3EYDA

Structure of hcv ns3-4a protease with an inhibitor derived from a boronic acid
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
181
structure length
181
Chain Sequence
APITAYAQQTRGLLGCIITSLTGRDKNQVEGEVQIVSTATQTFLATCINGVCWTVYHGAGTRTIASPKGPVIQMYTNVDQDLVGWPAPQGSRSLTPCTCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPISYLKGSSGGPLLCPAGHAVGLFRAAVCTRGVAKAVDFIPVENLETTMRS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCV NS3
publication title Potent inhibitors of HCV-NS3 protease derived from boronic acids.
pubmed doi rcsb
source organism Hepatitis c virus subtype 1a
molecule tags Viral protein
total genus 41
structure length 181
sequence length 181
chains with identical sequence C
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3eydA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3eydA01
1SLUB 4FXGH 2ANKH 4TY6A 1MAXA 3BTTE 2SFAA 3LGVA 1S6HA 1ZPZA 1MZAA 4ZKNU 4GPGA 1IHSH 2V3OH 1HUTH 1TABE 1NY22 1GBTA 1BITA 3SGBE 5B6OA 1S82A 3GCTF 3B8JA 1YBWA 1C5MD 1FY1A 1GI8B 4IC5A 3LC3A 3TJUA 1A0JA 2UUFB 1J9CH 3TH3H 3RDZA 3PMBB 2VWNA 4RSPA 2ZA5A 1C2MA 3QGJA 3TK5A 2SGPE 3DT0H 1GBIA 2XC4A 2PTNA 1TGNA 4FU8A 3A8CA 3Q3KA 3GY3A 1MKXH 1DM4B 1UTPA 4MVNA 3EDXB 2OP9A 2RDLA 2WPLS 1D3QB 2STAE 3ZVBA 3B23B 1O2QA 1ZSLA 1OKXA 2GZ7A 1F92A 2PFEA 4WY3A 3T26A 4WMEA 7GCHF 2O8MA 2ZEBA 2EA3A 1O5EH 2NU4E 4JCNA 3SU0A 1EX3A 1UK4A 5JBBS 4ZAEA 4UFFH 1TBQH 1W7GH 3M3TA 2H9EH 1GMHF 1Y59T 2PGBB 2ZTZA 2GP9B 1V2JT 1ZSKA 2BY7X 1GDUA 4D9RA 2WYJA 1FDPA 1V2TT 1VGCC 4I8HA 3GCHB 1BMAA 2HLCA 1O36A 3BTKE 2ZCKP 1P02A 4B2BA 4CRGA 3PWCA 2BOHB 4A6LA 2SNVA 3U69H 2G8TA 1OWKA 1W14U 2ASUB 2BTCE 2F9PA 2VIVA 1EATA 1BTZA 4BTUB 4MG3A 1EB2A 2G51A 1PYTC 4MLFB 2VNTA 2ZFPH 1GBLA 2FOEA 4NFEA 3EQ0H 3K6YA 3SZNA 1AKSA 1TNJA 3F1SB 3MMGA 2XBYA 5EQSA 3ODFA 4OM9A 5JB9S 3T5FH 1BTPA 2GV6A 1GI9B 2G5VA 2WYGA 1QJ1B 1FUJA 2PW8H 1ZSJA 4X6MA 1EAXA 1ELBA 1EAUA 4Y0ZE 2ZCLP 3ZVCA 2Y7XA 1L1JA 1P3CA 2AGIX 3LGTA 5LPEA 2BD8A 2P3FH 4U30A 3UQOA 1GI2A 2W3IA 8LPRA 2P3UB 3GICB 1MKXK 2WZQA 1TNKA 1O5DH 1EZQA 4B2AA 1P04A 2ZTXA 5T6GA 3A8AA 1WOFA 1TQ7B 4GHTA 4U32A 1G3BA 1ZMLA 4ISOA 3TJOA 2ZFFH 4JYUH 1FIWA 1IQFA 4JZFH 1PQ7A 1E35B 5G4BA 1O2WA 2OBOA 2VJ1A 1AFEH 2VVUA 5C1UA 1PPZA 1S0QA 3FANA 2R3YA 5HMAA 1B7XB 2PKSC 4JYTA 1FY8E 4UONA 1GG6B 1GVLA 1UTLM 2A4QA 3HATH 1H9LB 3A87A 3ZVGA 4ISLA 4DY7B 2PKSB 6ESTA 4X6PA 1N6XA 1O0DH 3N7OA 4BTTB 2FOAA 3HGPA 1ZHRA 1L2EA 4INHA 2CF9H 4ABDA 1PYTD 4TWYA 2VGCC 1PPHE 1O2MA 2ZF0H 3MU4A 1BHXB 4DURA 2ZDMA 4FUBA 1GBFA 1SSXA 3ZZ7A 1QCPA 4Y7BA 1K1LA 2EI7A 1C1VH 1C2DA 4O3UA 4AB9A 4THNH 1CA0C 2OC7A 3T2NA 3TNTA 3TNSA 3SGAE 2AIQA 5DG6A 2BXTH 1CGIE 3H09A 4CREA 1UTJA 1TGBA 1MCVA 1B0FA 4YESB 1JBUH 3RMMH 3RXQA 2A31A 3SNEA 4FU7A 3LPRA 1Z8IB 1TALA 5I46H 1GCTC 1EQ9A 2ZDKA 3PLKA 2WUCA 1SGIB 4SGBE 5DKMA 2BYAX 2EI8A 4DVAU 1ZJKA 1BRCE 1VITG 1ID5H 3LGYA 2ZP0H 2PHBA 1YCPH 3DFJA 4I7YH 1O2PA 4CRCA 1TPSA 1L4ZA 2ZC9H 3LIWA 1SLXB 2VIQA 1KDQA 1HIAA 2UUYA 3V13A 2K1QA 3GY6A 3A89A 4GVUA 1Z1IA 4IS5A 3F9EA 2BDCA 3DD2H 4F4OC 1H8IH 1ANCA 1AVWA 1C4Y2 1OSSA 1TWXB 1UVPA 1W3CA 2AFQB 1O38A 3EYDA 3F9FA 3IWMA 1C4V2 1GJAB 1P9UA 2OD3B 2IJOB 1HJAC 4ISIH 4TWWA 1EUFA 1BBRE 2OUAA 5TJXA 3M5OA 2Y7ZA 1TBZH 1GJ5H 3A88A 5EOKA 4LZ1H 2XW9A 2FLBH 3G01A 3PV2A 3SI4H 3MH7A 4BANB 2AMDA 3UNRA 3EA8A 3QUMP 2G00A 1PQ8A 2WPJS 3A80A 2NWNA 1ZGVA 2O8TA 2GV7A 2BLWA 2XWBI 1GI7B 4UFGH 1Q3XA 3UPEA 3AVZA 2ULLA 3SJOA 1WUNH 2GCHG 2FZZA 4JZIA 4Z6AH 1SHYA 2JH5D 3Q3XA 3LGIA 3LH3A 3SO3A 1LQDB 4FUEA 2AYWA 1EKBB 3UWJH 4WH6A 1O3PB 2BDGA 1M9UA 3KF2A 1RTLA 4FVBA 3GYLB 1TRYA 3LC5A 3RMLH 4AG2A 4ZXYH 1P2NA 4F49A 1GBBA 4MTBA 5AVDA 1LHDH 1UK2A 1UJ1A 4E05H 3BEFB 1OYQA 2A4GA 3ZZ9A 1GJ8B 3KGPA 4ABFA 1JRSA 1O2YA 4IMZA 1GHAG 1O2OA 1VJ9U 2H9TH 3P8OA 2C8YB 2FS8A 1BJVA 1K1IA 2OCVB 1UO6A 4NGAH 2QN5T 3VXFH 2J2UA 3GY7A 5FBIA 1QFKH 4I8JA 1YPJH 2G5NA 1QL8A 1O2NA 3ATIA 4FUDA 3D65E 2A5IA 2PWXA 4X8UH 3A7ZA 1NC6A 1P05A 4GCHG 2BX4A 2BX3A 2C93B 3W95A 1ORFA 1GI4A 2R2WU 2Z9IA 3VB7A 2ANWA 2ZPQA 1P10A 2ESTE 3BTDE 4UDWH 2A5AA 1P03A 4OGYA 5AFYH 1SL3A 4KELA 3SV2H 3SU1A 3B9FH 2PR3A 3ZYDA 3SV9A 8ESTE 3H7TA 1C1NA 3MH4A 3TPIZ 1LCYA 4UFEH 1BOQA 1G37A 1ZOMA 1DANH 1TNLA 1DDJA 4Y8YA 3SNBA 1INCA 1SQTA 4NCYA 2XXLA 5CHAC 1O3IA 3RM0H 1KTSB 1NRPH 3W94A 5HGGA 1FQ3A 1AUJA 1HAXB 1LVYA 4X0WU 3E1XB 3ATMA 4B75A 3FP7E 1FAKH 4ABGA 2ZCHP 2JKHA 2WPHS 2GZ8A 1MU8B 3E0NB 1TMUH 7KMEH 3MU0A 5CMXH 2P93A 2FI4E 1B5GH 1O3NA 5FPYA 3U1JB 1A4WH 1GBJA 1HGTH 2Y6TA 1VITF 1BBRH 3SN8A 1SGCA 1C5YB 1YP9A 3SU4A 3QK1A 5F6MA 1A5GH 1SMFE 3ATLA 1O2GH 4B6FA 5EODA 3VEQB 1C1MA 2HNTE 2PUQH 4GLYA 3FVFB 1BDAA 1A3EH 1NROH 2P95A 1G9IE 1NESE 1MCTA 2VWLA 3ZZ3A 1SOTA 5SGAE 1ZHMA 4GSOA 1HFDA 3OU0A 5T3HA 2D2DA 2ZZUH 2GMTC 2KAIB 1XKAC 3A8DA 5DP4A 1A3BH 4IN2A 1DPOA 1P8VC 1QR3E 1TGCA 4ZH8A 1WU1A 3WY8A 2VIOA 3LONA 1ESBA 2ODQA 2ZHEH 3E3TA 1NRRH 2BDAA 1EJNA 1EJMA 3MU1A 1O3KA 1YYY1 3SUGA 3AAVA 3MYWA 2A7JA 1YPGH 2BOKA 1ZPCA 1Y3XA 7GCHG 1BT7A 1WCZA 2VH0A 3MO6A 1DWBH 2GCHF 2STBE 3RLWH 5HXFA 1KLJH 5F03A 1W0YH 1BJUA 3KQBA 1CVWH 1BRBE 4IC6A 1DSUA 2ZG0H 5BPEA 1GMHG 1K22H 2DE8A 4B1TA 3ODDA 2GT8A 1ABIH 1YCPM 