHA 4Q48A 3K0AA 4DXDA 3WWDA 3I64A 3PQCA 1SXJD 3P0JA 3HSYA 2IODA 3B48A 1YASA 3BTOA 4JL8A 3M70A 4HGOA 2P30A 2W90A 3EVNA 3HO6A 4DQVA 1RPJA 1VMKA 5IDVA 1CE8B 3PC8C 2BFNA 3HCEA 1EESA 1MW9X 2OFXA 1QQ5A 3I5AA 4Y1EA 2D7JA 1YZ3A 2V8BA 1OGYA 1QJCA 3PFKA 4KPUB 1LW7A 4EG1A 1RFGE 2Y0BA 4KVFA 4N1AA 2QP3A 2ZGVA 5AVYA 4FP9A 2BJHA 1RWKA 4ALLA 1BHSA 2D2FA 3T7JA 1H1LB 1MOSA 1ZOPA 2A92A 3EF0A 1P5FA 3MRXA 3PITA 3THSA 3ZWBA 1XK7A 3PJGA 1E4YA 3GXOA 3SIPA 3T0FA 4XE5A 3WIUA 4XRGA 3IB6A 3LGXA 5D87A 3SSOA 2A5DA 3CNQS 4I81A 3L7AA 4BZZA 2PIAA 1PZEA 4DGSA 5K45A 5FOSA 1CS0A 3D6JA 4M86A 3RS2A 4HDNA 2BYTA 1YQQA 3LWBA 5E8JA 3G68A 2DQ4A 2HWWA 2YS7A 3ROMA 2R7KA 3RYHA 4TL7A 2ABWA 4WZBA 2H2IA 3SMVA 4IF4A 4MVJA 4FWBA 1Y5IA 4Y8VA 4YUVA 2WNSA 5AO9A 3JZFA 5L3QB 2ZJ1A 4I9HA 5FB3A 2C7OA 1N2CB 3KXDA 1UXKA 1QR6A 2QQ5A 4AG3A 1YJ8A 3RLFA 5ESWA 2BV3A 4O2BF 3SF8B 4GOLD 4O5OA 3H0CA 4QQNA 3FZNA 2H0QA 1PLKA 3G5TA 2ZRFA 4C6HA 4R2IA 5LL6P 1QZUA 2CYBA 1BWQA 4ND3A 4QYMA 2V7PA 3CW8X 4F6RA 3L4KA 4WH0A 1IK4A 4EUKA 2V1UA 1JFFB 2GAIA 3KQSA 4KBGA 1XP8A 2YICA 1VJ1A 3BIJA 4XWKA 4Q7KA 3U9LA 2GM5A 1MDFA 3CB2A 4POAA 4R3UC 4UAGA 2OP1A 3WLNA 5CDFE 2JCXA 3ZWXA 2P9CA 5J5VA 4PO8A 1GPJA 2HJSA 2LXNA 2VYND 2QZPA 1JJIA 4Z9FA 1I4OA 1JW9B 2G4VA 3EIXA 2GBCA 3E1SA 3HA7A 4OTZA 4JEIA 3UEOA 2Q1SA 3JTEA 3HDTA 4WXYB 3WK9A 4Q4HA 1ZJWA 1EK2A 3EXHB 1Z4IA 4A8JA 5BV0A 5JATA 3I04M 4PAGA 4AKHA 1LDEA 1Z35A 2CKMA 2A86A 3O93A 4TN1A 5F1OA 1OBCA 2CD9A 4E2FA 5JW6A 3PNPA 4PS1A 2B8WA 1B0ZA 4I50A 3WISA 2AC7A 3U1TA 4L8VA 3V8EA 3THWB 2CYCA 2WE7A 1YQGA 1NULA 4WI1A 1IHXA 1HKHA 1BO6A 2FW8A 3MMNA 1ZQ9A 5A4IS 2L18A 3NP7A 2J6CA 5HJ7A 2RAPA 5EP2A 3GGGA 4YMGA 5KMGA 4RMGA 5KI6A 1Q16A 2QROA 4RHYA 2CB0A 2ZJAA 4PGMA 5A3QA 1ZCZA 4LYJA 4YAJA 4KLRA 3L0DA 3LY5A 3CPHA 1GNQA 3Q5GA 1A9SA 2PZEA 5ALDA 3HJUA 