3EYDA

Structure of hcv ns3-4a protease with an inhibitor derived from a boronic acid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Potent inhibitors of HCV-NS3 protease derived from boronic acids.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1a
molecule tags Viral protein
molecule keywords HCV NS3
total genus 41
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3eydA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3eydA01
4FU9A 3QTVH 4O3UA 2H1UA 1KIGH 4JK5A 1P04A 1G9IE 1W8BH 3VB5A 4B73A 1GJ9B 1O33A 1RRKA 4Z0KA 2BHGA 8LPRA 1SPJA 1O2QA 1D6WA 2F4LA 5C1YA 1BRBE 1BRCE 1CGHA 1GGDC 1TA6A 4Q80A 3RM0H 3W95A 2VIQA 1GI8B 3O8RA 1QL9A 4JZIA 1AKSA 1YBWA 3ENSB 2BY7X 3HKIB 1O2XA 1EB1H 3A7XA 3VEQB 1YLCA 2FIRH 1OYQA 1ELBA 1XUGA 1PQ7A 4LZ1H 2STBE 4QT8C 4HFPB 1O2VA 3T27A 2XW9A 1AD8H 1BCUH 1OS8A 2BDCA 2IJOB 4Y79A 1HXEH 1SGCA 2Z3EA 1EAIA 2H6MA 2OBOA 3A8AA 5GDSH 3SHCH 1GI0A 3M61U 1JWTA 5E8EH 3ZVBA 1VITF 1P8VC 2B8OH 3SZNA 1DUAA 3C27B 2J92A 3EYDA 1CU1A 4KTSA 4ZKNU 1N6XA 5AHGH 1EPTB 3GCOA 1CT2E 1LVBA 3JZ1B 1D9IA 4PROA 2H9TH 3LT3A 3KIDU 3SU2A 1UVPA 1V3XA 5E2PA 2AERH 5TJXA 2ASUB 3ZZ8A 1P9SA 2FYRA 3QZQA 3UWIA 1QBOA 1O3CA 4TPIZ 7KMEH 4FVDA 4AG2A 2NU0E 1SC8U 1DPOA 3AAUA 4KELA 4ISNA 1OSSA 4AGKA 2A4GA 2ZTYA 4ISOA 1UTPA 1BTYA 3ZYDA 1GI5A 2BVXH 4TWYA 3E91A 3A8CA 1P09A 1SHHB 4RI0A 1O36A 3GY3A 1TNGA 2J9NA 3E3TA 4LK4A 1XVOA 3UTUH 1NFYA 3RXIA 3U98H 4Y6DA 1A2CH 1MTNC 3TIUA 2UUJB 2A4OA 2PHBA 4GVUA 1V2RT 1UTMA 2FX6A 4HZHA 3M3VA 1C2MA 8ESTE 5GWZA 1Y3UA 1TGNA 2G81E 1A3BH 5LPEA 2ZTXA 1P2KA 1GGDB 1TOMH 3DFLA 1KXEA 1V2LT 4FUHA 1ZTJA 1C1MA 2F9NA 1NRQH 1YPMH 4M7GA 1TPAE 3NUMA 2Q1JA 1V2VT 2VIVA 3A7ZA 1QQUA 2SGEE 2BQ7B 1RJXB 1MTUA 2GMTB 1TWXB 2HNTC 4A92A 1AO5A 2HGTH 1O2GH 1NRSH 2CN0H 1GHYH 4AX9H 1O5BB 1THRH 4NG9H 5L30H 3SU5A 1LCYA 1HRTH 1QFKH 1SL3A 3KCGH 1G30B 2GVFA 2GD4B 5JDUB 2G55A 4K1EA 3SU0A 1OOKB 1GHZA 3GYMA 1ELGA 2ZHFH 2ODQA 2BLWA 1GCTB 1WU1A 2P3UB 1BOQA 4X2VA 1TPOA 1ZOMA 2ZGBH 2OUAA 3IG6B 4WF8A 4XE4A 1V2JT 1XUFA 1NZQH 1OXGA 4IC6A 1QURH 1FDPA 1MKXK 1Q3XA 3LJOA 3RXVA 4K8BA 4B6EA 4YO9A 3HGPA 1HGTH 1NU9A 4HGCA 2UUYA 3FANA 1VCQA 3RLYH 1LDTT 3PWCA 3RU4E 2SNVA 1DT2A 4Z6AH 2VVCA 2FPZA 1BHXB 1SB1H 4DY7B 1T4VH 2BLVA 2D1JA 2ZGCA 1Z7KA 4OS6A 3KF2A 3ATLA 5EQSA 1C2JA 2R3UA 8KME2 1EOLA 1HFDA 1O3GA 1BA8B 2RDLA 3E6PH 1EAXA 3NKKA 3P8GA 1Z8GA 3TH3H 3UUZA 4GUXA 2RA3A 5T6GA 1H9HE 1HB0B 2HPPH 3STJA 1OP8A 2F9PA 1AFQB 4DCDA 4ISHH 1TGSZ 4K69A 4BXSA 5DG6A 2GCHG 2J95A 1JBUH 4B6FA 1YPJH 4YM9A 1ZPZA 5ESBA 2Y7ZA 4CHAC 3KEEA 3RC4A 1NFUA 1V2MT 1W0YH 1ZTKA 3U69H 3H5CB 1IQLA 2J34A 3F9EA 1FAXA 1UK4A 1AFQC 1BMNH 3PMAB 1N1LA 2BD9A 2BM2A 1W3CA 3UQOA 3BN9A 2GDEH 4X1RU 4E7RG 1V2KT 1GJAB 2W7SA 3CS7A 1AVGH 1FLEE 5J4SA 2A7JA 1F2SE 1BDAA 1TAWA 5F03A 1KDQB 1C5PA 1TPSA 2PGBB 3FP6E 3G01A 4GCHF 1AWHB 3I29A 5L2ZH 1MKWH 1GJBB 3S0NA 2GX4A 1AB9C 3ZZ9A 3SV7A 1WV7H 1ETSH 1QR3E 1K28D 1OPHB 4X0WU 1BITA 1XUIA 1TRNA 2SGFE 3T5FH 4IW4E 1RTKA 1O3EA 1QJ1B 1YPEH 1LHGH 5K7RA 4WJG2 1F0UA 1PYTD 5CHAB 1YPKH 1DS2E 2ZCHP 1V2TT 1LHDH 1UTOA 3RXCA 4U01A 2D2DA 4ABEA 2BD5A 4ESTE 3NXPA 4A5TS 1C4Y2 3MU0A 5F6MA 4BAMB 4A6LA 4MVNA 3R3GB 4K1SA 4OS2A 2GV7A 2CHAC 3SQHE 1GWAA 2UUFB 1TPPA 4NFEA 1ANEA 2QF3A 3BF6H 2BOHB 3LC5A 1S5SA 1XMNB 1RFNA 1CA0C 2GCTB 1WAYB 1RIWC 3PMHB 3ZV9A 2H9EH 3SV9A 3QX5H 2AMDA 2ZU5A 4MPXA 4SGAE 1F5RA 4WWYA 3PV2A 1ANBA 1SBWA 3IITA 1GI7B 3SZEA 1FQ3A 1JOUB 3MU5A 4ABDA 4CH2B 2A2QH 3VB3A 2PLXA 3LDXH 3PWBA 1TNIA 1RTFB 3RXHA 7GCHG 1DY8A 3DFJA 2FOEA 1G2MA 4Y8XA 4BTUB 2ALVA 5EXLA 1FY5A 1P2NA 1ZSKA 2SGDE 2ZGHA 1FY4A 2ODYB 4Q2KA 2XBXA 1VITH 1WSSH 1DUEA 1EZSC 2OTVA 1O31A 3BTDE 4ZKOU 1UK2A 5J4QA 3QTOH 1ETTH 2C8WB 1O32A 2BDHA 1ZHMA 2XC4A 3KNXA 1TX7A 1U6QA 4WMEA 1CQQA 1MD7A 1SOTA 1ESAA 1OP0A 1D3TB 2OQ5A 3OY6U 1Y5AT 3GY7A 1DWCH 2B7DH 4E7NA 1YPHC 1TIOA 4MDSA 4WMDA 2VINA 3MNBA 3T25A 3O8BA 2HRVA 4ABJA 4UFGH 4K8YA 1O34A 1VGCB 4ABHA 4X8SH 3RDZA 3RXAA 2Y7XA 1C2EA 5G4BA 1TGCA 1GJDB 1MAXA 1TOCB 4BAHB 1W2KH 1Z1IA 1QBVH 4H4FA 1C2HA 1O5AB 3ZZAA 7ESTE 2BLQA 3Q77A 3V3MA 3S9BA 3QN7A 1H9LB 2OINA 3E1XB 2J94A 4WY3A 1TONA 1DWBH 1LVOA 2P16A 5DP9A 1LHCH 1GBIA 1P3CA 3RUOA 3MNXA 4AZ2B 4AB8A 1JRTA 3GCHB 1FIZA 4NIVA 3UQVA 1O38A 1Z6EA 1SFQB 4UD9H 1W13U 3GY2A 2VU8E 1BUIA 3FP8E 1C5LH 1RGQA 4NSYA 4CH8B 2NU4E 4O03A 2ZU1A 3TJNA 1TNJA 4K60A 2FM2A 3KQBA 3A81A 3T29A 1HJAB 3ZZDA 4FU7A 2VIPA 4ZAEA 2QXGA 4TWWA 3MI4A 1O2MA 2C93B 1J14A 1PPEE 2BD7A 1TMBH 4X8VH 4MNVA 3NWUA 1G2LA 1GVLA 1D3QB 1FY8E 2OP9A 3K65B 4RN6A 5GXPA 1ZSLA 1OP2A 3UOUA 1P03A 2ZTZA 1ZYOA 3BSQA 4Y0YE 2BD4A 5JB8S 1HAPH 1E35B 1QA7A 4O3TA 1E0FD 2GCHF 1AVWA 1GBDA 4U2WA 4FU8A 4B75A 1MU6B 4MNWA 5GNDA 3RXGA 1QY6A 5I46H 1BTZA 1VJAU 3PROA 3CENA 4MQAA 1J8AA 3IWMA 4A1VA 3QUMP 1TALA 4CBOA 4KP0A 1LVYA 1DANH 4CRGA 5PTPA 4CHAB 3ITIA 3P8FA 1QBNA 1OKXA 4X8UH 3PLBA 1V2QT 2OLGA 1C1UH 4D76A 3QK1A 4Y71A 1GHBF 3GCTG 4MNYA 2EA3A 1MU8B 3L3TA 2ZGXH 1GMDG 1KLIH 1UJ1A 1AE8H 4THNH 1ZZZA 4BAOB 1GMHG 1P01A 4XFQA 3PMBB 3VXFH 5I25A 3BTME 3N7OA 1HAHH 1P10A 3ATWA 1C1NA 1AY6H 4Q7XA 1P02A 5DP5A 1ZLRA 3AAVA 3ZVCA 2QA9E 2P8OB 