1AU8A 1P2KA 4DJZB 1OXGA 4MPVA 1UCYE 1A0HB 1F2SE 2TPIZ 2QY0B 2HNTF 4ABBA 4A92A 4XOJA 2VB0A 3M61U 1MH0A 2HPPH 3BEIB 3P17H 1NFWA 3E90B 2ZKSA 4ZROA 4K1EA 3BN9A 1E34B 3E6PH 1AE8H 1GHAF 4LXBH 3L6PA 1P01A 3EA9A 3PYHA 4OS6A 1AFQC 5E2PA 7ESTE 3SOSA 1SLWB 5EU8A 5JBAS 2FOBA 1AGJA 2ZO3H 3TITA 1EXFA 4AOQA 2Y5GA 2ZGCA 1IQEA 1SR5C 1D3PB 1SGQE 1MBQA 3FAOA 3NUMA 2GKVE 4CRBA 1G30B 3RM2H 3RP2A 1GHYH 2PSXA 1LPKB 1G3EA 5C3NA 5A2MH 1LPGB 3RXJA 4ZXXH 2HALA 3HKJB 3RC4A 3M36A 1UK3A 1WQVH 4CHAC 2BDIA 4K1SA 4B76A 2ODYB 3GYMA 5AFZH 2UWPA 1PPBH 1D4PB 4CR9A 1RTKA 4X1NU 5C67A 1GI6A 1MD8A 4X2VA 4ZKOU 1V2LT 1KIGH 3UR9A 2XNIA 1A1RA 2QGRA 1ELAA 1HAIH 2ZU1A 4LZ4B 1Y8TA 5DP3A 2P3TB 4QT8C 3R0FA 2IOTA 1DWDH 3PLPA 3GOVB 1GJDB 4VGCB 3PV5A 2Y80A 3LJOA 5TCAA 2BDYA 1AN1E 2BD2A 2UUKB 1QB9A 6GCHG 2WV9A 1H9HE 1ZZZA 1ZLRA 1OX1A 3LKWA 3M7QA 1LVOA 1TMTH 5E0GA 4BNRA 2BZ6H 4WH8A 2AGEX 3BEUA 4FVDA 3UTUH 1D3TB 2A5KA 4AN7A 2BLOA 4X2WA 2Q6DA 1XUGA 3RXCA 2Z7FE 2B7DH 4K8YA 1HXFH 3KCGH 3V12A 4ZKSU 3NXPA 1S83A 3A83A 1DLKB 1L1GA 1LTOA 3OYPA 2GDEH 1QGFA 1H9IE 1GWAA 5FXLA 1EJAA 5EPYA 7LPRA 5T6DA 3ZV9A 5PTPA 5GPIB 2GZ9A 5TCCA 3MFJA 3SUFA 2VINA 1EPTC 3P70B 1V2VT 4DIHH 1Y3VA 2XWAA 4YT7H 2VIDA 1TIOA 1NS3A 1UCYH 1ZTKA 1C2JA 2NU2E 1GHBG 3RXIA 3RXGA 1GHXH 1Y3UA 1P09A 3LDXH 2AGGX 2ZDVH 2R3UA 5C5NA 1YPLH 2QYIA 3GCHC 5C1XA 3QDZB 1IHTH 3ZVEA 3NKKA 1EPTB 2QA9E 2QF0A 1OWJA 1WTGH 1TNIA 1B0EA 1V6DA 1O5AB 1O31A 2XBXA 2OBQA 4ISNA 2CF8H 4Q80A 1GHVH 2BDBA 1KY9A 1PFXC 4NG9H 4B2CA 1T4UH 3URCA 3SNCA 1O2LA 2BQWB 4NIVA 1GL1A 3MOCA 5DGJA 3VFEA 1HAOH 1QA7A 3KIDU 3DFLA 5L2YH 4Y71A 1GBCA 3UOPA 3RXTA 4UFDH 2A32A 1H4WA 2BZAA 1QHRB 5FHTA 2F83A 2FP7B 1LQEA 2F9BH 1P06A 2PV9B 3MHWU 3O8BA 1CHGA 3VPKA 5JB8S 2BQ6B 1C1TA 3NWUA 1MZDA 4K2YA 5E0JA 3SU5A 4IW4E 1G3DA 2RCEA 1EZXC 1O2VA 3GDSA 3IG6B 2I6SA 1C5QA 1THSH 1A46H 1SVPA 2UWLA 1YM0A 2FX4A 1YPKH 2THFB 1KLTA 3K9XB 5I25A 2O8LA 2BD4A 1ANEA 4JZDH 2FXRA 1KXEA 5EQQA 1VJAU 1UCYK 3TIUA 3MI4A 4HFPB 4NA9H 1CU1A 1ZMJA 1NRNH 1O32A 1EOLA 1T8LA 2SGDE 3LGWA 1V2PT 2YNAA 3QGNB 1HRTH 5K7RA 1GG6C 5FBEA 1CA8B 2Y82A 1EAWA 1NFUA 1IOEA 4IBLH 8GCHF 2GVFA 3NK8A 4YT6H 1QBVH 3GY4A 3QO6A 1BQYA 1O2XA 5LH8A 1FLEE 1XXFA 4H42U 2XTTB 2V6NA 4AYVB 1YKTA 1AUTC 2QXGA 1XVMA 3OTJE 2B5TB 5T6FA 1C5TA 3P6ZB 1MTUA 4UE7H 1A7SA 1YF4A 1A0LA 4BAOB 1OWHA 2FX6A 1E37B 3RMNH 2Z94A 3KNXA 1FNIA 4E7RG 5DP7A 1V3XA 4DIIH 6GCHF 2ALVA 3ELAH 4H6TA 1RIWB 2Z9JA 4O9VA 2F9NA 1V2NT 3FFGA 4CRAA 1Z1JA 4K1TA 4BAKB 1QL7A 3GCOA 9LPRA 1G36A 3RU4D 5GCHF 1TFXA 1D3DB 5FCRA 1SOZA 1O2TA 4J2YB 4KGAA 3ZVDA 3A8BA 3PMAB 3SU3A 2Z3EA 1HAGE 4I33A 1QRWA 1NN6A 1HAZB 2LNCA 3RMOH 3U8RH 4CBNA 3ATKA 3ZZ4A 4MNWA 1O2IA 1J8AA 1ESAA 1ZTLA 5F8TA 2J92A 1TONA 1HJ9A 2FOGA 1MTWA 1U6QA 1TA6A 4D7FA 3SQEE 4NIXA 1GHBF 1P12E 3RXAA 4HI3A 3M3SA 2IN2A 5FX6A 1N1LA 1ARCA 4Y6DA 2C3SA 2BLQA 2BD9A 1VZQH 4AZ2B 1NO9H 3UIRA 2V35A 2A4RA 3SUEA 3LT3A 3RXBA 1YLCA 1H1BA 1LVMA 1GJ9B 1LHEH 4FUGA 1N6YA 1DWCH 5DP8A 2WUBA 3M35A 2H5CA 1HYLA 3UOUA 3PMHB 2OQUA 4JK6A 2Z3DA 1W0ZU 1UVTH 2C4FH 3M5LA 3TU7H 3QLPH 2CV3A 5DK1A 1ZR0A 1C5RA 3D62A 1V2WT 5E0HA 2F9UA 1E0FD 3BG8A 2G55A 4Y8XA 3M7UA 1BTUA 2P16A 4D9QA 4B73A 1V2QT 2AIPA 1E36B 3CS0A 2CHAB 4NFFA 3E8LA 4X2YA 2GCTB 2BD5A 3SU2A 1SQOA 1IQMA 3BTME 4KTSA 3A85A 3SJ9A 1AY6H 1BTXA 4TYDA 3MTYA 3HGNA 1Q31A 5DO4H 2D1JA 2J4IA 2PLXA 2AS9A 2PSYA 3PB1E 1HLTH 2OINA 4MPWA 2Z6BD 3KQCA 3GCNA 2XC5A 2F9VA 2UWOA 1O37A 1GMCF 1NT1A 4YZUA 4X8TH 1BMLA 1FJSA 3S9CA 4Q7XA 1JIMA 2KAIA 4MNYA 1AWFH 2JH6D 1THPB 1K2I1 3S9AA 4A7IB 2J34A 4NIWA 2OLGA 4KTUA 1RXPA 3TH4H 4XDEA 2Y5HA 1QQUA 1O2KA 2F3CE 3GDVA 1IQHA 1O2ZA 4INKA 2XBVA 1YCPK 3T28A 4WMDA 1TYNA 1XUHA 4X8VH 1V2UT 1V2ST 3BG4B 3VGCB 3EAJA 1DSTA 3TJNA 1SFIA 3KL6A 3MU5A 3RC5A 3CENA 2VBCA 3S0NA 1G2LA 4TPYA 1RRKA 2C8WB 1QB6A 4BTIB 2QCYA 4AFSA 1PPCE 2FLRH 4NZQA 5EW2H 2BDHA 1TGTA 1SGEE 1YPHC 2QV1A 2C8XB 4I8LA 4Y8ZA 1SGFG 1EZUC 1F0RA 5A09A 1EP6A 4I32A 5T1VA 1K1NA 1IQJA 4AFUA 2BD7A 3ZVFA 2WPIS 5C1YA 1S5SA 2R0KA 1GJ4H 1O3CA 3RC6A 4JZ1A 2H2ZA 5HM2A 1QBNA 3SNAA 2NU1E 3RXPA 4MNXA 1P3EA 4K69A 1TPAE 4WF8A 4HTCH 2TRMA 1GBEA 1V2OT 3TLOA 4ZKRU 5A8XA 5FX5A 5E8EH 3BF6H 3VB4A 5J4QA 2FI5E 3KQEA 4WXVA 1P2OA 3BV9B 5ABWA 1V2MT 4OS7A 5C20A 1HV7A 2A7HA 1ETSH 1AB9B 1HNEE 2ZFQH 4R8TB 2VVCA 1IQNA 3GDUA 3D23A 1EP5A 3KHVA 1W12U 1BRUP 2XCFA 3ESTA 5C5OA 1DUAA 1FMGA 1C1QA 1K28D 5DP9A 2GX4A 5A0AE 1GGDC 4J1YA 1FI8A 3RXSA 1F5KU 1CGHA 5L30H 2O8UA 1GPZA 1O3BA 1GBHA 1K1MA 5J4SA 1BMMH 2FOCA 2W7UA 2EEKA 3UY9A 1P9SA 1GGDB 2QF3A 3BTEE 4KKDA 2JETB 3TGIE 3BTQE 1C5SA 1SGDE 2V3HH 1QRZA 1SQAA 4BXWA 4NA7A 2FTLE 1W7XH 3RXVA 1HBTH 3PO1B 1MTNC 1TX8A 1DOJA 1NU9A 3MNSA 3PROA 1FPCH 1KXBA 3CS7A 1BRAA 2ZU5A 1ZTJA 3S7HB 3PM3A 2CGAA 2WV5A 1OOKB 1O3MA 4WWYA 1RFNA 1S85A 4MDSA 5EGMA 1A5IA 1NM6A 1OPHB 2SNWA 1ETTH 3KN2A 1MTNB 1TQ0B 4NWKA 3E16B 5B6LA 2ZNKH 1Z8JB 4AGJA 2J38A 1ESTA 1BZXE 1QA0A 4GUXA 2W7SA 5HYOA 2XRCA 1CE5A 1Y5AT 2AEIH 1XUIA 1HAHH 2BMGB 5CE1A 1F0TA 1OP8A 5JYIA 1SG8B 4BAMB 2OK5A 1MAYA 3VB6A 1O2UA 1S81A 1AMHA 1KXCA 2CXVA 4GHQA 2P8OB 1BCUH 2ZECA 4X1PU 3Q77A 4YOJA 2BY8X 2TGAA 3RXHA 1D6RA 2G81E 1ABJH 1TB6H 3IITA 2B9LA 2FPZA 4FUIA 