3QWBA 1P74A 4HNHA 4C1BA 4B2LA 1KGDA 3KJIA 1UODA 2ST1A 3FNGA 4KO4S 3AV3A 4CM8B 1SC6A 1VTKA 4EECA 5A06A 3DB2A 4PHCA 4MGIR 1N5JA 3K8YA 1YZVA 3WVNA 4RKYA 4M8KA 3ZUGA 4ESHA 2EJTA 3K0FA 4KR3A 1UOQA 1K4KA 4BFCA 1Z88A 4WPGA 4AO6A 2KBEA 4L7QA 2K7FA 4M1EA 2NP6A 5LKAA 4F4IA 3RS9A 1J23A 1PVVA 4FYYA 1KL7A 4U8GA 4CJXA 3T4EA 4ZDKA 3FYTA 3C3JA 3PK0A 2QMOA 5LDGA 3SQMA 1QTNA 2E21A 3KNZA 4F4DA 1NBOA 5CVVA 4EB0A 1CUJA 1DEOA 2FVYA 2Y1GA 1R16A 1VE9A 5A03A 3CJQA 1C2TA 5E4FA 1VRVA 3G2LA 3L07A 2AW3A 2OAQ1 2XF2A 2G5TA 1WV0A 4XFJA 5CGQB 1MAAA 2NW6A 2O6HA 3PA6A 2BGNA 4RDCA 3T3EA 3RRFA 2E5LB 3S2IA 1AK1A 4PFKA 3T3HA 2LDXA 1XYVA 4TMFA 1E2GA 5BNWA 4WFIA 4ZRNA 5K6AC 4DR3B 4I9UA 4LI3X 4QXRA 3WQSB 1QWSA 2J3LA 2CNNA 1GA1A 1A7KA 3VR3D 1BDBA 4IO1A 2XQJA 3WJ2A 1O2DA 1LRLA 4DM3A 5JSUA 5KNBH 1NT2A 1Z6YA 5K3FA 1LGYA 4I3FA 3TBHA 3HO1A 1HT0A 4RGYA 4OB8A 2X86A 3WHIA 1CJSA 1CJTC 3GJYA 5K0SA 4MQMA 4J07A 2OENG 2VYCA 4ARVA 1A9TA 2MWMA 1B6RA 5EIEA 2YTZA 1V48A 3RSOA 5H3LA 4X66B 1D4OA 3LBNA 3M7IA 4KFUA 1S4QA 2HHLA 3AUYA 1IWOA 1FU4A 3DBRA 4P5DA 1J1ZA 3V4FA 1Z6TA 2JGMA 4X6XA 3FY4A 4FPXA 2WZCA 4HUJA 2Q62A 3OJLA 2NTEA 4YDHB 5K0BA 2O19A 4MHOA 1UMBB 5GWXA 3QFCA 3OEHD 1T8RA 3Q41A 4L6IA 3L0PA 1BDMA 4OJTA 1M8JA 3P9QA 4JS0A 1Z15A 4G0VA 3TIXB 4FYXA 4LHVA 4RTOA 4WIAA 4CV2A 4A8TA 3JVVA 4BCBA 4INAA 1M6YA 1T3LA 2C5EA 4IJWA 4O25A 4X45A 4QUKA 1NLFA 3RUHA 1G6HA 4CN9A 4JQCA 1RQPA 3C74A 4A4DA 4LF7B 3GBSA 3HJFA 3JZDA 4OFWA 3LFUA 3TNJA 1FX0A 1N2ZA 2OBFA 2RK4A 1QGDA 1S02A 4R1UA 2ZUTA 4RF3A 3KOUA 4DMGA 4QUJA 4I4IA 4ALJA 2PH5A 5C3MA 1E1CB 3KAPA 4DKJA 2JGEA 1QFJA 2POQX 2V5AA 2EFDB 2QU8A 3BB1A 1N8NA 3HE3A 1IPHA 4FFOA 1KJNA 4D99A 3WB9A 5JTTA 3QELB 1MQ8B 1KFEB 1J90A 1FQWA 4EJFA 1QOPB 2PXHA 1T3SA 2QSYA 4Y9RA 5KNDA 4FGKA 5F77A 4QUEA 3CCBA 3LP6A 3USZA 4AKTA 2PT5A 3T5AA 