3EY4A

Further studies with the 2-amino-1,3-thiazol-4(5h)-one class of 11-hydroxysteroid dehydrogenase type 1 (11-hsd1) inhibitors: reducing pregnane x receptor (pxr) activity and exploring activity in a monkey pharmacodynamic model
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
259
structure length
259
Chain Sequence
EEFRPEMLQGKKVIVTGASKGIGREMAYHLAKMGAHVVVTARSKETLQKVVSHCLELGAASAHYIAGTMEDMTFAEQFVAQAGKLMGGLDMLILNHITNTSLNLFHDDIHHVRKSMEVNFLSYVVLTVAALPMLKQSNGSIVVVSSLAGKVAYPMVAAYSASKFALDGFFSSIRKEYSVSRVNVSITLCVLGLIDTETAMKAVSGIVHMQAAPKEECALEIIKGGALRQEEVYYDSSLWTTLLIRNPSRKILEFLYSTS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 11-beta-Hydroxysteroid Dehydrogenase 1
publication title Further studies with the 2-amino-1,3-thiazol-4(5H)-one class of 11-hydroxysteroid dehydrogenase type 1 (11-HSD1) inhibitors: Reducing pregnane X receptor (PXR) activity and exploring activity in a monkey pharmacodynamic model
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 77
structure length 259
sequence length 259
chains with identical sequence B, C, D
ec nomenclature ec 1.1.1.146: 11-beta-hydroxysteroid dehydrogenase.
pdb deposition date 2008-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ey4A00
2HDHA 4JNKA 3KETA 5AYVA 4A73A 3WFJA 4FB5A 1YDEA 5L7WA 2CZCA 1ZEJA 3NT4A 4LMRA 4UUMA 1QRRA 5A9SA 4GLLA 3X2EA 1W8DA 4DQUA 1DLJA 4YR9A 5F1OA 3Q2KA 2XOXA 2ZYAA 3GR6A 1ISMA 1Q2XA 2ZJ0A 4Y6SA 2FY8A 4NBWA 4R1NA 1WXDA 4FFNA 5BR7A 2P5UA 2C07A 2PNFA 3IJRA 4J1SA 2NNLD 3AI1A 2I3AA 5TRTA 3LC7O 4KWIA 3RC9A 3SBOA 2C7VA 3LF2A 4DBVO 4XIYA 3B70A 4BNZA 3HFSA 3U4CA 1HDRA 1JVSA 5BQFA 4OAQA 4HKTA 3UUWA 3F46A 2JD0A 5KIAA 2W98A 4GGOA 1LLCA 5GZ1A 1I10A 2O50A 5IDXA 1MXFA 4IZHA 3C7CB 4YPOA 4R1SA 3D3WA 1UAYA 4FJ1A 3UCEA 1J4AA 2DTDA 1KVQA 1VSVA 1T1RA 3BHMA 3H3FA 4PLGA 3VHRA 1OZAA 2IYOA 5I9NA 4L73A 3WGYA 3WMWA 3H9UA 3JQBA 2BF7A 3ABIA 1HEUA 2VYNA 1LDGA 1BHSA 3IQDB 1BXGA 5TF4A 5TS3A 2PKRA 1D1TA 4Z6KA 1U4SA 3OBBA 4H7PA 3FBTA 1YE3A 1FDWA 1XA0A 1W6UA 3AFNA 4D43A 2O3QA 3JD1A 3ZN2A 1IUKA 4BO1A 4XA8A 3L4SO 2Q1WA 1ZSYA 4KWHA 5JMWA 1DRVA 3TJRA 5JDIA 5L4LA 3OQ6A 2Q49A 4U0JA 3VZRA 1HDCA 7ADHA 2BFPA 3GUYA 2YV1A 3BMNA 2BI7A 1NYTA 4CV2A 4IDGA 3ZWXA 3M1AA 5CDTA 4E13A 3WNQA 4YAIA 1QV7A 1EBUA 1DFGA 1IZ9A 1R4NA 3A06A 2DLDA 2Z95A 1DC5A 5IN5A 4FFRA 3GZNA 4II3A 3RD5A 4EZBA 4A2CA 3SJ7A 5IN4A 3S8MA 4M87A 1P1FA 2I99A 2OFPA 1VL6A 1Y8RB 3E03A 1PS9A 1PJ4A 4YACA 1E6UA 3GHYA 1DBVO 1NAHA 1WW8A 3F3SA 3HN7A 3KZVA 3OETA 3WJAA 2IE0A 3HB4X 1Z7BA 1P1JA 4CMGA 1BMDA 2G76A 2ZYDA 2EW2A 3OA0A 4PVCA 4E3ZA 3DMYA 4XYEA 3ICCA 4R16A 5CEJA 2IYPA 2YHIA 3K92A 3IP1A 3GZ4A 3PJGA 4R1UA 4YYZA 3D1LA 1R0SA 1V6AA 2BMAA 4BV9A 4R9RA 4I08A 5IJZA 2FMUA 3GEGA 3JV7A 3DBRB 3OJEA 3KYCA 3IUSA 1NHWA 1B2LA 1R4MA 4WEQA 2J3JA 2RBEA 2RHRA 1MFZA 2Y1DA 1CYDA 1ZUD1 2VCYA 5U1PA 1W73A 4ALLA 4EUHA 3ANNA 2DU8A 1PGQA 3CSDA 2VYND 1N92A 1L1FA 4S1VA 5LCXA 3WGGA 4CM8B 5EERA 5JXWA 4CQLA 4I5DA 4DYVA 4I5GA 3DFUA 5F1KA 3P19A 3JQFA 3K8ZA 2YFQA 3GA0A 3QQPA 1HDYA 2AQ8A 4ZU3A 4AJHA 1E3JA 2FWMX 1TA4A 1S7CA 4CUKA 3E5MA 1LDEA 4B4OA 3D0OA 2GZ2A 1XIVA 4GX1A 4YJHA 1UH5A 2BLLA 2Q4EA 1HE5A 4MO2A 4OYRA 3VKVA 2W4QA 4JIGA 2YQ5A 4J4TA 3B1JA 3RFVA 5JY6A 3KXDA 1PSDA 1V3TA 3JQ7A 1JW9B 4IXWA 4CUJA 1HYGA 2VN8A 1TLTA 5F21A 1BW9B 4IJUA 3U4HA 1WMAA 4CR6A 3HWRA 1LRKA 1ID1A 4K6FA 3U4IA 3STHA 1YOVA 2SCUA 3PHLA 1XSEA 3DOOA 3RIHA 2VHZA 3WQRA 2P9EA 3DFZA 4RVUA 3SEFA 1KY4A 1H9AA 3ON5A 4M49A 1TB4A 4CM9A 5L7TA 2P5YA 2WJPA 2DFDA 3INTA 3I3OA 2JCYA 4BGIA 4OXKA 1KEWA 2PLAA 4Y67A 4DQVA 3HDHA 5B4TA 5HTOA 4UUNA 2G17A 4ZQFA 4HXYA 3GT0A 1IL0A 3DHEA 4JCOA 1NX6A 1K6IA 4I5EA 4NZ9A 2CMDA 3DMTC 4DA9A 1CF2O 2FR0A 1ZCJA 1E3SA 1C1XB 1LA2A 5HA5A 2GERA 4J43A 2D3TA 5B37A 3DXFA 5FI5A 1MP0A 2H1SA 2YW9A 3PK0A 3GFBA 3OMLA 4W9NA 2QIOA 5MGBA 3F6YA 1YBAA 3NV9A 2ZCUA 1ONOA 3KRTA 1ML3A 4E5NA 1UP4A 2GZ3A 3FNGA 5EQDA 3AY7A 3B20A 3JD3A 3IIEA 3MJCA 4RGBA 4D7AA 5JAMA 2H63A 2VHYA 4JJGA 3RI3A 3CKYA 4B3HA 4HNGA 5ER9A 4EW6A 2EGHA 5L53A 4XDYA 2FHSA 1ZJZA 5CDSA 6LDHA 1N1GA 1Y8QB 3KYBA 1ENYA 2NV6A 4WKGA 1PJCA 3W8EA 4IS3A 1WDMA 3K31A 4GLOA 2W8ZA 4PLFA 1MB4A 1PWXA 3DTYA 3JQ8A 3BZUA 4U6SA 2B37A 3DZJA 1ZSNA 3NT5A 1AXEA 1E1KA 4UVIA 2RIRA 4IQ8A 2FRDA 2GD1O 5MDHA 4Q3BA 1Z7EA 2CNBA 3UW3A 2J3HA 4WLOA 4TRNA 3CE6A 3LLVA 1F8FA 1EMDA 4PLZA 4M54A 1BDBA 3PWSA 1G6KA 5K9ZA 2Y99A 2BRUA 3MZ0A 5I7FA 4ZJUA 2X5OA 3Q2IA 1U1IA 4PVDA 3G1TA 5A06A 1H2BA 3KBOA 3NDIA 1NAIA 3Q3CA 1PS0A 1O94A 2A35A 2W90A 4IINA 5H81A 3T4EA 1NQTA 3PRJA 2AXQA 3F4LA 1LDMA 3E9NA 1LDNA 4RPHA 4NBVA 3ASVA 2UYYA 2VTDA 4CM9D 1R37A 5DCWA 5DBFA 3WMXA 4IZIA 2HRBA 4E30A 3FN4A 3I9MA 4FD3A 4ZQHA 4AICA 3PVZA 1E3EA 3G49A 2J8ZA 2FSSA 4BNVA 2NM0A 4FFPA 4DL9A 1V35A 2ZIZA 5JW6A 4BNGA 4JROA 4CMKA 2NU7A 5ILOA 4OOEA 1E3WB 1E7SA 3A1NA 2YY7A 3I6QA 1UUFA 4MVJG 3VPFA 4AJ1A 4WEOA 4WUVA 4PLYA 4EJMA 3JD0A 4YJGA 3ORFA 3JQCA 3KO8A 2I6TA 2G5CA 5CEFA 3U09A 4WLVA 1KVUA 5DN9A 2Q3EA 1GTMA 4FSHA 1B0AA 3FR8A 4RPGA 3P5SA 4TROA 4MVJH 3ULKA 1GY8A 3GGOA 3O8QB 3PQFA 5A03A 1I30A 1T25A 3V2HA 3BMOA 3H4VA 3K6JA 2PV7A 3UHAA 1YWGO 2FPPA 4CPDA 4ZN6A 1F0YA 2B83A 4XB2A 1CJCA 2HMUA 2R00C 2HRZA 4XR4A 4FC6A 