1GBDA 1BBRK 1PJPA 1XVOA 3PMJA 1RD3B 2AH4X 1W13U 4Y0YE 2FM2A 1VR1H 1D6WA 1O34A 4U01A 1K1OA 3ZYEA 2GTBA 1IAUA 1SHHB 2GD4B 1GJ6A 2P94A 2GGVB 1AZZA 3F9GA 3SW2B 1W11U 1EPTA 3RXLA 3I78A 1ZJDA 1EB1H 1KLIH 1S84A 1ANDA 3A7YA 5ESBA 5EPNA 1C5ZB 1XKBC 1GCDA 5GDSH 4Z0KA 1FZZA 1UVUH 3HK6B 4AB8A 2D26C 1QL9A 3M3VA 3RXUA 2ZIQH 3SGQE 1PPEE 1ZRKA 2PKAA 1ANBA 3BIUH 1ELCA 2VVVA 1P2JA 1YPEH 4CR5A 3RXMA 1TRNA 3NCLA 4FUFA 3SHAH 4BAQB 3PLBA 1HJ8A 3L3TA 1OS8A 1F5RA 3SJIA 1CGJE 2FI3E 1CBWC 3BTWE 2VH6A 1GI5A 5EQRA 2Q1JA 1QB1A 1L0ZA 1FXYA 3SV8A 3SORA 4NZLA 1K21H 1Z7KA 4RKOB 4NA8A 5L2ZH 3T27A 8GCHG 1GJBB 4A1TA 1E38B 4NSYA 4VGCC 3UREA 4DGJA 1CBWB 4D8NA 1J15A 1WTHD 1C5NH 1FY3A 1XM1A 1BB0B 3BTFE 4JZEH 1LHGH 3K6ZA 3O8DA 2FESH 2H5DA 1MUEB 1NZQH 2EI6A 3MNBA 2FDAA 3ITIA 2V0BA 2SGAA 3JZ2B 4CRFA 1PPFE 2ZHDA 2XBWA 3LU9B 1O3AA 3I29A 2TGTA 1C2FA 3MNXA 1C4U2 1ZRBA 1JIRA 4OS1A 1SC8U 3PTBA 1EOJA 2FMJA 1FAXA 1O5FH 2ZFSA 4FU9A 4RKJB 4JMYA 4X1RU 1XXDA 1TE0A 4DOQA 4FUJA 4IGDA 1JOUB 3V7TA 3RXRA 3S7KB 3V3MA 1F7ZA 3DA9B 4AFQA 5EXMA 4ABAA 5GCHG 2ZFRH 1ELVA 3RU4E 2UUJB 3U8TH 1P57B 2BY6X 1ZHPA 1X7AC 4RI0A 1C1OA 3F6UH 3SNDA 2HGTH 1O3EA 1OYTH 1CQQA 1QIXB 2QC2A 1H8DH 1ZMNA 2PUXB 4LK4A 3A86A 1SI5H 1ZGIA 2I6QA 2PTCE 4UD9H 1BA8B 1XUKA 1GJ7B 4TPIZ 4X6OA 2A7CA 4Y10E 1HCGA 3HPTB 1J16A 3NPSA 1MD7A 2GT7A 2SGFE 4B6EA 1TPOA 1FV9A 2FOHA 1J14A 1QRXA 2BHGA 3QN7A 2ZWLH 1QBOA 1Y3YA 2ZDAH 1TA2A 3MU8A 2YOLA 1IQLA 4K60A 1ARBA 1S0RA 1AI8H 3URDA 4KTCA 3GY5A 3LOXA 3LJJA 3C1KA 4H6SB 2A2XH 1OP2A 3A7WA 1WV7H 1F0UA 2RA3A 1DWEH 1C1RA 3U1IB 3A82A 3OSYA 3RXEA 1WYKA 3GY8A 5H4IB 2PKAB 4O97A 3E0PB 4X1QU 1DXWA 1AVGH 2GDDA 2WPKS 3QWCH 5JBTA 4ESTE 1LHFH 4K3JA 1EAIA 3DHKH 1CSOE 3ENSB 2RG3A 4D7GA 2ZPSA 4WJG2 4YTAA 3ZZ5A 1C1UH 5A8YA 1JMOH 3T62A 4OS4A 1SGYE 1OWDA 1TMBH 3SYJA 4NWLA 1D9IA 1KYNA 1QURH 2ZPRA 3SJKA 3A84A 1YPMH 1MBMA 2ZI2H 1O2SA 3P8GA 2BB4A 1HDTH 1Z6EA 1C2IA 1WQSA 2BM2A 2JH0D 4X8SH 2R9PA 2W3KA 4WVPE 5EG4A 3VB5A 4MNVA 4UEHH 3T29A 1VGCB 4MPUA 1O39A 1O3GA 1GMCG 3Q3YA 1FY4A 5FCKA 1QY6A 4DCDA 1MMJN 3M5NA 3P8FA 4NIYA 2ZFTA 4OGXA 4CH8B 2BY5X 1ELGA 4XBDA 3RU4T 1GI1A 1HB0B 1HAVA 2O8WA 1UHBA 3PV4A 4AGKA 2BLVA 5C2ZA 2WINI 2H9HA 2F9OA 3AW0A 1CT0E 2BQ7B 1V2KT 1FN8A 1CO7E 5A0BA 4YLUA 3UR6A 2HVXA 4ABEA 2FOFA 2ZHQH 3ZZ6A 1BHXF 1GDQA 2XYAA 1AD8H 1GI3A 3EGKH 4IN1A 1SBWA 5L6NH 3ATWA 2A4OA 4XFQA 1LHCH 3MH6A 3QX5H 1RIWC 2QIQA 1HAPH 3PWBA 2ZGBH 1Q2WA 2Y5FA 1DICA 3S69A 1MTVA 4SGAE 2ZGHA 4DG4A 3FP6E 1AWHB 1NFXA 3C27B 3R3GB 3MH5A 5GIBA 1TBRH 5GXPA 1C5WB 1CT4E 2G52A 2XCNA 1CHOF 1EASA 4B71A 1NFYA 3QZRA 5DP6A 3SUDA 5A8ZA 2HRVA 2FOMB 2Q6FA 4AX9H 2G4TA 3RUOA 3KQDA 1JXPA 2B0FA 4XSKU 4HZHA 1GHZA 1DY8A 1KXDA 1LPZB 4B74A 2IJD1 1MQ5A 1AQ7A 5IDKA 3UWIA 1C9TA 3SI3H 2NU0E 4M9FA 3MNCA 1O3FA 1HXEH 1SGNE 3SJ8A 3VXEH 4ABJA 1TOCB 2HOBA 2ZQ1A 4YLQH 1UVSH 5K0HA 1A61H 3HK3B 1C1SA 4HGCA 3A81A 3STJA 1PPGE 1XMNB 2VGCB 1G2MA 5EXLA 4AFZA 4XBCA 3TJVA 5F8ZA 4AYYB 4MPXA 4ZMAH 1HAYB 3TK9A 2NU3E 4YM9A 5A0CA 4FUHA 1CA0B 5ESTE 4I8GA 4DW2U 1AVXA 5DP5A 3MO9A 1IQIA 3P95A 2CHAC 2CJIA 4K8BA 1UTOA 3FZZA 2GCTC 3SV6A 3EE0B 1O35A 1AKSB 1VCWA 1MKWH 1DLEA 1W2KH 1YPHE 1GCTB 4JYVH 2VU8E 1IQKA 1GVZA 1TLDA 1HAVB 3M7TA 2TBSA 1RJXB 2YNBA 1UHBB 2PGQB 5EXNA 1GBMA 4RN6A 2ZQ2A 1NRSH 3SQHE 2O9QA 1G32B 1OP0A 1ZYOA 1BTWA 4ASHA 1O3OA 1O2HA 2Z3CA 1DX5M 5F8XA 4YOGA 1C1WH 1GDNA 1DFPA 1LO6A 1W8BH 4ABIA 4K5ZA 3BTHE 1O30A 1O2JA 1GHWH 1O3JA 1P2QA 1SLVB 1ELDE 2FIRH 2ZHFH 2ANMH 1LKAA 2ANYA 1XX9A 1G3CA 5JBCS 1O33A 3BG4C 4Q2KA 4R0IA 3QZQA 3VGCC 4A5TS 1THRH 3HKIB 1HJAB 1YLDA 2VIWA 2J94A 1UTNA 4IMQA 1JWTA 1KTTB 1J17T 1T8MA 4Y7AA 1DUEA 5JDUB 2OXSA 2H6MA 4O03A 2A1DB 2F91A 1LDTT 1O5CB 2QXIA 4X2XA 1Z6JH 5BRRE 1GL0E 4A1VA 1ELEE 3A7TA 1IQGA 3DUXH 1KSNA 4X6NA 3GISB 3SHCH 3TK6A 2WV4A 4Y11E 4TY7A 2Z9GA 1QNJA 5HM9A 2VWMA 3SU6A 4CH2B 2CN0H 3Q76A 3L33A 1HPGA 2FO9A 3Q00A 1TX6A 4AG1A 3O8RA 1L1NA 1AHTH 5LPRA 1MKWK 3ZZDA 2ZU2A 2Q6GA 3RXKA 2BY9X 3ZZCA 2A2QH 4XBBA 4MQAA 1DS2E 3RXFA 1FN6A 4JK5A 3P92A 3QTOH 3QTVH 1VCPA 1C2LA 3A7VA 2OTVA 1Y5UT 1V2RT 1Z71A 5E2OA 4ZUHA 2OQ5A 4E06H 3AK5A 1ACBE 1QJ6B 1K1JA 3OTPA 1P2IA 2FTMA 4GAWA 2ZU4A 5EW1H 3NZIA 5AHGH 1W10U 1EZSC 2D8WA 3F9HA 1P11E 1AB9C 1MTSA 3K65B 1C5XB 1AO5A 1L4DA 1SFQB 2OC0A 4WMFA 1GI0A 1QJ7B 4U2WA 1T8OA 2A0QB 4CBOA 4KP0A 1OWIA 1RTFB 2HPQH 4OS2A 1KXFA 2CMYA 2OC8A 1C5PA 1C5LH 1C2EA 3AAUA 1K1PA 1Z8RA 2LPRA 2BVXH 3RXDA 1P2MA 1GMDG 3UUZA 3FP8E 1LKBA 1SGRE 3BTGE 3EA7A 1KDQB 1HIAB 3BSQA 1GBKA 1Y3WA 2TGPZ 5DPAA 3U8OH 2M5TA 2SGEE 2JETC 3TGKE 1PQ5A 1UTQA 3CP7A 1GVKB 4BOHA 2FS9A 2B8OH 3UFAA 2EC9H 4WXIA 3PO1C 3UQVA 1SPJA 5CHAB 1TPPA 2TGDA 3ZZBA 1O5BB 2HWLB 1XUFA 1C5UA 4BXSA 3M5MA 2ZHWH 5GWZA 3BIVH 9ESTA 1TNGA 2BVSH 1TGSZ 3STIA 1O3HA 3GCTG 2FYRA 3P8NA 3OY6U 2AMPA 3D49H 4PROA 2H1UA 1SGFA 2G4UA 1TX7A 3E91A 1TAWA 1A5HA 3SBKA 4XE4A 1T7CA 1JRTA 1DE7H 1MQ6A 1O2RA 2AMQA 1P0SH 2ZDLA 1WAYB 2P8OC 3MWIU 3K2UA 1LVBA 1QQ4A 4YOIA 1RS0A 1OWEA 2ALPA 1WSSH 1LMWB 2BD3A 1UVOA 4OS5A 1Y5BT 3TGJE 4ISHH 1BTYA 1DY9A 2J9NA 1CT2E 4YO9A 1C9PA 5AF9H 2IPHA 1GJCB 1NPMA 2C90B 1PQAA 1DXPA 2R2MB 2W26A 3ZVAA 1WXRA 2GMTB 1FPHH 4INLA 3JZ1B 1ETRH 1GBAA 2BVRH 