3EYIA

The crystal structure of the second z-dna binding domain of human dai (zbp1) in complex with z-dna
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
64
structure length
64
Chain Sequence
SPQFSQQREEDIYRFLKDNGPQRALVIAQALGMRTAKDVNRDLYRMKSRHLLDMDEQSKAWTIY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of the second Z-DNA binding domain of human DAI (ZBP1) in complex with Z-DNA reveals an unusual binding mode to Z-DNA.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Z-DNA-binding protein 1
total genus 20
structure length 64
sequence length 64
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eyiA00
2RVCA 1ZG3A 1S3JA 4WXCA 2ZMEA 2G9WA 3RYRA 3VODA 1QBJA 3AAFA 3TGNA 5LEJA 5JI6A 2L4AA 2IRFG 1BBYA 4QLCU 2D1VA 3ZMSA 5K5RA 3GLXA 1F5TA 2L02A 3TO7A 1DUXC 3ELKA 2ISYA 4CHUA 4Q5SF 1KU9A 3JW4A 3Q5FA 1HBXG 2CGPA 3F21A 3FXQA 3BZ6A 2BYVE 2G7HA 4ESBA 1MZBA 1KU3A 3CUQB 2EA2A 2RN7A 2P7CB 1ODDA 5L3CA 1JE8A 4JQFA 1U6GA 2PN6A 4G9YA 5D5VB 3NQOA 2DLLA 1FP1D 5FD6A 3K9TA 2IA1A 2PQ8A 2ZKZA 3CTAA 2ACJA 2F5EA 5ILVA 1E17A 5AIQA 1W7PD 1U8RA 5K1YA 3RKWA 2XAQA 3J80Z 2R3SA 4L9JA 4XLPF 2GQQA 1B6AA 3P9IA 2G7UA 1XSDA 1FT9A 3SFZA 2FF4A 1T98A 2MD5A 3U1DA 3MQ0A 2STWA 2QYOA 2HKOA 2W25A 1P4WA 5BPDA 2DK8A 1I1SA 2YPRA 2GA1A 1I27A 3M8FA 4IRHA 4KNYA 2XAJA 2FE3A 1ZG1A 1Z1DA 4NQWA 3BY6A 3V7CA 1PP7U 1HSTA 5BMZA 1G3SA 3PQJA 1ZRDA 1E2XA 2ZNYA 2PI0A 4IHSA 3WODF 3GFIA 2FU4A 4K2EA 1Q1HA 3T1BA 1YIOA 3K2ZA 4I98B 4L9NA 3SQNA 5E1WA 1FP2A 4R79A 2HEOA 2F5CA 1BIBA 2EV6A 3KLNA 3D0SA 2KIUA 4B8XA 1TTYA 4M71A 5LHIA 1SD7A 1OKRA 3GFLA 4YIIA 4O5VA 5FFXA 2CG4A 1JXSA 1P2FA 5J8CA 1XSXA 2XUBA 1XDUA 1CF7A 3IRRA 3NEUA 2IJLA 2QUFA 5A2QK 2DPDA 1FYMA 4EJVA 2QVOA 4RGRA 4WX9A 1Y0UA 4HV5A 2DU9A 3E5UA 2L4MA 2XAFA 1EH8A 1Z7UA 4L5IA 3GEZA 2CO5A 5E8GA 4S05A 2WV0A 1FSEA 3HRTA 4E70A 1D5VA 3JTGA 4JBAA 1CGPA 4ETSA 3LSTA 4YIFA 2KKOA 3J81K 1LQ1A 1IRFA 4F7ZA 2VOOA 1T0FA 2HKXA 3FXUA 1FZPB 3F23A 4A6DA 4ASNA 5LHHA 4HW0A 2A68F 1ZGAA 3K0LA 1BI0A 2CFXA 2OQGA 5HLIA 3VEPA 1L0OC 1KU2A 2CQKA 2PJPA 2QBYB 4MTDA 5HDNA 3BWGA 3BPXA 3K1MA 4MNUA 2BBYA 1TQIA 4G8XA 2Y0MA 4ON0A 4EJTA 1XMAA 3WU0A 2LSOA 1MD0A 3BJAA 2W84A 3KEOA 3I0TA 3L09A 5HS9A 3IKVA 1ZHFA 4LMYA 4AD9A 3HRMA 2EV0A 2QQBA 4CGZA 4UUVA 1TW2A 4BXUA 3C18A 4O6JA 3QP6A 4YFNF 4JK1X 4YFXF 2EWNA 4LLNA 3FMQA 4L5JA 2Z3YA 1Z91A 3WGHA 5AIPA 3NRVA 4WXDA 3KEQA 4DQ2A 1F1ZA 5D6EA 2W85A 1BJAA 5A2QZ 1BC7C 1RNLA 2Y48A 1U78A 3RKYA 3CUOA 3EETA 4IPAA 4G6DA 3ZN0A 4BYYA 1WWXA 3KZYA 3BDDA 5FO5A 3CO6C 3ECOA 1R1UA 1U5TA 3H92A 4I01A 1FYKA 3V8JA 1G4DA 2VBZA 3I59B 4NHJA 2PFBA 4R8HA 3Q9SA 3WE3A 5CVVA 1S29A 4BHBA 5BQTA 4LFUA 3KP2A 3E6DA 3V4GA 1YO5C 1ZYRF 2BEOA 1HQCA 2K7LA 3HTUA 1O57A 2XKOA 2HQRA 3HIFA 1XDSA 3ERED 1Z05A 4KN4X 5DD4A 5AONA 2R7FA 2RNJA 1UHWA 4GCVA 2VODA 2ZXJA 2XROA 1YYVA 4XRFA 5ICGA 1SFXA 3HOSA 4IRIA 4M6XA 3BP8A 1IF1A 