1FYEA 2RIRA 3LQQA 4S04A 4TMTA 4YRCA 3SLRA 1DS6A 5K01A 1JU3A 4YCCA 3CX4A 3CO0S 3PNBA 1QM5A 3I3OA 3QJYA 4X8LA 5F3RA 2Y93A 1WO8A 2WKPA 3R76A 3V8NA 4FKBA 4CDMA 3R8FA 3BK7A 1NQVA 4L75A 2RBKA 3WL4A 3BB4A 5DSXA 3RS5A 5HOEA 1Z13A 5JD4A 2JRLA 1DLIA 1P7PA 1PJTA 3M83A 1N3YA 4MUGA 4IIJA 4KXLA 3N7TA 3FWYA 4PZLA 2IYTA 1ABEA 1IONA 1DNPA 4FI3F 1QG6A 3ACDA 4UBKA 5DNDA 3KSMA 2BTQA 2ODQA 3DC2A 2C57A 3HYNA 4JITA 4QWMA 5CPBA 2NQ2C 1Q3TA 3IR5A 5KYWA 2H5LA 3FM9A 3P0EA 3DCJA 4DRXA 3W04A 3JQFA 1L7AA 3OUTA 4P33A 3G0HA 3EVTA 4DLLA 1YS6A 1I80A 4I4TB 4MRAA 1PL6A 2JH9A 3IUEA 3LQFA 2R62A 4WKOA 4TMVA 5HJ5A 1QIHA 2HK9A 2A58A 1VBMA 3KXKA 1U80A 2FLVA 3L7NA 4FYMA 4ZQIA 3I1JA 3RANA 3ELWA 2WY2D 1XDSA 3KOYA 3QXSA 3REQB 4YV2A 3EMBA 5CEEA 4YRQA 5AW0A 3H11B 3H1TA 2N42A 3DH0A 4Q3NA 4Z3KA 4M89A 2Q28A 4CCWA 4EX7A 3PEYA 1A8HA 1VKOA 1X86B 2ZS9A 3TI7A 3OT5A 3V1KA 3E84A 4F9TA 4I14A 4WJZA 1PJAA 3NT2A 3ECSA 4L50A 2VDJA 5H83A 1K7FB 1U28C 2REQB 5AI4A 4PPYA 4D02A 3ZUPA 3HB9A 3HCPA 3NBYC 5I8ZA 3CUYA 4AO8A 5LZ2A 1BMQA 4RU1A 3ADPA 5T4BA 5BW6B 1KI4A 2FJ0A 5FFNA 4MA0A 5I7RA 4EBBA 3AEXA 3UJPA 3AZQA 4GVPA 4GM4A 2EBFX 4YK7A 5TV2A 2WF7A 1NX6A 2SBTA 2VT3A 3PLRA 4H59A 5P8WA 3WK6A 3UY4A 2H51A 4I1OA 1P7ZA 1SUEA 2Q2VA 5ALZA 1CF2O 2EFGA 3E7XA 1V9CA 1OT3A 4URYR 4M88A 4V3BA 5COQA 3OOYA 1ZI8A 3UO8B 1MB4A 1X1AA 3AV0B 3BVPA 2FX2A 3AKYA 4QDZA 2XE7A 1P3JA 1CS4C 4FEEA 3IPAA 4JSRA 1R4AA 2JGFA 5AWFC 3O1JC 2IWHA 1CUFA 4EJSB 2GJSA 2Q3DA 3VR4A 2VDWA 2V7GA 3PKJA 5AHWA 4C43A 3H5AA 3C8HA 3SZLA 4E6EA 4YAKA 5JARA 5JSZA 2IH5A 1KI6A 4G0YA 4PAOA 2FW6A 2GN0A 1FEZA 2FUKA 3NUGA 3SYLA 2QLLA 5LU9A 2VN8A 2VT2A 3BIFA 1Y5NA 3AERB 3EXIB 1H9CA 5GM2A 4O3MA 1EUQA 4NCXA 1SA0A 1CIVA 1E1RD 1PO7A 2AHOA 4YO8A 5FUBA 5AJUA 2BGWA 4Y0VA 3FTFA 5EIBC 4REMA 5BVHB 1Q95A 2SNIE 2QS9A 1Z4KA 4DIDA 1B0AA 