2A45B 3MO3A 1FIZA 4I31A 5DJ7A 1QTFA 8KME2 3RXOA 1TOMH 2ZDNA 2ZU3A 2AERH 1NU7B 5LGOA 4A1XA 1C5VA 1C2KA 2FODA 2Z9LA 3SV7A 2DUCA 2C8ZB 5GJ4B 3TH2H 1C2GA 1C5OH 2J95A 1N8OC 1TRMA 1FY5A 1XUJA 3GY2A 2WHXA 1DITH 2QAAA 3V0XA 4ZHAA 4O3TA 2OC1A 3PTNA 3M37A 1T31A 2FEQH 4BAHB 5GNDA 4Y79A 1VITH 2SGQE 2Y81A 3VB3A 5FAHA 1F5LA 2RA0A 3AW1A 1O3LA 4ZHLU 1S6FA 1T32A 3UNQA 5LPFA 1N8OB 1VCQA 3SZEA 3OY5U 2ODPA 4ABHA 6CHAC 2ZGJA 3AASA 1DVAH 1MU6B 2DE9A 2HNTC 1YC0A 2QXJA 2BXUH 3ZV8A 3A7XA 4Y76A 3FZDA 2TIOA 1AZ8A 3TVJB 2ZTYA 1AE5A 1T8NA 2P59A 3OX7U 4H4FA 1F0SA 6CHAB 2QXHA 4Q7YA 5FPSA 3ZZAA 1SB1H 1RGQA 3F68H 3KEEA 1C1PA 4DT7B 3U9AH 1AFQB 1A2CH 2FYQA 4GCHF 4LOYH 4I8KA 1UTMA 1O5GH 1UTKA 1SGPE 2VWOA 1KXAA 2W5EA 4D76A 6LPRA 1UMAH 1ELTA 4NSVA 1YGCH 4FUCA 5ETXA 1DT2A 2FWWA 3H5CB 5JPMH 3S9BA 3H7OA 2ZGXH 1GMDF 3O8CA 3I77A 1Z8GA 4ZHMU 1WBGB 3LH1A 4M7GA 5IYTA 4Q7ZA 1BMNH 1ZPBA 4CRDA 1C2HA 1T4VH 1O3DA 3U98H 3RLYH 1K9OE 4CHAB 2XC0A 2Z9KA 3UNSA 2VIPA 1CHOG 2F4LA 1AIXH 1TNHA 1BIOA 1SGTA 3ZZ8A 2WPMS 3T25A 4E7NA 1BTHH 3LGUA 1NTPA 1FONA 2R0LA 4X1SU 4AORA 1NRQH 2ILNA 1ELFA 1BUIA 5FPTA
chains in the Genus database with same CATH superfamily
1SLUB 4FXGH 2ANKH 4TY6A 1MAXA 3BTTE 2SFAA 3LGVA 1S6HA 1ZPZA 1MZAA 4ZKNU 4GPGA 1IHSH 2V3OH 1HUTH 1TABE 1NY22 1GBTA 1BITA 3SGBE 5B6OA 1S82A 2JIZD 3GCTF 3B8JA 1YBWA 1C5MD 1FY1A 1GI8B 1H8ED 3LC3A 4IC5A 3TJUA 1A0JA 2UUFB 1J9CH 3TH3H 3RDZA 3PMBB 2VWNA 4RSPA 2ZA5A 1C2MA 3QGJA 3TK5A 2SGPE 3DT0H 1GBIA 2XC4A 2PTNA 1TGNA 4FU8A 3A8CA 3Q3KA 3GY3A 3MQKC 1MKXH 1DM4B 1UTPA 4MVNA 3EDXB 2OP9A 2RDLA 2WPLS 1D3QB 2STAE 3ZVBA 3B23B 1O2QA 1ZSLA 1OKXA 2GZ7A 1F92A 2PFEA 4WY3A 3T26A 4WMEA 3OFND 7GCHF 2O8MA 2ZEBA 2EA3A 3OEHD 1O5EH 2NU4E 5HIZA 4JCNA 3SU0A 1EX3A 1UK4A 5JBBS 4ZAEA 4UFFH 1TBQH 1W7GH 3M3TA 2H9EH 1GMHF 1Y59T 2PGBB 2ZTZA 2GP9B 1V2JT 1ZSKA 2BY7X 1GDUA 4D9RA 2WYJA 1FDPA 1V2TT 1VGCC 4I8HA 3GCHB 1BMAA 2HLCA 1O36A 3BTKE 2ZCKP 1P02A 4B2BA 4CRGA 3PWCA 2BOHB 2QE7D 4A6LA 2SNVA 3U69H 2G8TA 1OWKA 1W14U 2ASUB 2BTCE 2F9PA 2VIVA 1EATA 1BTZA 4BTUB 4Q63A 4MG3A 3FN8A 1EB2A 2G51A 1PYTC 4MLFB 2VNTA 2ZFPH 1GBLA 2FOEA 4NFEA 3EQ0H 3K6YA 3SZNA 1AKSA 1TNJA 3F1SB 3MMGA 2XBYA 5KECA 5EQSA 3ODFA 4OM9A 5JB9S 3T5FH 1BTPA 1YWUA 2GV6A 1GI9B 2G5VA 2WYGA 1QJ1B 1FUJA 2PW8H 1ZSJA 4X6MA 1EAXA 1ELBA 1EAUA 4Y0ZE 2ZCLP 3ZVCA 2Y7XA 1L1JA 1P3CA 2AGIX 3LGTA 5LPEA 2BD8A 2P3FH 4U30A 3UQOA 1GI2A 2W3IA 8LPRA 3W1EA 2P3UB 3GICB 1MKXK 2WZQA 1TNKA 1O5DH 1EZQA 4B2AA 1P04A 2ZTXA 5T6GA 3A8AA 1WOFA 1TQ7B 4GHTA 4U32A 1G3BA 1ZMLA 4ISOA 3TJOA 2ZFFH 4JYUH 3DSOA 1FIWA 1IQFA 4JZFH 1PQ7A 1E35B 5G4BA 1O2WA 2OBOA 3OAAD 2VJ1A 1AFEH 2VVUA 5C1UA 1PPZA 1S0QA 3FANA 2R3YA 5HMAA 3WW7A 1B7XB 2PKSC 4JYTA 1FY8E 4UONA 1GG6B 1GVLA 1UTLM 2A4QA 3HATH 1H9LB 3A87A 3ZVGA 4ISLA 4DY7B 2PKSB 6ESTA 4X6PA 1N6XA 1O0DH 3N7OA 4BTTB 2FOAA 3HGPA 1ZHRA 1L2EA 4INHA 2CF9H 4ABDA 1PYTD 4TWYA 2VGCC 1PPHE 1O2MA 2ZF0H 3MU4A 1BHXB 4DURA 2ZDMA 4FUBA 1GBFA 1SSXA 3ZZ7A 1QCPA 4Y7BA 1K1LA 2EI7A 1C1VH 1C2DA 4O3UA 4AB9A 4THNH 1CA0C 2OC7A 3T2NA 3TNTA 3TNSA 3SGAE 2AIQA 1YLNA 5DG6A 2BXTH 1CGIE 3H09A 4CREA 1UTJA 1TGBA 1MCVA 1B0FA 4YESB 1JBUH 3RMMH 3RXQA 2A31A 3SNEA 4FU7A 3LPRA 1Z8IB 1TALA 2KCPA 5I46H 1GCTC 1EQ9A 2ZDKA 3PLKA 2WUCA 1SGIB 4SGBE 5DKMA 2BYAX 2EI8A 4DVAU 1ZJKA 1BRCE 1VITG 1ID5H 3LGYA 2ZP0H 2PHBA 1YCPH 3DFJA 4I7YH 1O2PA 4CRCA 1TPSA 1L4ZA 2PP6A 2ZC9H 1SLXB 3LIWA 2VIQA 1KDQA 1HIAA 3UB0A 2UUYA 3V13A 2K1QA 3GY6A 3A89A 4GVUA 1Z1IA 4IS5A 3F9EA 2KCAA 2BDCA 5IK2D 4F4OC 3DD2H 1H8IH 1YY3A 2RFKC 1ANCA 1AVWA 1C4Y2 1OSSA 1TWXB 1UVPA 1W3CA 2AFQB 1O38A 3EYDA 3F9FA 3IWMA 1C4V2 1GJAB 1P9UA 2OD3B 2IJOB 1HJAC 4ISIH 3UAIC 4TWWA 1EUFA 1BBRE 2OUAA 5TJXA 3M5OA 2Y7ZA 1TBZH 1GJ5H 3A88A 5EOKA 4LZ1H 2XW9A 2FLBH 3G01A 3PV2A 3SI4H 3MH7A 1UW7A 4BANB 2AMDA 3UNRA 3EA8A 3QUMP 2G00A 1PQ8A 2WPJS 3A80A 2NWNA 1ZGVA 2O8TA 2GV7A 2BLWA 2XWBI 1GI7B 4UFGH 1Q3XA 3UPEA 3AVZA 2ULLA 3SJOA 1WUNH 2GCHG 2FZZA 4JZIA 4Z6AH 1SHYA 2JH5D 3Q3XA 3LGIA 3LH3A 3SO3A 1LQDB 3F2FA 4FUEA 2AYWA 1EKBB 3UWJH 4WH6A 1O3PB 2BDGA 1M9UA 3KF2A 1RTLA 4FVBA 3GYLB 1TRYA 3LC5A 3RMLH 4AG2A 4ZXYH 1P2NA 4F55A 4F49A 1GBBA 4MTBA 5AVDA 1LHDH 1UK2A 1UJ1A 4E05H 3BEFB 1OYQA 3F0OA 2A4GA 3ZZ9A 1GJ8B 3KGPA 4ABFA 1JRSA 1O2YA 4IMZA 2V7QD 1GHAG 1O2OA 1VJ9U 2H9TH 3P8OA 2C8YB 2FS8A 1BJVA 1K1IA 2OCVB 1UO6A 4NGAH 2QN5T 3VXFH 2J2UA 3GY7A 5FBIA 1QFKH 4I8JA 1YPJH 2G5NA 1QL8A 1O2NA 3ATIA 4FUDA 3D65E 2A5IA 2PWXA 4X8UH 3A7ZA 1NC6A 1P05A 4GCHG 2BX4A 2BX3A 2C93B 3W95A 1ORFA 1GI4A 2R2WU 2Z9IA 3VB7A 2ANWA 2ZPQA 1P10A 2ESTE 3BTDE 4UDWH 2A5AA 1P03A 4OGYA 5AFYH 1SL3A 2J98A 4KELA 3SV2H 1H8HD 3SU1A 3B9FH 2PR3A 3ZYDA 3SV9A 3F0PA 8ESTE 3H7TA 1C1NA 3MH4A 3TPIZ 1LCYA 4UFEH 1BOQA 1G37A 1ZOMA 1DANH 1TNLA 1DDJA 3OE7D 4Y8YA 3SNBA 1INCA 2L74A 1SQTA 4NCYA 2XXLA 5CHAC 1O3IA 3RM0H 1KTSB 1NRPH 3W94A 5HGGA 1FQ3A 1AUJA 2QF5A 1HAXB 1LVYA 4X0WU 3E1XB 3ATMA 4B75A 3FP7E 1FAKH 4ABGA 2ZCHP 2JKHA 2WPHS 2GZ8A 1MU8B 5DN6D 3E0NB 1TMUH 7KMEH 3MU0A 5CMXH 2P93A 2FI4E 1B5GH 1O3NA 5FPYA 3U1JB 1A4WH 1GBJA 1HGTH 2Y6TA 1VITF 1BBRH 3SN8A 1SGCA 1C5YB 1YP9A 3SU4A 3QK1A 5F6MA 1A5GH 1SMFE 3ATLA 1O2GH 4B6FA 5EODA 3VEQB 1C1MA 2HNTE 2PUQH 