3KQCA 2AIPA 1BMLA 4Y7AA 1O2KA 2ANMH 4I8KA 5FBIA 2ZQ1A 1GBKA 1A0LA 1YCPM 4H6TA 4UEHH 3SJKA 3SUEA 1KY9A 3M36A 1C2GA 3E16B 4H42U 1M9UA 1BMMH 1EB2A 1MTWA 1GJ8B 1L2EA 1C4V2 2F9OA 2Z3CA 1H9IE 4IMZA 1O2IA 3VFEA 1DOJA 1SGQE 2WHXA 1AMHA 3MHWU 2VBCA 2BDAA 1CBWC 1TMTH 1HV7A 3ODDA 2ZFFH 2TGDA 1LHFH 2O8WA 3ZV8A 1BRAA 1GI6A 9ESTA 1ABIH 2FXRA 2NU1E 3H09A 1LKBA 1BT7A 4U30A 1O2RA 3M5LA 4IS5A 1DSTA 1DFPA 5F8ZA 3LKWA 3M3SA 1PPHE 3S69A 3K6YA 1C9TA 1HNEE 1C5YB 3U8OH 1O5EH 3A83A 1YPHE 3BG4B 1GG6B 1GMCF 2VVUA 4OS4A 3KL6A 1PPZA 4D8NA 2Z9LA 1NESE 3UNRA 3MO6A 4KTCA 2ILNA 1V2OT 2FOCA 1SLXB 2GTBA 3VXEH 1A5GH 3P8NA 1K1OA 5IYTA 1AU8A 1MBMA 1O37A 1AKSB 2BY6X 2PKSB 1YP9A 3ELAH 1C5SA 2NU3E 4LOYH 3QZRA 1BJVA 1W14U 1BTPA 4B74A 1V2NT 3S9CA 4JK6A 2ZNKH 1BRUP 2VH0A 4NA9H 2FI5E 1GJ7B 1AUTC 2STAE 1LVMA 2O8MA 2QC2A 3STIA 1NO9H 2DE8A 2Z9JA 4OS1A 1HAVB 3PTNA 3VB7A 2J38A 3MWIU 3KHVA 2WPLS 1IQKA 4YOJA 3OX7U 2AMPA 2FOGA 4ZXXH 3SGAE 1MZDA 4XBBA 4MNXA 1CT4E 2A32A 6CHAC 1EPTA 4UDWH 2IPHA 2CF9H 1GBAA 2OC8A 4NIWA 1IHTH 1WCZA 4X6NA 1SVPA 1AUJA 1SFIA 5JBCS 1W7GH 1AFEH 5FXLA 3SYJA 1VGCC 3GY8A 4CREA 2FS9A 1DE7H 2GP9B 2Y5HA 4YTAA 5JYIA 3URCA 2ZECA 1AQ7A 4NSVA 1ZRBA 4ZUHA 4AG1A 1P2IA 4IMQA 4CRFA 3ESTA 1Y5BT 4A7IB 3TJUA 3SN8A 2W5EA 3TU7H 3VPKA 4UFFH 1SGNE 3LU9B 3VGCB 4NCYA 1NT1A 2BY8X 2ZG0H 1LPGB 1C4U2 2TIOA 4I33A 1C5RA 1KXAA 3T28A 3MTYA 1HAZB 2WPIS 2XYAA 2BDGA 2ZGJA 2HOBA 2OCVB 2ZDVH 2W26A 3OTPA 2VJ1A 4YT6H 1ELVA 2ZFTA 4DURA 4LZ4B 2LPRA 4CR5A 2K1QA 3QGNB 3F9HA 1C1WH 2G52A 3SJ8A 3K9XB 3LGUA 2WYJA 3HATH 1WTHD 1KTSB 1MD8A 3KGPA 1ELCA 1FONA 1O3IA 1LTOA 5JBBS 5A0CA 4Y8YA 3BEIB 4WXVA 2UWLA 1MTSA 2OQUA 1C9PA 5K0HA 3B23B 1UVOA 3VB4A 2R0LA 1A5HA 1QQ4A 1SQOA 4JZDH 4IC5A 3U1IB 4XBCA 5T1VA 4GPGA 3BTWE 1S81A 3SU3A 1Y3VA 2XC5A 2M5TA 3ATIA 1W7XH 1FJSA 2FODA 1OWKA 5TCCA 4J2YB 4ABBA 2A5IA 4X6PA 3A85A 3BTTE 1DSUA 1CHOF 1EJNA 1O5GH 2Y82A 1ID5H 1O2OA 1V2WT 5CMXH 1Y3XA 1S6FA 1QB6A 1O2NA 4O97A 1GHAF 2H2ZA 2ZPQA 2P59A 2LNCA 3LIWA 1LO6A 4A1TA 1DXPA 3UREA 1BQYA 3BIUH 2BQ6B 5B6LA 1SR5C 1GPZA 1ESTA 1IOEA 3R0FA 4ABGA 1AZ8A 1GI1A 3RXRA 4OS5A 4UFDH 5CHAC 3U8RH 2BMGB 1Y59T 5FCKA 4ZHAA 1F5LA 2YNAA 2VIOA 5HGGA 2IJD1 1TNKA 1PQAA 2XBYA 2BQWB 1TNLA 1LPZB 3A7VA 1QRXA 1BTUA 3TH4H 4YLQH 1ZGVA 3UNQA 1JMOH 5AVDA 1T8MA 2JETB 2XRCA 1GBLA 3D49H 1CHGA 1VR1H 5LGOA 1L1NA 2PKAA 1MTVA 2ZPRA 4GHQA 1Y3WA 4X1NU 1GHXH 3Q00A 2ZZUH 5A8XA 3SQEE 1K1MA 5EXMA 1GI3A 1IAUA 2WV5A 1CHOG 2TGTA 4K1TA 2PSXA 2ANKH 1LQDB 1HAIH 2ZU2A 1L0ZA 1L4DA 1QIXB 4FXGH 1B0EA 2BTCE 3A86A 3RM2H 2FP7B 3TNTA 4TY6A 1P57B 1A5IA 1O3KA 4BTTB 4OGXA 1O5FH 1MMJN 1T32A 1UHBA 4OS7A 3F9GA 3TK6A 1DY9A 1K1NA 3D62A 3RXOA 4UE7H 3M5MA 4ISIH 2G4UA 3CS0A 2PUXB 2WPHS 2RA0A 1A7SA 1ZSJA 2R9PA 2XXLA 3HGNA 1QB9A 2FEQH 2J4IA 2HALA 3M5OA 3M37A 1Z8IB 1SGIB 1C1TA 3FZDA 2XNIA 1KLJH 1XKAC 3PO1B 2GT7A 2FYQA 2CGAA 1KSNA 1L1GA 1Y3YA 4ZH8A 3V0XA 1YGCH 3Q3YA 1N8OC 2GKVE 1C5XB 1AWFH 1RTLA 1VJ9U 3ATMA 4I8JA 4X2XA 1UCYE 1FNIA 1K1PA 1THPB 2ZFQH 4CR9A 1DVAH 2Z7FE 1EAUA 1C5MD 1TRMA 1GG6C 5BPEA 1F0TA 2ZIQH 1O3HA 2KAIA 2A45B 3E0NB 1B7XB 5EU8A 4MPUA 1O2PA 3TJOA 1C1QA 3FP7E 1A0HB 3GICB 2QIQA 2W3IA 1UTQA 1GI4A 3SJIA 1SMFE 5HM9A 1O3LA 1T7CA 2UWOA 1P0SH 2ZHWH 2FESH 3LPRA 1NN6A 4Y0ZE 1TQ7B 1AIXH 1TYNA 2A0QB 1GBHA 3LGTA 1GMCG 1C5OH 2O8UA 1KLTA 4B2CA 4WXIA 2Y6TA 1C5ZB 1MQ5A 2NWNA 1ZMJA 1YC0A 2AGGX 2WPJS 3V7TA 2BZ6H 3ODFA 1CBWB 3RXPA 2G8TA 2HNTF 1UO6A 1YYY1 3GDUA 1EASA 3EE0B 4E06H 2FOMB 5EOKA 1C2DA 1LKAA 3TLOA 4XOJA 1SQTA 3MU8A 4VGCB 3TJVA 1DITH 1GMHF 3MMGA 3A80A 5IDKA 4F4OC 5SGAE 1Z71A 2VNTA 3B8JA 1GHWH 4NWKA 4MPWA 3LJJA 4BAKB 3SGQE 3F68H 1O3FA 3A88A 1T31A 3RLWH 1IQEA 3S7HB 2XCNA 1WYKA 3UIRA 1HAGE 2B9LA 3VB6A 1TBRH 4GAWA 1XXDA 2BD8A 5HMAA 1Z6JH 5AFZH 4B2BA 3M7TA 1KXCA 2Z9GA 3UWJH 3A8DA 1XVMA 5B6OA 5E0GA 5CE1A 3UPEA 3P95A 2FTLE 4TY7A 1O3NA 2CHAB 1HIAB 3MFJA 1V6DA 1ARCA 2CV3A 1O2YA 1A4WH 2W3KA 2THFB 1OX1A 2O9QA 2A1DB 3RMLH 4IN2A 1CA0B 3RXMA 3TVJB 2VB0A 1JIRA 4BANB 3MNSA 1MTNB 2XC0A 4ZXYH 2P8OC 1ABJH 3B9FH 1GJ5H 1GBMA 2PFEA 2UWPA 4I8HA 3DA9B 2JKHA 4X1PU 1O30A 1VZQH 3GCHC 1AVXA 2BY5X 2ZI2H 1O2UA 3RXLA 2WINI 3NCLA 3BTGE 1UCYK 2A4QA 1GHAG 2Z94A 2ZDMA 4JYVH 3AK5A 1IHSH 2C4FH 3FFGA 1UVTH 3S9AA 4INLA 2D26C 2FI4E 1C5UA 2Y81A 1AN1E 1DLKB 1UVSH 2CF8H 4NIYA 4I8LA 1P11E 1ACBE 1TFXA 1X7AC 3LOXA 1T8OA 2ZA5A 1ZMNA 4FUGA 1KYNA 2PW8H 2GGVB 4X1SU 2QYIA 1KDQA 1HPGA 3Q3XA 1E38B 1P12E 3ZZ5A 1GHBG 3GCTF 1GBEA 1HJAC 3BIVH 3AVZA 3I78A 3SOSA 1ELTA 1MCVA 1LHEH 3FVFB 3H7OA 2FX4A 3SW2B 1L4ZA 1EOJA 2FS8A 3A7TA 1FUJA 6GCHF 2JH5D 1GJ6A 4KGAA 1TE0A 4FUJA 1LMWB 2WV9A 1TNHA 2F9BH 1S85A 2ZC9H 2XTTB 4YZUA 1K21H 1XUJA 4R8TB 5ABWA 2ZDKA 3MH6A 4Y7BA 2GMTC 4ABFA 3SUGA 1DDJA 3OY5U 1T8NA 3BTQE 4WVPE 1BBRE 4ZMAH 2V0BA 4DVAU 4NZLA 3SI4H 5JBTA 4INKA 1K1JA 5TCAA 1TB6H 1A3EH 1EXFA 1ZHRA 2SNWA 2XCFA 2EI7A 1BJUA 5HXFA 1QJ6B 2ZO3H 1G3BA 1SLVB 1XKBC 2DUCA 2Q6GA 4IN1A 4BTIB 3QO6A 1KXDA 1S0QA 1YCPH 2ZU3A 5EQRA 4BXWA 1P9UA 1P2OA 3SV2H 1SI5H 2Q6FA 1IQFA 2J2UA 2A2XH 4TYDA 1HJ9A 4H6SB 1NY22 2WUCA 1O3OA 2V3OH 1EX3A 4ZHMU 1N6YA 3E90B 2P3FH 4BAQB 5FPSA 1GJCB 3BTEE 