1TQMA 3L00A 3V8LA 1XB4A 3P9KA 2VC1A 3E6BA 4ENJA 1FX7A 2IA0A 3I59A 3IL2A 2PG4A 2XASA 3WTYC 3QPHA 5LRRA 2XGXA 2A61A 4AWXB 2A07F 5H6RA 1D3YA 2FNPA 4N9HA 1J59A 4EV0A 4S04A 1FBSA 2ESHA 4EJUA 3P7NA 4UXNA 1FOKA 3DPLC 3ZMUA 2FNAA 3JSPA 4U0VA 3REOA 3FM3A 1F9NA 3GZ6A 5E1XA 1EV7A 4GO1A 2VBXA 3DQVC 1O3SA 5L3FA 2NS0A 4HYEA 1ZRFA 3V7SA 5HS8A 5ILUA 2Q0OA 1STZA 2QZ8A 4IXAA 4EVIA 2CYYA 3QAHA 4RAZA 3LWFA 5HLGA 3L9FA 5DEQA 4L0ZB 2UWMA 3K1PA 1T39A 5F6FA 3WGGA 3HHGA 1IN6A 1SD4A 2VONA 2GWRA 1JHFA 3BROA 2IPQX 4U7DA 2OU2A 2CSOA 2E7XA 4OINF 1QQIA 2UXXA 3ML6A 5FGMA 1G3YA 2DT5A 2EFQA 1FSHA 1J7KA 2O0YA 3O3KA 4Z2YA 2ZBKA 4CICA 3R60A 3ZQ7A 2F5DA 1Z6RA 5DD8A 1O7LA 1IRGA 1R7JA 1IXRC 3J81Z 1JHHA 5K5QA 3ABTA 1P4AA 2P6SA 5LEKA 1A04A 2K4BA 2HYGD 4BNCA 2A5YB 5L3GA 4FX0A 1TLHB 3HSRA 5K5OA 2HTJA 3IRQA 5BOXA 3FXRA 2JPCA 3WTXC 1BI1A 3F3XA 3KE2A 3KP4A 4KMUX 2EK5A 5D8KB 3FMRA 3TOAA 3PFIA 3FX3A 2XIGA 2GAUA 3EQLF 1GXPA 1REPC 2D2WA 4BQAA 2Z5UA 2GXGA 4RAYA 5DCMB 3KLOA 5IT9K 3JTHA 1MJAA 1LB2A 1DPUA 2EFPA 5HVQC 4FX4A 5F64A 2BV6A 1SFEA 1WQ2A 3DPTA 2DFIA 4A5MA 2GZWA 5FLXK 1UCRA 1J5YA 3LA7A 3GW2A 5E18F 4G7ZF 2KJBA 2E1NA 3LA2A 3Q9VA 1U3EM 4PZJA 5DCFA 3ZP5A 4ESJA 3PQKA 2ELHA 4UVAA 5JVTA 4I0AA 2RKHA 1HKSA 4R1HA 5D6FA 3HSEA 1R22A 3HHHA 3IC7A 4WF2A 5D4RA 1QZZA 2A6HF 1R5GA 2RDPA 2XRNA 4IF4A 1RUOA 2E7WA 5KVRA 3ZPLA 1IN5A 2OBPA 3CUQC 4FHTA 2K27A 4KIGA 1FBQA 2YX4A 3K69A 2MH9A 5JFRA 1YW7A 2H09A 2XAHA 4LK1F 2UZKA 4N9IA 3V8KA 1K6OA 4ZYGA 2W24A 3KFWX 1ZREA 1U5TB 5LHGA 2FXAA 4D0PA 4HLYA 3RYPA 1O3QA 2L3DA 3WTSC 5HS7A 4M73A 2P8TA 3GFJA 2IA2A 4HV6A 3GWZA 1HW2A 1SMTA 1BM9A 3E5XA 3HTSB 2L01A 4MGRA 1XN7A 2KJCA 1QGPA 3LAPA 2AS5F 1OYIA 5IT3A 2HYFA 2JSCA 3CJNA 2MLKA 5LBQA 4MQVA 1K78A 3I58A 2F2EA 4ZYEA 1FYLA 2MC3A 2OAZA 4XBFA 1WKMA 2K4JA 4L0YB 3QU3A 3ROUA 5D5WB 4LB6B 2M30A 5DYMA 4CXFA 1KQ9A 2JRTA 1R36A 2YR2A 3IWFA 1P92A 1TNTA 2P5VA 1SAXA 1BIAA 2EJRA 2RV8A 1Z9CA 5FD5A 3QPTA 2DQLA 2QQAA 5J8FA 1GXQA 2LNBA 4ZYDA 2A69F 4L9TA 3VB2A 1P6RA 6PAXA 4XSZF 5E20A 3MZYA 1AOYA 3E6CC 1ZG5A 1W5SA 4LD5A 2FSWA 2QM3A 4AIJA 1EH7A 1LEAA 3U2RA 2HFHA 1ZLJA 4GYIA 3DKWA 4MTEA 4EQQA 2V6CA 2DI3A 3FHZA 3F8MA 4KICA 2B0LA 2EFOA 3RPUA 3MWMA 2GA2A 5CVUA 1YS7A 1VTNC 2VN2A 1SFUA 2XV4S 4Q4ZF 2JT1A 4ZH4F 3KP7A 4FT8A 3F6OA 1ON2A 1RZ4A 5E1ZB 1XGOA 2IP2A 2MH2A 3I54A 2HS5A 4XLNF 2COMA 3RTRA 3GFMA 3ZMTA 3GO5A 1B4AA 2VOPA 1XSVA 5ERIA 3ISPA 2PLYA 2P7VB 5CLSA 2WTEA 4HOBA 1IN7A 3H3UA 3RIRA 1WRJA 2ZNZA 4OIPF 2ZO4A 2DPUA 3RPQA 4A5NA 5L3DA 2LF8A 4P55A 2MA3A 4GXOA 4A12A 2FEZA 1S8NA 1KYZA 4HX4A 5LLQA 5JHUA 2E1CA 1G3WA 5ICEA 2QLZA 3R61A 1BN5A 3GXOA 3I71A 2PBIA 4BHPA 1HW1A 4G7OF 2V9VA 2H6BA 3F8BA 2VE9A 3M8EA 4I02A 1U2WA 5HLHA 2HTSA 2D1HA 3WTWC 1MJBA 2VBYA 4Y17A 3IKTA 3GUDA 3MFKA 1RIOH 2VT3A 2PEXA 4OIQF 3M9AA 4RB1A 2DQRA 3ZN1A 1XCBA 1YW8A 1KQ8A 1SD6A 4ZZLA 1D8JA 3F8CA 1FC3A 5LGNA 1HW5A 1QNTA 2K02A 