4GLYA 3FVFB 1BDAA 1A3EH 1NROH 2P95A 1G9IE 1NESE 1MCTA 2VWLA 3ZZ3A 1SOTA 5SGAE 1ZHMA 4GSOA 1HFDA 3OU0A 5T3HA 2D2DA 2ZZUH 2GMTC 2KAIB 1XKAC 3A8DA 5DP4A 1A3BH 4IN2A 1DPOA 1P8VC 1QR3E 1TGCA 4ZH8A 1WU1A 3WY8A 2VIOA 3LONA 1ESBA 2ODQA 2ZHEH 3E3TA 1NRRH 2BDAA 1EJNA 1EJMA 3MU1A 1O3KA 1YYY1 3SUGA 3AAVA 3MYWA 2A7JA 1YPGH 2BOKA 2V3MA 1ZPCA 1Y3XA 7GCHG 1BT7A 1WCZA 4TSFD 2VH0A 3MO6A 1DWBH 2GCHF 2STBE 3RLWH 5HXFA 1KLJH 5F03A 1W0YH 1BJUA 3KQBA 1CVWH 1BRBE 4IC6A 1DSUA 2ZG0H 5BPEA 2YMSC 1EFRD 1GMHG 1K22H 2DE8A 4B1TA 3ODDA 2GT8A 1ABIH 1YCPM 1AU8A 1P2KA 4DJZB 4ACAA 1OXGA 4MPVA 1UCYE 1A0HB 1F2SE 2TPIZ 2QY0B 2HNTF 4ABBA 4A92A 4XOJA 2VB0A 3M61U 1MH0A 2HPPH 3BEIB 3P17H 1NFWA 3E90B 2ZKSA 5EJZA 4ZROA 3U28C 4K1EA 3BN9A 1E34B 3E6PH 1AE8H 1GHAF 4LXBH 2XNDD 3L6PA 1P01A 3EA9A 3PYHA 4OS6A 1AFQC 5E2PA 7ESTE 3SOSA 1SLWB 5EU8A 5JBAS 2FOBA 1AGJA 2ZO3H 3TITA 1EXFA 4YXWD 4AOQA 2Y5GA 2ZGCA 2K8IA 1IQEA 1SR5C 1D3PB 1SGQE 1MBQA 2JJ2D 3FAOA 3NUMA 2GKVE 4CRBA 1G30B 3DSGA 3RM2H 3RP2A 1GHYH 2PSXA 1LPKB 1G3EA 5C3NA 5A2MH 1LPGB 1KMHB 3RXJA 4ZXXH 2HALA 3HKJB 3RC4A 3M36A 1UK3A 1WQVH 4CHAC 2BDIA 4K1SA 4B76A 2ODYB 3GYMA 5AFZH 2UWPA 1PPBH 1D4PB 4CR9A 1RTKA 4X1NU 5C67A 1GI6A 1MD8A 4X2VA 4ZKOU 1V2LT 1KIGH 3UR9A 2XNIA 1A1RA 2QGRA 1ELAA 1HAIH 2ZU1A 4LZ4B 1Y8TA 5DP3A 2P3TB 4QT8C 3R0FA 2IOTA 1DWDH 3PLPA 3GOVB 1GJDB 4VGCB 3PV5A 2Y80A 3LJOA 5TCAA 2BDYA 1AN1E 2BD2A 2UUKB 1QB9A 6GCHG 2WV9A 1H9HE 1ZZZA 1ZLRA 1OX1A 3LKWA 3M7QA 1LVOA 1TMTH 5E0GA 3PRBA 4BNRA 2BZ6H 4WH8A 2AGEX 3BEUA 4FVDA 3UTUH 1D3TB 2A5KA 4AN7A 2BLOA 5EJ1A 4X2WA 2Q6DA 1XUGA 3RXCA 2Z7FE 2B7DH 4K8YA 2JJ1D 1HXFH 3KCGH 3V12A 3FKSD 4ZKSU 3NXPA 1S83A 3A83A 1DLKB 1L1GA 1LTOA 3OYPA 4XD7D 2GDEH 1QGFA 1H9IE 1GWAA 5FXLA 1EJAA 5EPYA 7LPRA 5T6DA 3ZV9A 5PTPA 5GPIB 2GZ9A 5TCCA 3MFJA 3SUFA 2VINA 1EPTC 3P70B 1V2VT 4DIHH 1Y3VA 2XWAA 4YT7H 2VIDA 1TIOA 1NS3A 1UCYH 1ZTKA 1C2JA 2NU2E 1GHBG 3RXIA 3RXGA 1GHXH 1Y3UA 1P09A 3LDXH 2AGGX 2ZDVH 2R3UA 5C5NA 1YPLH 2QYIA 3GCHC 2KZ4A 5C1XA 3QDZB 1IHTH 3ZVEA 3NKKA 1EPTB 2QA9E 2QF0A 1OWJA 1WTGH 1TNIA 1B0EA 1V6DA 1O5AB 1O31A 2XBXA 2OBQA 4ISNA 2CF8H 4Q80A 2KFWA 1GHVH 2BDBA 1KY9A 1PFXC 4NG9H 4B2CA 1T4UH 3URCA 3SNCA 1O2LA 2BQWB 4NIVA 1GL1A 3MOCA 5DGJA 3VFEA 1HAOH 1QA7A 3KIDU 3DFLA 5L2YH 4Y71A 1GBCA 3UOPA 3RXTA 4UFDH 2A32A 1H4WA 2BZAA 1QHRB 5FHTA 5C0UA 2F83A 2FP7B 4F48B 1LQEA 2F9BH 1P06A 2PV9B 3MHWU 3O8BA 1CHGA 3VPKA 5JB8S 2BQ6B 1C1TA 3NWUA 1MZDA 4K2YA 5E0JA 3SU5A 4IW4E 1G3DA 2RCEA 1EZXC 1O2VA 3GDSA 3IG6B 2I6SA 4RT0A 1C5QA 1THSH 1A46H 1SVPA 2UWLA 1YM0A 2FX4A 1YPKH 2THFB 1KLTA 3K9XB 5I25A 2O8LA 2BD4A 1ANEA 4JZDH 2FXRA 1KXEA 5EQQA 1VJAU 1UCYK 3TIUA 3MI4A 4XRNA 4HFPB 4NA9H 1CU1A 1ZMJA 1NRNH 1O32A 1EOLA 1T8LA 2SGDE 3LGWA 1V2PT 2YNAA 3QGNB 1HRTH 5K7RA 1GG6C 5FBEA 1CA8B 2Y82A 1EAWA 1NFUA 1IOEA 4IBLH 8GCHF 2GVFA 3NK8A 4YT6H 1QBVH 3GY4A 3QO6A 1BQYA 1O2XA 5LH8A 1FLEE 1XXFA 4H42U 2XTTB 2V6NA 4AYVB 1YKTA 1AUTC 2QXGA 1XVMA 3OTJE 2B5TB 5T6FA 1C5TA 3P6ZB 1MTUA 4UE7H 1A7SA 3CNRA 1YF4A 1A0LA 4BAOB 1OWHA 2FX6A 1E37B 3RMNH 2Z94A 2IPQX 3KNXA 1FNIA 4E7RG 5DP7A 1V3XA 4DIIH 4P00A 6GCHF 2ALVA 3ELAH 4H6TA 1RIWB 2Z9JA 4O9VA 2F9NA 1V2NT 3FFGA 4CRAA 1Z1JA 4K1TA 4BAKB 1FX0B 1QL7A 3GCOA 9LPRA 2KCYA 1G36A 3RU4D 5GCHF 1TFXA 1D3DB 5FCRA 1SOZA 1O2TA 4J2YB 4KGAA 3ZVDA 3A8BA 2QF4A 3PMAB 3SU3A 2Z3EA 1HAGE 4I33A 1QRWA 1NN6A 1HAZB 2LNCA 3RMOH 3U8RH 4CBNA 3ATKA 3ZZ4A 4MNWA 1O2IA 1J8AA 1ESAA 1ZTLA 5F8TA 2J92A 1TONA 1HJ9A 2FOGA 1MTWA 1U6QA 1TA6A 4D7FA 3SQEE 4NIXA 1GHBF 1P12E 3RXAA 4HI3A 3M3SA 2IN2A 1S6LA 5FX6A 1N1LA 1ARCA 4Y6DA 5EJLA 2C3SA 2BLQA 2BD9A 1VZQH 4AZ2B 1NO9H 3UIRA 2V35A 2A4RA 3SUEA 3LT3A 3RXBA 1YLCA 1H1BA 1LVMA 5EIYA 1GJ9B 1LHEH 4FUGA 1N6YA 1DWCH 5DP8A 2WUBA 3M35A 2H5CA 1HYLA 3UOUA 3PMHB 2OQUA 4JK6A 2Z3DA 1W0ZU 1UVTH 2C4FH 3F3BA 3M5LA 5HIYA 3TU7H 2CV3A 3QLPH 5DK1A 1ZR0A 1C5RA 1SKYE 3D62A 1V2WT 5E0HA 2F9UA 1E0FD 3BG8A 2G55A 4Y8XA 3M7UA 3VG8A 1BTUA 2P16A 4D9QA 4B73A 1V2QT 2AIPA 1E36B 3CS0A 2CHAB 4NFFA 3E8LA 4X2YA 2GCTB 2BD5A 3SU2A 1SQOA 1IQMA 3BTME 4KTSA 3A85A 3SJ9A 1AY6H 1BTXA 4TYDA 3MTYA 3HGNA 1Q31A 5DO4H 2D1JA 2J4IA 2PLXA 2AS9A 2PSYA 3PB1E 1HLTH 2OINA 4MPWA 2Z6BD 3KQCA 2HVYB 3GCNA 2XC5A 2F9VA 2UWOA 1O37A 4I86A 1GMCF 1NT1A 4YZUA 4X8TH 1BMLA 1FJSA 3S9CA 4Q7XA 1JIMA 2KAIA 4MNYA 1AWFH 2JH6D 1THPB 1K2I1 3S9AA 4A7IB 2J34A 3NRLA 4NIWA 2OLGA 4KTUA 1RXPA 3TH4H 4XDEA 2Y5HA 1QQUA 1O2KA 2F3CE 3GDVA 1IQHA 1O2ZA 4INKA 2XBVA 1YCPK 3T28A 4WMDA 4DT4A 1TYNA 1XUHA 4X8VH 1V2UT 1V2ST 3BG4B 3VGCB 3EAJA 1DSTA 3TJNA 1SFIA 3KL6A 3MU5A 3RC5A 3CENA 2VBCA 4TT3D 3S0NA 1G2LA 4TPYA 1RRKA 5FL7D 2C8WB 1QB6A 4BTIB 2QCYA 1E1RD 4AFSA 1PPCE 2FLRH 4NZQA 5EW2H 2BDHA 1TGTA 1SGEE 1YPHC 2QV1A 2C8XB 4I8LA 4Y8ZA 1SGFG 1EZUC 1F0RA 5A09A 1EP6A 4I32A 4P02A 5T1VA 1K1NA 1IQJA 4AFUA 2BD7A 3ZVFA 2WPIS 5C1YA 1S5SA 2R0KA 1GJ4H 1O3CA 3RC6A 4JZ1A 2H2ZA 5HM2A 1QBNA 3N7DA 3SNAA 2F43B 2NU1E 3RXPA 4MNXA 1P3EA 4K69A 5KGOA 1TPAE 4WF8A 4HTCH 2TRMA 1GBEA 1V2OT 2LP6A 4ZKRU 3TLOA 5A8XA 5FX5A 5E8EH 3BF6H 3VB4A 5J4QA 2FI5E 3KQEA 4WXVA 1P2OA 3BV9B 5ABWA 1V2MT 4OS7A 5C20A 1HV7A 3WWFA 2A7HA 1ETSH 1AB9B 1HNEE 2ZFQH 4R8TB 2VVCA 1IQNA 3GDUA 3D23A 1EP5A 