2FLRH 1K1IA 1NROH 2CXVA 1NS3A 1AZZA 3RXFA 3ZZ3A 1QCPA 2H5CA 3M35A 5EW2H 1HJ8A 4CRBA 2WZQA 5EG4A 5DP4A 1ELFA 2BDBA 5C67A 2FI3E 2A5AA 2XBWA 1GDQA 3A89A 5A8ZA 1TX8A 1TLDA 1EAWA 4X6MA 1QRZA 1V2UT 3E8LA 2BDIA 4FUIA 2ZKSA 4RKOB 4ABAA 2FOAA 3JZ2B 1MZAA 1K2I1 2ZHDA 1BBRH 3ZVGA 1PQ5A 2FOHA 2Y80A 1F92A 1ZJDA 4UONA 3PB1E 3RXBA 2XWAA 2FTMA 1B5GH 1Q2WA 4ASHA 1O2LA 2ESTE 2OC0A 2QCYA 1JRSA 1NFWA 1GJ4H 1P2JA 3DHKH 1EKBB 5H4IB 1CVWH 2Z9KA 3DT0H 1Y5UT 4DG4A 2WV4A 1RIWB 3A87A 4SGBE 1KTTB 2QAAA 1DWDH 3UY9A 5BRRE 3DD2H 2WYGA 2VIWA 3FAOA 1GI2A 2F3CE 1DLEA 4CRAA 1RS0A 2FMJA 1QRWA 5L6NH 4NFFA 1W12U 2GDDA 1TRYA 5FPYA 1Z8RA 1Q31A 4I8GA 1J15A 4MPVA 2EI8A 1F0SA 5T3HA 2AH4X 3QGJA 1WOFA 1YPGH 2PWXA 1CT0E 2A5KA 2FOFA 2ZCLP 2ZFPH 3MH7A 3ZVDA 2FZZA 1NTPA 3EA9A 1MKXH 1V2ST 1BB0B 4JMYA 2VWNA 3ZVEA 1PPCE 1H4WA 2GZ7A 1PFXC 4DT7B 2R2WU 3TGIE 2R3YA 4O9VA 1TQ0B 1CGIE 3TK9A 2CMYA 2P95A 1Y8TA 1TABE 3PLPA 1G36A 2GZ9A 1QNJA 1CE5A 1S6HA 4JZEH 1YLDA 3P8OA 1UMAH 1S83A 4WH6A 3SU6A 3W94A 1ELAA 1O3DA 3A7YA 3F9FA 2HWLB 4B71A 4AN7A 5DO4H 3SORA 1CO7E 3M7QA 1P06A 2PTNA 2VGCB 2TRMA 1GL1A 3F6UH 1ORFA 4GSOA 1CSOE 4NGAH 3EGKH 5DP3A 3A82A 1YKTA 2BD3A 4Y8ZA 5A09A 1AI8H 4ZHLU 1KXFA 2Z9IA 3TGJE 2QV1A 2I6SA 1ZPBA 4U32A 5DJ7A 3LONA 3H7TA 3SBKA 3SNAA 2V6NA 2UUKB 4B76A 5EXNA 5HM2A 4AORA 1GBTA 3RMNH 2GCTC 1NC6A 1B0FA 1EUFA 3KN2A 3EA7A 3I77A 1A61H 1YCPK 5A0BA 3RXKA 1OWEA 4I7YH 1C1SA 4D9RA 2NU2E 1W10U 4DGJA 1K9OE 1XM1A 3ZVFA 2QXHA 2JETC 2AGEX 3EAJA 1GCTC 3M5NA 3BEUA 4YESB 1GBFA 3U8TH 1GBCA 4K5ZA 3UR9A 1PQ8A 3D23A 1O3BA 1ANDA 1C2FA 2JH0D 5A0AE 1HBTH 1A46H 1P05A 1QJ7B 4X1QU 2ZQ2A 4R0IA 4D9QA 4X2WA 1DICA 1JIMA 2XWBI 1J16A 2H5DA 2PUQH 4M9FA 3QWCH 4JCNA 1YPLH 4NIXA 5E0JA 1J9CH 1HCGA 2Y5GA 1TMUH 1HAYB 3MU1A 5ESTE 3SO3A 2TBSA 1ZGIA 5T6DA 2VWOA 1D6RA 3RMMH 1C5VA 2ODPA 4YOGA 3FZZA 1RD3B 1H8DH 1G3EA 1OYTH 4Y76A 3MO9A 1SGFG 1GBJA 1XUKA 1TA2A 3TPIZ 1P3EA 2ANYA 1GDNA 4MLFB 3RXQA 3WY8A 5T6FA 6ESTA 3UOPA 1C2LA 3CP7A 3RXUA 4KKDA 1O5DH 4HTCH 2PTCE 3SGBE 1HUTH 3RC5A 3T2NA 4ISLA 3V13A 1PPBH 5GJ4B 4GCHG 4AFUA 2G4TA 2BX3A 1L1JA 1BBRK 3ZZ6A 1HYLA 4GHTA 1IQMA 1FV9A 2SGAA 2C8XB 1V2PT 2ZEBA 4CBNA 2AMQA 1MBQA 2O8LA 5E2OA 4BOHA 3PYHA 3LH1A 1HXFH 3SU4A 1NRPH 3RXEA 4WH8A 3PLKA 1TGBA 2JH6D 3EQ0H 2PGQB 3GY4A 4RSPA 1AE5A 5FHTA 1TBQH 1BMAA 2QF0A 1HAVA 2PKAB 1SQAA 1WUNH 1ZHPA 1PPFE 5FX5A 9LPRA 2PV9B 3P92A 4AYYB 1QA0A 2FLBH 2I6QA 2BVRH 4Y10E 5HYOA 1KXBA 3LGYA 3MYWA 1NRRH 8GCHF 3RXTA 1H1BA 1K22H 1UHBB 2BVSH 2CJIA 4NZQA 3BV9B 3MH4A 5F8XA 4FUDA 5EODA 3ZYEA 3SU1A 7GCHF 1EQ9A 1GL0E 1G3CA 1S0RA 5GPIB 2F9UA 1P2MA 2G51A 2QGRA 3PV5A 4NWLA 5C1XA 3NPSA 4FVBA 3D65E 3O8CA 1O2ZA 1SLUB 4Q7YA 4LXBH 3SJ9A 3QDZB 5DGJA 1BIOA 3URDA 1NFXA 2EEKA 4FUEA 3ZZ7A 1H8IH 2ZHEH 5LPRA 1NM6A 3PTBA 1EZUC 1FN8A 2C8YB 2AEIH 3SV8A 1SGYE 2BY9X 2ZF0H 2TGPZ 1FPCH 5C5NA 4I32A 2VWMA 3RC6A 5GCHF 4DW2U 3ZVAA 1QL7A 3LGVA 1C5TA 5JBAS 2TPIZ 2QN5T 2VGCC 1C5NH 4NA7A 1GDUA 1IQNA 1DX5M 1F7ZA 2KAIB 3GCNA 3L33A 3HK3B 1FMGA 3SJOA 1ARBA 3SV6A 3SHAH 2Q6DA 2VWLA 2VIDA 4TPYA 2GZ8A 3K6ZA 2DE9A 1LPKB 2PKSC 1SSXA 1IQGA 3GDVA 1S82A 3U1JB 1IQHA 1EZXC 3EA8A 3P17H 3PV4A 1C5QA 4FUBA 4AFZA 1YF4A 2GT8A 1ZPCA 2EI6A 1AGJA 1EJAA 3Q3KA 1GBBA 3LGWA 4X8TH 2F83A 1EZQA 4AGJA 1SG8B 1THSH 5AFYH 3RP2A 1FPHH 8GCHG 4K2YA 3EDXB 3UR6A 2AYWA 1NRNH 1D4PB 2BB4A 4ZKSU 6CHAB 2A31A 5F8TA 5GIBA 1ELDE 1MUEB 3OU0A 1O2HA 2BDYA 3MOCA 2OC1A 4ZKRU 2C3SA 1WBGB 3BTKE 3A8BA 1O3AA 3PM3A 3SNEA 2IOTA 5DP8A 4CRDA 2OD3B 3M7UA 1FXYA 2GV6A 2QXIA 3SI3H 3MH5A 2QXJA 2AS9A 4UFEH 1OWJA 2BXUH 3TH2H 3UFAA 1QTFA 1UK3A 4WMFA 2Y5FA 1AHTH 1SGRE 2ZPSA 1TX6A 1F0RA 1O2WA 1MQ6A 1N8OB 2A4RA 3OSYA 4XDEA 2H9HA 1E37B 1GI9B 3GY5A 3Q76A 4ABIA 2ZDLA 1C1PA 1HLTH 1TBZH 3MNCA 1BTXA 5DK1A 2V3HH 3RXDA 1SGPE 1FI8A 2FDAA 1HAOH 2O8TA 1ZR0A 1NU7B 2HPQH 4X2YA 3A84A 4NA8A 5FPTA 5A2MH 2F9VA 3RMOH 2XBVA 4KTUA 2ZFSA 1VCWA 4AOQA 2A7HA 4B1TA 1ESBA 2OXSA 1HIAA 1ELEE 1FN6A 2P3TB 3MO3A 3QLPH 1ZTLA 4AFSA 2ZHQH 1EP5A 5A8YA 1IQIA 4I31A 1XUHA 1CGJE 4IBLH 1XX9A 1TGTA 3AW1A 5FCRA 4BNRA 2ULLA 1OWIA 5JPMH 5AF9H 2ZP0H 4FUFA 1QL8A 1HDTH 2Z6BD 6LPRA 1BTHH 4X6OA 1UTNA 2BYAX 1W0ZU 2YNBA 2ZU4A 2G5VA 1PYTC 4XSKU 1ANCA 3MU4A 1EPTC 1GVKB 2ALPA 3V12A 3OYPA 2ZFRH 3BEFB 1WQVH 2OC7A 3GDSA 2B0FA 2FOBA 5DKMA 2AGIX 5GCHG 1MKWK 4D7GA 4OM9A 2A7CA 3SNBA 4INHA 1K1LA 3KQEA 3U9AH 1O0DH 2HLCA 1QGFA 2EC9H 2B5TB 4JYUH 2WPMS 1EP6A 4HI3A 5C5OA 2VH6A 1C1RA 4J1YA 1JXPA 1FZZA 1UTJA 1O2SA 1C5WB 1FAKH 7LPRA 1S84A 2HVXA 1MH0A 3HKJB 2WUBA 1SHYA 1ZJKA 3TITA 1QB1A 4Y11E 5EQQA 3S7KB 1D3DB 3P70B 2BZAA 3AASA 3KQDA 5C1UA 3RXJA 2IN2A 1E36B 5L2YH 1INCA 2OBQA 4RKJB 1Z1JA 1SGFA 3TGKE 4YT7H 3SUFA 1FY1A 1WTGH 1MCTA 4MTBA 1O35A 4DOQA 1C1OA 3TNSA 5EW1H 2ZCKP 3GYLB 5C3NA 2VVVA 4DIIH 1C2IA 1GMDF 1UVUH 1IQJA 5LH8A 3ZZCA 1OWHA 3BTFE 5C2ZA 2BD2A 2P94A 4AB9A 1T8LA 4OGYA 1A0JA 4JZ1A 1EATA 1PJPA 1T4UH 1BHXF 3RU4T 1GHVH 4B2AA 1SGDE 4AFQA 1GVZA 1UTKA 3K2UA 4Q7ZA 1O3JA 2SFAA 1E34B 3ZZ4A 3E0PB 2ZDNA 1DWEH 2OK5A 2BXTH 4K3JA 1UTLM 3SNDA 2FO9A 3SUDA 2G5NA 4AYVB 3LH3A 3BG4C 2SGQE 3C1KA 5JB9S 1LQEA 1G3DA 3TK5A 1SGEE 1ZMLA 5E0HA 1P2QA 