4OMYA 3TQNA 2NNYA 2H6CA 4EM1A 2ZCWA 2JPBA 4GGGA 1IN8A 4KIFA 2EA4A 5FFZA 4ENKA 2QWWA 5EEHA 5D4SA 2LF7A 3ZMZA 4CO8A 4P5OA 5DV5A 3CLOA 2QQ9A 1FNNA 1UHMA 2V1DA 3D5LA 5LRSA 4OIRF 3KP6A 1YLFA 1BI2A 2KIFA 1YTYA 2AXLA 3TOBA 4KA4A 1KU7A 5LGUA 4OIOF 1G6NA 2HGCA 4LLLA 4HDVA 5DUIA 4ENMA 1HKQA 4KMFA 3OOPA 4BAYA 1LNWA 2UXNA 1S7AA 1JGSA 3S2WA 3B73A 3WU1B 4G94A 3WTZA 3R0JA 4HA8A 4HDUA 3KP3A 4QWQA 1OPCA 1U5TC 1ZGJA 1IN4A 4IHTA 2EFWA 1LVAA 3DEUA 3JAMZ 3J7AO 1FBUA 2J5PA 2V79A 4LLGF 2OZUA 1QZYA 2EV5A 4AIHA 1IUYA 2OQRA 1DDNA 1J0RA 1B59A 4P9FA 4OMZA 3I64A 1J2XA 2OA4A 2DBBA 1W5TA 4P9UA 1W7PA 4LG0B 1Z6TA 4LG0A 4M74A 5HOOA 4U0YA 5H6QA 3DP7A 4BHCA 3H3ZA 2KIMA 2MBFA 4M6YA 4EGZA 2YSRA 4ESFA 3QU6A 5F1RA 4HBLA 3VFZA 2VE8A 3GX4X 1ZH5A 3CDHA 5CYVA 1K79A 2M5WA 4EJWA 1QPMA 1HXDA 3MCZA 2DK5A 1WI9A 3K1NA 2XKPA 3DV8A 4Q47A 2FA5A 2XHKA 4CYDA 4I2OA 3KZZA 1IAWA 4UHTA 4A6EA 1SMYF 1R23A 3IHUA 3GVAA 1ULYA 1QO0D 4HQMA 4L9VA 3WGIA 4CZZA 4P96A 1O3TA 2NNNA 2NRAC 2C6YA 2ZJ2A 1W7PB 2STTA 4ZYHA 3N4MA 4UNOA 4IRGA 3GYHX 2HQNA 4RS8A 4GYGA 3SZTA 4A2UA 1DP7P 2IVMA 4AIKA 5HDGA 4Y13A 4RGUA 2WC2A 2JTVA 4U7BA 1TQPA 1XD7A 4BH9A 2EFNA 5E17F 2O3FA 3HYIA 3RI4A 4HAMA 4M72A 5E8IA 4HF0A 2Y75A 2FMYA 2FBKA 2JZYA 2FBIA 4HZFA 4YFKF 4IJAA 4L18B 2PMHA 4MQ9F 2VXZA 2O6GE 5ILSA 1S6LA 4I7HA 1AWCA 2P4WA 3ULQB 2P6TA 1RI7A 2Z33A 1OYWA 1NHAA 1YG2A 3JAMK 4EJOA 5TRDA 1YFHA 1T2KA 1T38A 5HDKA 2H27A 2LDUA 2D45A 1MDMB 1PDNC 1ZN2A 2RC4A 2CWEA 2HZTA 5LGTA 3B02A 1P4XA 5D5UB 2EB7A 1C0WA 3VOEA 1LEBA 4N0BA 1IZ1A 3OV8A 4KFCA 3TO6A 1MGTA 2Z99A 4A0ZA 3WG9A 2GXBA 1V4RA 4PGGA 3I5UA 1USSA 1R1TA 4WCGA 1YS6A 2XAGA 1R58A 2L54A 3SHFA 3CO7C 3MEXA 3HRSA 3W6JB 4LGWA 2P5KA 1B1BA 1OYYA 3RJPA 2W57A 4HQEA 3E5QA 4PDKA 1TNSA 1MDMA 4I09A 2FOKA 1XGSA 2Q8KA 4OU0A 3C7JA 3T0YA 2ISZA 1T6SA 1SD5A 4G7HF 3LFKA 1MJ9A 1I5ZA 4EGYA 4A0YA 3L2CA 3QP5A 5CVIA 1K78B 4LB5A 3C3WA 3R4KA 3HOTA 5FLXZ 1IXCA 4RGSA 3GZ5A 4MEYF 4KIBA 3E3VA 2A3SA 3SXYA 1TW3A 3QRFF 4U0WA 3E6MA 4RGXA 4NB5A 3G3ZA 5DDGA 1I1GA 3SZPA 2HOEA 1B9MA 1ON1A 1IW7F 2RGVA 5FB2A 3T8TA 1IXSB 3F22A 3U9GA 2IT0A 2V1UA 4Q48A 1H0MA 3L7WA 1LDKB 1BI3A 4WWCA 4G6QA 2CW0F 3JSOA 1PP8F 2YU3A 1TBXA 2HWVA 2OD5A 3F72A 2YX7A 4UVCA 3N97A 2RQPA 3KETA 1ZLKA 1H9TA 1HSJA 4RB0A 2DO7A 1UFMA 1YQAA 1GHCA 3FWEA 3EDPA 3RKXA 4UV9A 4ZZDA 4RB2C 1HKTA 3EYIA 3BOQA 1OR7A 1W4MA 4A0XA 3BJOA 3M1EA 4LK0F 1MKMA 2DAOA 5D8LB 3DXJF 4ENNA 3QOPA 2J5OA 2A6EF 5H20A 4I0BA 5D5XB 4RB3C 4DNCA 3LQQA 4PGHA 2Q2EA 4PCQA 5CVJA 2QBYA 3FF5A 4KT5C 3KCCA 2TDXA 3F6VA 1CF7B 3LAJA 3G73A 1O3RA 3E97A 5ICCA 3V7RA 1XGNA 1ZARA 3O2PE 5DCMA 3W6KB 3COAC 1ZRCA 4M9XA 3FZVA 2HDCA 4Y15A 4WK8F 2M8EA 2P5LC 5IT9Z 3WTUC 5BS6A 5ICFA 3GF2A 2FRHA 2MLGA 4HF2A 4IVNA 3WE2A 1K7AA 1KQ0A 2IW5A 2X0LA 3TDZC 4YG2F 3WTTC 2GIVA 4M9ZA 3J80K 1R1VA 1ONVA 2KRFA 2H94A 3DF8A 2ETHA 2M87A 3HRUA 2PMUA 3EUHA 2ZFWA 4HLXA 4LJZF 1DPRA 3F8NA 