3KHVA 1W12U 4ACBA 1BRUP 2XCFA 3ESTA 5C5OA 1DUAA 1FMGA 1C1QA 1K28D 5DP9A 2GX4A 5A0AE 1GGDC 4J1YA 1FI8A 3RXSA 1F5KU 1CGHA 5L30H 2O8UA 1GPZA 1O3BA 1GBHA 1K1MA 5J4SA 3KYGA 1BMMH 1BMFD 2FOCA 2W7UA 2EEKA 3UY9A 1P9SA 1GGDB 2QF3A 3BTEE 4KKDA 2JETB 3TGIE 3BTQE 1C5SA 1SGDE 2KCOA 1QRZA 2V3HH 1SQAA 4BXWA 4NA7A 2FTLE 2XOKD 1W7XH 3RXVA 1HBTH 3PO1B 2WPDD 1MTNC 1TX8A 4ASUD 1DOJA 3FOAA 1NU9A 3MNSA 3WWBA 3PROA 1FPCH 1KXBA 3CS7A 1BRAA 2ZU5A 1ZTJA 3S7HB 3PM3A 2CGAA 2WV5A 1OOKB 1O3MA 4WWYA 1RFNA 2LELA 1S85A 4MDSA 5EGMA 1A5IA 1NM6A 1OPHB 2SNWA 1ETTH 3KN2A 1MTNB 1TQ0B 4NWKA 3E16B 5B6LA 2ZNKH 1Z8JB 4AGJA 2J38A 1ESTA 1BZXE 1QA0A 4GUXA 2W7SA 5HYOA 2XRCA 1CE5A 1Y5AT 2AEIH 1XUIA 1HAHH 2BMGB 5CE1A 1F0TA 1OP8A 5JYIA 1SG8B 4BAMB 2OK5A 1MAYA 3VB6A 1O2UA 1S81A 1AMHA 1KXCA 2CXVA 4GHQA 2P8OB 1BCUH 2ZECA 4X1PU 3Q77A 4YOJA 2BY8X 2TGAA 3RXHA 1D6RA 2G81E 1ABJH 1TB6H 3IITA 2B9LA 2FPZA 4FUIA 1GBDA 1BBRK 1PJPA 1XVOA 3PMJA 1RD3B 2AH4X 1W13U 4Y0YE 2FM2A 1VR1H 1D6WA 1O34A 4U01A 1K1OA 3ZYEA 2GTBA 1IAUA 1SHHB 2GD4B 1GJ6A 2P94A 2GGVB 1AZZA 3F9GA 3SW2B 1W11U 1EPTA 3RXLA 3I78A 1ZJDA 1EB1H 1KLIH 1S84A 1ANDA 3A7YA 5ESBA 5EPNA 1C5ZB 1XKBC 1GCDA 5GDSH 4Z0KA 1FZZA 1UVUH 3HK6B 4AB8A 2D26C 1QL9A 3M3VA 3RXUA 2W6ID 5HKKD 2ZIQH 3SGQE 1PPEE 3KYFA 1ZRKA 2PKAA 1ANBA 3BIUH 3F2HA 1ELCA 1E1QD 2VVVA 1P2JA 1YPEH 4CR5A 3RXMA 1TRNA 3NCLA 4FUFA 3SHAH 4BAQB 3PLBA 1HJ8A 1W0KD 3L3TA 4AC9A 1OS8A 1K0HA 1F5RA 3SJIA 1CGJE 2FI3E 1CBWC 3BTWE 2VH6A 1GI5A 5EQRA 2Q1JA 1QB1A 1L0ZA 1FXYA 3SV8A 3SORA 4NZLA 1K21H 1Z7KA 4RKOB 4NA8A 5L2ZH 3T27A 8GCHG 1GJBB 4A1TA 1E38B 4NSYA 4VGCC 3UREA 4DGJA 1CBWB 4D8NA 1J15A 2L6OA 2M2AA 1WTHD 4RT1A 1C5NH 1FY3A 1XM1A 1BB0B 3BTFE 4JZEH 1LHGH 3K6ZA 3O8DA 2FESH 2H5DA 1MUEB 1NZQH 2EI6A 3MNBA 2FDAA 3ITIA 2V0BA 3N7EA 2SGAA 2GJGA 3JZ2B 4CRFA 1PPFE 1MABB 2ZHDA 2XBWA 3LU9B 1O3AA 3I29A 2TGTA 1C2FA 3MNXA 1C4U2 1ZRBA 1JIRA 2KR7A 1SC8U 4OS1A 3PTBA 1EOJA 2FMJA 1FAXA 1O5FH 2ZFSA 4FU9A 4RKJB 4JMYA 4X1RU 1XXDA 1TE0A 4DOQA 5CDFE 4FUJA 4IGDA 1JOUB 3V7TA 3RXRA 3S7KB 3V3MA 1F7ZA 3DA9B 4AFQA 5EXMA 4ABAA 5GCHG 2ZFRH 1ELVA 3RU4E 5KEDA 2UUJB 3U8TH 1P57B 2BY6X 3OEED 1ZHPA 1X7AC 4RI0A 1C1OA 3F6UH 5CHBA 3SNDA 2HGTH 2WSSD 1O3EA 1OYTH 1CQQA 1QIXB 2QC2A 1H8DH 1ZMNA 2PUXB 4LK4A 3A86A 1SI5H 1ZGIA 2I6QA 2PTCE 4UD9H 1BA8B 1XUKA 1GJ7B 4TPIZ 4X6OA 2A7CA 4Y10E 2AHME 1HCGA 3HPTB 1J16A 3NPSA 1MD7A 2GT7A 2SGFE 4B6EA 1TPOA 1FV9A 2FOHA 1J14A 1QRXA 2BHGA 3QN7A 2ZWLH 1QBOA 5DSFA 1Y3YA 2ZDAH 1TA2A 3MU8A 2YOLA 1IQLA 4K60A 4FETA 1ARBA 1S0RA 1AI8H 3URDA 2W6JD 4KTCA 3GY5A 3LOXA 3LJJA 3C1KA 4H6SB 2A2XH 1OP2A 3A7WA 1WV7H 1F0UA 2RA3A 1DWEH 1C1RA 3U1IB 3A82A 3OSYA 3RXEA 1WYKA 3GY8A 5H4IB 2PKAB 4O97A 3E0PB 4X1QU 2KM0A 1DXWA 1AVGH 1QZ8A 2GDDA 2WPKS 3QWCH 5JBTA 4ESTE 1LHFH 4K3JA 1EAIA 3DHKH 1CSOE 3ENSB 2RG3A 4D7GA 2ZPSA 3GS9A 4WJG2 4YTAA 3ZZ5A 1C1UH 5A8YA 1JMOH 3T62A 1OHHD 4OS4A 1SGYE 1OWDA 1TMBH 3SYJA 4NWLA 1D9IA 2HLDD 1KYNA 1QURH 2ZPRA 3SJKA 3A84A 1YPMH 1MBMA 1NBMD 2ZI2H 1O2SA 4Z1MD 3P8GA 2BB4A 1HDTH 1Z6EA 1C2IA 1WQSA 2BM2A 2JH0D 4X8SH 2R9PA 3DSPA 2W3KA 4WVPE 5EG4A 2CK3D 3VB5A 4MNVA 4UEHH 3T29A 1VGCB 4MPUA 1O39A 1O3GA 1GMCG 3Q3YA 1FY4A 5FCKA 1QY6A 4DCDA 1MMJN 3M5NA 3P8FA 4NIYA 2ZFTA 4OGXA 4CH8B 2BY5X 1ELGA 4XBDA 3RU4T 1GI1A 1HB0B 1HAVA 2O8WA 1UHBA 3PV4A 4AGKA 2BLVA 5C2ZA 2WINI 2H9HA 2F9OA 3AW0A 1CT0E 2BQ7B 1V2KT 1FN8A 1CO7E 5A0BA 4YLUA 4FOUC 3UR6A 2HVXA 4ABEA 2FOFA 2ZHQH 3ZZ6A 1BHXF 1GDQA 2XYAA 1AD8H 1GI3A 3EGKH 4IN1A 1SBWA 5L6NH 3ATWA 2A4OA 4XFQA 1LHCH 3MH6A 3QX5H 1RIWC 2QIQA 1HAPH 3PWBA 2ZGBH 1Q2WA 2Y5FA 1DICA 3S69A 1MTVA 4SGAE 2ZGHA 4DG4A 3FP6E 1AWHB 1NFXA 3C27B 3R3GB 3F2GA 3MH5A 5GIBA 1TBRH 5GXPA 1C5WB 1CT4E 2G52A 2XCNA 1CHOF 1EASA 4B71A 1NFYA 3QZRA 5DP6A 3SUDA 5A8ZA 1E79D 2HRVA 2FOMB 2Q6FA 4AX9H 2G4TA 3RUOA 3KQDA 5C0TA 1JXPA 1W0JD 2B0FA 4Q4LA 4XSKU 4HZHA 1GHZA 1DY8A 1KXDA 1LPZB 4B74A 2IJD1 1MQ5A 1AQ7A 5IDKA 3UWIA 1C9TA 2J97A 3SI3H 2NU0E 4M9FA 3MNCA 1O3FA 1HXEH 1SGNE 3SJ8A 3VXEH 4ABJA 1TOCB 2HOBA 2ZQ1A 4YLQH 1UVSH 5K0HA 1A61H 3HK3B 1C1SA 4HGCA 3A81A 3STJA 1PPGE 1XMNB 2VGCB 1G2MA 5EXLA 4AFZA 4XBCA 3TJVA 5F8ZA 4AYYB 4MPXA 4ZMAH 1HAYB 3TK9A 2NU3E 4YM9A 5A0CA 4FUHA 1CA0B 5ESTE 4I8GA 4DW2U 1AVXA 5DP5A 3MO9A 1IQIA 3P95A 2CHAC 2CJIA 4K8BA 1UTOA 3FZZA 2GCTC 3SV6A 3EE0B 1O35A 3DCLA 1AKSB 1VCWA 1MKWH 1DLEA 1W2KH 1YPHE 1GCTB 4JYVH 2VU8E 1IQKA 1GVZA 1TLDA 1HAVB 3M7TA 2TBSA 1RJXB 2YNBA 1UHBB 2PGQB 5EXNA 1GBMA 4RN6A 2ZQ2A 1NRSH 3SQHE 2O9QA 1G32B 1OP0A 1ZYOA 1BTWA 4ASHA 1O3OA 1O2HA 2Z3CA 2J5UA 1DX5M 5F8XA 4YOGA 1C1WH 1GDNA 1DFPA 1LO6A 1W8BH 4ABIA 4K5ZA 3BTHE 1O30A 1O2JA 1GHWH 1O3JA 1P2QA 1SLVB 1ELDE 2FIRH 2ZHFH 2ANMH 5C17A 1LKAA 2ANYA 2EY4C 1XX9A 3N99A 1G3CA 5JBCS 1O33A 3BG4C 4Q2KA 4R0IA 3QZQA 3VGCC 4A5TS 1THRH 3HKIB 1HJAB 1YLDA 2VIWA 2J94A 1UTNA 4IMQA 1JWTA 1KTTB 1J17T 1T8MA 2JDID 4Y7AA 1DUEA 5JDUB 2OXSA 2H6MA 4O03A 2A1DB 2F91A 1LDTT 1O5CB 2QXIA 4X2XA 1Z6JH 5BRRE 1GL0E 4A1VA 1ELEE 3FO8D 3A7TA 1IQGA 3DUXH 1KSNA 4X6NA 3GISB 3SHCH 3TK6A 2WV4A 4Y11E 4TY7A 2Z9GA 1QNJA 5HM9A 2VWMA 3SU6A 4CH2B 2CN0H 3Q76A 3L33A 1HPGA 2FO9A 3Q00A 1TX6A 4AG1A 3O8RA 1L1NA 1AHTH 5LPRA 1MKWK 3ZZDA 2ZU2A 2Q6GA 