3O8DA 1QHRB 1SLWB 1Z8JB 5FBEA 3A7WA 3NZIA 2ZDAH 2ZWLH 5C20A 2C8ZB 2R0KA 3F1SB 1ZRKA 2BOKA 4DIHH 1SOZA 1F5KU 3DUXH 3T62A 1GCDA 5DP7A 1FIWA 4ZROA 1RXPA 5LPFA 3LGIA 3UNSA 1CA8B 3NK8A 4F49A 1BZXE 1O2JA 1C2KA 3T26A 5DP6A 1VCPA 1UCYH 4MG3A 1AB9B 1FY3A 2F91A 1PPGE 1XXFA 3HK6B 1EJMA 4D7FA 1C1VH 4YLUA 4YOIA 1J17T 2G00A 3AW0A 3M3TA 4FUCA 2C90B 3ZZBA 3GY6A 2Z3DA 2PR3A 5EGMA 2BLOA 4GLYA 2D8WA 2AIQA 1WQSA 1OWDA 3PMJA 1O3MA 3VGCC 1YM0A 2R2MB 1SGTA 1A1RA 1NPMA 3ATKA 4JYTA 3RXSA 1DXWA 3P6ZB 2W7UA 3SNCA 3GOVB 3LC3A 4XBDA 1DM4B 1BTWA 4E05H 5EPNA 1O5CB 2PSYA 2P93A 2AFQB 4VGCC 1G32B 3HPTB 2SGPE 3GISB 1O2TA 2BX4A 3RU4D 3BTHE 3L6PA 1HAXB 5DPAA 4IGDA 4A1XA 2RCEA 2YOLA 5EPYA 1G37A 1ETRH 1MAYA 3OTJE 2RG3A 1O39A 4JZFH 1O3PB 5ETXA 4CRCA 2V35A 4DJZB 5FAHA 1D3PB 2TGAA 2HNTE 2ANWA 2FWWA 5FX6A 1W11U 2WPKS 3PO1C 6GCHG 2QY0B 3BG8A 1VITG 1WXRA
chains in the Genus database with same CATH superfamily
4FU9A 3QTVH 4O3UA 2H1UA 1KIGH 4JK5A 1P04A 1G9IE 1W8BH 3VB5A 4B73A 1GJ9B 1O33A 1RRKA 3N7DA 4Z0KA 2BHGA 8LPRA 1SPJA 1O2QA 1D6WA 2F4LA 5C1YA 1BRBE 1BRCE 1CGHA 1GGDC 1TA6A 4Q80A 3RM0H 3W95A 2VIQA 1GI8B 3O8RA 1QL9A 4JZIA 1AKSA 1YBWA 3ENSB 2BY7X 3HKIB 1O2XA 1EB1H 3A7XA 3VEQB 1YLCA 2FIRH 1OYQA 1ELBA 1XUGA 1PQ7A 4LZ1H 2STBE 4QT8C 4HFPB 1O2VA 3T27A 2XW9A 1AD8H 1BCUH 4ZCNA 1OS8A 2BDCA 2IJOB 4Y79A 1HXEH 1SGCA 2Z3EA 1EAIA 2H6MA 2OBOA 3A8AA 5GDSH 3SHCH 1GI0A 3NRLA 3UAIC 3M61U 1JWTA 5E8EH 3ZVBA 1VITF 1P8VC 2B8OH 3SZNA 1DUAA 3C27B 2J92A 3EYDA 1CU1A 5IK2D 4ACBA 4KTSA 4ZKNU 1N6XA 2YMSC 5AHGH 1EPTB 3GCOA 1CT2E 1LVBA 3JZ1B 3KYFA 1D9IA 4PROA 2H9TH 3LT3A 3KIDU 3SU2A 1UVPA 1V3XA 5E2PA 2AERH 5TJXA 2ASUB 3ZZ8A 1P9SA 2FYRA 3QZQA 3UWIA 1QBOA 1O3CA 4TPIZ 7KMEH 4FVDA 4AG2A 2NU0E 1SC8U 1DPOA 3AAUA 4KELA 4ISNA 1OSSA 4AGKA 2A4GA 2ZTYA 4ISOA 1UTPA 1BTYA 3ZYDA 1GI5A 2BVXH 4TWYA 3E91A 3A8CA 1P09A 1SHHB 4RI0A 1O36A 3GY3A 1TNGA 2J9NA 3E3TA 4LK4A 1XVOA 3UTUH 1NFYA 3RXIA 3U98H 4Y6DA 1A2CH 1MTNC 3TIUA 2UUJB 4TSFD 2A4OA 2PHBA 4GVUA 1V2RT 1UTMA 2FX6A 4HZHA 3M3VA 1C2MA 8ESTE 5GWZA 1Y3UA 1TGNA 2G81E 1A3BH 5LPEA 2ZTXA 1P2KA 1GGDB 1TOMH 3DFLA 1KXEA 1V2LT 4FUHA 1E1QD 1ZTJA 1C1MA 2F9NA 1NRQH 1YPMH 4M7GA 1TPAE 3NUMA 2L6OA 2Q1JA 1V2VT 2VIVA 3A7ZA 1QQUA 2SGEE 2BQ7B 1RJXB 1MTUA 2GMTB 1TWXB 2HNTC 4A92A 1AO5A 2HGTH 1O2GH 1NRSH 2CN0H 1GHYH 4AX9H 1O5BB 1THRH 4NG9H 5L30H 3SU5A 1LCYA 1HRTH 1QFKH 1SL3A 3KCGH 2W6JD 1G30B 2GVFA 2GD4B 5JDUB 2G55A 4K1EA 3SU0A 1OOKB 1GHZA 3GYMA 1ELGA 2KFWA 2ZHFH 2ODQA 2BLWA 1GCTB 1WU1A 2P3UB 1BOQA 4X2VA 4FOUC 1TPOA 1ZOMA 2ZGBH 5KECA 2OUAA 3IG6B 4WF8A 4XE4A 1V2JT 1XUFA 1NZQH 1OXGA 4IC6A 1QURH 1FDPA 1MKXK 1Q3XA 3LJOA 3RXVA 4K8BA 4B6EA 4YO9A 3HGPA 1HGTH 1NU9A 4HGCA 1QZ8A 5DSFA 2UUYA 3FANA 1VCQA 3RLYH 1LDTT 3PWCA 3RU4E 2SNVA 1DT2A 4Z6AH 2VVCA 2FPZA 1BHXB 1SB1H 4DY7B 1T4VH 2BLVA 2D1JA 2ZGCA 1Z7KA 4OS6A 3KF2A 3ATLA 5EQSA 1C2JA 2R3UA 8KME2 1EOLA 1HFDA 1O3GA 1BA8B 2RDLA 3DSGA 3E6PH 1EAXA 3NKKA 3P8GA 1Z8GA 3TH3H 3UUZA 4GUXA 2RA3A 5T6GA 1H9HE 1HB0B 2RFKC 2HPPH 3STJA 1OP8A 2F9PA 1AFQB 4DCDA 4ISHH 1TGSZ 4K69A 4BXSA 1NBMD 5DG6A 2GCHG 2J95A 1JBUH 4B6FA 1YPJH 4YM9A 1ZPZA 5ESBA 2Y7ZA 4CHAC 3KEEA 3RC4A 1NFUA 1V2MT 1W0YH 1ZTKA 3OEHD 3U69H 3H5CB 1IQLA 2J34A 3F9EA 1FAXA 1UK4A 1AFQC 1BMNH 3PMAB 1N1LA 2BD9A 2BM2A 1W3CA 1YWUA 3UQOA 3BN9A 2GDEH 4X1RU 4E7RG 1V2KT 1GJAB 2W7SA 3CS7A 1AVGH 1FLEE 1E1RD 5J4SA 2A7JA 1F2SE 1BDAA 1TAWA 5F03A 1KDQB 1C5PA 1TPSA 2PGBB 3FP6E 3G01A 4GCHF 1AWHB 3I29A 5L2ZH 1MKWH 1GJBB 3S0NA 2GX4A 1AB9C 3ZZ9A 3SV7A 1WV7H 1ETSH 1QR3E 1K28D 1OPHB 4X0WU 1BITA 1XUIA 1TRNA 2SGFE 1W0JD 3T5FH 4IW4E 1RTKA 1O3EA 1QJ1B 1YPEH 1LHGH 5K7RA 4WJG2 1F0UA 1PYTD 5CHAB 1YPKH 1DS2E 2J97A 2ZCHP 1V2TT 1LHDH 1UTOA 3RXCA 4U01A 2D2DA 4ABEA 2BD5A 4ESTE 3NXPA 4A5TS 1C4Y2 3MU0A 5F6MA 4BAMB 4A6LA 4MVNA 3R3GB 4K1SA 4OS2A 2GV7A 2CHAC 3SQHE 1GWAA 2UUFB 1TPPA 4NFEA 1ANEA 2QF3A 3BF6H 2BOHB 3LC5A 1S5SA 5DN6D 1XMNB 1RFNA 1CA0C 2GCTB 1WAYB 1RIWC 3PMHB 3ZV9A 2H9EH 3SV9A 2WPDD 3QX5H 2AMDA 2ZU5A 4MPXA 4SGAE 1F5RA 1YY3A 4WWYA 3PV2A 1ANBA 1SBWA 3IITA 1GI7B 3SZEA 1FQ3A 2KR7A 1JOUB 1W0KD 3MU5A 4ABDA 4CH2B 2A2QH 3VB3A 2PLXA 3LDXH 3PWBA 1TNIA 1RTFB 3RXHA 7GCHG 1DY8A 3DFJA 2FOEA 1G2MA 4Y8XA 4BTUB 2ALVA 5EXLA 1FY5A 1P2NA 1ZSKA 2SGDE 2ZGHA 1FY4A 2ODYB 4Q2KA 2XBXA 1VITH 1WSSH 1DUEA 1EZSC 2OTVA 1O31A 3BTDE 3ZIAD 4ZKOU 1UK2A 5J4QA 3PRBA 3QTOH 1ETTH 2C8WB 3GS9A 1O32A 2BDHA 1ZHMA 2XC4A 3KNXA 1TX7A 1U6QA 4WMEA 1CQQA 1MD7A 1SOTA 1ESAA 3U28C 1OP0A 1D3TB 2OQ5A 3OY6U 2YMSB 1Y5AT 3GY7A 1DWCH 2B7DH 4E7NA 1YPHC 1TIOA 4MDSA 4WMDA 2VINA 3MNBA 3T25A 3O8BA 2QF4A 2HRVA 4ABJA 4UFGH 4K8YA 1O34A 1VGCB 4ABHA 4X8SH 3RDZA 3RXAA 2Y7XA 1C2EA 1E79D 5G4BA 1TGCA 1GJDB 1MAXA 1TOCB 4BAHB 1W2KH 1Z1IA 1QBVH 4H4FA 3N7EA 1C2HA 1O5AB 3ZZAA 7ESTE 2BLQA 3Q77A 3V3MA 3S9BA 3QN7A 1H9LB 2OINA 3E1XB 2J94A 4WY3A 1TONA 1DWBH 1LVOA 2P16A 5DP9A 1LHCH 1GBIA 1P3CA 3RUOA 3MNXA 4AZ2B 4AB8A 1JRTA 3GCHB 1FIZA 4NIVA 3UQVA 1O38A 1Z6EA 1SFQB 4UD9H 1W13U 3GY2A 2VU8E 1BUIA 3FP8E 1C5LH 1RGQA 4NSYA 2CK3D 2NU4E 4CH8B 4O03A 2ZU1A 3TJNA 1TNJA 4K60A 2FM2A 3KQBA 3A81A 3T29A 1HJAB 3ZZDA 4FU7A 2VIPA 4ZAEA 