2XVCA 4MHGA 1KA8A 2HR3A 1D8KA 4KYWA 2Z9OA 4OOIA 4UVBA 2NYXA 5CJ9A 5J6XA 1EH6A 2VC0A 1S7OA 1KYWA 4EMSA 5EEGA 1H9GA 5KK1A 3BPVA 3KP5A 1R5HA 2K86A 1BC8C 2LKPA 2OZ6A 1J75A 3C1DA 1R00A 2FMLA 4KUMA 3I53A 1XCVA 1I6XA 3F8FA 1LDDA 1PUEE 1GVJA 1UB9A 2ZMEB 1O7FA 2DTRA 3R0AA 1ZAOA 1X3UA 2M45A 1G3TA 3MAJA 5CVRA 2V1XA 3ABUA 2F5FA 2O8XA 3ZMDA 3MZHA 5BPIA 1BOAA 4EM0B 4H0EA 3FM5A 3TDUC 3TKYA 2M1BA 3IWZA 3LA3A 1FY7A 2FQ3A 3P9CA 2BE5F 3M7GA 4HX7A 3TO9A 1J9IA 3RDIA 3T8RA 2QENA 1L3LA 2FBHA 5JR3A 1FWZA 5L3BA 2DW4A 4HX8A 1FPQA 3R6SA 4O3MA 2ESNA 3T5XA 5DUKA 5L3EA 1B9NA 3BJ6A 1XGMA 1FLIA 1F4KA 2VBWA 2VT2A 1KGSA 3HUGA 4AVPA 4U88A 2WWYA 3DFGA 1USTA 3ECHA 1WSUA 4KN7X 4EM2A 4UV8A 1YW9A 1LDJA 3ZMVA 4WXHA 2NAZA 3HSFA 4MEXF 2O03A 4KDPA 2X4HA 3I4PA 1V3FA 5TJJA 2R7DA 4M9SA 3O6BB 1XMKA 3WTVC 3CUQA 3FMSA 4XSXF 2O61A 4HF1A 2ADUA 4TV7A 2BGCA 4CDGA 3LQRA 4B09A 1OMIA 3EYYA 1LJ9A 1RUNA 5ED4A
chains in the Genus database with same CATH superfamily
1P9QC 1MBKA 2RVCA 2PJRB 1ZG3A 1S3JA 4WXCA 2ZMEA 2QQ8A 2G9WA 4M3GA 3RYRA 1FTZA 2VKHA 3VODA 2PX9A 1QBJA 3AAFA 3TGNA 5LEJA 1JUMA 3TBIA 5JI6A 2L4AA 2AXTC 5FROA 3VSLA 1IUFA 4XN3A 4XNFA 2IRFG 4XOTA 2LG4A 1BBYA 4QLCU 5J47A 2D1VA 3DBRB 2FJ1A 3ZMSA 4ZTFA 5K5RA 3GLXA 2XGDA 1F5TA 2L02A 1X2MA 3TO7A 4DYRA 2VIXA 4M3FA 1DUXC 3ELKA 1IDYA 2ISYA 4CHUA 3IH4A 4Q5SF 1KU9A 3JW4A 3LSKA 1V55H 3Q5FA 1XX5A 2O7OA 1HBXG 2QCOA 3OSFA 2CGPA 3F21A 3FXQA 3BZ6A 2BYVE 2G7HA 3CMMA 4ESBA 4LIVA 1YE9A 3CDLA 2KQRA 3GTMJ 2NXNB 1MZBA 2Z16A 1KU3A 3L2WA 3CUQB 3JRBA 2QSFX 3Q3SA 2EA2A 2RN7A 2P7CB 1ODDA 5F27A 5L3CA 1AKHA 2HU9A 1JE8A 4JQFA 4L5EA 1R71A 1U6GA 5HLTA 1UAAA 4BQQA 3M3YJ 1VQ8I 2QSGX 2PN6A 2VQCA 4G9YA 1ETYA 4XKWA 4QPOA 3NQOA 5D5VB 3CP8A 3OYMA 2IS4A 4RM2A 2DLLA 1FP1D 5FD6A 3K9TA 2IA1A 1UG2A 3S2DJ 2K5CA 3HL2A 2PQ8A 4HG2A 2ZKZA 3CTAA 2XGEA 1HLVA 2ACJA 2F5EA 1LE8A 5ILVA 3AL0B 1E17A 3CJQB 3FBNB 3PFYA 5AIQA 3SJMA 1W7PD 1U8RA 5K1YA 2O5RA 4IZZA 2CQNA 3RKWA 2DTZA 2XAQA 2L7ZA 3J80Z 1PYVA 5GAEJ 2X6YA 2WAEA 2O8KA 1VQPI 5EJCA 2R3SA 1DU0A 3BQYA 3P5JA 4XKVA 4L9JA 2E1MB 4BEHB 1S9HA 4C3IJ 4XLPF 1SAUA 5IY5H 2GQQA 2KIQA 4KITB 1B6AA 1WFXA 3P9IA 4A3MJ 2IS6A 2G7UA 1XSDA 1FT9A 4DZPA 1NH3A 3LNQA 3SFZA 1MMSA 2FF4A 3FK7A 4CCMA 1VQ5I 5M3MJ 1T98A 2VXDA 2MD5A 3U1DA 3PIOF 3MQ0A 3IP4B 4IL6C 2EZKA 4DZJA 2KT0A 2STWA 2QYOA 3CC2I 2HKOA 2W25A 5EF6A 4IKFA 2R5YB 1P4WA 5BPDA 2DYRH 4EEFG 3S32A 2DK8A 1A35A 3RPUD 1I1SA 3KPHA 2YPRA 3S17J 2HOSA 2IS1A 3G2BA 2GA1A 1I27A 2QF7A 3M8FA 4IRHA 3CC4I 4KNYA 3ERMA 2XAJA 2BXZA 2FE3A 4XOPA 1ZG1A 1Z1DA 3DTKA 4NQWA 3BY6A 2V7FA 3UKGA 3V7CA 2DA4A 4RDUA 1PP7U 1HSTA 5BMZA 1G3SA 3PQJA 4NQWB 1ZTRA 1ZRDA 2R7SA 1E2XA 2ZNYA 2PI0A 2LRDA 4IHSA 3BG5A 3WODF 3GFIA 3ZRGA 3OYFA 2FU4A 4XRSA 1HOMA 3AL0C 4K2EA 2BOLA 1Q1HA 3Q0VA 3T1BA 1YIOA 2JVGA 1MBHA 2ZJRF 3MN2A 4XLAA 1YRNB 3K2ZA 2CH0A 3DU6A 4I98B 2HXOA 1M1EB 4L9NA 3SQNA 2KMUA 