2HO5A 3D7LA 2HMTA 4RZHA 3GPDG 4U7WA 4E5PA 2GNAA 5F3RA 1XLTA 1SOVA 2W2KA 2PZMA 4CMCA 4FBGA 2CF6A 3GVXA 1CQJA 4Z9YA 1WPQA 3OJFA 4QT0A 2EERA 4NNJA 2NSDA 1I2BA 3S1LA 3MOGA 5TX7A 1Y5MA 2O3TA 4GBJA 5C7IO 3ZU2A 1E3IA 3K73O 1UXHA 2ZATA 5IXSA 3TFOA 2PA3A 2NUAA 1L7DA 1PR9A 1WZEA 2EW8A 2IEDA 4AJNA 4EGFA 1FXSA 4WCDA 1CRWG 5U9CA 3DBHA 4UVGA 5A4DA 1HYHA 2C54A 1P45A 1JAXA 2YJZA 3WLEA 2CF5A 3RCBA 4DPKA 4WCFA 1PJ3A 3U9LA 2DC1A 4NQZA 5TC4A 3W6ZA 3E18A 1B8VA 4KTVE 5C5IA 5L45A 2ZQYA 4D79A 5DCUA 3H3JA 3ZHBA 3HDYA 4GX5A 3VZSA 3DAPA 3DL2A 4XQCA 1XKQA 4BNKA 5CEEA 1GYRA 2YDYA 4L4RA 4MVJF 3KHUA 2X22A 3ZWCA 3HHPA 1EVJA 4AJLA 4OH1A 2ZB8A 5DCYA 5JMPA 3VZPA 3ZV3A 3CMCO 5L40A 2Q1TA 4WPGA 1EEHA 1GADO 4MVJM 3GY0A 1P74A 4GKVA 2ET6A 3SLKA 3V8BA 3ZV6A 4WOJA 3A9WA 3PIDA 4L75A 5IF3A 1WAMA 4RLSA 1ISGA 3JQ6A 4D42A 5G4KA 1PU2A 5G0VA 4J2HA 3KEOA 3CXRA 4CL8A 1HSOA 3WWYA 3KEQA 3GNTA 3ZU4A 1UJMA 4FFLA 1VM6A 3BTUA 4LCEA 5A02A 3V1UA 4RQUA 3ST7A 4BNJA 1GL3A 3ENKA 4ND1A 2CD9A 2Y66A 4ND5A 1O95A 3RC7A 3GAZA 3MOIA 2NVUB 1U28A 3FPCA 4RQTA 3HN2A 4GKBA 3DHYA 4CQMB 2D5CA 3WS7A 4R1TA 4D0RA 1ZJYA 2C82A 4L74A 1ZK0A 3IUPA 3ZNOA 1K0UA 4CLRA 4MVJI 3EAGA 1QLJA 3I9KA 4JP3A 5T57A 3PZBA 2Z1MA 4IIUA 1ZXBA 4N54A 1B15A 4QECA 4ND2A 1PGOA 4TZKA 5CHEA 1QYVA 2H6EA 2Q2WA 3RFXA 3ZNPA 1ZXLA 2IXAA 4JP2A 4E5KA 3JQDA 5JDCA 5KNLA 4FR5A 5FWNA 1P9LA 1SBYA 4AJJA 1Z82A 2I9PA 3GN1A 3QIVA 1CWUA 5IZ4A 4EUEA 3H9EO 5JAZA 3KLPX 3I9JA 5K6AA 4L8VA 1VKOA 1R0KA 4QO8A 3BTOA 1LDBA 4JBHA 4AVYA 3GEMA 2VWHA 2J3IA 1EQ2A 4TVOA 4XGNA 4CM4A 5TQVA 5ES3A 1LU9A 3EVTA 4E12A 3PIIA 2B35A 4BO8A 4FDAA 3BMQA 1AN9A 3D5TA 1TT5B 2G1UA 1FDSA 3PHJA 1C3VA 2Q1SA 4UVHA 1UZNA 2F00A 3JYOA 4OO3A 3OQBA 1EZ4A 3M2PA 2AQIA 5BSEA 4CL3A 1RYDA 2ZTVA 2HSDA 2GYYA 1UR5A 1ULSA 2BGLA 3ZHXA 4BS9A 5B1YA 5H83A 3QLJA 3OH8A 4OJNA 2V6FA 4L76A 1JKFA 2P9CA 4WE3A 3CUKA 2HKIA 2NWQA 4FOOA 4J1NA 1QV6A 2ZJ1A 4MJLA 3C85A 1O89A 4EI2A 1DC4A 2PR2A 2TMGA 1J6UA 3FTNA 4M55A 3OQ1A 4M89A 5L4NA 4JGBA 3NGXA 4FIZA 5A1TA 3ZV4A 1GUYA 3WGQA 5GZ6A 1I3KA 3L4BC 1J5PA 4IPTA 4A27A 3RUCA 4JK3A 3WYBA 3MJ4A 2D0IA 1M6HA 4OGWA 2BD0A 3DO5A 3PZRA 2DTEA 1GZ6A 2GRAA 4Y6RA 4PLPA 3JTMA 1I0ZA 4O1MA 1HLDA 3MTJA 2VHWA 3GUCA 3K2BA 3OJ0A 5T8KA 3VH2A 2O3UA 4BNLA 4GAEA 2G0TA 3LLSA 3TWOA 3GVCA 1IHYA 3O03A 1YB5A 1MC5A 1LC3A 5CFZA 1E7MA 3OF2A 3I4CA 2JFHA 1Z6ZA 2BFMA 3H6KA 4UEKA 2P9GA 2IZ0A 5A3JA 4WNCA 1D4FA 4ID9A 1A27A 1XU9A 1P31A 2O23A 2GLXA 3VTZA 2C5EA 3I5MA 1LTHR 4R5MA 5JNLA 2VOEA 3MJSA 2NADA 1QP8A 3UKOA 2WYVA 4LISA 4FC7A 4IQ0A 4J4HA 1EUDA 2X0RA 3QVOA 1P77A 3KTDA 3LT0A 4BNFA 2ZTLA 3AW9A 5A3VA 1JQBA 5KOIA 5COBA 3Q1LA 3DC2A 1IOLA 2DBZA 3TOXA 2NTJA 5JFOA 1EQUA 4K26A 4BKPA 4OL9A 4XGKA 3IOYA 4YT5A 3ZCXA 3AJRA 4ESOA 3AUUA 1QKIA 4KZPA 2CDAA 1B26A 4ZA2A 5EL0A 1GCUA 2D59A 4FQ8A 3VVBA 3TPCA 3KLMX 3L6OO 3BAZA 4FS3A 1R66A 3QWAA 1GDHA 3JCZA 2VRCA 3KYDB 4ZD6A 4ZGWA 1U3UA 4Q3AA 3FNEA 4BNYA 4L4SA 4CLOA 3GGPA 2AHRA 1YJ8A 4F6CA 4JJIA 5EJ2A 4JLWA 4R3NA 4K28A 3HE3A 2Z1NA 3TFQA 1OC2A 4J16A 5HRUA 4NJMA 4YXFA 5K0ZA 2HUNA 1U8XX 1GEEA 2DM6A 2NU6A 8LDHA 3NAQA 1XEAA 4ZVVA 2VNSA 3DAGA 4N7RA 3WYCA 3OM9A 3W8FA 4URFA 1NWHA 4BKRA 3VPXA 4DQXA 1Y81A 1KVTA 4FW8A 4CMEA 5JBIA 4YJDA 1XDWA 1ZNQO 1AUPA 4IBOA 3VPSA 3QWFA 5ICMA 2AEFA 4HFJA 3IJPA 4EEXA 3RBZA 3CIFA 3V5NA 3RAJA 3ZGYA 1ZKMA 3WTBA 3WYEA 3HADA 1E92A 4N18A 3QJ5A 1HT0A 1K6JA 4BO6A 5EQFA 3WX0A 3DB2A 4GVLA 1VJ0A 3LC1O 1QXSA 3KB6A 4CMBA 3WGTA 4YT2A 4CM8A 2A9FA 3NUGA 4KMSA 1X7DA 1Q0QA 5CAEA 1C14A 4OSPA 2BH9A 4OHUA 1M67A 3QWBA 1HZJA 2PZJA 4IXTA 1JN0A 3AFMA 2YUTA 1U3WA 1NVMB 4QO7A 1X15A 1DIAA 2HU2A 4GMGA 1UXKA 3INGA 2HQ1A 3RU7A 1XU7A 2B4RO 4EJ6A 1PR3A 1I01A 1NR7A 3OIGA 4PRKA 2BFAA 2FP4A 5IZCA 2E48A 4PLWA 2P68A 5KVSA 5TJ9A 1SNYA 1O0SA 1BW9A 1Q1NA 1H6DA 1A72A 1PGJA 5IDWA 3GEDA 3SX2A 1OFGA 1XHLA 1RM5A 2I65A 2FR8A 2PH5A 2JHGA 1TEHA 3AM3A 2BGKA 3DBVO 4DGSA 2X8LA 1Q7BA 2VRCD 5A04A 3RROA 4YAGA 2QZ9A 1M66A 2AW5A 3JQGB 1PZGA 3ROPA 2R6JA 4IDFA 3VPHA 5G2OA 2EG9A 4I5FA 1LC0A 2OL4A 1EUCA 4NBRA 5EESA 5DOVA 4BKOA 4IJWA 1ISIA 2YFHA 1YXMA 1RM0A 3PJFA 1U2DA 1P1KA 1P3DA 4PIVA 1AGNA 4BKQA 3AI2A 1TVEA 4RL6A 1H6AA 2DBQA 5DT9A 5ENDA 4PG8A 4MIEA 3F9IA 4TZTA 3EW7A 2EXXA 3BA1A 4BIIA 3FI9A 2QZZA 4XR9A 3L6EA 2EJWA 4CLXA 3V1YA 2EWMA 2O4CA 1MXHA 1GFSA 4AJEA 5HBRA 4LW8A 4LRTB 1X7HA 2P4QA 2QX7A 3OECA 1HL3A 4P22A 1E7YA 3EYWA 2GN9A 1QMGA 3U4DA 4PN3A 2GN8A 4RV9A 1SEVA 2VWGA 1QR6A 4TKMA 1M6WA 2V6BA 3U0BA 1C1DA 4UUPA 2AMFA 5A9SB 1UP6A 3NTOA 4J91A 3WGHA 3PJDA 5JYEA 4J7CA 1I2CA 4XQGA 4MINA 4ZHSA 4BO3A 1XGKA 3HNPA 2VHVA 5B4VA 1KYQA 2P4HX 4IIVA 1HLPA 2BFOA 2AG8A 4OXYA 1I24A 3MJVA 1NNUA 1PJQA 1ZO8A 3GDOA 4BB5A 2HMSA 4BMSA 3ADOA 2NU9A 4MP3A 1ZK3A 2IZ1A 3BXXA 3RUHA 1O8CA 1Z74A 2QRJA 5DBGA 4DIFA 1HETA 1XWFA 2LDXA 4QFDA 5TGDA 4TKLA 1PIWA 1T4DA 3AU9A 3D3WB 2OHXA 2QRLA 4F46A 4RVHA 3TN7A 4BVAA 5GMOA 3HG7A 4HFRA 3F47A 1FF9A 1E1LA 1ZSVA 4KUGA 4PG4A 4CR8A 3MJTA 3N7UA 2OBNA 1EK6A 3PYMA 3WG9A 4EJ0A 2XF8A 4E0BA 4ALNA 1YBVA 3AOEC 4GH5A 1BXGB 1B14A 3IKVA 4J1TA 2C2XA 4Z0PA 2I66A 1V0JA 3E9MA 4H15A 3RKRA 1OMOA 1VI2A 2HK9A 3UCFA 3EY4A 5BSFA 2XAAA 3ASUA 5FI3A 1L7EA 1N9GA 3GOHA 1LRLA 3H5NA 3UF0A 2O3RA 4YRBA 2JKVA 3EHEA 1Q7GA 1VLLA 3HDJA 2BELA 