2QXGA 4TWWA 3MI4A 1O2MA 2C93B 1J14A 1PPEE 2BD7A 1TMBH 4X8VH 4MNVA 3NWUA 1G2LA 1GVLA 1D3QB 1FY8E 2OP9A 3K65B 4RN6A 5GXPA 1ZSLA 1OP2A 3UOUA 1P03A 2ZTZA 1ZYOA 3BSQA 4Y0YE 2BD4A 5JB8S 1HAPH 1E35B 1QA7A 4O3TA 1E0FD 2GCHF 2IPQX 1AVWA 1GBDA 4U2WA 4FU8A 4B75A 1MU6B 4MNWA 5GNDA 3RXGA 3KYGA 1QY6A 5I46H 1BTZA 1VJAU 3PROA 3CENA 4MQAA 1J8AA 3IWMA 4A1VA 3QUMP 1TALA 4CBOA 4KP0A 1LVYA 1DANH 4CRGA 5PTPA 4CHAB 3ITIA 3P8FA 1QBNA 1OKXA 4X8UH 3PLBA 1V2QT 2OLGA 1C1UH 3OEED 4D76A 3QK1A 4Y71A 1GHBF 3GCTG 4MNYA 2EA3A 1MU8B 3L3TA 2ZGXH 1GMDG 1KLIH 1UJ1A 1AE8H 4THNH 1ZZZA 4BAOB 1GMHG 1P01A 4XFQA 3PMBB 3VXFH 5I25A 3BTME 3N7OA 1HAHH 1P10A 3ATWA 1C1NA 1AY6H 4Q7XA 1P02A 5DP5A 1ZLRA 3AAVA 3ZVCA 2QA9E 2P8OB 3KQCA 2AIPA 1BMLA 4Y7AA 1O2KA 2ANMH 4I8KA 5FBIA 2ZQ1A 1GBKA 1A0LA 1YCPM 4H6TA 4UEHH 3SJKA 3SUEA 1KY9A 3M36A 1C2GA 2KCOA 3E16B 4H42U 1M9UA 1BMMH 1EB2A 1MTWA 1GJ8B 1L2EA 1C4V2 2F9OA 2Z3CA 1H9IE 4IMZA 5FL7D 1O2IA 3VFEA 2HVYB 1DOJA 1SGQE 2WHXA 1AMHA 3MHWU 2VBCA 2BDAA 1CBWC 1TMTH 1HV7A 3ODDA 2ZFFH 2TGDA 1LHFH 2O8WA 3ZV8A 1BRAA 1GI6A 9ESTA 1ABIH 2FXRA 2NU1E 3H09A 1LKBA 1BT7A 4U30A 1O2RA 3M5LA 4IS5A 1DSTA 1DFPA 5F8ZA 3LKWA 3M3SA 1PPHE 3S69A 3K6YA 1C9TA 1HNEE 1C5YB 3U8OH 1O5EH 3A83A 1YPHE 3BG4B 1GG6B 1GMCF 2VVUA 4OS4A 3KL6A 1PPZA 4D8NA 2Z9LA 1NESE 3UNRA 3MO6A 4KTCA 2ILNA 1V2OT 2FOCA 1SLXB 2GTBA 3VXEH 1A5GH 3P8NA 1K1OA 5IYTA 1AU8A 1MBMA 4DT4A 1O37A 1AKSB 2BY6X 2PKSB 1YP9A 3ELAH 1C5SA 2NU3E 4LOYH 3QZRA 1BJVA 1W14U 1BTPA 4B74A 1V2NT 3S9CA 4JK6A 2ZNKH 1BRUP 2VH0A 4NA9H 2FI5E 1GJ7B 1AUTC 2STAE 1LVMA 2O8MA 2QC2A 3STIA 1NO9H 2DE8A 2Z9JA 4OS1A 1HAVB 3PTNA 3VB7A 2J38A 3MWIU 3KHVA 2WPLS 1IQKA 4ASUD 4YOJA 3OX7U 2AMPA 2FOGA 4ZXXH 3SGAE 1MZDA 4XBBA 4MNXA 1CT4E 2A32A 6CHAC 1EPTA 4UDWH 2IPHA 2CF9H 1GBAA 2OC8A 4NIWA 1IHTH 1WCZA 4X6NA 1SVPA 1AUJA 1SFIA 5JBCS 1W7GH 1AFEH 5FXLA 3SYJA 1VGCC 3GY8A 4CREA 2FS9A 1DE7H 2GP9B 2Y5HA 4YTAA 5JYIA 3URCA 2ZECA 1AQ7A 4NSVA 1ZRBA 4ZUHA 4AG1A 1P2IA 4IMQA 4CRFA 3ESTA 1Y5BT 4A7IB 3TJUA 3SN8A 2W5EA 3TU7H 3VPKA 4UFFH 1SGNE 3LU9B 3VGCB 4NCYA 1NT1A 2BY8X 2QF5A 2ZG0H 1LPGB 1C4U2 2TIOA 4I33A 1C5RA 1KXAA 3T28A 3MTYA 1HAZB 2WPIS 2XYAA 2BDGA 2ZGJA 2HOBA 2OCVB 2ZDVH 2W26A 3OTPA 2VJ1A 4YT6H 1ELVA 2ZFTA 4DURA 4LZ4B 2LPRA 4CR5A 2K1QA 3QGNB 3F9HA 1C1WH 2G52A 3SJ8A 3K9XB 3LGUA 2WYJA 3HATH 1WTHD 1KTSB 1MD8A 3KGPA 1ELCA 1FONA 1O3IA 1LTOA 5JBBS 5A0CA 4Y8YA 3BEIB 4WXVA 2UWLA 1MTSA 2OQUA 1C9PA 5K0HA 3B23B 1UVOA 3VB4A 2R0LA 1A5HA 1QQ4A 1SQOA 4JZDH 4IC5A 5T1VA 4XBCA 3U1IB 4GPGA 4HG6A 3BTWE 1S81A 3SU3A 1Y3VA 5CDFE 2XC5A 2M5TA 3ATIA 1W7XH 1FJSA 2FODA 1OWKA 5TCCA 4J2YB 4ABBA 2A5IA 4X6PA 3A85A 3BTTE 1DSUA 1CHOF 1EJNA 1O5GH 2Y82A 1ID5H 1O2OA 1V2WT 5CMXH 1KMHB 1Y3XA 1S6FA 1QB6A 1O2NA 4O97A 1GHAF 2H2ZA 2ZPQA 3CNRA 2P59A 2LNCA 1COWD 3LIWA 1LO6A 4A1TA 1DXPA 3UREA 1BQYA 3BIUH 2BQ6B 5B6LA 1SR5C 1GPZA 1ESTA 1IOEA 3R0FA 4ABGA 1AZ8A 1GI1A 3RXRA 4OS5A 4UFDH 5CHAC 3U8RH 2BMGB 1Y59T 2LELA 5FCKA 5EJ1A 4ZHAA 1F5LA 2YNAA 2VIOA 5HGGA 2IJD1 1TNKA 1PQAA 2XBYA 3F3BA 2BQWB 1TNLA 1LPZB 3A7VA 3F0OA 1QRXA 1BTUA 1FX0B 3TH4H 4YLQH 1ZGVA 3UNQA 1JMOH 5AVDA 1T8MA 2JETB 2XRCA 1GBLA 3D49H 1CHGA 1VR1H 5LGOA 1L1NA 2PKAA 1MTVA 2ZPRA 4GHQA 1Y3WA 4X1NU 1GHXH 3Q00A 2ZZUH 5A8XA 3SQEE 1K1MA 5EXMA 1GI3A 1IAUA 2WV5A 1CHOG 2TGTA 4K1TA 2PSXA 2ANKH 1LQDB 1HAIH 2ZU2A 1L0ZA 1L4DA 1QIXB 4FXGH 1B0EA 2BTCE 3A86A 3RM2H 2FP7B 3TNTA 4TY6A 1P57B 1A5IA 4Q4LA 1O3KA 4BTTB 4OGXA 1O5FH 1MMJN 1T32A 1UHBA 4OS7A 3F9GA 3TK6A 1DY9A 1K1NA 3D62A 3RXOA 4UE7H 3M5MA 4ISIH 2G4UA 3CS0A 2PUXB 2WPHS 2RA0A 1A7SA 1ZSJA 2R9PA 2XXLA 3HGNA 1QB9A 2FEQH 2J4IA 2HALA 3M5OA 3M37A 1Z8IB 1SGIB 1C1TA 3FZDA 2XNIA 1KLJH 1XKAC 3PO1B 2GT7A 4Q63A 2FYQA 2CGAA 1KSNA 1L1GA 1Y3YA 4ZH8A 3V0XA 1YGCH 3Q3YA 1N8OC 2GKVE 1C5XB 1AWFH 1RTLA 1VJ9U 5HIYA 3ATMA 4I8JA 4X2XA 1UCYE 1FNIA 1K1PA 1THPB 2ZFQH 4CR9A 1DVAH 2Z7FE 1EAUA 1C5MD 1TRMA 1GG6C 5BPEA 1F0TA 2ZIQH 1O3HA 2KAIA 2A45B 3E0NB 1B7XB 5EU8A 4MPUA 1O2PA 3TJOA 1C1QA 3FP7E 1A0HB 3GICB 2QIQA 2W3IA 1UTQA 1GI4A 3SJIA 1SMFE 5HM9A 1O3LA 1T7CA 2UWOA 1P0SH 2ZHWH 2FESH 3LPRA 1NN6A 4Y0ZE 1TQ7B 1AIXH 1TYNA 2A0QB 1GBHA 3LGTA 1GMCG 1C5OH 2O8UA 1KLTA 4B2CA 4WXIA 2Y6TA 1C5ZB 1MQ5A 2J98A 2NWNA 1ZMJA 4P02A 1YC0A 2AGGX 2WPJS 5CHBA 3V7TA 2BZ6H 3ODFA 1CBWB 3RXPA 2G8TA 2HNTF 1UO6A 1YYY1 3GDUA 1EASA 3EE0B 4E06H 2FOMB 5EOKA 1C2DA 1LKAA 3TLOA 4XOJA 3OFND 1SQTA 3MU8A 4VGCB 3TJVA 1DITH 1GMHF 3MMGA 2XOKD 3A80A 5IDKA 4F4OC 2V7QD 5SGAE 1Z71A 2VNTA 5C94A 3B8JA 1GHWH 4NWKA 4MPWA 3LJJA 1VKYA 4BAKB 3SGQE 3F68H 1O3FA 3MQKC 3A88A 1T31A 3RLWH 1IQEA 3S7HB 2XCNA 1WYKA 3UIRA 1HAGE 2B9LA 3VB6A 1TBRH 4GAWA 1XXDA 3DSPA 2BD8A 5HMAA 1Z6JH 5AFZH 4B2BA 3M7TA 1KXCA 2Z9GA 3UWJH 3A8DA 1XVMA 5B6OA 5E0GA 5CE1A 3UPEA 3P95A 2FTLE 4TY7A 1O3NA 2CHAB 1HIAB 3MFJA 1V6DA 1ARCA 2CV3A 1O2YA 1A4WH 2W3KA 2THFB 1OX1A 2O9QA 2A1DB 3RMLH 4IN2A 1CA0B 3RXMA 3TVJB 2VB0A 1JIRA 4BANB 3MNSA 1MTNB 2XC0A 4ZXYH 2P8OC 1ABJH 3B9FH 2HLDD 1GJ5H 1GBMA 2PFEA 2UWPA 4I8HA 3DA9B 2JKHA 4X1PU 1O30A 1VZQH 3GCHC 1AVXA 2BY5X 2XNDD 2ZI2H 1O2UA 3RXLA 2WINI 3NCLA 3BTGE 1UCYK 2A4QA 1GHAG 2Z94A 2ZDMA 4JYVH 3AK5A 