3HXLA 2LVSA 5E1WA 1G59A 1W1WE 3RCOA 1FP2A 4R79A 2HEOA 4B47A 2F5CA 1BIBA 2EV6A 5EEAA 3ABKH 3KLNA 4M3BA 3D0SA 3PSFA 2KIUA 2WB1N 3DLLF 4B8XA 1TTYA 5HNHA 4M71A 3W2WA 5LHIA 1SD7A 3HOXJ 2E35A 1OKRA 3GFLA 1VNDA 1Y39A 3DEWA 4O5VA 4YIIA 2ELJA 5FFXA 2CG4A 2CQ7A 4G12A 1P2FA 1JXSA 3BZKA 3OS1A 5J8CA 1XSXA 2XUBA 1XDUA 1CF7A 1LFUP 3FDYA 4NC7A 2ICWG 2X1CA 3IRRA 3NEUA 2IJLA 2LD5A 2QUFA 1YIJI 5A2QK 2DPDA 2M7BA 1FYMA 3GTKJ 3AG4H 4EJVA 1R9TJ 2QVOA 3O8HA 4RGRA 4WX9A 1Y0UA 4HV5A 4E7LA 2DU9A 2OCEA 1D5YA 3E5UA 2L4MA 2XAFA 2H1KA 1WPKA 5J1RA 1EH8A 1Z7UA 4L5IA 4F55A 3GEZA 4UB6C 2CO5A 5E8GA 4S05A 1IDZA 4QIWN 2WV0A 1UELB 1AHDP 2DMUA 2HOAA 1FSEA 4N4NB 3HRTA 4E70A 1D5VA 3JTGA 3OYCA 1ORKA 4JBAA 1CGPA 3LSGA 4ETSA 3M4OJ 4BUPA 2V6EA 1WJ5A 3LSTA 4YIFA 2KKOA 2ME6A 3J81K 1LQ1A 4B48A 4W97A 1XTAA 1IRFA 3D5RC 3JRGA 4F7ZA 1H88C 4XICA 1S5LC 2LYCA 4I76A 2R7WA 1T0FA 2E2JJ 2VOOA 2CV1A 2HKXA 5F0HA 3FXUA 3GTLJ 1FZPB 3F23A 1PUFB 3MMYB 4A6DA 3LSPA 2IAIA 1HDPA 4ASNA 5LHHA 3VYTB 3G4SI 1ACIA 3QPLA 4A3JJ 3CCLI 4HW0A 2A68F 4S0HB 3ZQHA 1ZGAA 3H35A 3K0LA 1BI0A 2CFXA 2QGUA 4HSTA 4E7HA 2OQGA 4MFDA 1D0YA 5HLIA 3VEPA 1L0OC 1KU2A 4RAGA 2CQKA 4A3EJ 2TCTA 2PJPA 3OL4A 5KNLA 2QBYB 4MTDA 1S72I 5HDNA 3BWGA 3S2HJ 2E2IJ 1YITI 2Z1DA 3HKZA 2YUSA 5KHDA 3BPXA 3K1MA 2M4GA 3JR9A 4KISA 1JTYA 4MNUA 3UNGC 4RAFA 2BBYA 1TQIA 4G8XA 4DIQA 3RZOJ 2Y0MA 4ON0A 3BTIA 2CQQA 4EJTA 1XMAA 3WU0A 2LSOA 1MD0A 2AQEA 3BJAA 2W7NA 2XSDC 1A36A 3LOCA 2W84A 3KEOA 3I0TA 4YRVA 3L09A 5HS9A 3IKVA 4AU7A 4LG3A 1ZHFA 5DM7F 4LMYA 4AD9A 2LKXA 3HRMA 2KDZA 2EV0A 2QQBA 4CGZA 5GP9A 4UUVA 1TW2A 4BXUA 3C18A 4O6JA 4II2A 1HF0A 4IHYA 3HBLA 3QP6A 4YFNF 3I4NJ 1FEXA 4PJNA 4JK1X 3V42A 4YFXF 1TWCJ 2KHMA 2MD0A 5IP6A 2XAUA 2EWNA 1BR1A 2KRHA 4Y33A 1MH3A 4LLNA 3OOUA 4BKXA 2JN6A 4C2UA 3FMQA 3LFUA 3OR1C 4L5JA 2ZSIB 2Z3YA 5H2FC 1Z91A 3WGHA 5AIPA 3NRVA 4NC8A 4WXDA 3NAUA 3BR3A 2LBFB 3KEQA 1OCTC 3FXKA 4DQ2A 4IHXA 2L5QA 2NOJB 3GTJJ 4BEHA 3H9GA 1F1ZA 5CQGA 5D6EA 4Z6YA 3IV5A 1KZHA 1GV2A 2W85A 3OY9A 1BJAA 3ZR8X 1I3QJ 5FKLA 5A2QZ 1BC7C 1RNLA 2Y48A 1U78A 5CQEA 3RKYA 3CUOA 3MVPA 3EETA 4IPAA 4G6DA 3ZN0A 4BYYA 1WWXA 1WH7A 3KZYA 3HJEA 3BDDA 5FO5A 1U9NA 1ERDA 3CO6C 1ZKGA 3ECOA 3BR6A 3FKJA 2BY0A 1R1UA 1U5TA 4CYCB 2WV1A 4F52A 1E3HA 3OYEA 3H92A 4I01A 1FYKA 3V8JA 1HC8A 1G4DA 3DEEA 2VBZA 3I59B 2ID3A 4NHJA 2E71A 2PFBA 4R8HA 3Q9SA 2XGCA 3WE3A 5CVVA 1S29A 4BHBA 5BQTA 4LFUA 2JJ7A 2ZJQF 3KP2A 3E6DA 3V4GA 1YO5C 3A0BC 2NVYJ 2NVXJ 1ZYRF 3JRCA 2BEOA 2KLOA 2LH9A 5E3MA 2DOEA 1HQCA 2K7LA 3HTUA 1O57A 1CQTA 4A3CJ 1DU6A 3DKYA 4IO9F 2XKOA 2HQRA 2JK3A 3HIFA 1XDSA 3K4CA 3KYCB 4XR6A 3ERED 1Z05A 4KN4X 2XDVA 2DFHA 5DD4A 5AONA 2R7FA 5IYDJ 4ZJZA 4J19A 2RNJA 2A6TA 1UHWA 4GCVA 2Y31A 2DT7B 5GPCA 2VODA 1T33A 2ZXJA 3S1QJ 4B1RA 3E7LA 1YYVA 2XROA 3A03A 2M34A 4XRFA 5GPAA 5ICGA 1SFXA 2R7QA 2Y0SN 3HOSA 1KONA 3FKIJ 2E36A 4IRIA 3GTQJ 4AC0A 3VPRA 3W6VA 