1O9BA 4BUCA 4EBFA 1GD1O 1MG5A 5COQA 3MCVA 4A03A 5KVQA 1EDOA 3KSZO 4M86A 5DNAA 3O8QA 1CQIA 2CDBA 1H0KA 4DMLA 5F5NA 2X9VA 4QTZA 1PQPA 3CINA 2Q2QA 1KVRA 4ALIA 3WXBA 2QHXA 3GNSA 4KQWA 5T67A 1R4NB 5EN4A 3OFSA 2PZKA 3GZNB 3D3EA 1N1EA 2O7QA 5FF9A 3BYZA 1Q0HA 1ZBQA 3AUAA 2VYVA 3W6UA 4CUZA 4E2ZA 3C8MA 1W4ZA 1GZ3A 1YH3A 4ZQBA 3TZHA 1T26A 3ZH2A 5HS6A 3SC4A 1LSOA 3GHHA 3AU8A 1N8KA 3G79A 4BMVA 3EZYA 4HV4A 1GUFA 1VRWA 4E4YA 3NTRA 1RJWA 5KJ1A 2GO1A 5KJEA 3PP8A 2PGDA 1DDOA 4MVJP 5JLAA 5G0WA 3D4OA 3DZKA 5TJHA 3IP3A 3O9ZA 5I7EA 3VAZA 2BGMA 3OHSX 3RQSA 3BTSA 4Y8VA 3NJ4A 3PPIA 4D3FA 4YT8A 3PI7A 4YJFA 3ZZNA 1R4MB 1C0KA 2CY0A 4Q39A 2PY6A 1P1HA 4FFMA 4E5YA 1GQQA 3P2OA 1PZHA 1EFKA 4WGGA 3NJ8A 3ANLA 1SB8A 3RWBA 2PFGA 1LEHA 1ZVMA 4Q3EA 4CQLB 4DPMA 3MWEB 1HWYA 3UH1A 4P8RA 5T64A 2W2LA 1ISHA 3W8DA 4PZEA 3K9QO 3EZLA 3CTMA 2HK7A 1T24A 2X0NA 4YJHB 2VWQA 1GZ4A 2DVMA 3DR3A 1Y5RA 1GQ2A 4CR7A 4CMIB 3GLQA 1RPNA 3JQ7B 2O3SA 5F5LA 3LVFO 1K6XA 2NTVA 1GCOA 4NH4A 1TXGA 3QW2A 4CM1A 1T1SA 3MEQA 4UULA 4YAKA 2P91A 1YOVB 1LSUA 3G0OA 4XGIA 3TDKA 2WM3A 3OJLA 3AI3A 2ZK7A 3ITKA 4B7UA 4BNUA 2C2YA 5KCZA 4IGEA 4NIMA 4BO0A 2VYVD 4UEOA 1Q7CA 2FPGA 5L7YA 4BO7A 1HE4A 5J23A 1X14A 1HF3A 1KVSA 2IEBA 3R3SA 4NI5A 1I3NA 4JQCA 5FFFA 3C7AA 3JQ9A 1KY5A 1Y9AA 3FPLA 5AXDA 3E5RA 3RUFA 1MC4A 2GDZA 4IGFA 4BNXA 5KJ6A 3QVSA 2DFVA 4A26A 4AJ4A 3PTZA 3ZHYA 3VH1A 3KUXA 3EVNA 2IXBA 3L9WA 1M2WA 3L0DA 3WSVA 1DB3A 3JQAB 5JDIC 4AJPA 5KTKA 1EVIA 3UAGA 1HTBA 5LC1A 1YL5A 4F3YA 1IZ0A 4R68A 4PG6A 1JAYA 2VQ3A 3HQ4O 3PDJA 4P4NA 4DYDA 5EMHA 4B3JA 3K5PA 2GR9A 1IYZA 1YQXA 3OIFA 4U6QA 2WTBA 1T4BA 4R01A 4ZQGA 1KEVA 1H9BA 2AQHA 4R3WA 4R9SA 2JD2A 3ZWMA 3JQ8B 3LC2O 3QHAA 3LYLA 1F06A 4O0LA 3LK7A 1MV8A 2CFCA 3WTCA 5AQ1A 4XIJA 2YDXA 2J6IA 1K5HA 3G3EA 4D3SA 2W2LD 2RH4A 3AY6A 1NFFA 4Z0TA 3H9QA 4W99A 4MOWA 2HLPA 4RDIA 3GGGA 3NRCA 5C7OO 2CVQA 3GDGA 1VJ1A 4KDFA 2ILTA 4B4UA 1VPDA 1DHTA 1PS8A 3T4XA 2JFGA 2OUIA 4NU5A 4B4WA 3K30A 4N5MA 4NBUA 4WK6A 4QSMA 3NDRA 1KIFA 1M76A 1U8FO 2AQKA 1DRWA 1B3BA 1KOLA 1I8TA 4FGSA 4N5LA 2E49A 3WIEA 1LXCA 4WLUA 1NPYA 5BNIA 5JAIA 4NU6A 3D5QA 4TRRA 5ER6A 1U4OA 2FZEA 4MKRA 4J2OA 2WD8A 4KP7A 4D41A 2QW8A 2Y0DA 4A5OA 1LBEA 3R3JA 4CM7A 4AL4A 3H2SA 5TT1A 3U3XA 5EPOA 2X5KO 4MIYA 1X1TA 3DBLA 3JQFC 1ZK2A 2DQ4A 3ZW8A 3WNVA 3OIDA 2PGLA 2PKQP 4HFMA 4FOSA 3QV1A 1GR0A 4KUEA 4QXMA 1ZMTA 1U3TA 3VDRA 1F8GA 3Q6IA 2X9NA 1UDCA 2Y67A 2EIHA 4YJGB 2UAGA 2ZB4A 3WICA 1QYWA 2JL1A 1HDOA 2YZ7A 5IFLA 3PYXA 4BNWA 3QVXA 3NYWA 3PGJA 4ALKA 3QWIA 3GFGA 1GUZA 2ZCVA 2Q1UA 3C7DB 4J90A 5IAAA 1P0FA 2B4TO 5BT9A 2GN6A 2HJRA 1X1EA 3BMOB 3C1OA 1EE9A 1UDAA 4Y6PA 3P7MA 4U5QA 2WWRA 4MKZA 2J5KA 4BO4A 1EVYA 3JYQA 3NDJA 4LGVA 2VHXA 5COAA 3TL3A 3WQSB 3TZ6A 1M75A 1VC2A 3ONFA 4FJ2A 2PD3A 2J3KA 2OOSA 4CM5A 1V9LA 3DONA 4DXHA 1SO8A 2W2KB 3RUAA 5HS4A 1BVRA 1QSGA 3VDQA 4Z0HO 1HDZA 2DT5A 4YB8A 3LDHA 2D5AA 4XZ3A 1DHRA 3BMCA 4I8XA 4W9NC 2NQTA 1IB6A 2NTNA 4XEHA 1BWSA 3OP4A 3ENNA 3GQVA 4ROSA 4NG5A 4KTTE 4OXNA 1BG6A 1NFRA 4MP8A 3TL2A 1OAAA 3DBHB 3N74A 3RC1A 3NEPX 1DFHA 2Q99A 2WD7A 4ZICA 1PJ2A 1RM3A 4YT4A 3FF4A 1E5QA 1E77A 2VZ9A 3LT1A 4NHEA 3UICA 3RUEA 2J5QA 3TRIA 4DTIA 1UXJA 3KYDA 4O63O 3I1JA 4XB1A 4RO0A 1VE9A 4DBZA 2PGJA 1SB9A 3PLRA 4Q3NA 2POQX 2DUWA 1DPGA 3RSHA 6ADHA 1YDWA 1ZH8A 1I3LA 2Q45A 1ZZEA 2WMDA 5JC1A 1LDYA 3IL2A 5FEUA 1YL7A 3WR5A 2DTXA 4HBGA 1CEQA 1WDKA 3WJ7A 1J0XO 3TZKA 1E1NA 2Y1OA 1YONA 1U7HA 3MJEA 3RUDA 3QSGA 2B36A 2YYYA 3FNHA 3PYLA 3UOGA 5A9RA 1SOWA 1A7KA 2X7HA 4Z3KA 1HRDA 3K96A 1A5ZA 1BGVA 1FK8A 4YAJA 1QYCA 3HJAA 4GX2A 5ENVA 3T7CA 3GG9A 1A9ZA 2Y1CA 5I9MA 4LRSB 2ZKLA 4H3VA 2PTGA 3FRJA 1WVGA 2UUOA 5THQA 2QYTA 2VTEA 5DF1A 4LVUA 5TIIA 1DRUA 2IRWA 3E6AA 5BSHA 2HAEA 2X0IA 5CG2A 4BOYA 2X58A 3NGLA 5DZSA 3WGOA 1E7WA 1P0CA 3FD8A 3NKLA 4GSKA 3I4FA 3UFXA 4CJXA 5CDYA 4J9UE 4UVDA 3HZZA 1QYXA 2D2IA 3CEAA 5B12A 1JLLA 4TSKA 4DLBA 3R0IA 4IY1A 1E6EA 4R51A 3EK2A 5TSDA 3ROQA 3V2UA 4TRMA 4G2NA 4IJKA 5KVVA 5L51A 2H5LA 4J0EA 4GQAA 4F6LA 1EVZA 3FSRA 3MWDB 4XQEA 4BNHA 5JO9A 4J49A 4BNTA 4J0FA 3DMTA 3S2EA 2FN7A 2JAHA 1WP4A 1HE3A 2CUKA 4MIOA 5EIOA 5HM8A 1Q0LA 4CMHA 1Y1PA 1ZW1A 4NFHA 1U7TA 2AEJA 4IMRA 2FSVA 1TI7A 2JAPA 3IS3A 3JD2A 4OOFA 1T2FA 1U3VA 4RJTA 3IDSA 3ONDA 4NFSA 4CLRB 1LUAA 1RM4A 1UZMA 3O4RA 3C3XA 2TMDA 3QP9A 4YWJA 4D46A 2Y1GA 2UVDA 3GF4A 4XKJA 4IDAA 4I9NA 1PGPA 4QFCA 4ALJA 2J5RA 5L95A 1KEPA 4JX8A 1JDJA 3RJ9A 1NBOA 3R6DA 4E21A 2NACA 1PGNA 5AXCA 2WYUA 1Y8RA 4L0QA 1JWBB 2X86A 2C5AA 4H16A 5U4QA 1P33A 1CIVA 3H65A 4CM4B 4E6PA 9LDTA 1IPEA 1NQAO 2B5WA 2GSDA 3GG2A 4TMFA 3ZWYA 1G0OA 3UN1A 4Q9NA 3ZNQA 1I36A 2CVZA 3OJOA 1YJQA 4XYLA 1NR1A 2JCXA 2VUUA 3M1LA 5DP1A 4KOAA 3GVHA 3S55A 3T7EA 4B4VA 5JS6A 2YV3A 1GYQA 4EDFA 1D8AA 4WCFC 3VH4A 1DIHA 4R5HA 3ZDFA 3DBRA 2O4UX 2PK3A 1KERA 1ENPA 3SVTA 1GPJA 3ICPA 5CDUA 1EK5A 3FWNA 4JXKA 4IDEA 3QA9A 4KQXA 4OQYA 1AHIA 2RAFA 4TRJA 1JTVA 2WE8A 1WLYA 1LJ8A 4BB6A 4JJFA 2Q4BA 3FWZA 3ZV5A 2NVWA 1XCBA 1E6WA 5A05A 4RPLA 1K2WA 1Y9EA 3NT2A 3ZWWA 2VZ8A 5IDQA 4U8GA 3BHIA 1E0DA 2O3JA 3KVOA 2I76A 5KKCA 4E32A 4OIMA 3JSAA 5L3ZA 1EDZA 4IUYA 2WYWA 3DZGA 4XYGA 2JHFA 3L6DA 1UAGA 1E1MA 2GF2A 3JYLA 1YVEI 4WASA 4RVSA 1VL8A 2NU8A 4XWYA 4GL4A 4EEZA 3GRKA 3BTVA 