3RXKA 2BY9X 3ZZCA 2A2QH 4XBBA 4MQAA 1DS2E 4ZCNA 3RXFA 1FN6A 4JK5A 3P92A 3QTOH 3QTVH 1VCPA 1C2LA 3A7VA 2OTVA 1Y5UT 1V2RT 1Z71A 5E2OA 4ZUHA 2OQ5A 4E06H 3AK5A 1ACBE 1QJ6B 1K1JA 3OTPA 1P2IA 2FTMA 4GAWA 2ZU4A 5EW1H 3NZIA 5AHGH 1W10U 1EZSC 2D8WA 3F9HA 1P11E 1AB9C 1MTSA 3K65B 1C5XB 1AO5A 1L4DA 1SFQB 2OC0A 4WMFA 1GI0A 1QJ7B 4U2WA 1T8OA 2A0QB 4CBOA 4KP0A 1OWIA 1RTFB 2HPQH 4OS2A 1KXFA 2CMYA 2OC8A 1C5PA 1C5LH 1C2EA 3AAUA 1K1PA 1Z8RA 2LPRA 2BVXH 3RXDA 1P2MA 1GMDG 3UUZA 3FP8E 1LKBA 1SGRE 3BTGE 3EA7A 1KDQB 1HIAB 3BSQA 3ZIAD 1GBKA 1Y3WA 2TGPZ 5DPAA 3U8OH 2M5TA 2SGEE 2JETC 3TGKE 1PQ5A 1UTQA 3CP7A 1GVKB 3KQ5A 1WDIA 4BOHA 1VKYA 2FS9A 2B8OH 3UFAA 2EC9H 4WXIA 3PO1C 3UQVA 1SPJA 5CHAB 1TPPA 2TGDA 3ZZBA 1O5BB 2HWLB 1XUFA 1C5UA 4BXSA 3M5MA 2ZHWH 5GWZA 3BIVH 9ESTA 1TNGA 2BVSH 2EQNA 1TGSZ 3STIA 1O3HA 3GCTG 2FYRA 3P8NA 3OY6U 2AMPA 3D49H 4PROA 2H1UA 1SGFA 2G4UA 1TX7A 3E91A 1TAWA 1A5HA 3SBKA 4XE4A 1T7CA 1JRTA 1DE7H 1MQ6A 1O2RA 2AMQA 1P0SH 2ZDLA 1WAYB 2P8OC 3MWIU 3K2UA 1LVBA 1QQ4A 4YOIA 1RS0A 1OWEA 2ALPA 1WSSH 1LMWB 2BD3A 1UVOA 4OS5A 1Y5BT 3TGJE 4ISHH 1BTYA 1DY9A 2J9NA 1CT2E 4YO9A 1C9PA 5AF9H 2IPHA 1GJCB 1NPMA 2C90B 1PQAA 1DXPA 2R2MB 2W26A 3ZVAA 1WXRA 2GMTB 1FPHH 4INLA 3JZ1B 1ETRH 1GBAA 2BVRH 2A45B 3MO3A 1SQRA 1FIZA 4I31A 5DJ7A 1QTFA 2K0QA 8KME2 3RXOA 1TOMH 2ZDNA 2ZU3A 2AERH 1NU7B 5LGOA 4A1XA 2KX4A 1C5VA 1C2KA 2FODA 2Z9LA 3SV7A 2DUCA 2C8ZB 5GJ4B 3TH2H 1C2GA 1C5OH 2J95A 1N8OC 1TRMA 1FY5A 1XUJA 2WHXA 3GY2A 1DITH 2QAAA 3V0XA 4ZHAA 4O3TA 2OC1A 3PTNA 3EE7A 3M37A 1T31A 1NBME 2FEQH 4BAHB 5GNDA 2YMSB 4Y79A 1VITH 2SGQE 2Y81A 3VB3A 5FAHA 1F5LA 2RA0A 3AW1A 1O3LA 4ZHLU 1S6FA 1T32A 3UNQA 5F53A 5LPFA 1COWD 1N8OB 1VCQA 3SZEA 3OY5U 2ODPA 4ABHA 6CHAC 2ZGJA 3PRDA 2J98B 3AASA 1DVAH 1MU6B 2DE9A 2HNTC 1YC0A 2QXJA 2BXUH 3ZV8A 3A7XA 4Y76A 3FZDA 2TIOA 1AZ8A 3TVJB 2ZTYA 1AE5A 1T8NA 2P59A 3OX7U 4H4FA 1F0SA 6CHAB 2QXHA 4Q7YA 5FPSA 3ZZAA 4HG6A 1SB1H 1RGQA 3F68H 5C94A 3KEEA 1C1PA 4DT7B 3U9AH 1AFQB 1A2CH 2FYQA 4GCHF 4LOYH 4I8KA 1UTMA 1O5GH 1UTKA 1SGPE 2VWOA 1KXAA 2W5EA 4D76A 6LPRA 1UMAH 1ELTA 4NSVA 1YGCH 4FUCA 5ETXA 1DT2A 2FWWA 3H5CB 5JPMH 3S9BA 3H7OA 2ZGXH 1GMDF 3O8CA 3I77A 1Z8GA 4ZHMU 1WBGB 3LH1A 4M7GA 5IYTA 4Q7ZA 1BMNH 1ZPBA 4CRDA 1C2HA 1T4VH 1O3DA 3U98H 2YMSD 1K9OE 3RLYH 4CHAB 2XC0A 2Z9KA 3UNSA 2VIPA 1CHOG 2F4LA 1AIXH 1TNHA 1BIOA 1SGTA 2RDEA 3ZZ8A 2WPMS 3T25A 4E7NA 1BTHH 3LGUA 1NTPA 1FONA 2R0LA 4X1SU 4AORA 1NRQH 2ILNA 1ELFA 1BUIA 5FPTA
chains in the Genus database with same CATH topology
1SLUB 4FXGH 2ANKH 4TY6A 1MAXA 3BTTE 2SFAA 3LGVA 1S6HA 1ZPZA 1MZAA 4ZKNU 4GPGA 1IHSH 2V3OH 1HUTH 1TABE 1NY22 1GBTA 1BITA 3SGBE 5B6OA 1S82A 3GCTF 2JIZD 3B8JA 1YBWA 1C5MD 1FY1A 1GI8B 4IC5A 3LC3A 1H8ED 3TJUA 1A0JA 2UUFB 1J9CH 3TH3H 3RDZA 3PMBB 2VWNA 4RSPA 2ZA5A 1C2MA 3QGJA 3TK5A 2SGPE 3DT0H 1GBIA 2XC4A 2PTNA 1TGNA 4FU8A 3A8CA 3Q3KA 3GY3A 1MKXH 1DM4B 1UTPA 4MVNA 3EDXB 2OP9A 2RDLA 2WPLS 1D3QB 2STAE 3ZVBA 3B23B 1O2QA 1ZSLA 1OKXA 2GZ7A 1F92A 2PFEA 4WY3A 3T26A 4WMEA 7GCHF 3OFND 2O8MA 2ZEBA 2EA3A 3OEHD 1O5EH 2NU4E 4JCNA 3SU0A 1EX3A 1UK4A 5JBBS 4ZAEA 4UFFH 1TBQH 1W7GH 3M3TA 2H9EH 1GMHF 1Y59T 2PGBB 2ZTZA 2GP9B 1V2JT 1ZSKA 2BY7X 1GDUA 4D9RA 2WYJA 1FDPA 1V2TT 1VGCC 4I8HA 3GCHB 1BMAA 2HLCA 1O36A 3BTKE 2ZCKP 1P02A 4B2BA 4CRGA 3PWCA 2BOHB 2QE7D 4A6LA 2SNVA 3U69H 2G8TA 1OWKA 1W14U 2ASUB 2BTCE 2F9PA 2VIVA 1EATA 1BTZA 4BTUB 4Q63A 4MG3A 3FN8A 1EB2A 2G51A 1PYTC 4MLFB 2VNTA 2ZFPH 1GBLA 2FOEA 4NFEA 3EQ0H 3K6YA 3SZNA 1AKSA 1TNJA 3F1SB 3MMGA 2XBYA 5EQSA 3ODFA 4OM9A 5JB9S 3T5FH 1BTPA 2GV6A 1GI9B 2G5VA 2WYGA 1QJ1B 1FUJA 2PW8H 1ZSJA 4X6MA 1EAXA 1ELBA 1EAUA 4Y0ZE 2ZCLP 3ZVCA 2Y7XA 1L1JA 1P3CA 2AGIX 3LGTA 5LPEA 2BD8A 2P3FH 4U30A 3UQOA 1GI2A 2W3IA 8LPRA 3W1EA 2P3UB 3GICB 1MKXK 2WZQA 1TNKA 1O5DH 1EZQA 4B2AA 1P04A 2ZTXA 5T6GA 3A8AA 1WOFA 1TQ7B 4GHTA 4U32A 1G3BA 1ZMLA 4ISOA 3TJOA 2ZFFH 4JYUH 3DSOA 1FIWA 1IQFA 4JZFH 1PQ7A 1E35B 5G4BA 1O2WA 2OBOA 3OAAD 2VJ1A 1AFEH 2VVUA 5C1UA 1PPZA 1S0QA 3FANA 2R3YA 5HMAA 3WW7A 1B7XB 2PKSC 4JYTA 1FY8E 4UONA 1GG6B 1GVLA 1UTLM 2A4QA 3HATH 1H9LB 3A87A 3ZVGA 4ISLA 4DY7B 2PKSB 6ESTA 4X6PA 1N6XA 1O0DH 3N7OA 4BTTB 2FOAA 3HGPA 1ZHRA 1L2EA 4INHA 2CF9H 4ABDA 1PYTD 4TWYA 2VGCC 1PPHE 1O2MA 2ZF0H 3MU4A 1BHXB 4DURA 2ZDMA 4FUBA 1GBFA 1SSXA 3ZZ7A 1QCPA 4Y7BA 1K1LA 2EI7A 1C1VH 1C2DA 4O3UA 4AB9A 4THNH 1CA0C 2OC7A 3T2NA 3TNTA 3TNSA 3SGAE 2AIQA 5DG6A 2BXTH 1CGIE 3H09A 4CREA 1UTJA 1TGBA 1MCVA 1B0FA 4YESB 1JBUH 3RMMH 3RXQA 2A31A 3SNEA 4FU7A 3LPRA 1Z8IB 1TALA 5I46H 2KCPA 1GCTC 1EQ9A 2ZDKA 3PLKA 2WUCA 1SGIB 4SGBE 5DKMA 2BYAX 2EI8A 4DVAU 1ZJKA 1BRCE 1VITG 1ID5H 3LGYA 2ZP0H 2PHBA 1YCPH 3DFJA 4I7YH 1O2PA 4CRCA 1TPSA 1L4ZA 2ZC9H 3LIWA 1SLXB 2VIQA 1KDQA 1HIAA 3UB0A 2UUYA 3V13A 2K1QA 3GY6A 3A89A 4GVUA 1Z1IA 4IS5A 3F9EA 2KCAA 2BDCA 3DD2H 4F4OC 5IK2D 1H8IH 1ANCA 1AVWA 1C4Y2 1OSSA 1TWXB 1UVPA 1W3CA 2AFQB 1O38A 3EYDA 3F9FA 3IWMA 1C4V2 1GJAB 1P9UA 2OD3B 2IJOB 1HJAC 4ISIH 4TWWA 1EUFA 1BBRE 2OUAA 5TJXA 3M5OA 2Y7ZA 1TBZH 1GJ5H 3A88A 5EOKA 4LZ1H 2XW9A 2FLBH 3G01A 3PV2A 3SI4H 3MH7A 4BANB 2AMDA 3UNRA 3EA8A 3QUMP 2G00A 1PQ8A 2WPJS 3A80A 2NWNA 1ZGVA 2O8TA 2GV7A 2BLWA 2XWBI 1GI7B 4UFGH 