1IHSH 2C4FH 3EE7A 3FFGA 1UVTH 3S9AA 4INLA 4YXWD 2D26C 2FI4E 1C5UA 3WW7A 2Y81A 1AN1E 1DLKB 1UVSH 3W1EA 2CF8H 4NIYA 4I8LA 1P11E 1ACBE 1TFXA 1X7AC 3LOXA 1T8OA 2ZA5A 1ZMNA 4FUGA 1KYNA 2PW8H 2GGVB 4X1SU 2QYIA 1KDQA 1HPGA 3Q3XA 1E38B 1P12E 3ZZ5A 1GHBG 3GCTF 4RT0A 1GBEA 1HJAC 3BIVH 3AVZA 3I78A 3SOSA 1ELTA 1MCVA 1LHEH 3FVFB 3H7OA 2FX4A 3SW2B 4I86A 1L4ZA 1EOJA 2FS8A 3A7TA 1FUJA 6GCHF 2JH5D 1GJ6A 4KGAA 1TE0A 4FUJA 1LMWB 2WV9A 1TNHA 2F9BH 1S85A 2ZC9H 2XTTB 4YZUA 2KM0A 1K21H 1XUJA 4R8TB 5ABWA 2ZDKA 3MH6A 4Y7BA 2GMTC 4ABFA 3SUGA 1DDJA 3OY5U 1T8NA 3BTQE 4WVPE 1BBRE 4ZMAH 2V0BA 4DVAU 4NZLA 3SI4H 5JBTA 4INKA 1K1JA 5TCAA 1TB6H 1A3EH 1EXFA 1ZHRA 2SNWA 2XCFA 2EI7A 1BJUA 5HXFA 1QJ6B 2ZO3H 1G3BA 1SLVB 1XKBC 2DUCA 2Q6GA 4IN1A 4BTIB 3QO6A 1KXDA 1S0QA 1YCPH 2ZU3A 5EQRA 4BXWA 1P9UA 1P2OA 3SV2H 1SI5H 2Q6FA 1IQFA 2J2UA 2A2XH 4TYDA 1HJ9A 4H6SB 1NY22 4XD7D 2QE7D 2WUCA 1O3OA 2V3OH 1EX3A 3DCLA 4ZHMU 1N6YA 3E90B 2P3FH 4BAQB 3OAAD 5FPSA 1GJCB 3BTEE 2FLRH 1K1IA 2JJ1D 1NROH 2CXVA 1NS3A 1AZZA 3RXFA 3ZZ3A 1QCPA 2H5CA 3M35A 5EW2H 1HJ8A 4CRBA 2WZQA 5EG4A 3DSOA 5DP4A 1ELFA 2BDBA 5C67A 2FI3E 2A5AA 2XBWA 1GDQA 3A89A 5A8ZA 1TX8A 1TLDA 1EAWA 4X6MA 1QRZA 1V2UT 3E8LA 2BDIA 4FUIA 2ZKSA 4RKOB 4ABAA 2FOAA 3JZ2B 1MZAA 1K2I1 2ZHDA 1BBRH 3ZVGA 1PQ5A 2FOHA 2Y80A 1F92A 1ZJDA 4UONA 3PB1E 3RXBA 3F2FA 2XWAA 2FTMA 1B5GH 1Q2WA 1UW7A 1H8HD 1O2LA 4ASHA 1H8ED 2ESTE 2OC0A 2QCYA 1JRSA 1NFWA 1GJ4H 1P2JA 3DHKH 1EKBB 5H4IB 1CVWH 2Z9KA 3DT0H 1Y5UT 4DG4A 2WV4A 1RIWB 3A87A 4SGBE 1KTTB 2QAAA 1DWDH 3UY9A 5BRRE 3DD2H 2WYGA 2VIWA 3FAOA 1GI2A 2F3CE 1SKYE 1DLEA 4CRAA 1RS0A 2FMJA 1QRWA 5L6NH 4NFFA 1W12U 2GDDA 1TRYA 5FPYA 1Z8RA 1Q31A 4I8GA 1J15A 4MPVA 4Z1MD 2EI8A 1F0SA 5T3HA 2AH4X 3QGJA 1WOFA 1YPGH 2PWXA 1CT0E 2A5KA 2FOFA 2ZCLP 2ZFPH 3MH7A 3ZVDA 2FZZA 1NTPA 3EA9A 1MKXH 1V2ST 1BB0B 4JMYA 2VWNA 3ZVEA 1PPCE 1H4WA 2GZ7A 1PFXC 4DT7B 2R2WU 3TGIE 2R3YA 4O9VA 1TQ0B 2KCAA 2AHME 1CGIE 3TK9A 2CMYA 4F55A 2P95A 1Y8TA 1TABE 3PLPA 1G36A 2L74A 2GZ9A 1QNJA 1CE5A 1S6HA 4JZEH 1YLDA 3P8OA 1UMAH 1S83A 4WH6A 3SU6A 3W94A 1ELAA 1O3DA 3A7YA 3F9FA 2HWLB 4B71A 4AN7A 5DO4H 5C0TA 3SORA 1CO7E 3M7QA 1P06A 2PTNA 2VGCB 2TRMA 1GL1A 3F6UH 1ORFA 4GSOA 1CSOE 4NGAH 3EGKH 5DP3A 3A82A 3F0PA 1YKTA 2BD3A 4Y8ZA 5A09A 1AI8H 4ZHLU 1KXFA 2Z9IA 3TGJE 2QV1A 2I6SA 1ZPBA 4U32A 5DJ7A 3LONA 3H7TA 3SBKA 3SNAA 2V6NA 2UUKB 4B76A 5EXNA 5HM2A 4AORA 1GBTA 3RMNH 2GCTC 1NC6A 1B0FA 1EUFA 3KN2A 3EA7A 3I77A 1A61H 1YCPK 5A0BA 3RXKA 1OWEA 4I7YH 1C1SA 4D9RA 2NU2E 1W10U 4DGJA 1K9OE 1OHHD 1XM1A 3ZVFA 2QXHA 2JETC 2AGEX 3EAJA 1GCTC 3M5NA 2KZ4A 3BEUA 1GBFA 4YESB 1GBCA 3U8TH 4K5ZA 3UR9A 1PQ8A 3D23A 1O3BA 1ANDA 1C2FA 1SQRA 2JH0D 5A0AE 1HBTH 1A46H 1P05A 1QJ7B 4X1QU 2ZQ2A 4R0IA 4D9QA 4X2WA 1DICA 1JIMA 2XWBI 1J16A 2H5DA 2PUQH 4M9FA 3F2GA 3UB0A 3QWCH 2KCPA 4JCNA 1YPLH 4NIXA 5E0JA 1J9CH 1HCGA 2Y5GA 1TMUH 5KEDA 1HAYB 3MU1A 5HIZA 3OE7D 5ESTE 3SO3A 2TBSA 1ZGIA 5T6DA 2VWOA 1D6RA 3RMMH 1C5VA 2ODPA 4YOGA 3FZZA 1RD3B 1H8DH 1G3EA 1OYTH 4Y76A 3MO9A 1SGFG 1GBJA 1XUKA 2KX4A 1TA2A 3TPIZ 1P3EA 2ANYA 1GDNA 4MLFB 3RXQA 3WY8A 2JIZD 5T6FA 6ESTA 3UOPA 1C2LA 3CP7A 3RXUA 4KKDA 1O5DH 4ACAA 4HTCH 2PTCE 3SGBE 1HUTH 3RC5A 3T2NA 4ISLA 3V13A 1PPBH 5GJ4B 4GCHG 4AFUA 2G4TA 2BX3A 1L1JA 1BBRK 3ZZ6A 1HYLA 4GHTA 1IQMA 1FV9A 2SGAA 2C8XB 1V2PT 2ZEBA 4CBNA 2AMQA 5EIYA 1MBQA 2O8LA 5E2OA 4BOHA 3PYHA 3LH1A 1HXFH 3SU4A 1NRPH 3RXEA 4WH8A 3PLKA 1TGBA 2JH6D 3EQ0H 2PGQB 3GY4A 4RSPA 1AE5A 5FHTA 1TBQH 1BMAA 2QF0A 1HAVA 2PKAB 2V3MA 1SQAA 1WUNH 1ZHPA 1PPFE 5FX5A 9LPRA 2PV9B 3P92A 4AYYB 1QA0A 2FLBH 2I6QA 2BVRH 4Y10E 5HYOA 1KXBA 3KQ5A 5HKKD 3LGYA 3MYWA 1NRRH 8GCHF 3RXTA 1H1BA 1K22H 1UHBB 2BVSH 2CJIA 4NZQA 3BV9B 3MH4A 5F8XA 4FUDA 5EODA 3ZYEA 3SU1A 7GCHF 1EQ9A 1GL0E 1G3CA 1S0RA 5GPIB 2F9UA 1P2MA 2G51A 2QGRA 3PV5A 4NWLA 5C1XA 3NPSA 4FVBA 3D65E 3O8CA 1O2ZA 1SLUB 4Q7YA 4LXBH 3SJ9A 3QDZB 5DGJA 1BIOA 3URDA 1NFXA 2EQNA 2EEKA 2RDEA 4FUEA 1H8IH 2ZHEH 3ZZ7A 5LPRA 1NM6A 3PTBA 1EZUC 1FN8A 2C8YB 2AEIH 3SV8A 1SGYE 2BY9X 2ZF0H 2TGPZ 1FPCH 5C5NA 4I32A 2VWMA 3RC6A 5GCHF 4DW2U 3ZVAA 1QL7A 3PRDA 3LGVA 1C5TA 5JBAS 2TPIZ 2QN5T 2VGCC 1C5NH 4NA7A 1GDUA 1IQNA 1DX5M 1F7ZA 2KAIB 3GCNA 3L33A 3HK3B 1FMGA 3SJOA 1ARBA 3SV6A 3SHAH 2Q6DA 2VWLA 2VIDA 4TPYA 2GZ8A 3K6ZA 2DE9A 1LPKB 1K0HA 2PKSC 1SSXA 1IQGA 3GDVA 1S82A 3U1JB 1IQHA 1EZXC 3EA8A 3P17H 3PV4A 1C5QA 4FUBA 4AFZA 1YF4A 2GT8A 1ZPCA 2EI6A 1AGJA 1EJAA 3Q3KA 1GBBA 3LGWA 4X8TH 2F83A 1EZQA 4AGJA 1SG8B 1WDIA 2J98B 1THSH 5AFYH 3RP2A 1FPHH 8GCHG 4K2YA 3EDXB 2JDID 3UR6A 2AYWA 1NRNH 3FOAA 1D4PB 2BB4A 4ZKSU 6CHAB 2A31A 5F8TA 5GIBA 1ELDE 1MUEB 3OU0A 1O2HA 2BDYA 3MOCA 2OC1A 4ZKRU 2C3SA 4AC9A 1WBGB 3BTKE 3A8BA 1O3AA 3PM3A 3SNEA 5C0UA 2IOTA 5DP8A 4CRDA 2OD3B 3M7UA 1FXYA 2GV6A 2QXIA 3SI3H 3MH5A 2QXJA 2AS9A 2WSSD 4UFEH 1OWJA 2BXUH 3TH2H 3UFAA 1QTFA 1UK3A 4WMFA 2W6ID 2Y5FA 1AHTH 1SGRE 2ZPSA 1TX6A 1F0RA 1O2WA 1MQ6A 1N8OB 2A4RA 3OSYA 4XDEA 2H9HA 1E37B 1GI9B 3GY5A 4P00A 3Q76A 4ABIA 2ZDLA 1C1PA 1HLTH 1TBZH 3MNCA 1BTXA 5DK1A 2V3HH 3RXDA 1SGPE 1FI8A 2FDAA 1HAOH 2O8TA 1ZR0A 1NU7B 2HPQH 5KGOA 4X2YA 3A84A 4NA8A 5FPTA 5A2MH 