1AE1A 4O59O 1U9JA 1EE2A 4LK3A 4B8WA 4LVCA 1SPXA 3O26A 1N2SA 1ADFA 3ANMA 4PG5A 1GEGA 3W1VA 5IXYA 1Z73A 3DTTA 4I1IA 4I9HA 4PG7A 4UUOA 4CODB 2BI8A 3L07A 3OICA 5GY7A 1NTOA 1XQ1A 2WDZA 4FCCA 2X6TA 4GWKA 3K2EA 4GPD1 2PZLA 3LT4A 2R00A 4DLAA 1OOEA 1FJHA 2D1YA 2PD6A 2QRKA 2VZ0A 3I9LA 4DUPA 4WECA 2V65A 3NX4A 4HX5A 1DJQA 3UXYA 3WSWA 1C1XA 1IE3A 1LSJA 2A92A 4O5OA 4PFJA 4BQPA 2GCGA 4CV0A 2Y05A 1H6BA 2RHCA 3AUTA 1KS9A 3ADPA 2IZZA 2WSBA 4BGEA 5JO0A 1GV0A 2P2SA 3I9OA 3GMSA 1FDUA 3L9XA 2Y1EA 3S2GA 1LNQA 5IG2A 3IKTA 2ZTUA 1H5QA 5C37A 1KBZA 2X4GA 3F4BA 2O48X 4O6VA 1ONPA 2B5VA 3Q9NA 5JDCC 2C59A 1Y8QA 2UDPA 3KOUA 4CLOB 3C24A 1BXKA 1F12A 4HY3A 3IC5A 3FCOA 3F1KA 2Y1FA 5K6AC 2C0CA 4XYBA 2CSUA 1SZJG 4NJMB 4DC1A 3H7AA 4R69A 1NHGA 4RVFA 1ADCA 4K1LA 1GAEO 4CV3A 4M8SA 1TT7A 2HCTA 4W4TA 1ARZA 4RORA 2E4AA 3UCXA 3VH3A 1U5AA 3WLFA 3SLGA 2HJSA 1ISJA 3ZWOA 4AJIA 3PJEA 1I3MA 4MVJE 3RBVA 4OSOA 1S6YA 1SAYA 3OSUA 1ISFA 1K3TA 4F45A 3WGIA 1B3RA 2O2SA 3VKUA 4C4OA 2FOIA 1BDMA 3MTGA 2R2GA 2BHLA 1IHXA 2PKQO 1E5LA 1LQTA 2EKLA 5C3MA 3DOCA 1DC6A 4ZRMA 2O7SA 1NXQA 4BKUA 1Z75A 4K6CA 2OO5A 1D3AA 4RF2A 3U62A 2GASA 5KVCA 5G0TA 5AXAA 4ZRNA 1PZEA 1Z45A 2FPIA 4R4JA 2DBVO 4QEDA 4JBIA 5G0SA 3UVEA 4BGVA 1EBFA 3ZI0A 3VOSA 4CV1A 4NR0A 5BNFA 1PJBA 5T6BA 2YHUA 1QORA 1F14A 2VUSA 5F1PA 4A7PA 1WMBA 5I8WA 4WJZA 3GPIA 1YQDA 4W7IA 4XRGA 3FBGA 3WIDA 1R15A 1NQ5A 3ONEA 1LQUA 3QRWA 2DBRA 4AG3A 3CMMA 5B4UA 1E3WA 2E82A 2VNAA 4CMIA 8ADHA 4M1QA 3Q9UA 4HUJA 3JYPA 4W82A 1MX3A 4OKNA 1OBFO 1C0LA 1R16A 4RPKA 5TT0A 1MG0A 2XXBA 3WBFA 2GGSA 2OBYA 2WE7A 3ETEA 4B79A 4ZQEA 1N5DA 1SMKA 3E48A 3QVWA 4RZIA 4Z9XA 3DHNA 4P4LA 1DLIA 1YBMA 1ZK1A 2WEKA 2ZTMA 5T8KC 1B16A 1PQUA 3OA2A 2PD4A 3RJ5A 1ZFNA 4ILKA 1HXHA 3DZBA 2DAPA 2E37A 4RVGA 1QYDA 1HSZA 2AE2A 3PQDA 3VC7A 4BNIA 3BMNB 3S2FA 1OI7A 2FR1A 3O38A 5DDIP 1DAPA 3A4VA 4DLLA 5CDGA 2B69A 1GQYA 3LF1A 4NDNE 4Y98A 2C20A 3AUSA 3W4IA 2Y0EA 4IQGA 1KC3A 3INRA 2DKNA 1D1SA 2QYSA 4P4GA 1UP7A 4Q3DA 4L4XA 4NJOA 1DIGA 3CPSA 4DRYA 3IMFA 3GDFA 3GK3A 3GN2A 3PLNA 5JC8A 4MPDA 3D64A 3WDSA 4B7CA 1B7GO 2VWPA 3D4PA 5G0UA 3ROMA 1V3UA 2GUGA 3JQAA 4IM7A 1EUZA 4YVFA 1J49A 2YV2A 2D4AA 4YCAA 1XQ6A 4PCVA 4KDEA 4GMFA 4IMPA 4YAEA 4E2XA 2YHIB 1XYGA 5JSFA 1N7GA 3SJUA 2GPTA 4J1QA 4PZCA 4YEDA 3H9GA 4WLNA 4YQYA 1JU9A 1C1DB 1BVUA 3EUWA 4YTEA 1C0PA 1CERA 3KYCB 3OEWA 3DEYX 2IDZA 1HDXA 1MA0A 4GX0A 2X5JO 4BL5A 1Y6JA 5A9TA 2NQ8A 1X7GA 4NK5A 3DZFA 1E3LA 1DIBA 3LT2A 1NVTA 1YB1A 3DOJA 3TOZA 4BO5A 1LI4A 1YKFA 3Q0EA 3KSDO 1T2EA 4XDZA 2HMWA 2C7GA 1B8PA 2I67A 3PDUA 3H5RA 4J3FA 3X2FA 3HSKA 3OEYA 4EITA 1NQOA 2EGGA 1JKJA 1D7OA 3H9JA 3QWHA 1CETA 1PQWA 3PQEA 2EEZA 4CMEC 1NFQA 4L9RA 3ZHZA 4DIOA 1XR3A 3G1UA 1F17A 2ZB7A 1FDVA 2JJYA 3PFFA 4DMMA 3KM0A 1EFLA 3L4BA 3GH3A 4YRDA 4B8ZA 1MFPA 3PEFA 5A5FA 4E2YA 2GN4A 3TNLA 5KJFA 2DPHA 2VT3A 1DXYA 3C1TA 1O6ZA 2XPCA 3F5QA 4UEJA 7MDHA 3ITDA 2EKPA 1JVBA 1I2ZA 1MLDA 4C7JA 4WLFA 4CM6A 1A7AA 3AK4A 1NASA 1W0CA 4UAGA 3M6IA 4ND3A 4YRAA 3JQBC 3ZWVA 4RF4A 2EHDA 4BNMA 3CZMA 2EP5A 1PEDA 1NPTO 4QUKA 3VZQA 4LN1A 1ONNA 5A5EA 1GYPA 3DWFA 3JQAD 3TZQA 2B0JA 1N9GB 3H2ZA 1JKIA 2HK8A 5H82A 1IULA 2GZ1A 4DREA 5JCXA 5IZCC 3PWKA 1V3VA 3H8VA 1BSVA 4BV8A 4PLTA 5JE8A 2EKQA 2X9GA 1YL6A 4NPCA 4E5MA 1E7QA 2VOJA 2OGUA 3LU1A 4GWGA 3WWZA 2VUTA 3ZU5A 4D3DA 1H6CA 1PJTA 2OP0A 4LCJA 4GVXA 2NVUA 9LDBA 1PTJA 3B1FA 5AXBA 4BO9A 5ITWA 1AHHA 4XYMA 4PRLA 1GV1A 2BKAA 4CQMA 2Z5LA 2A4KA 1JWAB 5TLSA 2ZYGA 1WZIA 1PZFA 5HWSA 3TQHA 3ZWAA 3SC6A 3Q11A 1DAOA 3RFTA 3KSUA 4B7XA 4XX0A 4CLEA 4FGWA 1YQGA 3VTFA 5CP8A 1OC4A 1NPDA 2Q46A 3RU9A 4NK4A 2H9IA 1I33A 3GAFA 3QE3A 4J7XA 1ADGA 4HWKA 3S2IA 1Y7TA 4TQGA 4HP8A 3EMKA 3ETDA 3L77A 1G1AA 3NTQA 1VL0A 3QVTA 1FMCA 5THKA 3PHGA 4YQZA 1YO6A 4D45A 3PHHA 2AE1A 2X0JA 3HDQA 4IDDA 5GZ3A 1IPFA 3FNFA 3ZWBA 4BNNA 3AOGA 2Q50A 3V1TC 4G81A 1U2GA 3DZHA 4D44A 4FJ0A 2ZQZA 1X0XA 3EGOA 4U0KA 3B6ZA 4R41A 2EJVA 1TT5A 3DQPA 3E82A 4YJFB 4GGPA 3U5TA 3RC2A 1DOHA 2FZWA 5C7LO 4PLHA 5AVOA 1PJSA 1PJLA 3DZIA 3H5AA 4RPJA 1A4UA 1GU7A 4AJKA 1KC1A 2E6UX 2OORA 1FDTA 5JAQA 1BRMA 3I52A 4EUFA 1A4IA 1KEUA 3RVDA 4DIBA 2XXJA 4ND4A 1T2DA 2I3GA 1WWKA 2I5PO 3UGKA 4IS2A 4Z3DA 2V6GA 4AJOA 4RF5A 3WOHA 1YS4A 2QQ5A 2LDBA 5ITVA 1C0IA 1YGYA 3FR7A 3PWZA 4IJVA 4DWVA 3GVIA 3FTPA 4BMNA 3RKUA 4CMAA 4OM8A 1ZIDA 1ORRA 1RWBA 4PLCA 1A71A 1NWCA 3KV3O 3GVPA 4UREA 4AJ2A 4J4BA 3VPGA 4BO2A 4CM3A 3ZW9A 4CQMD 5LDHA 1RKXA 1ULUA 4GI2A 2V6MA 1DEHA 3QY9A 4N5NA 1P1RA 1R6DA 1WNTA 1ZMOA 4II2A 4XQ9A 1UXIA 2VT2A 3JD4A 3PXXA 4JBGA 4XCVA 3ZNNA 5G4LA 2JCVA 1QLHA 3PHIA 3G17A 3ZWNA 1ZK4A 1HDGO 1LLDA 3TZCA 5DBIA 5JCJA 5T5QA 3EC7A 3HB5X 1DJNA 3N58A 5L4SA 3IAHA 1LX6A 3PGXA 1ENZA 4PLVA 3PFWO 5LDGA 1HKUA 1RYEA 2RH8A 1E7RA 2CVOA 1LLQA 4I9UA 4ALMA 4MDHA 3GRPA 3I6IA 2D8AA 2EF1A 4FN4A 3AWDA 1R0LA 1SEPA 1O5IA 3E1KA 3E9QA 2OZPA 3VVCA 3F1LA 1K89A 4QX6A 4JN6B 1ADBA 1QG6A 4RF3A 3F5SA 1H93A 3A28A 3M2TA 4XJTA 2B4QA 2NLOA 4A10A 1VJTA 1CDOA 1B8UA 1BXZA 1DSSG 3LQFA 5AOVA 5KKAA 3R1IA 5JPIA 4R54A 5KWEA 3AM4A 3C1AA 5DULA 1I5RA 1YB4A 1P44A 4W6ZA 3HUDA 2F1KA 2Y68A 4HADA 4WCFB 3WFIA 2G82A 2CDCA 4X54A 5I9LA 2JFFA 4A0SA 4OMUA 3WQQA 1PWZA 4GSLA 1VSUA 1ENOA 5BSGA 2VRBA 4UVEA 4OQZA 2C29D 2NVBA 