4M6XA 3BP8A 1IF1A 4GFBA 1TQMA 3L00A 3V8LA 1TZLA 1XB4A 1BW5A 3P9KA 2VC1A 3E6BA 3VYRB 4ENJA 3E0JB 5IOZA 4XM3A 2VKDA 1FX7A 2IA0A 3I59A 1WCMJ 3KZIC 5IYCJ 3IL2A 2JA7J 2PG4A 2XASA 4BE0A 3WTYC 4PSWA 3QPHA 3S3NA 5LRRA 2LKSA 2XGXA 2DFEA 2A61A 1DGWY 4AWXB 2A07F 5H6RA 1D3YA 2P0WA 1UMQA 2FNPA 3DKXA 4N9HA 1J59A 3ZQQA 4BJ5C 4EV0A 4S04A 1FBSA 2ESHA 1BW6A 2L9NA 3WHCA 4EJUA 2UV1A 2NVQJ 3P7NA 4MIMA 4UXNA 1FOKA 1MW7A 3DPLC 3ZMUA 2FNAA 3JSPA 3BG6A 4U0VA 1AA7A 3REOA 1Y8QB 4D5CA 1JKRC 3FM3A 1F9NA 3GZ6A 1DGRM 5E1XA 1V5EA 4X0GA 2BXYA 2OPTA 2CV2A 2E34A 1EV7A 2R7XA 4GO1A 3OIQA 1FOYA 2HQ5A 1XS9A 2B63J 2VBXA 1SFOJ 3DQVC 1X1AA 1O3SA 1D0XA 4B3XA 3BG3A 5L3FA 2NS0A 4FQGA 4HYEA 3V7SA 1ZRFA 5IPAA 4ITVA 2X85A 5HS8A 3AKZA 1BR4A 5ILUA 3ASNH 2Q0OA 1STZA 2QZ8A 4IXAA 4EVIA 4MO7A 2CYYA 1IJWC 1HDDC 2E5ZA 3QAHA 4RAZA 3LWFA 5HLGA 3L9FA 2X48A 2DJIA 3QODA 5DEQA 4D1QA 3OYGA 4L0ZB 4ANJA 3OYBA 1YRNA 1N77A 4F91B 3GCMA 2UWMA 3HC7A 3K1PA 3S3OA 1T39A 5F6FA 2HNHA 2F6CA 2XRLA 3WGGA 3HHGA 1IN6A 1SD4A 2NOGA 2VONA 2GWRA 1JHFA 2W82A 3BROA 2IPQX 3CJTB 4U7DA 3ZXSA 2OU2A 1Y1WJ 2CSOA 2E7XA 3AG3H 2LOOA 4OINF 1QQIA 2UXXA 3ML6A 1ETOA 5FGMA 1G3YA 4BGDA 3CC7I 3A2KA 2DT5A 2CFOA 2EFQA 4E7IA 1FSHA 4QSHA 1J7KA 3QYBA 2O0YA 5J3LA 3LSJA 3O3KA 2R92J 3GTPJ 1E3PA 4Z2YA 3ZCOA 2EBIA 2ZBKA 3X2QH 4CICA 2R5ZB 3K70C 3R60A 2R7OA 3ZQ7A 2F5DA 2OCCH 4BL0B 2F5VA 1ETWA 1Z6RA 2I8DA 5FRNA 2LK2A 5DD8A 2Y2ZA 1O7LA 2CRGA 5JLXA 1IRGA 2EIMH 1R7JA 1IXRC 2JUGA 3J81Z 1JHHA 5K5QA 3ABTA 1P4AA 3CCUI 2P6SA 5LEKA 2RREA 2ZB9A 4X1EA 2VB6A 1A04A 1VF9A 3HKZN 2K4BA 3LSHA 2BHZA 2VJJA 2QKMB 1X3WB 2HYGD 4BNCA 4UUSA 2A5YB 1IO2A 4CA0A 5L3GA 4W1UA 4FX0A 1TLHB 4DJAA 3HSRA 5K5OA 2M7AA 2VJ5A 4PJLA 2CUEA 4RBOA 2HTJA 3IRQA 5BOXA 1JKOC 1EKEA 3FXRA 1W5CC 2JPCA 3WTXC 3GTOJ 3MKZA 1BI1A 3F3XA 1H8AC 3KE2A 3KP4A 1MBGA 4KMUX 2CV0A 2EK5A 3RSNA 3OL3A 3FMRA 3TOAA 5D8KB 3CLQA 3PFIA 2V9PA 1OLTA 3FX3A 2XIGA 5DS9A 2GAUA 4C9YA 3EQLF 1GXPA 1K83J 1POGA 5B5EC 1FJLA 3VWBA 1G8XA 1YJWI 2OUMA 1REPC 2PJRA 2AO9A 4AIDA 2D2WA 3CCSI 3OWTA 4BQAA 4NBQA 2Z5UA 2GXGA 1SVOA 2BY2A 1JJ6C 1ETXA 3G71I 4RAYA 1JUSA 5DCMB 5FLVA 3KLOA 2IXSA 5IT9K 2EZLA 1MJAA 3JTHA 4Y4RA 1LB2A 1IV6A 1DPUA 2EFPA 1JT0A 5HVQC 2L9RA 4C3JJ 2RQQA 5IOYA 1OQYA 4FX4A 4JP0A 5JVGF 3HGYA 4FE7A 1BOBA 3MD2A 5GAGJ 2OC6A 3JRDA 2I10A 5F64A 2HI3A 2BV6A 2QEXI 1SFEA 1WQ2A 3DPTA 2Y9ZA 4YEJA 2DFIA 2R7UA 4CZCA 3QOEA 4A5MA 3HEFA 4LOCA 1LFBA 1X1BA 3TEDA 2GZWA 5FLXK 1UCRA 3CP2A 1J5YA 2WA0A 3FBIB 3LA7A 3SYTA 1X1PA 3GW2A 5E18F 4G7ZF 2KJBA 2HXIA 3BTLA 2E1NA 3LA2A 3Q9VA 4CYCA 3HM5A 1U3EM 1OCPA 4PZJA 5DCFA 3ZP5A 4N4OB 2DDBA 4ESJA 1JTXA 3A1YA 1QHGA 2ELHA 3ABMH 3PQKA 3CCJI 4UVAA 5JVTA 4I0AA 2RKHA 2FOWA 1HKSA 2XB0X 3BTCA 4M3EA 2X6XA 4R1HA 5D6FA 3HSEA 2XPUA 1TWHJ 1R22A 3G1OA 1UHSA 3HHHA 3MKLA 3IC7A 1YJ9I 1VQKI 4WF2A 3BTJA 1MMGA 5D4RA 1QZZA 2A6HF 1R5GA 4A69C 2RDPA 3CMYA 2IGKA 4XL9A 