4UVDA 2JBAB 2Z58A 3QE3A 3K09A 3JQAD 2EIHA 2XBLA 4C0BA 1SB9A 5HM8A 3SPXA 2BEJA 2H59A 5LWQA 3STXA 5L7WA 1N6OA 2AZDA 4E7PA 1I7NA 5KHAA 3AVPA 3P2KA 4EA6A 2R44A 2X6QA 1R8XA 4YCAA 3FW1A 1SCUB 2X6TA 2O59A 5CB4F 4Q4JA 1Y3AA 2I71A 5FWNA 3CZMA 2NU7B 1SVIA 3IRUA 1TYZA 4MUYA 5FOTA 1YDHA 4M0KA 3MIIA 4WY5A 3NHUA 2ERCA 1FOEB 4GDFA 1XZMA 4NAVA 2M6SA 2Q5FA 4DBZA 2PUCA 2G1PA 4LE1A 2XB9A 1UPAA 1MEOA 4WOJA 2IUSA 2Z2ZA 3W5HA 5H70A 1USUA 4OB7A 3EIEA 4UNPA 5HIIA 4DR1B 2CWDA 2ASEA 2BI4A 5G3ZA 4BL5A 5C1OA 3I8OA 3C2QA 3LZDA 1NMQA 3ILVA 4NH4A 4P53A 5K3DA 4DCCA 3FPJA 1U2ZA 1YZYA 2YWHA 2AD5A 1T3HA 1NYLA 1FZTA 2O2GA 3QKSA 4XEHA 3K0SA 3UUFA 2XUZA 3PR2B 5F1PA 3O75A 4G5RA 4LN1A 4XX0B 5IBPA 1V8PA 3V42A 3W7BA 3H1FA 1NRJB 4HGPA 5L3ZA 4OP1A 2GTIA 2IP1A 1ZHOA 3FMOB 4Q1CA 1K4MA 4IFIA 4Q3KA 1OA0A 2HGSA 1QGUA 2PXXA 2IJGX 4X85A 3S1SA 4IRMA 2AUTA 4MYUA 5KJ1A 1B23P 1MH1A 3AVTA 2C8VA 2VF7A 4MS1B 1GU7A 3JX9A 4L5BA 4GC5A 1QYDA 2IH4A 3WYAA 1EI9A 1NNSA 3BAFA 2FWPA 4Q1AA 2YY6A 4IVQA 3F97A 2FPIB 1ULTA 4JJ4A 2G5GX 1MABB 4QRDA 5FLKA 5I9LA 5ICGA 3ZJTA 5J63A 3UZUA 1K6MA 3P9CA 3TBFA 1N57A 3D2AA 4HADA 1L7OA 4UMFA 4B4VA 3GCGA 4F9GA 3EZNA 2AR7A 1WHTA 4X6YA 4GQAA 4NC9A 3AB7A 1G21E 1JPUA 3OFNA 4IBOA 4N8EA 5DDIP 1S2IA 3G9TA 2PUDA 4DDVA 3MJTA 2XNHA 3OH8A 1HRKA 5KOJB 2JFXA 3HM2A 4ZZ1A 3TI9A 3KB8A 1U3CA 4JLOA 3L79A 1ODKA 4LSWA 1EHCA 2G1JA 4IGAA 3UHPA 2B4AA 1O96B 2Y1WA 3B9PA 3N87A 3Q8KA 5I9SA 4IWXA 3DL7A 1R50A 1G8YA 3VI3B 2Z2JA 5ALFA 2DY0A 4AKIA 1J0CA 1UMDB 1RAHA 4JBNA 1HFEL 2YVQA 4MJXA 4BFTA 2VLBA 4HAWA 2O14A 1XZJA 2YIMA 4NL4H 1QBKC 2P11A 3R7NA 1J1IA 1TADA 2HCRA 1O94C 4NONA 4P08A 3BE4A 3C7TA 3QHAA 1NQXA 4TWBA 3FCSB 3OY7A 5ALOA 2UZ0A 1XK6A 2DPGA 3LT4A 4CM9D 1HDYA 1H22A 4ZOBA 4EZEA 1X9IA 2GRUA 2OE2A 2VHZA 4G4JA 2D0PB 4KKVA 1L5LA 5BSMA 3DXXA 2AJDA 2QIOA 