5DOZA 4J7UA 3E8XA 3SXPA 1KETA 4EYEA 2A94A 4INAA 4AFNA 4Q3CA 3D4NA 4LSWA 1U5CA 3GNQA 5L9AA 3WB9A 1PX0A 4MVJA 4LMPA 2IODA 3BIOA 1X0VA 4CMJA 3HFGA 4ITUA 1G0NA 4TWRA 4DVJA 1LSSA 4W7HA 1WDLA 5TNXA 5I8ZA 3RBXA 4E31A 3W4JA 1BTOA 1NM5A 3RASA 4XRRA 4LSMA 1HYEA 4YBZA 1T2AA 4FFOA 1ZEMA 3EDMA 1LRJA 2AG5A 2UUPA 5JCJD 1PL8A 5CG1A 3BHJA 1UZLA 2AEMA 1H94A 4HNHA 4K9DA 3AY3A 3TF5A 2JD1A 4YDRA 4WLEA 5DP2A 4G5HA 4IDCA 5KJCA 3DBLB 2EV9A 1XELA 3U49A 5G4KB 2EP7A 3WBBA 4NMHA 5JYDA 3ZU3A 4FPXA 4WOKA 4CLHA 4E2WA 5I7VA 4NFYA 4TVBA 4RDHA 3RUIA 3ZWPA 2QG4A 3AOEA 1H2HA 1DO8A 1X13A 4XJSA 3ROKA 4BQRA 1IY8A 5CPBA 4CLDA 3TSCA 4RLHA 4RVDA 2HMVA 2X23A 1GPDG 2DUUA 4C7KA 1SCUA 2UV8A 1UDBA 3JQEA 1PL6A 1AXGA 3GC6A 4KUHA 4BGUA 2OMEA 3WGZA 3CZRA 4OKIA 2PH3A 4MP6A 1YRLA 4Z9FA 5ILGA 1VKNA 4IDBA 3CH6A 4RCVA 3GMDA 2OXIA 2RCYA 4B3IA 4P38A 3A14A 1N7HA 2AA3A 2Y0CA 4NBTA 4DPLA 1MUUA 3LSYA 3COSA 5FYDA 4G65A 2PWZA 2OP1A 1DC3A 5EINA 5IDYA 4Y9DA 1HZZA 1MGOA 4ONEA 4S3MA 4XD2A 1I32A 3B1KA 3JQ9C 2Y93A 1NP3A 3W4KA 1UXGA 4BHTA 1XG5A 3V2GA 4PGFA 4QQRA 3JQGA 3P2YA 4HFNA 1A9YA 1JA9A 2Q2VA 3FHLA 3DAFA 1HE2A 4DC0A 3ETGA 4PZDA 5ADHA 2DPGA 3BMCB 2X1HA 1SC6A 1T2CA 5BNTA 1PL7A 2V7PA 4MVJD 2O2YA 4MKXA 5ICSA 1DIRA 5I7SA 3LZ6A 2YQ4A 4E33A 1DFIA 4J6FA 4WNIA 2ZB3A 1LLUA 1V8BA 4J9VA 3I23A 3I83A 5CPFA 2WD7B 4D0SA 3AM5A 1P1IA 3BMQB 3DDNA 5JY1A 1R12A 1NVGA 4YA6A 3JYNA 3I9NA
chains in the Genus database with same CATH superfamily
1BMFD 1MOZA 2L0XA 4O2AB 4A73A 3LXUX 1AHPA 3WFJA 1KDYA 2FVXA 5K0TA 1YDEA 4D6XA 1JDTA 5HQ3B 2CZCA 1T5DX 2ZRAA 4G4IA 3EEIA 3NT4A 4LMRA 2AF3C 2YZNA 3L7KA 1ND5A 1T8RA 3CUVA 3GA5A 4GLLA 3VJMA 3X2EA 4AUEA 3U44A 3TLJA 4YR9A 4FYXA 3O4FA 5LZ8A 2ZTSA 3O3OB 1M2KA 4LF7B 3HGQA 1Q2XA 3ZWQA 4O0MA 1SBHA 1VLMA 4JB3A 2OFOA 1X9GA 1ESCA 3CRMA 4KW7A 1BQEA 2HNBA 4FFNA 5BR7A 2Q3MA 2NNLD 5AJHA 2I3AA 4KWIA 4KYUA 1TAGA 1LW7A 3B70A 4DLVA 1MQAA 2FDRA 2Z57A 1KPGA 4UKDA 3WGLA 3AH8A 4FYHA 2NNWB 5BOSB 4GMXA 1DRJA 3MK31 5KIAA 2Y8EA 3WYAA 1PR5A 1P7ZA 3BGIA 3IP5A 4YY3B 1AUOA 3RRBA 4R40A 4CI9A 2N3ZA 1I10A 5REQA 1RIIA 4RW0A 1MXFA 2Q9BA 4IZHA 4YPOA 5B7QA 2A1TS 1SKYB 4R1SA 1FUYB 2BGJA 2WWHA 1QTRA 4EJFA 3OPYA 1TKAA 3LHFA 4LZJA 3RADC 1T35A 2ECOA 1V1RB 2X8WA 5CJPA 4MQFA 1G7RA 5MHTA 5G3ZA 1I13A 1ZH4A 1WR8A 1TJPB 1KEEB 1VE1A 1E61A 2ZDQA 1D4OA 3UBMA 2IW1A 4ATNA 4BAZA 4C3UA 1Y4AE 2CNOA 3PJRA 3F67A 3PLAE 3ABIA 1HEUA 5BORA 3ZE6A 2VYNA 2PUDA 3D7SA 3IQDB 2R97A 3KQOA 2M32A 5TS3A 3RSGA 3K0CC 3B12A 1U4SA 2JA1A 2RI1A 3KZOA 1JL3A 1X80B 4QGFA 4ZI3A 1NJ5A 5A5DA 1ZM4A 5A6SB 1E1YA 4JITA 2HIHA 1W6UA 1XRJA 2WK1A 2QEQA 4D43A 1KGSA 1JXOA 1IUKA 1J0CA 2VP0A 1DZ3A 5UKDA 4NCAA 2Q1WA 3V1MA 5JMWA 1DRVA 4KRGA 1WUYA 3MBKA 3PUXA 3QU5A 5CTJA 5T4EA 1N3IA 3SF0A 1VXOA 3OQ6A 5HFAA 5JDIA 4JOBA 2Q5OA 3HDVA 1HDCA 2EFYA 2P9YA 4R3UC 4U0JA 4YGYA 3TSZA 4BV3A 1G8GA 1JMKC 2BFPA 2YV1A 3BGWA 1T9BA 3BMNA 3GUYA 4BLTA 4CV2A 4IDGA 4H4EA 3HNOA 2WMYA 3M1AA 4Q1VA 4U63A 3SHWA 4K8OA 4YAIA 1ECPA 1EBUA 1DFGA 2M2IA 3ORYA 1Y7HA 1Y3FE 2B30A 2W2OA 1ZMBA 4JCCA 4NKRA 4PZUA 2DLDA 4RSHA 2F8MA 4F04A 5GAJA 3ZZMA 2WHPB 2HQRA 2FEKA 3LKDA 4CU5A 1ZIPA 3O92A 1HQKA 2C84A 5LLTA 1P1FA 2OFPA 3EE6A 1Y8RB 5HKLA 3CLTC 3LNTA 4U2CA 4HL6A 2DWQA 2IEZA 4O4IF 1PJ4A 4KDRA 4PXSA 1EWQA 5C18A 2H4YA 1DBVO 4AMVA 3WRWA 3F3SA 2VK4A 3OETA 1NVXQ 4G01B 1NJSA 2IE0A 1QBGA 1HA3A 1HORA 3GRVA 4QNRA 2XGGA 1K8QA 3G5TA 4EFKA 3IE1A 2EW2A 3BDVA 3OA0A 1TU0A 5CB4F 5CHYA 2IDKA 2GI4A 1CP3A 2HXYA 2J3MA 4B85A 4CVNA 2IYPA 4R1UA 2QT0A 3GZ4A 3HO6A 5NULA 1JG4A 3GOQA 3I5AA 1TCCA 2BMAA 4BFUA 1NOKA 1NF8A 4EIWA 4LAFA 5DGCA 1GGKA 1CF4A 1MOSA 4CG2A 1P2SA 3G8CA 3OFKA 1NN3A 2FQWA 2V7QD 4FYVA 4KLNA 1W6RA 3PXUA 4JELA 3O8BA 3V34A 2QDKA 3KUDA 1S4MA 5ALWA 4ZVPA 2J3JA 2UYHA 4OAOA 1PD0A 2X8JA 3AG6A 3EISA 4ZC1A 1JWLA 3H87A 4MLCA 5U1PA 2XDAA 1W73A 4U9IS 1NMEA 3MSCA 3K6SB 1N92A 1RXSA 4LKRA 4S1VA 2J0VA 1T9GS 3A6ZA 3AUKA 4IO0A 3SQDA 1PWEA 1MN6A 1PUIA 2X0KA 3MWEA 1PFQA 3CV3A 4J0KA 3T9FA 1XNJA 3GH1A 3I61A 1OCEA 1IZ8A 1TYEB 3K8ZA 4TZ0A 2VZLA 1HDYA 1VG9B 3KHKA 1B00A 1TA4A 1H69A 2VNJA 2PWYA 1LDEA 2JJQA 4ECAA 1FTSA 2I8CA 1J39A 1IM5A 3D0OA 5IMSA 4D02A 1AV7A 2ZYVX 4FFDA 2ZANA 3ESXA 3CNEA 4MO2A 3P4UA 3VKVA 3ZUGA 1NY6A 4JIGA 2VKTA 3ESDA 3GBPA 1IDN1 1V1MB 1SVUA 2OHJA 3M4JA 1JSCA 3IALA 4Y18A 3JQ7A 5E6UB 5HOQA 3F7TA 4YJ3A 4Q1CA 3L0BA 4CUJA 1GZSA 1HYGA 1C3OB 2A5FA 2JGMA 1TLTA 2B94A 3E84A 3G9ZA 4Q9JA 3WO1A 4YR7A 1FMFA 1I1HA 4RK7A 3U4HA 1L5RA 2IY9A 5K8JB 1MIHA 5LXTB 3URKA 4HS4A 1LRKA 1ID1A 3O95A 1GP2A 3BK1A 1U6IA 3RS8A 4AP5A 1Z56C 1PUXA 4AQDA 1EXWA 2NPFA 1E64A 4WADA 3UJCA 2P9EA 2QKYA 4RVUA 3WQRA 3LT5A 4WFQA 3HFJA 3ETLA 1MH1A 3PGA1 2BE7A 2NN3C 5BWLA 1MB9A 2WZDA 3ZCVA 1P75A 5PNTA 2ABWA 1G21B 2ECQA 4OXKA 3BIFA 1G9SA 4QBKA 3HDHA 4Y67A 4C6HA 3W5AA 3KL4A 1RQXA 2G17A 4UUNA 3RVBA 5CJJA 3TNDA 4HXYA 4MUKA 3NKVA 4JCOA 4JLSA 4G5QA 4I5EA 1J9ZA 3B8EA 4MW9A 4R8SA 2FR0A 4LDZA 3M9XA 4DEXA 1X1QA 4HWPA 3UWPA 1HPLA 4IIJF 1Q3HA 5LMUB 1LA2A 1WXIA 3UGTA 3U61B 1RHQA 2FE4A 5B37A 5A4KA 2FSVC 1TFUA 1IEWA 3NHSA 1X39A 3KOZA 2QMYA 4MKIA 2YW9A 4J6EA 2O0JA 2ZI6A 5KPDA 2Q3FA 3PK0A 1SELA 3GFBA 4W9NA 2IPXA 3VNSA 1BDIA 3F6YA 3NV9A 1A2KC 1W2HA 1A96A 3IKJA 1WCV1 3KRTA 3PKZA 4E5NA 3IPAA 4G6ZA 