2F9VA 3RMOH 2XBVA 4KTUA 2ZFSA 1VCWA 4AOQA 2A7HA 4B1TA 1ESBA 2OXSA 1HIAA 1ELEE 1FN6A 2P3TB 3MO3A 3QLPH 1ZTLA 4AFSA 2ZHQH 1EP5A 5A8YA 1IQIA 4I31A 3FKSD 1XUHA 1CGJE 4IBLH 1XX9A 1TGTA 3AW1A 5FCRA 4BNRA 2ULLA 1OWIA 5JPMH 5AF9H 2ZP0H 4FUFA 1QL8A 1HDTH 2Z6BD 6LPRA 1BTHH 4X6OA 1UTNA 2BYAX 1W0ZU 2YNBA 2ZU4A 2G5VA 1MABB 1PYTC 4XSKU 1ANCA 3MU4A 1EPTC 1GVKB 2ALPA 3V12A 5F53A 2M2AA 3OYPA 2ZFRH 3BEFB 1WQVH 2OC7A 3GDSA 2B0FA 2FOBA 5DKMA 2AGIX 5GCHG 1MKWK 4D7GA 4OM9A 2A7CA 2KCYA 3SNBA 4INHA 1K1LA 3KQEA 3U9AH 1O0DH 2HLCA 1QGFA 2EC9H 2B5TB 4JYUH 4XRNA 2WPMS 1EP6A 4HI3A 5C5OA 2VH6A 1C1RA 4J1YA 1JXPA 1FZZA 1UTJA 1O2SA 1C5WB 1FAKH 7LPRA 1S84A 2HVXA 1MH0A 3HKJB 2WUBA 1SHYA 1ZJKA 3TITA 1QB1A 4Y11E 5EQQA 3S7KB 1D3DB 3P70B 4TT3D 2BZAA 3AASA 1S6LA 3KQDA 5C1UA 3RXJA 2IN2A 2K8IA 1E36B 5L2YH 1INCA 1YLNA 2OBQA 4RKJB 1Z1JA 1SGFA 3TGKE 2K0QA 3FN8A 4YT7H 3SUFA 1FY1A 1WTGH 1MCTA 4MTBA 1O35A 4DOQA 1C1OA 3TNSA 2PP6A 5EW1H 2ZCKP 3GYLB 5C3NA 2VVVA 4DIIH 1C2IA 1GMDF 1UVUH 1IQJA 2JJ2D 5LH8A 3ZZCA 2LP6A 1OWHA 3BTFE 5C2ZA 2BD2A 2P94A 3N99A 4AB9A 1T8LA 4OGYA 1A0JA 4JZ1A 1EATA 1PJPA 1T4UH 1BHXF 3RU4T 1GHVH 4B2AA 1SGDE 4AFQA 1GVZA 1UTKA 3K2UA 4Q7ZA 1O3JA 3F2HA 2SFAA 1E34B 3ZZ4A 3E0PB 2ZDNA 3WWFA 1DWEH 2OK5A 3WWBA 2BXTH 4K3JA 1UTLM 3SNDA 2FO9A 3SUDA 2G5NA 4AYVB 3LH3A 3BG4C 2SGQE 3C1KA 5JB9S 1LQEA 1G3DA 3TK5A 1SGEE 1ZMLA 5E0HA 1P2QA 5EJLA 3O8DA 1BMFD 1QHRB 1SLWB 1Z8JB 5FBEA 3A7WA 3NZIA 2ZDAH 2ZWLH 5C20A 2C8ZB 2F43B 2R0KA 3F1SB 1ZRKA 2BOKA 4F48B 4DIHH 1SOZA 1F5KU 3DUXH 3T62A 1GCDA 5DP7A 1FIWA 4ZROA 1RXPA 5LPFA 2EY4C 3LGIA 3UNSA 1CA8B 3NK8A 4F49A 1BZXE 1O2JA 1C2KA 3T26A 5DP6A 1VCPA 1UCYH 4MG3A 1AB9B 1FY3A 2F91A 4RT1A 1PPGE 1XXFA 3HK6B 1EJMA 1NBME 4D7FA 1C1VH 4YLUA 4YOIA 1J17T 2G00A 3AW0A 3M3TA 4FUCA 2C90B 3ZZBA 3GY6A 2Z3DA 2PR3A 5EGMA 2BLOA 4GLYA 2D8WA 2AIQA 1WQSA 1OWDA 3FO8D 3PMJA 1O3MA 3VGCC 1YM0A 2R2MB 1SGTA 1A1RA 1NPMA 3ATKA 4JYTA 3RXSA 1DXWA 5C17A 3P6ZB 2W7UA 3SNCA 3GOVB 3LC3A 4XBDA 1DM4B 1BTWA 5EJZA 4E05H 5EPNA 1O5CB 2PSYA 2P93A 2AFQB 4VGCC 1G32B 3HPTB 2SGPE 2J5UA 3GISB 1O2TA 2BX4A 3RU4D 3BTHE 3L6PA 1HAXB 5DPAA 4IGDA 4A1XA 2RCEA 2YOLA 5EPYA 1G37A 1EFRD 1ETRH 1MAYA 3OTJE 2RG3A 2YMSD 1O39A 4JZFH 1O3PB 5ETXA 4CRCA 2GJGA 2V35A 4DJZB 5FAHA 1D3PB 2TGAA 2HNTE 2ANWA 2FWWA 4FETA 5FX6A 1W11U 2WPKS 3VG8A 3PO1C 6GCHG 2QY0B 3BG8A 1VITG 1WXRA
chains in the Genus database with same CATH topology
4FU9A 3QTVH 4O3UA 2H1UA 1KIGH 4JK5A 1P04A 1G9IE 1W8BH 3VB5A 4B73A 1GJ9B 1O33A 1RRKA 4Z0KA 3N7DA 2BHGA 8LPRA 1SPJA 1O2QA 1D6WA 2F4LA 5C1YA 1BRBE 1BRCE 1CGHA 1GGDC 1TA6A 4Q80A 3RM0H 3W95A 2VIQA 1GI8B 3O8RA 1QL9A 4JZIA 1AKSA 1YBWA 3ENSB 2BY7X 3HKIB 1O2XA 1EB1H 3A7XA 3VEQB 1YLCA 2FIRH 1OYQA 1ELBA 1XUGA 1PQ7A 4LZ1H 2STBE 4QT8C 4HFPB 1O2VA 3T27A 2XW9A 1AD8H 1BCUH 4ZCNA 1OS8A 2BDCA 2IJOB 4Y79A 1HXEH 1SGCA 2Z3EA 1EAIA 2H6MA 2OBOA 3A8AA 5GDSH 3SHCH 1GI0A 3NRLA 3M61U 1JWTA 5E8EH 3ZVBA 1VITF 1P8VC 2B8OH 3SZNA 1DUAA 3C27B 2J92A 3EYDA 1CU1A 5IK2D 4KTSA 4ZKNU 1N6XA 5AHGH 2YMSC 1EPTB 3GCOA 1CT2E 1LVBA 3JZ1B 1D9IA 4PROA 2H9TH 3LT3A 3KIDU 3SU2A 1UVPA 1V3XA 5E2PA 2AERH 5TJXA 2ASUB 3ZZ8A 1P9SA 2FYRA 3QZQA 3UWIA 1QBOA 1O3CA 4TPIZ 7KMEH 4FVDA 4AG2A 2NU0E 1SC8U 1DPOA 3AAUA 4KELA 4ISNA 1OSSA 4AGKA 2A4GA 2ZTYA 4ISOA 1UTPA 1BTYA 3ZYDA 1GI5A 2BVXH 4TWYA 3E91A 3A8CA 1P09A 1SHHB 4RI0A 1O36A 3GY3A 1TNGA 2J9NA 3E3TA 4LK4A 1XVOA 3UTUH 1NFYA 3RXIA 3U98H 4Y6DA 1A2CH 1MTNC 3TIUA 2UUJB 4TSFD 2A4OA 2PHBA 4GVUA 1V2RT 1UTMA 2FX6A 4HZHA 3M3VA 1C2MA 8ESTE 5GWZA 1Y3UA 1TGNA 2G81E 1A3BH 5LPEA 2ZTXA 1P2KA 1GGDB 1TOMH 3DFLA 1KXEA 1V2LT 4FUHA 1E1QD 1ZTJA 1C1MA 2F9NA 1NRQH 1YPMH 4M7GA 1TPAE 3NUMA 2L6OA 2Q1JA 1V2VT 2VIVA 3A7ZA 1QQUA 2SGEE 2BQ7B 1RJXB 1MTUA 2GMTB 1TWXB 2HNTC 4A92A 1AO5A 2HGTH 1O2GH 1NRSH 2CN0H 1GHYH 4AX9H 1O5BB 1THRH 4NG9H 5L30H 3SU5A 1LCYA 1HRTH 1QFKH 1SL3A 3KCGH 2W6JD 1G30B 2GVFA 2GD4B 5JDUB 2G55A 4K1EA 3SU0A 1OOKB 1GHZA 3GYMA 1ELGA 2KFWA 2ZHFH 2ODQA 2BLWA 1GCTB 1WU1A 2P3UB 1BOQA 4X2VA 1TPOA 1ZOMA 2ZGBH 2OUAA 3IG6B 4WF8A 4XE4A 1V2JT 1XUFA 1NZQH 1OXGA 4IC6A 1QURH 1FDPA 1MKXK 1Q3XA 3LJOA 3RXVA 4K8BA 4B6EA 4YO9A 3HGPA 1HGTH 1NU9A 4HGCA 5DSFA 2UUYA 3FANA 1VCQA 3RLYH 1LDTT 3PWCA 3RU4E 2SNVA 1DT2A 4Z6AH 2VVCA 2FPZA 1BHXB 1SB1H 4DY7B 1T4VH 2BLVA 2D1JA 2ZGCA 1Z7KA 4OS6A 3KF2A 3ATLA 5EQSA 1C2JA 2R3UA 8KME2 1EOLA 1HFDA 1O3GA 1BA8B 2RDLA 3E6PH 1EAXA 3NKKA 3P8GA 1Z8GA 3TH3H 3UUZA 4GUXA 2RA3A 5T6GA 1H9HE 1HB0B 2HPPH 3STJA 1OP8A 2F9PA 1AFQB 4DCDA 4ISHH 1TGSZ 4K69A 4BXSA 5DG6A 1NBMD 2GCHG 2J95A 1JBUH 4B6FA 1YPJH 4YM9A 1ZPZA 5ESBA 2Y7ZA 4CHAC 3KEEA 3RC4A 1NFUA 1V2MT 1W0YH 1ZTKA 3OEHD 3U69H 3H5CB 1IQLA 2J34A 3F9EA 1FAXA 1UK4A 1AFQC 1BMNH 3PMAB 1N1LA 2BD9A 2BM2A 1W3CA 3UQOA 3BN9A 2GDEH 4X1RU 4E7RG 1V2KT 1GJAB 2W7SA 3CS7A 1AVGH 1FLEE 1E1RD 5J4SA 2A7JA 1F2SE 1BDAA 1TAWA 5F03A 1KDQB 1C5PA 1TPSA 2PGBB 3FP6E 3G01A 4GCHF 1AWHB 3I29A 5L2ZH 1MKWH 1GJBB 3S0NA 2GX4A 1AB9C 3ZZ9A 3SV7A 1WV7H 1ETSH 1QR3E 1K28D 1OPHB 4X0WU 1BITA 1XUIA 1TRNA 2SGFE 3T5FH 1W0JD 4IW4E 1RTKA 1O3EA 1QJ1B 1YPEH 1LHGH 5K7RA 4WJG2 1F0UA 1PYTD 5CHAB 1YPKH 1DS2E 2ZCHP 1V2TT 