1VLZA 3NU1A 3KLMX 4NCHA 1D4ZA 1ZH4A 1E2JA 3C8ZA 1KYXA 3MCAA 4DRZA 5IZ4A 4F4CA 5H5JA 3ZHXA 2EZ9A 3U4DA 1AY0A 1Z45A 3KJNA 4QREA 1YJAA 1Y9EA 1U0FA 1TGYA 4M7RA 2ET6A 2J9RA 3F7NA 2M6RA 4YUWA 1YFZA 4Y2GA 3ZK7A 2VNIA 4IG4A 1T1GA 1T3GA 2J5KA 4HQKA 2H52A 3PD0A 5HFAA 2Q7XA 2R8XA 5KDOA 1KZGB 2AKYA 3N2KA 3A2NA 3OZ7A 3E22A 3O8QB 1C3JA 3IOYA 3QOYA 4R5MA 3VRHA 5HYVA 1ZR2A 1UOOA 4I08A 1DLJA 1HT3A 4TKVA 1KDYA 5JMTA 4HAUA 4DIBA 5JAUA 221PA 2DHDA 3A70A 3VR2D 5AJYA 2G07A 4G5GA 3IHLA 3V32A 2AI2A 2ZAIA 5GVSA 3DZBA 4XJSA 3MWDA 3BCRA 4FNOA 2E37A 2IUYA 3ZDCA 5IH7A 1Z5WA 1ZESA 3AY6A 2OXFA 4FIDA 3IVCA 2NPIA 4P0TA 3U7GA 4HUTA 2B99A 3QVXA 2FY8A 2C97A 1JXQA 1UK6A 3KPWA 2WFMA 1XP5A 1DBPA 1SD2A 2WFLA 4M22A 4OA5A 5DM2A 3ROEA 2JLXA 1FPQA 1ZK3A 1W9MA 2FW0A 2NQTA 4KQIA 4P4NA 2CUTA 3WKAA 1GVHA 4D0LB 1V11B 2DC1A 4RVFA 3KJEA 1WUJS 2AFRA 3NH6A 1CUAA 3ES9A 4HMQA 4PYMA 4TKLA 1N1DA 1UBLS 2HSWA 2XKAA 3VMMA 1E96A 4DKXA 3G7UA 3GROA 1N0IA 5C34B 4J0JA 1U3TA 1T9HA 1Z3IX 5AOCA 5CB8A 5JSFA 2CEAA 4DUZB 1B8NA 1TUGA 4MI6A 3TBKA 4A16A 1OLXB 4L07A 4HNAB 1VG8A 2C5HA 1YJQA 3AYZB 3OFVA 4R7TA 4YAOA 5KS2A 1BS2A 3ER9A 4UQOA 1AE1A 1COWD 1EZ1A 1V1MA 2ETVA 3DZJA 4X3CA 1E7SA 1OYYA 4HB2A 4XASA 2IE0A 3ST7A 2GEFA 4L15A 4LJ7A 1ECBA 1TUBB 4ZV4A 4MRMA 3KUUA 4YMVA 2BRUC 3LBYA 4KI7A 2FW1A 5DOZA 3ERCA 2EYQA 2A5FA 1MCZA 1IDN1 4QYWA 1CYEA 2HPHA 5EP1A 2JLYA 2Y3IA 4G0MA 5F33A 3WLHA 1SCKA 1ATIA 3BQ9A 2FPGA 2H06A 4EG4A 4KWHA 5HVNA 1EX1A 1H2AS 1X94A 5J4HA 1Q0RA 1SCDA 5BVGA 8AT1A 4CKCA 4WE3A 3MXTA 5T8KA 3AL3A 3A6LA 4C4SA 2JLVA 3W6OA 4CLOB 1TVMA 1FSFA 1TMKA 4KXMA 4DOMA 4M0LA 3FDZB 1YB1A 1SNYA 3A4TA 2QW0X 4WXEA 2JIDA 2V3VA 3M2TA 4AB1A 5IPFA 4Z4IA 4B35A 1QVRA 3UC9A 2ZRJA 2QTMA 3SYRA 2VZLA 3OETA 4EKNB 1GTG1 1JZTA 3PSHA 2DF8A 3OBBA 4D96A 4TTPA 1AD2A 2YL2A 1RTTA 1M7GA 1SUFA 