3TW7A 1A31A 2XRNA 3LMMA 4PK4A 4IF4A 2LBFA 4QTRA 1RUOA 3ESWB 2YS9A 2R4GA 2NVUB 2E7WA 3K4LA 5KVRA 4B44A 1VQ4I 2L2OA 3ZPLA 3CUQC 1IN5A 2F4OB 2OBPA 4FHTA 2LLKA 2FQ4A 2GXAA 2K27A 3AG2H 4KIGA 1FBQA 2YX4A 3K69A 1APLC 5M3FJ 2MH9A 5JFRA 1YW7A 2H09A 2XAHA 3GBGA 4LK1F 4CCOA 1HA8A 2UZKA 4N9IA 1K61A 2JA5J 2HYJA 3V8KA 4BBSJ 3DBHB 1K6OA 1QRYA 4ZYGA 4RLFA 1NK3P 2W24A 3KFWX 1ZREA 1U5TB 5LHGA 1NTCA 1P7IA 5F04A 4UUSB 2FXAA 2F48A 4D0PA 2XPWA 4HLYA 3RYPA 1O3QA 2L3DA 2GIZA 3WTSC 1MNMC 2CS3A 4M73A 5HS7A 2P8TA 3DCFA 3GFJA 2IA2A 4HV6A 3GWZA 1HW2A 2CQXA 3FXLA 3S1RJ 1SMTA 2RAEA 3IUOA 1BM9A 3E5XA 2KZVA 3HTSB 2L01A 3EPZA 4MGRA 1W36D 1XN7A 2KJCA 5TGTA 3TP3A 1QGPA 2R7ZJ 3W3CA 2IGOA 2KL4A 3LAPA 2AS5F 1OYIA 5IT3A 2HYFA 1WGXA 2JSCA 3CJNA 2MLKA 5EG0A 2BW3B 5LBQA 4MQVA 2EIJH 1B8IA 1K78A 3I58A 4BXFA 2E1MC 2X1DA 2F2EA 2JQ7A 4BDZA 1TWFJ 2EINH 3ZQFA 2NVTJ 3F9KA 4PJMA 5B3SH 1FIAA 4ZYEA 3H5RA 3PM1A 3JRAA 2L9VA 1FYLA 2JUCA 1RR8C 2VKEA 2MC3A 2OAZA 5CKTA 4XBFA 5EDNA 2CW7A 1WKMA 2K4JA 4AYBA 4L0YB 4ZDPA 1Y56A 5J4YA 3QU3A 3ROUA 5D5WB 4LB6B 2M30A 5DYMA 4DGWB 4CXFA 4IOAF 1A6IA 1JGGA 1KQ9A 3H36A 3OYNA 2JRTA 1R36A 2YR2A 3IWFA 1ZR4A 1P92A 1VZ0A 1TNTA 2DMPA 2P5VA 3GTGJ 2E19A 1BIAA 2KZGA 1ZGWA 2EJRA 1SAXA 1G2HA 2IGMA 2RV8A 1Z9CA 5FD5A 3QPTA 3ZQLA 2DQLA 3LSIA 1QU3A 2KISA 4BACA 2QQAA 5J8FA 1EF4A 1GXQA 2LNBA 4V19K 1DP3A 4ZYDA 3H5AA 3S1MJ 1SVLA 4C2MJ 2UUZA 3H0DA 2A69F 4UB8C 4A3BJ 3HUGB 4L9TA 3VB2A 3OYLA 1P6RA 1R49A 6PAXA 4XSZF 5E20A 2LP0A 3MZYA 4HNTA 2X1EA 1AOYA 3SDGA 1XPXA 3HOWJ 3E6CC 1ZG5A 1Q1VA 1W5SA 4LD5A 2FSWA 2QM3A 1W0TA 4AIJA 4BE2A 1EH7A 1LEAA 3U2RA 2HFHA 3DPUA 2DOAA 1ZLJA 4GYIA 3DKWA 2VASA 4MTEA 4EQQA 2PMZN 1OCOH 5F1JA 3DWLE 1ETQA 2NS7A 2V6CA 2DI3A 3I9V2 3PO2J 2VPRA 3OYDA 3FIWA 3UR3C 3FHZA 3F8MA 4KICA 2A05A 2EZIA 4A3IJ 2B0LA 4IHVA 2EFOA 3RPUA 1A6QA 3U1KA 3MWMA 1I50J 2GA2A 5CVUA 4M6VA 1YS7A 1VTNC 2KDOA 3Q0UA 2VN2A 1OISA 1SFUA 1E0EA 1VI0A 3ZOBA 4AM3A 3LSRA 2XV4S 3J7YJ 4Q4ZF 5K7ZA 2JT1A 3FHNA 3S8PA 1T56A 2DYSH 4ZH4F 4RA2A 4NUBA 3KP7A 2DA1A 4FT8A 5DM6F 4D9JA 3WU2C 2BVMA 3F6OA 1LVKA 1ON2A 1RZ4A 2MFZA 5E1ZB 2DN0A 1XGOA 3OIOA 3GZNB 1MBEA 2IP2A 2MH2A 3I54A 3OYHA 3DTIA 5DTDA 3OSGA 2HS5A 4XLNF 2WBMA 2COMA 3SEQA 3RTRA 3GFMA 3ZMTA 3GO5A 3S1NJ 1B4AA 4BS9A 1U9OA 2VOPA 1XSVA 1WJCA 5ERIA 2JMWA 3ISPA 1YHQI 2PLYA 3DLAA 3VYSB 4U87A 2P7VB 3RKQA 5CLSA 1PJRA 1K4TA 1WJDA 3S3MA 3CESA 2VI6A 1Z21A 1QVTA 2WTEA 4HOBA 1VQOI 1IN7A 3D1NI 3K6GA 3H3UA 3RIRA 4CSWA 2V1NA 1WJFA 1WRJA 4XQFA 2ZNZA 2GOMA 4OIPF 2ZO4A 2E60A 2DPUA 3RPQA 4A5NA 2MSYA 5L3DA 3J7AY 2PMZA 2LF8A 4P55A 2MA3A 2FX0A 4GXOA 1X1DA 4A12A 4Y52J 2FEZA 2K9LA 5EZGA 5HODA 1S8NA 2JA2A 1I39A 1KYZA 2DA7A 4HX4A 4XN0A 5LLQA 5JHUA 2E1CA 1G3WA 2DDAA 4D7MA 5ICEA 4IX7A 2QLZA 9ANTA 3NWSA 3R61A 1BN5A 3GXOA 3I71A 2PBIA 5F0FA 1HW1A 4BHPA 4LIUA 2BW3A 2R7VA 5J40A 2B9SA 1ITYA 3PUBA 1OFCX 4G7OF 2V9VA 4E7SA 3H9QA 