1LHDH 1UTOA 3RXCA 4U01A 2D2DA 4ABEA 2BD5A 4ESTE 3NXPA 4A5TS 1C4Y2 3MU0A 5F6MA 4BAMB 4A6LA 4MVNA 3R3GB 4K1SA 4OS2A 2GV7A 2CHAC 3SQHE 1GWAA 2UUFB 1TPPA 4NFEA 1ANEA 2QF3A 3BF6H 2BOHB 3LC5A 1S5SA 5DN6D 1XMNB 1RFNA 1CA0C 2GCTB 1WAYB 1RIWC 3PMHB 3ZV9A 2H9EH 3SV9A 2WPDD 3QX5H 2AMDA 2ZU5A 4MPXA 4SGAE 1F5RA 4WWYA 3PV2A 1ANBA 1SBWA 3IITA 1GI7B 3SZEA 1FQ3A 2KR7A 1JOUB 1W0KD 3MU5A 4ABDA 4CH2B 2A2QH 3VB3A 2PLXA 3LDXH 3PWBA 1TNIA 1RTFB 3RXHA 7GCHG 1DY8A 3DFJA 2FOEA 1G2MA 4Y8XA 4BTUB 2ALVA 5EXLA 1FY5A 1P2NA 1ZSKA 2SGDE 2ZGHA 1FY4A 2ODYB 4Q2KA 2XBXA 1VITH 1WSSH 1DUEA 1EZSC 2OTVA 1O31A 3BTDE 3ZIAD 4ZKOU 1UK2A 5J4QA 3QTOH 3PRBA 1ETTH 2C8WB 3GS9A 1O32A 2BDHA 1ZHMA 2XC4A 3KNXA 1TX7A 1U6QA 4WMEA 1CQQA 1MD7A 1SOTA 1ESAA 1OP0A 1D3TB 2OQ5A 3OY6U 2YMSB 1Y5AT 3GY7A 1DWCH 2B7DH 4E7NA 1YPHC 1TIOA 4MDSA 4WMDA 2VINA 3MNBA 3T25A 3O8BA 2QF4A 2HRVA 4ABJA 4UFGH 4K8YA 1O34A 1VGCB 4ABHA 4X8SH 3RDZA 3RXAA 2Y7XA 1C2EA 1E79D 5G4BA 1TGCA 1GJDB 1MAXA 1TOCB 4BAHB 1W2KH 1Z1IA 1QBVH 4H4FA 3N7EA 1C2HA 1O5AB 3ZZAA 7ESTE 2BLQA 3Q77A 3V3MA 3S9BA 3QN7A 1H9LB 2OINA 3E1XB 2J94A 4WY3A 1TONA 1DWBH 1LVOA 2P16A 5DP9A 1LHCH 1GBIA 1P3CA 3RUOA 3MNXA 4AZ2B 4AB8A 1JRTA 3GCHB 1FIZA 4NIVA 3UQVA 1O38A 1Z6EA 1SFQB 4UD9H 1W13U 3GY2A 2VU8E 1BUIA 3FP8E 1C5LH 1RGQA 4NSYA 4CH8B 2NU4E 2CK3D 4O03A 2ZU1A 3TJNA 1TNJA 4K60A 2FM2A 3KQBA 3A81A 3T29A 1HJAB 3ZZDA 4FU7A 2VIPA 4ZAEA 2QXGA 4TWWA 3MI4A 1O2MA 2C93B 1J14A 1PPEE 2BD7A 1TMBH 4X8VH 4MNVA 3NWUA 1G2LA 1GVLA 1D3QB 1FY8E 2OP9A 3K65B 4RN6A 5GXPA 1ZSLA 1OP2A 3UOUA 1P03A 2ZTZA 1ZYOA 3BSQA 4Y0YE 2BD4A 5JB8S 1HAPH 1E35B 1QA7A 4O3TA 1E0FD 2GCHF 1AVWA 1GBDA 4U2WA 4FU8A 4B75A 1MU6B 4MNWA 5GNDA 3RXGA 1QY6A 5I46H 1BTZA 1VJAU 3PROA 3CENA 4MQAA 1J8AA 3IWMA 4A1VA 3QUMP 1TALA 4CBOA 4KP0A 1LVYA 1DANH 4CRGA 5PTPA 4CHAB 3ITIA 3P8FA 1QBNA 1OKXA 4X8UH 3PLBA 1V2QT 2OLGA 1C1UH 3OEED 4D76A 3QK1A 4Y71A 1GHBF 3GCTG 4MNYA 2EA3A 1MU8B 3L3TA 2ZGXH 1GMDG 1KLIH 1UJ1A 1AE8H 4THNH 1ZZZA 4BAOB 1GMHG 1P01A 4XFQA 3PMBB 3VXFH 5I25A 3BTME 3N7OA 1HAHH 1P10A 3ATWA 1C1NA 1AY6H 4Q7XA 1P02A 5DP5A 1ZLRA 3AAVA 3ZVCA 2QA9E 2P8OB 3KQCA 2AIPA 1BMLA 4Y7AA 1O2KA 2ANMH 4I8KA 5FBIA 2ZQ1A 1GBKA 1A0LA 1YCPM 4H6TA 4UEHH 3SJKA 3SUEA 1KY9A 3M36A 1C2GA 3E16B 2KCOA 4H42U 1M9UA 1BMMH 1EB2A 1MTWA 1GJ8B 1L2EA 1C4V2 2F9OA 2Z3CA 1H9IE 4IMZA 5FL7D 1O2IA 3VFEA 1DOJA 1SGQE 2WHXA 1AMHA 3MHWU 2VBCA 2BDAA 1CBWC 1TMTH 1HV7A 3ODDA 2ZFFH 2TGDA 1LHFH 2O8WA 3ZV8A 1BRAA 1GI6A 9ESTA 1ABIH 2FXRA 2NU1E 3H09A 1LKBA 1BT7A 4U30A 1O2RA 3M5LA 4IS5A 1DSTA 1DFPA 5F8ZA 3LKWA 3M3SA 1PPHE 3S69A 3K6YA 1C9TA 1HNEE 1C5YB 3U8OH 1O5EH 3A83A 1YPHE 3BG4B 1GG6B 1GMCF 2VVUA 4OS4A 3KL6A 1PPZA 4D8NA 2Z9LA 1NESE 3UNRA 3MO6A 4KTCA 2ILNA 1V2OT 2FOCA 1SLXB 2GTBA 3VXEH 1A5GH 3P8NA 1K1OA 5IYTA 1AU8A 1MBMA 4DT4A 1O37A 1AKSB 2BY6X 2PKSB 1YP9A 3ELAH 1C5SA 2NU3E 4LOYH 3QZRA 1BJVA 1W14U 1BTPA 4B74A 1V2NT 3S9CA 4JK6A 2ZNKH 1BRUP 2VH0A 4NA9H 2FI5E 1GJ7B 1AUTC 2STAE 1LVMA 2O8MA 2QC2A 3STIA 1NO9H 2DE8A 2Z9JA 4OS1A 1HAVB 3PTNA 3VB7A 2J38A 3MWIU 3KHVA 2WPLS 1IQKA 4ASUD 4YOJA 3OX7U 2AMPA 2FOGA 4ZXXH 3SGAE 1MZDA 4XBBA 4MNXA 1CT4E 2A32A 6CHAC 1EPTA 4UDWH 2IPHA 2CF9H 1GBAA 2OC8A 4NIWA 1IHTH 1WCZA 4X6NA 1SVPA 1AUJA 1SFIA 5JBCS 1W7GH 1AFEH 5FXLA 3SYJA 1VGCC 3GY8A 4CREA 2FS9A 1DE7H 2GP9B 2Y5HA 4YTAA 5JYIA 3URCA 2ZECA 1AQ7A 4NSVA 1ZRBA 4ZUHA 4AG1A 1P2IA 4IMQA 4CRFA 3ESTA 1Y5BT 4A7IB 3TJUA 3SN8A 2W5EA 3TU7H 3VPKA 4UFFH 1SGNE 3LU9B 3VGCB 4NCYA 1NT1A 2BY8X 2QF5A 2ZG0H 1LPGB 1C4U2 2TIOA 4I33A 1C5RA 1KXAA 3T28A 3MTYA 1HAZB 2WPIS 2XYAA 2BDGA 2ZGJA 2HOBA 2OCVB 2ZDVH 2W26A 3OTPA 2VJ1A 4YT6H 1ELVA 2ZFTA 4DURA 4LZ4B 2LPRA 4CR5A 2K1QA 3QGNB 3F9HA 1C1WH 2G52A 3SJ8A 3K9XB 3LGUA 2WYJA 3HATH 1WTHD 1KTSB 1MD8A 3KGPA 1ELCA 1FONA 1O3IA 1LTOA 5JBBS 5A0CA 4Y8YA 3BEIB 4WXVA 2UWLA 1MTSA 2OQUA 1C9PA 5K0HA 3B23B 1UVOA 3VB4A 2R0LA 1A5HA 1QQ4A 1SQOA 4JZDH 4IC5A 3U1IB 4XBCA 5T1VA 4GPGA 3BTWE 1S81A 3SU3A 1Y3VA 5CDFE 2XC5A 2M5TA 3ATIA 1W7XH 1FJSA 2FODA 1OWKA 5TCCA 4J2YB 4ABBA 2A5IA 4X6PA 3A85A 3BTTE 1DSUA 1CHOF 1EJNA 1O5GH 2Y82A 1ID5H 1O2OA 1V2WT 5CMXH 1Y3XA 1KMHB 1S6FA 1QB6A 1O2NA 4O97A 1GHAF 2H2ZA 2ZPQA 2P59A 2LNCA 1COWD 3LIWA 1LO6A 4A1TA 1DXPA 3UREA 1BQYA 3BIUH 2BQ6B 5B6LA 1SR5C 1GPZA 1ESTA 1IOEA 3R0FA 4ABGA 1AZ8A 1GI1A 3RXRA 4OS5A 4UFDH 5CHAC 3U8RH 2BMGB 1Y59T 2LELA 5FCKA 4ZHAA 1F5LA 2YNAA 2VIOA 5HGGA 2IJD1 1TNKA 1PQAA 2XBYA 3F3BA 2BQWB 1TNLA 1LPZB 3A7VA 3F0OA 1QRXA 1BTUA 3TH4H 1FX0B 4YLQH 1ZGVA 3UNQA 1JMOH 5AVDA 1T8MA 2JETB 2XRCA 1GBLA 3D49H 1CHGA 1VR1H 5LGOA 1L1NA 2PKAA 1MTVA 2ZPRA 4GHQA 1Y3WA 4X1NU 1GHXH 3Q00A 2ZZUH 5A8XA 3SQEE 1K1MA 5EXMA 1GI3A 1IAUA 2WV5A 1CHOG 2TGTA 4K1TA 2PSXA 2ANKH 1LQDB 1HAIH 2ZU2A 1L0ZA 1L4DA 1QIXB 4FXGH 1B0EA 2BTCE 3A86A 3RM2H 2FP7B 3TNTA 4TY6A 1P57B 1A5IA 4Q4LA 1O3KA 4BTTB 4OGXA 1O5FH 1MMJN 1T32A 1UHBA 4OS7A 3F9GA 3TK6A 1DY9A 1K1NA 3D62A 3RXOA 4UE7H 3M5MA 4ISIH 2G4UA 3CS0A 2PUXB 2WPHS 2RA0A 1A7SA 1ZSJA 2R9PA 2XXLA 3HGNA 1QB9A 2FEQH 2J4IA 2HALA 3M5OA 3M37A 1Z8IB 1SGIB 1C1TA 3FZDA 2XNIA 1KLJH 1XKAC 3PO1B 2GT7A 4Q63A 2FYQA 2CGAA 1KSNA 1L1GA 1Y3YA 4ZH8A 3V0XA