3PUWA 4F7DA 4RK4A 4FYPA 2R4UA 4DCNA 4NIMA 1SCBA 3TJRA 3UMJA 1F8FA 4Z4QA 5K8TA 3DDSA 1QH1A 2BCEA 3P9PA 5DEOA 3F8WA 4PLCA 4G26A 1DX6A 1Z8HA 5AW4A 2ZT5A 1KMIY 1CP3A 2CZCA 2WP0A 2BSXA 2EJBA 1UH5A 2DLNA 5BNFA 3REOA 2YVUA 3L6RA 2A1TS 3X44A 3ZCUA 2Z1NA 1WQ3A 4ZN6A 3IIIA 1A9PA 1L5YA 2B6NA 3GRVA 4F12A 4B8ZA 4Y3UA 5HJEA 3PHGA 2O4CA 5EE3A 1G20E 1KIAA 1EU1A 1LI5A 1U1EA 4XTCS 3HG7A 1NW5A 4TL6A 4IDAA 2WJAA 3BRSA 2C04A 3ORYA 4YP1A 5HF5A 3VTFA 1XZLA 3PT9A 2ID8A 3ZOZA 1WXIA 3SIXA 4FZVA 4QNNA 3ZJUA 3E1GA 3ND7A 5BR8B 4CEHA 4K6GA 2C5GA 1H8EA 1VRWA 3OZCA 2UZ4A 2I1WA 1JKJA 4LA4A 3EXFB 3ZD8A 2OXCA 1PT8A 2QW8A 1HMYA 2ZI4A 3KZMA 2PM8A 1EHYA 1KU0A 3O0TA 1A5BB 2ZBVA 2P9JA 2ZZMA 1Z36A 2XDQA 5ENZA 4A0QA 3U3JA 1UEJA 5L4LA 5B3KA 4CF6A 1JECA 1OZHA 1I4EB 2GERA 4PFSA 4XH9B 3X3HA 4RJIA 1JHMA 3N70A 3TUZC 1OOEA 4HL6A 1M34B 3L01A 1YRWA 4JJ7A 3VDNB 1YE5A 5IWCA 5B1HA 1DIRA 1DQZA 2G63A 3OE7D 3AHEA 2X1MA 1R6TA 4J76A 4JA2A 1VGVA 1L1RA 2BFBA 3HY3A 3JZAA 2A35A 2MSWA 2ONYA 3ABZA 3R4CA 1NMEA 4KQKA 5FUWA 3WMXA 4MMXB 2WEKA 3TB6A 3I9NA 2OXIA 1AK9A 3LS2A 2AXQA 2ODWA 4MUBA 3C8MA 4UHCA 2P5SA 2CCJA 4A0GA 1SCNE 3DM9B 1JSXA 4M2LA 3DYVA 4RZSA 2WUEA 3FHCB 2Y77A 3BH7A 2Q1TA 5AVOA 2LPMA 4B7XA 4GZ6A 1NWHA 3C6KA 1LF0A 4ZZ2A 3GL9A 2GVZC 3HACA 3KOXA 4Z4EA 1K3UB 2X19A 3WGUA 4EG3A 1DCMA 3CURA 5K0EA 3P5BA 5JG7A 3WYBA 5C35A 1NI4A 4NWIA 2KJQA 1TAQA 1LI4A 4Z9BA 3D4BA 2W8BA 3H6KA 2FWNA 3OJEA 4GOND 1JG1A 4UMVA 2VZ0A 5FIUA 4RFSB 1IXYA 2XY4A 3V8MA 1R5JA 3PQ2A 2QHXA 4D0GA 3E61A 3F6EX 3UANA 1JHZA 2QZZA 2XUFA 2WPDA 5CA1F 4HDQB 1V37A 3AP2A 1J0DA 3WLTA 1HYHA 3B85A 2FN4A 2QN6A 5E7MA 1MA0A 1TRKA 3O2SB 4OJQA 4URWR 3IVRA 4RD0A 3DEJA 4CU2A 4BYGA 2QR3A 1QC5B 1G4AE 5TE9A 1MO2A 3UYLA 4WSOA 4RTQA 1CY6A 5FBRB 1EA5A 4CKBB 2QPLA 3QNUA 3H1EA 2CXHA 4BJ1A 1GZUA 4MQFB 5KNCA 