1Q3XA 3UPEA 3AVZA 2ULLA 3SJOA 1WUNH 2GCHG 2FZZA 4JZIA 4Z6AH 1SHYA 2JH5D 3Q3XA 3LGIA 3LH3A 3SO3A 1LQDB 4FUEA 3F2FA 2AYWA 1EKBB 3UWJH 4WH6A 1O3PB 2BDGA 1M9UA 3KF2A 1RTLA 4FVBA 3GYLB 1TRYA 3LC5A 3RMLH 4AG2A 4ZXYH 1P2NA 4F55A 4F49A 1GBBA 4MTBA 5AVDA 1LHDH 1UK2A 1UJ1A 4E05H 3BEFB 1OYQA 3F0OA 2A4GA 3ZZ9A 1GJ8B 3KGPA 4ABFA 1JRSA 1O2YA 4IMZA 2V7QD 1GHAG 1O2OA 1VJ9U 2H9TH 3P8OA 2C8YB 2FS8A 1BJVA 1K1IA 2OCVB 1UO6A 4NGAH 2QN5T 3VXFH 2J2UA 3GY7A 5FBIA 1QFKH 4I8JA 1YPJH 2G5NA 1QL8A 1O2NA 3ATIA 4FUDA 3D65E 2A5IA 2PWXA 4X8UH 3A7ZA 1NC6A 1P05A 4GCHG 2BX4A 2BX3A 2C93B 3W95A 1ORFA 1GI4A 2R2WU 2Z9IA 3VB7A 2ANWA 2ZPQA 1P10A 2ESTE 3BTDE 4UDWH 2A5AA 1P03A 4OGYA 5AFYH 1SL3A 4KELA 3SV2H 1H8HD 3SU1A 3B9FH 2PR3A 3ZYDA 3SV9A 3F0PA 8ESTE 3H7TA 1C1NA 3MH4A 3TPIZ 1LCYA 4UFEH 1BOQA 1G37A 1ZOMA 1DANH 1TNLA 1DDJA 3OE7D 4Y8YA 3SNBA 1INCA 1SQTA 4NCYA 2XXLA 5CHAC 1O3IA 3RM0H 1KTSB 1NRPH 3W94A 5HGGA 1FQ3A 1AUJA 2QF5A 1HAXB 1LVYA 4X0WU 3E1XB 3ATMA 4B75A 3FP7E 1FAKH 4ABGA 2ZCHP 2JKHA 2WPHS 2GZ8A 1MU8B 5DN6D 3E0NB 1TMUH 7KMEH 3MU0A 5CMXH 2P93A 2FI4E 1B5GH 1O3NA 5FPYA 3U1JB 1A4WH 1GBJA 1HGTH 2Y6TA 1VITF 1BBRH 3SN8A 1SGCA 1C5YB 1YP9A 3SU4A 3QK1A 5F6MA 1A5GH 1SMFE 3ATLA 1O2GH 4B6FA 5EODA 3VEQB 1C1MA 2HNTE 2PUQH 4GLYA 3FVFB 1BDAA 1A3EH 1NROH 2P95A 1G9IE 1NESE 1MCTA 2VWLA 3ZZ3A 1SOTA 5SGAE 1ZHMA 4GSOA 1HFDA 3OU0A 5T3HA 2D2DA 2ZZUH 2GMTC 2KAIB 1XKAC 3A8DA 5DP4A 1A3BH 4IN2A 1DPOA 1P8VC 1QR3E 1TGCA 4ZH8A 1WU1A 3WY8A 2VIOA 3LONA 1ESBA 2ODQA 2ZHEH 3E3TA 1NRRH 2BDAA 1EJNA 1EJMA 3MU1A 1O3KA 1YYY1 3SUGA 3AAVA 3MYWA 2A7JA 1YPGH 2BOKA 1ZPCA 1Y3XA 7GCHG 1BT7A 1WCZA 4TSFD 2VH0A 3MO6A 1DWBH 2GCHF 2STBE 3RLWH 5HXFA 1KLJH 5F03A 1W0YH 1BJUA 3KQBA 1CVWH 1BRBE 4IC6A 1DSUA 2ZG0H 5BPEA 2YMSC 1GMHG 1K22H 1EFRD 2DE8A 4B1TA 3ODDA 2GT8A 1ABIH 1YCPM 1AU8A 1P2KA 4DJZB 1OXGA 4MPVA 1UCYE 1A0HB 1F2SE 2TPIZ 2QY0B 2HNTF 4ABBA 4A92A 4XOJA 2VB0A 3M61U 1MH0A 2HPPH 3BEIB 3P17H 1NFWA 3E90B 2ZKSA 4ZROA 4K1EA 3BN9A 1E34B 3E6PH 1AE8H 1GHAF 4LXBH 2XNDD 3L6PA 1P01A 3EA9A 3PYHA 4OS6A 1AFQC 5E2PA 7ESTE 3SOSA 1SLWB 5EU8A 5JBAS 2FOBA 1AGJA 2ZO3H 3TITA 1EXFA 4YXWD 4AOQA 2Y5GA 2ZGCA 2K8IA 1IQEA 1SR5C 1D3PB 1SGQE 1MBQA 3FAOA 3NUMA 2JJ2D 2GKVE 4CRBA 1G30B 3RM2H 3RP2A 1GHYH 2PSXA 1LPKB 1G3EA 5C3NA 5A2MH 1LPGB 1KMHB 3RXJA 4ZXXH 2HALA 3HKJB 3RC4A 3M36A 1UK3A 1WQVH 4CHAC 2BDIA 4K1SA 4B76A 2ODYB 3GYMA 5AFZH 2UWPA 1PPBH 1D4PB 4CR9A 1RTKA 4X1NU 5C67A 1GI6A 1MD8A 4X2VA 4ZKOU 1V2LT 1KIGH 3UR9A 2XNIA 1A1RA 2QGRA 1ELAA 1HAIH 2ZU1A 4LZ4B 1Y8TA 5DP3A 2P3TB 4QT8C 3R0FA 2IOTA 1DWDH 3PLPA 3GOVB 1GJDB 4VGCB 3PV5A 2Y80A 3LJOA 5TCAA 2BDYA 1AN1E 2BD2A 2UUKB 1QB9A 6GCHG 2WV9A 1H9HE 1ZZZA 1ZLRA 1OX1A 3LKWA 3M7QA 1LVOA 1TMTH 5E0GA 4BNRA 3PRBA 2BZ6H 4WH8A 2AGEX 3BEUA 4FVDA 3UTUH 1D3TB 2A5KA 4AN7A 2BLOA 4X2WA 2Q6DA 1XUGA 3RXCA 2Z7FE 2B7DH 4K8YA 2JJ1D 1HXFH 3KCGH 3V12A 3FKSD 4ZKSU 3NXPA 1S83A 3A83A 1DLKB 1L1GA 1LTOA 3OYPA 4XD7D 2GDEH 1QGFA 1H9IE 1GWAA 5FXLA 1EJAA 5EPYA 7LPRA 5T6DA 3ZV9A 5PTPA 5GPIB 2GZ9A 5TCCA 3MFJA 3SUFA 2VINA 1EPTC 3P70B 1V2VT 4DIHH 1Y3VA 2XWAA 4YT7H 2VIDA 1TIOA 1NS3A 1UCYH 1ZTKA 1C2JA 2NU2E 1GHBG 3RXIA 3RXGA 1GHXH 1Y3UA 1P09A 3LDXH 2AGGX 2ZDVH 2R3UA 5C5NA 1YPLH 2QYIA 3GCHC 2KZ4A 5C1XA 3QDZB 1IHTH 3ZVEA 3NKKA 1EPTB 2QA9E 2QF0A 1OWJA 1WTGH 1TNIA 1B0EA 1V6DA 1O5AB 1O31A 2XBXA 2OBQA 4ISNA 2CF8H 4Q80A 2KFWA 1GHVH 2BDBA 1KY9A 1PFXC 4NG9H 4B2CA 1T4UH 3URCA 3SNCA 1O2LA 2BQWB 4NIVA 1GL1A 3MOCA 5DGJA 3VFEA 1HAOH 1QA7A 3KIDU 3DFLA 5L2YH 4Y71A 1GBCA 3UOPA 3RXTA 4UFDH 2A32A 1H4WA 2BZAA 1QHRB 5FHTA 5C0UA 2F83A 2FP7B 1LQEA 2F9BH 1P06A 2PV9B 3MHWU 3O8BA 1CHGA 3VPKA 5JB8S 2BQ6B 1C1TA 3NWUA 1MZDA 4K2YA 5E0JA 3SU5A 4IW4E 1G3DA 2RCEA 1EZXC 1O2VA 3GDSA 3IG6B 2I6SA 1C5QA 1THSH 1A46H 1SVPA 2UWLA 1YM0A 2FX4A 1YPKH 2THFB 1KLTA 3K9XB 5I25A 2O8LA 2BD4A 1ANEA 4JZDH 2FXRA 1KXEA 5EQQA 1VJAU 1UCYK 3TIUA 3MI4A 4HFPB 4NA9H 1CU1A 1ZMJA 1NRNH 1O32A 1EOLA 1T8LA 2SGDE 3LGWA 1V2PT 2YNAA 3QGNB 1HRTH 5K7RA 1GG6C 5FBEA 1CA8B 2Y82A 1EAWA 1NFUA 1IOEA 4IBLH 8GCHF 2GVFA 3NK8A 4YT6H 1QBVH 3GY4A 3QO6A 1BQYA 1O2XA 5LH8A 1FLEE 1XXFA 4H42U 2XTTB 2V6NA 4AYVB 1YKTA 1AUTC 2QXGA 1XVMA 3OTJE 2B5TB 5T6FA 1C5TA 3P6ZB 1MTUA 4UE7H 1A7SA 1YF4A 1A0LA 4BAOB 1OWHA 2FX6A 1E37B 3RMNH 2Z94A 3KNXA 1FNIA 4E7RG 5DP7A 1V3XA 4DIIH 6GCHF 2ALVA 3ELAH 4H6TA 1RIWB 2Z9JA 4O9VA 2F9NA 1V2NT 3FFGA 4CRAA 1Z1JA 4K1TA 4BAKB 1QL7A 1FX0B 3GCOA 9LPRA 2KCYA 1G36A 3RU4D 5GCHF 1TFXA 1D3DB 5FCRA 1SOZA 1O2TA 4J2YB 4KGAA 3ZVDA 3A8BA 2QF4A 3PMAB 3SU3A 2Z3EA 1HAGE 4I33A 1QRWA 1NN6A 1HAZB 2LNCA 3RMOH 3U8RH 4CBNA 3ATKA 3ZZ4A 4MNWA 1O2IA 1J8AA 1ESAA 1ZTLA 5F8TA 2J92A 1TONA 1HJ9A 2FOGA 1MTWA 1U6QA 1TA6A 4D7FA 3SQEE 4NIXA 1GHBF 1P12E 3RXAA 4HI3A 3M3SA 2IN2A 1S6LA 5FX6A 1N1LA 1ARCA 4Y6DA 2C3SA 2BLQA 2BD9A 1VZQH 4AZ2B 1NO9H 3UIRA 2V35A 2A4RA 3SUEA 3LT3A 3RXBA 1YLCA 1H1BA 1LVMA 1GJ9B 1LHEH 4FUGA 1N6YA 1DWCH 5DP8A 2WUBA 3M35A 2H5CA 1HYLA 3UOUA 3PMHB 2OQUA 4JK6A 2Z3DA 1W0ZU 1UVTH 2C4FH 3M5LA 3TU7H 3QLPH 3F3BA 2CV3A 5DK1A 1ZR0A 1C5RA 1SKYE 3D62A 1V2WT 5E0HA 2F9UA 1E0FD 3BG8A 2G55A 4Y8XA 3M7UA 3VG8A 1BTUA 2P16A 4D9QA 4B73A 1V2QT 2AIPA 1E36B 3CS0A 2CHAB 4NFFA 3E8LA