5G53C 1WKCA 4GQIA 3TCNA 3QKRB 2Z04A 1GZ7A 2FLKA 3JQQA 4L7QA 4X60A 1OXTA 5BYJA 4CKWB 3TNJA 3SQXA 4KIGA 2FHSA 1ZJZA 4LXIA 6LDHA 4IDPA 4EI7A 4QGSA 1Z16A 1Y8QB 2CLLB 2HGSA 2IEIA 3H1EA 2RI6A 2HOQA 4ZVTA 4EAQA 1KDTA 4HDCA 4IS3A 3K31A 4GLOA 5E3JA 5L3QB 3H8SA 3BX1A 3E3NA 3VU0A 1JHUA 2E9SA 4D8TA 1J70A 2WPDA 4KX5A 2B3TA 5EP2A 3NH6A 4FM9A 4H60A 4C7MA 1KHTA 4IQ8A 2COKA 1Z7EA 1JEAA 2H4XA 3PIRA 2VTBA 3NORA 4MV4A 3R74A 5B55A 3OLWA 4WLOA 3PQCA 2VPZA 3W2FA 3CE6A 3LLVA 4GPTA 5AW8A 1NV8A 1E99A 4TV9A 4M54A 5EPEA 1BDBA 4ASUD 1G2PA 1HV8A 2FUG6 1T1IA 4FHZA 2B8JA 4L2IB 1ODKA 4K8RB 4DKXA 3ZY2A 2CJXA 2FQXA 5JH7B 3CLRC 3MZ0A 3U7IA 2LCQA 5I7FA 1JDBC 1GIAA 2L18A 3HL0A 4OK3A 3KTFA 5AKEA 5U4XA 4A2QA 1ZHOA 2R6R1 2X5OA 4PVDA 1U1IA 1UJ2A 4PTZA 5DHSA 2ISQA 4CKBB 4FE4A 2C2OA 1SVIA 2OLKA 1NAIA 3NOXA 3NM4A 1PS0A 1O94A 2W90A 3PQ6A 4HD8A 4KIUA 3L1KA 2BCGY 4W1SA 1FE8A 3IP8A 3F4LA 1EX1A 4URYR 2JH3A 4HG2A 2IZOA 2WR8A 2O8BA 2UYYA 4IDQA 1N6HA 1CKEA 4BDSA 2JA2A 4MROA 4UTVA 3DCNA 1MDFA 4UJ3A 5DBFA 3TLMA 2GM3A 1WA5A 1MC1A 3AEUB 1W87A 1C29B 1Z5UA 3EDQA 2F3RA 3BSWA 3I9MA 4FD3A 1XTZA 3UYLA 5KC9A 1E3EA 1CUBA 1MIOB 1XK7A 3CZCA 3G49A 4MV3A 4YP9A 2PMEA 2VI5A 4YRJA 3Q7QA 2AOWA 4X8OA 2VFAA 2YWFA 5K4AA 1SFRA 2J8ZA 2FSSA 1CCWA 4XJXA 4HAUA 3BB1A 3KZKA 4DBLC 3NUZA 3C70A 2EBFX 4ZOBA 2OFFA 2O9JA 1V35A 5JW6A 1DDGA 3KX2A 2JVKA 3P97A 4JROA 4TT3D 4CMKA 1FP4A 2NU7A 3AR5A 3O7MA 4OOEA 5SYMA 3WK6A 4A1FA 3HA7A 4F38A 1E7SA 3EC1A 3I6QA 1Q7RA 4I3FA 4EB6B 2Q7DA 3AJEA 4B2LA 4WEOA 4BMDA 4W8OA 4DADA 2FDCA 4FN5A 4EJMA 3JD0A 1T0PA 2MYTA 3JATA 2B1IA 4MW4A 4ZEOA 1KZHA 3VC1A 1JFVA 1ZU4A 1S3FA 1A97A 2PS9A 1XQYA 4ER0A 3E23A 1KVUA 3K7EA 4ZVSA 2D3WA 3YASA 1YCGA 2V3CC 4DCPA 3OE1A 1Z5WA 1MNQA 2RGNC 4TROA 4MVJH 5GIPE 1GY8A 3KQLA 4P4SA 3GGOA 1EJ6A 1U2EA 3O8QB 4Q4JA 5A03A 5IM4F 2DSNA 1W44A 2FWBA 2PV7A 1QGED 3NGMA 3OZ7A 4UAVA 4DMFA 4ZN6A 4DLSA 2YXPX 3I0MA 5KYNA 3IUEA 4HJRA 2D7CA 2WB4A 1KAEA 2R751 4PC3A 3C43A 1XTVA 2HMTA 2I7VA 2C3UA 1NIJA 3GPDG 3OLXA 4E6EA 1G3QA 3BXGA 4M60A 4JJAA 5EWJB 1Z5GA 4LPSA 3QVLA 2QB5A 3MD0A 5FYQA 3GRAA 2LXNA 2ZIWB 4CMCA 4OREX 1IPHA 2CVHA 2IVFA 4JEUA 4LI3X 1WPQA 1B43A 1JJFA 1HFKA 4X94A 5J4YA 3NANA 1VG8A 3BB4A 2NSDA 3DM9B 3T7RA 3H5VA 4BRZA 3JVIA 1NMSA 1A8IA 1Z9BA 1IRIA 3N9IA 5TX7A 1GTVA 1WPRA 4DQKA 2GCOB 2Z6QA 2GYUA 2KI5A 2KQUA 3VR5D 2MR6A 4D3YA 3Q9SA 4KMMA 4UOEA 1V5IA 2PA3A 4RS3A 4RY9A 1PR9A 3D3JA 5KNDA 2A9JA 2EIXA 1JHOA 2YWRA 4P08A 2IHBA 4WCDA 5B64A 3LD9A 3LY8A 3MTDA 2EWVA 1P18A 4F5EA 5A4DA 2C54A 3ZEIA 1VHWA 3PUYA 4I6JA 1UBEA 2GEVA 2QQ0A 1JAXA 3L01A 3OUUA 3A0RB 4MEBA 4KQ9A 5H80A 4LECA 5FUVA 1LLFA 2EDAA 4AZWA 3WLEA 5CNIA 1IM2A 2O0LA 2PKYX 2DLCX 2VAWA 5CD1A 3U9LA 5AI6A 3W6ZA 1B23P 3CXUA 2QU7A 2PANA 1WOYA 4G1EB 3EODA 5HJ7A 3SY8A 3P20A 5C5IA 5L45A 2X7XA 3GDWA 1M5UA 2VAVA 3MLEA 1EK2A 4D79A 1G5HA 1OZFA 1XZAA 4FSDA 4QRHA 2Q8PA 1SIWA 3T8YA 4XQCA 3KJNA 4IZ6A 1XKQA 5ECYA 1W9HA 2PZAA 2YDYA 3OOJA 4L4RA 1NW8A 3FYUA 3E0QA 3KHUA 1WMDA 1DAGA 1YFLA 2Z83A 3AERB 1OZ0A 2B34A 3OVMA 4G5RA 4CDRA 4KR6A 3SQMA 3IPYA 1DO2A 2GF0A 2PEZA 2OUKA 2ZIXB 3AZOA 1R7RA 5L40A 2LZ0A 3HUUA 2VNHA 3H1GA 2HLHA 1WSBA 2P4UA 5MN4A 4OI4A 2VJMA 2GPBA 1P74A 5CIQA 5CM2Z 1ZJ6A 2M98A 3UNXA 3GJ8A 3V8BA 1YQUA 3DTVA 1QB8A 3V1LA 3TQOA 2OO3A 5J5CA 4FR2A 3RIMA 4P7FA 3AEKB 3RGGA 3BF7A 4D42A 1LFAA 3SSMA 4L4UA 2QD5A 4TMWA 3EN0A 4E5VA 1QOZA 2AJ8A 5HGJA 4QXRA 2OHFA 1F2UA 3O31A 2C9DA 3KEQA 1YR6A 3W5SA 3GNTA 4FFBB 1W5EA 4P2GA 2OQVA 1P5RA 2XJ4A 2P77A 1VM6A 1XVIA 3BTUA 1E1CB 1NBMA 1IBSA 3P0EA 4LUCA 2J9YB 3AR2A 1GL3A 1YC2A 3N2EA 5A7GA 4DT1A 2CD9A 3CSSA 2ZM6B 3B6IA 3BS4A 4GDMA 4ND5A 1O95A 3AESA 4C0BA 1LPPA 1ABBA 3HN2A 3I42A 4GKBA 4WBSA 4LXUA 1EFPA 2BCJQ 4NULA 1EXVA 2LCIA 2RKBA 5I4KA 2NP7A 4Q19A 2A9RA 1RQ7A 4GF5A 1JG7A 3OIVA 5JNWA 4E5UA 4JJKA 3ZNOA 1FNCA 1DX6A 1SQ5A 1IN6A 2BTOA 4I4TA 3QUBA 3W5IA 1L3CA 3I9KA 2ZBVA 3N8HA 1BKYA 1GGHA 1ZXBA 1Y8CA 1YFJA 2Z30A 3FGPA 3LIIA 3JSXA 3LZCA 4CF3A 1JKMA 3JALA 4FZ3A 1JSLA 3PDIB 4ND2A 5DI3A 2KPOA 4IX9A 4E5KA 3ZNPA 1ZXLA 3OM8A 3Q3IA 3X43A 3JQDA 5JDCA 2ZTHA 3NBQA 1DQPA 2NUTA 1JS1X 4DDHA 5BRAA 1SBYA 4AJJA 1QQ7A 1K5DA 1Y89A 3QIVA 3LA6A 1KI7A 3STWA 4XIGS 2J9RA 2OM2A 3RODA 3I9JA 2IH2A 1ACJA 1H2YA 4QDTA 3IEIA 5AP9A 3WDLA 5K6AA 2LUOA 4ARIA 3SYTA 2B6HA 3ML1A 3C41J 1E9SA 1QS0A 3C2QA 1MJFA 4JBHA 3PB3A 3QKUA 2PN1A 4PHCA 1WXXA 1R64A 4KO3S 4ZKEA 3A31A 1DQNA 4BFSA 4EG7A 1RWPA 3CW9A 3SI7A 1LU9A 2AR7A 4CKCB 5CB0A 1XMOB 5HILA 2B35A 2QUAA 1COZA 1AN9A 1TPZA 3D5TA 2VRWA 3O8OB 4LQLA 4TS4A 4AO8A 1RNLA 3GJRA 2PX4A 4HGPA 3JX9A 4LGYA 3PDWA 2ONJA 1ZG3A 3JYOA 2OK8A 4POOA 2PT7A 2ZR9A 1BJRE 1EZ4A 1GARA 5B58T 1T1GA 2ZVQX 1ECLA 3CVWA 3UJAA 4KXYA 4BFZA 4ND8B 1R5NA 2CLCX 3IQZA 4A6XA 2GNPA 1T3TA 2JF0A 1RYDA 5D6NA 1X8JA 4YRFA 1GL6A 2PJUA 2ZTVA 3A6EA 5EZSA 5KINB 3EXIB 5BPHA 1JDNA 2HRRA 4F3CA 2BGLA 1NVWQ 2EP8A 4BS9A 4DS3A 5H83A 5IVIA 5GGYA 1D2CA 3QLJA 4G67A 3J7AC 1DJOA 4OJNA 1PR0A 4ARAA 1RQPA 2WU0A 4L76A 2CXTA 3CX4A 3CUKA 2HKIA 2ZRKA 4FOOA 4G4JA 4KG7A 1VMDA 4J1NA 4PC6A 3RHZA 2JLXA 2ZZNA 1DTSA 4DHWA 3C85A 4XSHA 3V6MA 3P9QA 4M55A 1JH8A 4PIMA 1C7IA 1DJLA 3C3MA 4FIZA 1SVLA 4JGBA 4TM7A 1TM3E 3G88A 3NB0A 4MYRA 3ZCPA 3ZV4A 3L4BC 4IPTA 2DWPA 3FMOB 3RUCA 