4N39A 1Y1KE 2OCGA 3H8SA 2FSHA 1GZ4A 2A14A 4MYSA 3EZ9A 3OG9A 1Q0TA 4BY9E 1NBMD 3MW8A 3EDMA 2H1LA 2IEDA 1IZZA 2PS1A 4E94A 3QMPA 2IYOA 1KMNA 3C3WA 5IBCA 1A9RA 4A82A 2P0AA 2YVAA 4JI3B 2OGSA 4QGSA 2UZ1A 1JEYB 1EVLA 4FHFA 3Q3HA 2QT0A 5JANA 4D97A 1JA1A 1P33A 4QOSA 3TNYA 3P27A 2XZPA 2H9IA 3TLMA 4R71A 3M3DA 1Y3DE 4LNHA 3DBOB 2B35A 3DLAA 3DR5A 4KE7A 4TTVA 1XZEA 3M1IA 4DN6A 4RHFA 3CLRD 1IYZA 3O9VA 4G84A 2EHJA 5C8YA 1U94A 1QIKA 2HU7A 2W83A 3WKEA 2E0IA 4X64B 1CRZA 3B12A 2CFOA 3MA0A 1P8AA 4ARUA 1I5RA 4BQEA 3GWZA 2XWQA 1E7WA 3D8TA 4KQ1A 4FE3A 4OK6A 1QNLA 1JFSA 4GWKA 2WMYA 1TD9A 4O59O 2FZ5A 1FUIA 3EPLA 1XZNA 1M2NA 2ZWAA 3MMSA 5A9SB 3UG7A 4Z7JA 2YJTD 2ZR9A 3CBGA 4MQLA 2XNDD 5G0VA 4F4FA 3JVEA 4W8GA 2GXSA 5DTIA 3OKCA 1DAIA 5HKKA 1UKAA 5IVIA 4P34A 1ECFA 3FIUA 4FFRA 2WM3A 1DTEA 3A9VA 4YXFA 4DR6B 5KU1A 1E3DA 2PEZA 3OM9A 5T6MA 3T9FA 1QIFA 4TTIA 3UUEA 3F3SA 4AURA 1C30A 3VVBA 5JI3E 1WG8A 2X8AA 4JMLA 5IDWA 4K9PA 3IMKA 3P2YA 1CB7A 5EN4A 2A33A 3A6PC 3LA8A 3D0KA 3O84A 4M9CA 3BGIA 4O4LF 4XPZA 3U0BA 1AQLA 4FZJA 1WXHA 4DJDC 2ZUUA 4GBGA 1M2VB 3TFWA 3OI7A 3Q7SA 3U3ZA 4DCPA 2ZRDA 5KWSA 3B8EA 1EVEA 4GG1A 3VV2A 5JHGB 1O8CA 1Q17A 2WOJA 4DEXA 1RU3A 2CMKA 4DWJA 2QLJA 5G41A 2AG1A 1BEEA 3WYGA 4RHTA 3IUYA 1T3ZA 3ILHA 4MDHA 2E89A 1RPZA 2UDPA 1W36B 2Q5LA 2VBCA 3B53X 4A26A 2EZ4A 1Z2CA 3H4TA 2RK3A 4R0VA 3GV0A 3ANXA 5DI9A 2IQ5A 3Q8XB 2GM3A 3KHUA 1L7VC 3NBAA 4NK4A 3VSBA 1PEYA 2BEUA 1RW4A 4XGIA 2HRDA 4FR2A 4YH1A 3QVLA 1HWYA 2OYSA 3DZ8A 4GIBA 3C7CB 4ZD6A 1ZICA 1XQ1A 2X5JO 3HR7A 3O8NA 2ZQYA 4I36A 1G41A 4RZXA 5HZGA 1O95A 3K5PA 4H18A 4TS3A 4MW1A 1NOKA 4GMDA 5F4ZA 3Q7IA 5FPTA 4DLKA 3AF2A 4ND4A 4X7RA 3K4QA 4XR9A 1R6XA 3FA2A 3R0IA 4JLDA 2GFIA 4MHTA 1O9HA 1C81A 3JR7A 3MF4A 4Y6GB 3UYKA 4TVSA 3H42B 2PZGA 3RVOA 1P2GA 2B20A 4KPYA 5EWMB 4M9UA 3SZRA</