4AP6A 4JK3A 4E22A 3H1BA 3MJ4A 3O93A 4BWFB 1M6HA 3QENA 4OGWA 2RGEA 2BD0A 5FTKA 3IVGA 4MNTA 1YI8A 1DINA 4O1MA 3HLTA 3PITA 2Q6IA 5LQDA 4RKWA 1SXJE 2C03A 3K2BA 3TIGA 4U3JA 5DX1A 1PW5A 2VDKB 4N7JA 1T2VA 3HJTA 3A6LA 1Q0ZA 5T8KA 1YQWA 2QRUA 4DAEA 3C7KA 4PN7A 3CZ4A 3U3ZA 4GLBA 2G0TA 2V7XA 3A9VA 4EY5A 2A9VA 5AHKA 3GQBB 1XPOA 3O03A 1IHYA 2BKUA 3KAJA 3F78A 5A6VA 5T3UA 4P2BA 2PUBA 1VG0B 4H0NA 2R2AA 2WKQA 3CJRA 1E7MA 4CKYA 4ENWA 3OF2A 3KSRA 1GAJA 2ZZMA 2XKAA 1H1TA 4OHCA 1Z6ZA 4A0FA 1N32B 2I2DA 2P7HA 3RV3A 1E2IA 3EVDA 1RVDA 1XZFA 3ILYA 4B1FA 3CX6A 1XU9A 3EPPA 3ZD7A 4XIIA 5JJIA 2GLXA 1LBTA 3G8DA 5FUYA 1B6RA 3IQEA 2JNWA 4L02A 4L5YA 2WYVA 3SF8A 4FC7A 4IQ0A 1U2TA 3KR2A 4EY6A 3OPVA 1P77A 2PKEA 1IXZA 3V42A 5C8DA 4F3NA 2ZTLA 3IO3A 3DE5X 4LCBA 4IOLA 3AW9A 1FPMA 5A3VA 5KWVA 4X1KA 1CX9B 5KOIA 4OP2A 1K08A 3Q1LA 2VPTA 2RH9B 5FTLA 4KMOA 2M1XA 4N8DA 4OL9A 3B6KA 3Q15C 2XZLA 2CBXA 4N1AA 5EG5A 1I6MA 1Y9JA 3L49A 4MV7A 1QKIA 2H1FA 4KZPA 4XFKA 2D59A 3CNLA 4L8GA 4QJ5A 4RMHA 3QVGA 5F51A 4DEVA 4OA8A 2ENUA 1DQRA 1GDHA 2BFCA 5K0SA 1IJEA 3LA8A 2QSUA 1EFRA 4DV2B 2WIKA 3FNEA 4LOJA 2IW3A 1NI4B 2X9QA 4GPAA 1YJ8A 2CL0X 5C32A 2C31A 3A1TA 4JJIA 2GK3A 4UEWA 1K66A 2WIAA 3B9RA 3CKKA 5HK8A 3JZFA 4J16A 3P5BA 5DGDA 4RBNA 1CUYA 1M1YE 4RWZA 2DM6A 5FWYA 4R1PA 3SHTA 4XWWA 1ZMRA 2YFYA 5ALEA 2AC4A 2JHCA 3KJZA 4X63A 4JDPA 2YZMA 4ZOAA 5LZ7A 5ADVA 4N7RA 3OM9A 2G06A 3N8NA 4URFA 3FDZA 2PXHA 3KKOA 4N6GA 3QU9A 5CA0B 4DG9A 4JEIA 4YJDA 1Z28A 3AFIA 3AP3A 4G0MA 4LJ4A 3Q6NA 3TEMA 5JAHA 3QWFA 4LBVA 5ICMA 5EE1A 4F71A 5JASA 1QVAA 2AOTB 4MQ5A 1ZONA 4OGKA 4OQPA 1Z12A 2LIVA 1M34E 4QYIA 3T5DA 3W5CA 1ZKMA 3WYEA 2I9KA 1Y4DE 3I9V6 5B3KA 1XDZA 3IRVA 2JATA 3BEDA 1NLYA 3EARA 1N2IA 5EQFA 4YP0A 1M6EX 1VJ0A 4GICA 4UOZA 2WTUA 1N8SA 2MMCA 3VNVA 3AHCA 4FNGA 3HVUA 1MMFB 3MS7A 4FWBA 5KTRA 2HF7A 4CM8A 2PO7A 2ONCA 4BLWA 3AVWA 1X9HA 1PN3A 1AKWA 3WSTA 4ZT6A 2F4VB 1RBQA 2BH9A 1QH8A 3QYPA 4OHUA 2FPRA 3MMXA 2PZJA 3JAWA 4P6VF 3BEOA 3KR9A 3AR9A 5BQXA 1UM9A 2BR4A 2HPVA 1DEXA 4ZOLB 4WINA 5ALYA 1TA9A 2HU2A 3F6RA 4GMGA 3ZCQA 1W88B 1CT9A 1ODSA 1YRBA 3RU7A 1SCUB 2ZUDA 1PR3A 2E21A 4BZZA 4CG0A 3DV9A 4K86A 1NR7A 2VT6A 4CETA 5KNBH 3FCUB 3SIXA 3GW8A 3WLAA 4LC9A 2DH5A 4YJ3F 2X5NA 3MT0A 4L6AA 1O0SA 1Q1NA 5K8TA 1A72A 3ELDA 3M6XA 4HEA6 2XUZA 3SX2A 1RABA 4PNHA 5IDWA 1ZC3A 2H29A 3L8FA 1XHLA 4ZAYA 2I65A 5FD8A 5AKKA 1NUAA 2PH5A 4CDGA 2JHGA 1TEHA 3AM3A 4NXMB 1Y98A 2LV8A 2O7RA 4DGSA 6YASA 4TYWA 2P3OA 1TJ4A 3JVVA 4Q6BA 4Y0AA 1CEXA 1MZVA 4RD0A 3RROA 2OYSA 2XY4A 3SGLA 5J2UA 4YI3A 4AT1A 2AJTA 5F9MA 4C9BA 1NNI1 4ZV4A 1M66A 3ROPA 3BM5A 5JD5A 4IDFA 2OGSA 3UKDA 1PWYE 2IZ7A 4DIMA 3FWPA 2VJDA 1RBZA 1LC0A 1IC6A 1PEAA 1XRLA 4I5FA 1ZRHA 2VF8A 4DMRA 2CB0A 4PCLA 2UVPA 4X7MA 4Z9BA 4B34A 4PNEA 2C4HA 1P3DA 3W3AH 1C3LA 3QLUA 5EAIA 4IGAA 1OAOA 1Z4QA 3AI7A 4FYYA 2ZUVA 1WXGA 1KOFA 3PWTA 5CB6A 5DT9A 5EOVA 5BRNA 5LQCA 3THXA 1KXZA 2H4JA 3UJ8A 4PG8A 3OE7D 5J4VA 1V26A 2P11A 5LQAA 4OI1A 2EXXA 3BA1A 4K9OA 1QV9A 2C77A 4J0IA 4MPPA 4B87A 2W83A 4ZCSA 2QD3A 3EGVA 3V1YA 3S29A 3AJ8A 3IERA 2ZXEA 4PS1A 1KL7A 4LZZA 1WIWA 2QX7A 4DABA 1G19A 1HL3A 2W0SA 1OF1A 3EYWA 4H6WA 1GQRA 4ABYA 4MGIR 2WQ7A 4URVR 1L0BA 2QD1A 2WYHA 1QGUB 3I09A 1UFRA 1VBFA 2YHBA 2JAXA 1RP1A 3N2GA 4LRQA 7ABPA 2X2EA 4KQFA 1FZTA 4J29A 4X7PA 3OPMA 4OHXA 5LYYA 2HHCA 2AMFA 3PC8A 1FVOA 3FNQA 4QOFA 3UMMA 1DCTA 3LKVA 3LPCA 1H2FA 2ZT8A 3PX3A 3WK8A 5IF9A 4GZ6A 2CHFA 1EAYA 2HCFA 1AZSC 1VCMA 3H1FA 3R9KA 1VE6A 1FX0A 5MFPA 6ABPA 1Z6PA 5DGTA 5A62A 5CK5A 4BO3A 1Z35A 4KGXA 4TL8A 1WRBA 3HNPA 5B4VA 1KYQA 3DE3X 3KVVA 4IIVA 3TMYA 1HLPA 3EMVA 1YK1A 1Z47A 2WOJA 2I34A 4TV9F 4ZT3A 2JAOA 3B2QA 1VHJA 3NOQA 1LJLA 3L7LA 1SU6A 4W9RA 4DR5B 5C51B 2R7KA 4XUCA 3EYAA 1FLVA 3ADOA 5EJ9A 3G2HA 1QFZA 1ZK3A 2IZ1A 1O8CA 2R1VB 1OTHA 3NTLA 2A1TR 2QRJA 3QPWA 4TKUB 1XMJA 2Y0PA 4HAIA 4NYJQ 3SEQA 1GRRA 3PCXA 2GHTA 1OREA 3STUA 3N75A 1AJEA 2FSGA 1C50A 4NCNA 1U0EA 4S1WA 3P9CA 2IS4A 3TN7A 1FYDA 2FP3A 2ZRJA 4HFRA 5BMOA 1FF9A 2JLQA 1I51A 3UBTA 1UBHS 1PFGA 1S3SA 4KUGA 4CEHB 1BFDA 1SHUX 2GOYA 4RFVA 3P9IA 1F0KA 3FCEA 1GOTA 3WG9A 4EJ0A 2ECPA 3F73A 2JASA 2BMDA 4ZXFA 3D6MA 1KDOA 2M6RA 5MN6A 3B36A 1BXGB 4J1TA 2C2XA 4RK5A 4Z0PA 4L95C 3G9UA 1BWPA 3E9MA 2OCKA 3RKRA 1EPUA 3UCFA 4PYJA 2WNIA 3EY4A 2YL2A 3QKTA 3ASUA 3D2BA 5FI3A 1H3NA 1HLFA 1N9GA 2XNHA 5M2QA 3H5NA 3T52A 2OECA 2OMKA 1P7PA 1X3SA 1GPBA 2A0FA 3W6OA 4EOGA 3DL7A 1AKQA 1Q7GA 4YHBA 2GZMA 3NIGB 4H1VA 5K0EA 2XT9A 2BELA 4FGJA 2UZAA 4CF4A 5IJ0B 5F98A 1M1NB 4HZGA 1GD1O 3D4LA 3QBDA 4XFJA 3W7AA 4A03A 3Q72A 3FWHA 4MWSA 3UMVA 4JQZA 3ZY6A 2ZJ7A 5K8UA 2YHSA 4BKMA 1JSRA 2CDBA 4TKVB 5AM5A 4ZCPA 5F5NA 2YN4A 3WV5A 3CW2A 3PCRB 5TQ2B 1XZPA 1AMNA 2Q2QA 5JYCA 2DWCA 4XWAA 3KS9A 5T67A 3OQHA 2J7PA 1D6JA 2JHPA 3UM9A 1C1YA 3MUFA 2I6XA 5CDFE 5EN4A 4FXOA 2G28A 1JLMA 1QWOA 2EF0A 3D3EA 4G8BA 4CXMA 4DV0B 5FBLB 5FF9A 2ID8A 2VDQB 2O2GA 5DBHX 2XZTA 1XXHA 3BYZA 3T7TA 1U6JA 2AKEA 3LTEA 4A0QA 2JFYA 1NONA 1YNOA 2WOOA 2G72A 1BFKA 3WLPA 4HDKA 2IT1A 1GZ3A 1YH3A 1NATA 4HGYA 4NU0A 2IITA 4B3DA 2J7KA 1C9DB 3Q7SA 5AVJA 3SBEA 3IILA 3Q3HA 3ZH2A 5KBYA 1RCTE 5SZJA 1R6AA 4V0QA 1N0HA 3R7LA 1EFTA 4D4LA 5KB3A 1Z2AA 4BMVA 3GPBA 1QGOA 1GUFA 4EX7A 1CZKA 2R7NA 3N8DA 3NTRA 4S0ZA 2O8DA 1IQ0A 4HX9A 5KJ1A 1YS6A 2M6SA 2D2VA 5AVYA 2PGDA 4GP6A 5JLAA 1BIFA 1KYXA 1VJ5A 4O25A 3D4OA 5G0WA 5SZKB 1SKAA 5IS2A 2KB0A 4L9WA 4M2LA 5TJHA 3ZHUA 3O9ZA 3ZY4A 1Y4UA 1G20B 3E7DA 1EHIA 4WH0A 2QL6A 4NDAA 5CIWA 1J2RA 1BS2A 2NAFA 4MR9A 3R6WA 3C8UA 3FZQA 3HBLA 3L8ZA 3AHJA 1NUSA 4YT8A 1E2PA 1VLJA 2Z8YM 1OWPA 3A05A 1XNQB 3LHSA 4DNFA 1TAUA 1C0KA 2CY0A 4Q39A 2XRZA 1T9GR 5B36A 4I4IA 5EHGA 3BD9A 4FFMA 2Q3HA 1OI3A 4NV0A 1PZHA 4YCBA 4BMZA 4OFXA 4DUZB 3ITEA 1EFCA 1NYQA 1T5HX 2WHEA 1SZPA 3SAJA 5GJBA 1G291 2PFGA 4PF1A 3BFKA 4DPMA 3AJDA 3CPHA 3P2KA 4QUHA 3Q5GA 2C9MA 2QW0X 1HWYA 4MV6A 2QENA 5DH9A 2ZG6A 3Q0IA 4CFYA 2PLRA 3GLHB 3UH1A 5T64A 2O07A 4G9GA 4PZEA 5EXEA 5BNWA 1L4NA 1HFWA 2H4ZA 1F8UA 5HUQA 1I3OA 2ZSEA 3BOSA 1MJNA 1ZESA 2X0NA 1E2EA 3CNBA 4KAAA 3OPQA 3ZIUA 2XE4A 3IQFA 4QYWA 4AY2A 4TTJA 4NQRA 1M74A 4E70A 1FYXA 4JFAA 4CMIB 4Q7KA 3SVZA 4OTZA 4C30A 1RPNA 2ZSBA 5DTJA 4HT3B 5KS2A 2R4UA 2V97A 4OVKA 3G5UA 5MN5A 5F5LA 3LVFO 2DKOA 1K6XA 4HQLA 1GCOA 4XM1A 1YMVA 2VJQA 1TXGA 1T4CA 3QW2A 3I72A 3WK7A 2IYLD 1T1SA 3HWX1 4IRUB 4OHOA 1BAPA 4YAFA 4BLUA 3LRXA 3ZHQA 2P91A 4XGIA 2QX8A 3TDKA 4BIMA 4YAKA 1AY0A 2WAAA 721PA 3OJLA 2XCIA 1GNLA 1NBHA 3BILA 4UAJA 5HKKA 4BNUA 3HKDB 1ZA1A 3HBNA 1MC8A 4KBGA 4FX5A 1PR1A 4NIMA 2VYVD 3QW4B 3RK1A 1QOQB 1B0ZA 3SJBA 4A9AA 4BO0A 3BMXA 2FPGA 5L7YA 1M8GA 1XQVA 3LFUA 1H22A 1IG3A 1L4FA 2I6FA 3CONA 5KOJB 1R5BA 1J56A 1EZZA 1TZCA 4JQCA 2YOHA 3C7AA 3I2FA 3IQHX 3LYHA 5HIJA 1C0EA 3E5RA 2QXUA 4B40A 4BNXA 4B0PA 4K40A 4C21A 5JMTA 4A26A 5JPCA 5DYTA 3ZHYA 3H8JA 2BGTA 4HZUB 4N3CA 4O4JA 4Q9IA 2HY7A 3KB8A 3KUXA 2VLBA 4JLDA 4M53A 1M2WA 4O4IB 3HTXA 2WZQA 3OKCA 5J4HA 5A0TA 3R3VA 1V7ZA 3WWEA 5JDIC 1NUTA 2AI3A 4I2NA 4NPAA 1KH1A 2IKSA 3EA5A 5KTKA 5LC1A 1YL5A 5E2AA 3SJAA 1IZ0A 3RAPR 5IK2D 2JJ2D 2PSDA 4OGFA 4CYMA 1XCGB 3DO6A 4EH1A 2VQ3A 1M10A 1X8XA 5CB4B 3GLFE 2C7PA 4JLMA 1GN9A 3K5PA 4G0XA 3C16C 1DX4A 1SWWA 5AOCA 3U0VA 1UPCA 3K70D 4I1PA 3FYCA 2WTBA 3O91A 3VVMA 3ZDCA 2AQHA 1JQDA 3UT5A 4RCYA 2R25B 4F97A 4QNMA 4AW9A 2JD2A 2P30A 3ZWMA 2OBXA 3OWHA 4FDUA 3UT0A 3ILHA 3QHAA 3PGLA 1F06A 1FLAA 3KHTA 1DKMA 3VHQA 5BW8A 4XWKA 3BE8A 3G2JA 1MX1A 3I05A 2HMYB 3TGPA 5AQ1A 2INGX 4HNAB 3AR3A 1QGYA 2D1FA 4KQCA 2OENG 2BEUA 4DYHA 1VZ2A 1XVVA 1RJDA 5CIYA 2OK7A 3AY6A 4ZRDA 3BK7A 1YZYA 3Q4GA 4LE2A 4Z0TA 1PT7A 5GM1A 3QTBA 3GCGA 4MOWA 3T3EA 4BUZA 2WJIA 4RDIA 3GGGA 1GGEA 2CVQA 3SC3A 4KDFA 1HQYE 3H7IA 3DPUA 4LJ7A 1UBCA 3QX3A 2FUNB 4PYNA 4JC0A 3T4XA 2OUIA 1M1YA 1U5BA 3COPA 4G1CA 3Q7EA 5FTWA 1DV2A 1O57A 2REBA 4NBUA 4Z53A 4QSMA 3G7UA 1WTCA 3LAWA 2JGNA 5AJVB 2AQKA 3B1WA 1IEQA 3T3PB 1B3BA 2UYQA 4QVKA 3G0GA 1KOLA 4B3RB 1AGPA 2YXEA 3AJ9A 4XB6B 3WIEA 3R9XA 3I6YA 4YDQA 1EX9A 1GQOA 1S1CA 2Q5FA 3GLUA 1SVMA 5BO5A 4DA4A 4JBXA 1RRCA 1WBBA 1EUQA 3IAS6 3DWGA 4NU6A 3U4AA 2XZDA 3LBHA 2PSJA 5CCBA 4JXXA 3EWIA 4G1BA 5E0KB 5FPPA 5FQOA 5I9BA 3ETHA 2HU5A 3U1TA 4V1CI 1U4OA 5JMOA 2JFNA 5EHZA 1DKQA 3W90A 4I50A 1N7IA 3VC3A 2AMVA 1LBEA 3PCTA 3PSHA 1DIOB 4AL4A 4BMXA 3H2SA 3L5KA 1JEJA 2Q0HA 1GUBA 5EPOA 1F3LA 1MAHA 1TMGE 2EFGA 1X1TA 2IP1A 2X5KO 3CH4B 3DBLA 4QRDA 3ZW8A 4BMOB 2OB2A 4HFMA 4LHVA 5F4ZA 1NV9A 4FOSA 4DLZA 4KHPB 2NGRA 1FS5A 3K8QA 4QXMA 1ZMTA 2IHVA 3C3CA 3Q6IA 2X9NA 4QXAA 1N75A 1PZMA 1UDCA 4U7DA 3IBCA 1QBKC 1Z0ZA 2UAGA 4E1VA 1QYWA 1RACA 2V7EA 2Q1XA 3ZD8A 2JL1A 5CVTA 1HDOA 2YZ7A 2IA5A 4FDMA 3PYXA 4LWOA 5DMXA 1L2TA 3NYWA 4RMIA 4CE6A 4F0JA 5BURA 2CLIB 3QWIA 1VKHA 4Q15A 1CR4A 4L72A 4OXXA 1BE6A 4OJYA 2ZUBA 2EZUA 4MS3B 4NYJR 4ESEA 4BEWA 7REQB 2G9RA 3VPAA 2I7CA 3ZE0B 2GN6A 3KHSA 4YRZA 2O2IA 1H65A 2A78A 1N0VC 2WSSA 4GFDA 4NMXB 3C1OA 4ER3A 1ZLYA 1ACMA 1G8YA 5JXGA 1JG6A 4GVPA 3P7MA 3AL3A 4ENRA 2WWRA 3ZJUA 2FPPB 5FNVB 1JIKA 2J9GA 4MKGA 4WV3A 1EVYA 1RPTA 5EQTA 4R2MA 5GONA 4IIDA 2CEKA 3HJFA 1Q1ZA 4OMCA 3VA7A 3TZ6A 5I45A 3O21A 4GMDA 1M75A 3JZMA 4JC8A 2PD3A 4GOND 3DONA 3B8HA 2CUNA 1CVLA 1P1CA 1DKUA 3DXZA 1FNMA 1YJBA 5JSQA 1GRCA 2BH2A 1ABFA 5IKXA 2OBMA 1QSGA 3ZGOA 4ZCQA 4I6GA 3RLFA 4D0GA 1T10A 3VDQA 5FUQA 3MTIA 5AW3A 4C0KA 4EUSA 1ZCZA 2JFXA 1E6KA 1H2AS 3N0XA 1OH7A 4ISBA 3BMCA 3K5HA 4W9NC 5IAKA 2AHOA 1N2BA 2QVBA 2VDRB 3L4EA 4M1OA 2I4TA 4XEHA 2BTQA 1BWSA 3HXKA 4JB0A 4ROSA 1JYSA 4UZSA 1L5HA 5E7MA 3MWYW 3O0DA 4KNWA 2DGDA 3FXAA 1RZVA 4KC0A 1VFNA 4KQEA 1RP7A 5BN4A 1G4UR 1XT6A 3N74A 1H3EA 1XYVA 5ERYA 4ZAXA 5B57C 2OCGA 3EEYA 4QBFA 3UZUA 1U9IA 4OLFA 4R83A 3WADA 3RC3A 1SCAA 4FB4A 1YDHA 4HDRA 4F85A 1HNZB 3BXPA 4OMDA 3ROTA 4AUNA 2VZ9A 221PA 3KZMA 1WE2A 2J5QA 3PX2A 1WW2A 4LE0A 3MIZA 5JZVA 1W96A 3HO8A 2C83A 1TQ8A 1GAXA 1NVVQ 1FUUA 2IS1A 3NBAA 2DUWA 3R40A 5K01A 2HBYA 1ZH8A 2FZCA 2WWFA 4AKEA 4C20A 3GFQA 2WMDA 5JC1A 2QTVA 5EZ6B 2JAQA 2D5LA 3IL2A 1I7SB 3IEXA 1NKVA 1WZ2A 4AY3A 2N0SA 2CB9A 2FCRA 5HR5A 2Y1OA 4O2BF 2FA9A 1U7HA 1VA4A 5JATA 5JZ9A 2QLNA 2QMZA 1VLVA 2VP2A 3UOGA 1A7KA 5D3QA 3FUTA 1NLMA 1IWOA 4ZHQA 3DZ8A 3R23A 1HRDA 2WTNA 3DMGA 1FK8A 1PR2A 2ADFA 2MTBA 1QYCA 3HJAA 3LWBA 3NVAA 3R41A 5K05A 1M83A 4N65A 4DV4B 1YKSA 4XPIA 5DHRA 5I9MA 4YONB 4UM5A 4LRSB 2XQVA 1CR1A 2ZKLA 1O94C 3TI7A 4ZK6A 2YXBA 1PE0A 3KDAA 4DCMA 5LP1A 5THQA 2FRXA 4LJ8A 1NTRA 3SS7X 3L7CA 3SIWA 5JV5A 4LVUA 2A33A 4QWWA 1DRUA 4UNQA 5ALXA 3E6AA 4D99A