2H6BA 2K3FA 3F8BA 2LY2A 4C30A 2VE9A 3BC8A 3M8EA 2E1OA 2F4IA 4IEJA 2GOXB 2LY1A 1U2WA 4I02A 2ZSHB 5HLHA 3CCEI 5EGOA 2HTSA 2HPIA 2D1HA 3WTWC 1GT0C 1H89C 1UZCA 1MJBA 2VBYA 4Y17A 3IKTA 3GUDA 3MFKA 1RIOH 2M9HA 2VT3A 1IC8A 2PEXA 2XF7A 1NG6A 1NK2P 3HOZJ 4OIQF 3M9AA 1X4OA 1JUPA 3M1CA 4RB1A 2DQRA 4JX6A 2AHQA 5KAIC 3ZN1A 1XCBA 1YW8A 4BY1J 1KQ8A 1D0ZA 1SD6A 3VDXA 4ZZLA 1D8JA 3F8CA 1FC3A 3DTEA 5J4VA 5J1UA 5LGNA 1HW5A 2K9SA 1QNTA 2K02A 4OMYA 3TQNA 2NNYA 4A3KJ 2TRTA 3AG1H 2H6CA 4EM1A 2ZCWA 2Y69H 2JPBA 3CCVI 3K4BA 2Y0SA 4GGGA 3PO3J 2VUMJ 4BJTA 1IN8A 4KIFA 2EA4A 5FFZA 3TP0A 4ENKA 2NS8A 1K6YA 2QWWA 2OTJI 3QWLA 2DMNA 5EEHA 1LUJB 3HG9A 5D4SA 3H0GJ 2LF7A 3ZMZA 4CO8A 1WJEA 4MLOA 2K3PA 4P5OA 5DV5A 4DYQA 3CLOA 2LTPA 2QQ9A 1FNNA 1TC3C 1UHMA 2V1DA 3D5LA 3NWTA 3TMOA 5LRSA 4OIRF 4PFOA 5HNFA 1RKTA 3KP6A 5K7FA 1D1AA 3BR0A 3L1PA 1YLFA 4AVZA 1BI2A 1B8IB 2F4MB 2KIFA 1SC7A 1ENHA 3VYUB 1YTYA 1LE8B 2AXLA 3TOBA 4E6KG 4KA4A 1KU7A 2HVSA 5LGUA 4FTHA 1MMNA 3EUAA 2O9LA 4OIOF 3SZGA 1G6NA 2HGCA 4LLLA 4HDVA 5DUIA 4ENMA 1HKQA 1P7JA 1WH5A 4KMFA 3OOPA 4BAYA 1LNWA 2UXNA 1S7AA 4I6ZA 1JGSA 3S2WA 3B73A 3WU1B 3BT9A 2IGNA 4G94A 5C3EJ 1JT6A 2W1OA 3WTZA 4CCKA 3R0JA 4HA8A 4HDUA 3BQZA 2L9SA 1RC9A 3KP3A 2MGQA 4QWQA 1OPCA 1U5TC 4XK4A 1OCCH 1IN4A 1ZGJA 2KFDA 1E3OC 2R5YA 4IHTA 2CJJA 2EFWA 3VSKA 1LVAA 2HVRA 3DEUA 3JAMZ 4B4CA 3J7AO 1FBUA 2J5PA 2V79A 2LMDA 4LLGF 2EZHA 2OZUA 1QZYA 5GAHJ 2EV5A 4Y3OA 1IRZA 4AIHA 1X2NA 1IUYA 2OQRA 1DDNA 3HOYJ 1J0RA 1EJ9A 1B59A 2H8WA 4P9FA 4D7NA 4OMZA 3I64A 1TL8A 1J2XA 1SANA 2OA4A 2DBBA 1W5TA 4P9UA 2AQFA 1ZR2A 1W7PA 4LG0B 1Z6TA 4LG0A 4M74A 4HEA2 5EG0B 4B43A 4FCYA 5HOOA 2B7EA 2MYSA 3BR5A 2K9MA 4U0YA 5H6QA 3DP7A 2BHYA 3H3ZA 4BHCA 2KIMA 4CCLA 4IQJA 2JRMA 2MBFA 1QHHD 3ZQGA 4M6YA 5E3NA 1ZQ3P 4EGZA 1N25A 2HDDA 2YSRA 4ESFA 4BJ6C 3QU6A 5F1RA 4HBLA 3VFZA 2VE8A 1W36C 3QQAA 1SEUA 3GX4X 1ZH5A 1Y6IA 3CDHA 1Z77A 5CYVA 4PJJA 4BBRJ 2DFFA 5EYRA 1K79A 2MABA 2M3AA 4H4KC 2M5WA 1SFKA 2IEKA 4EJWA 5C4JJ 1QPMA 4BQNA 1HXDA 4XRMA 3GLLA 3MCZA 4A93J 2DK5A 3K70D 1MMAA 1WI9A 1Z3XA 2CMPA 4D5FA 3K1NA 2XKPA 4EATA 3W2AA 4C3HJ 3DV8A 4Q47A 1OR7C 2FA5A 3B6CA 4CCNA 4JYKA 1RRJA 1MH4A 2R5ZA 2XHKA 2X51A 4CYDA 4I2OA 1VQ7I 2DA2A 1Z7LA 3KZZA 3CCYA 1IAWA 1OCZH 4UHTA 5F0CA 4A6EA 3SDBA 2WY8Q 2KPMA 2L7FP 4PJ0C 1SMYF 1R23A 3IHUA 3GVAA 1GLNA 2XSJC 1B72B 1ULYA 1QO0D 4HQMA 4L9VA 4CUGA 3L2VA 2DOFA 3WGIA 3ZGKA 4RLQA 2DMQA 3K4JA 4CZZA 1Z67A 4X6AJ 4P96A 2K85A 5FLMJ 3IH2A 1O3TA 2NNNA 2NRAC 2C6YA 2ZJ2A 1VQMI 1W7PB 1VQ6I 4P1WA 4DOZA 2STTA 3RQIA 1RPWA 2W48A 4ZYHA 1EA3A 4A3DJ 3BR1A 4HNVA 3N4MA 4UNOA 4IRGA 3GYHX 2HQNA 1U8BA 4RS8A 3LSMA 5FKOA 1Y0NA 4GYGA 2ZMEC 3SZTA 2L7KA 4A2UA 5B66C 4BXXJ 3BCBA 1R6RA 1DP7P 4IQ4A 2IVMA 4AIKA 3HZJA 5HDGA 3FXMA 4Y13A 2WY7Q 4OAZA 1X4PA 4RGUA 2WC2A 2LC2A 2JTVA 2GM4A 4U7BA 1TQPA 3PJRA 1XD7A 2L7MP 2ZFUA 3QYFA 4BH9A 2EFNA 2VLAA 1LPQA 5FKKA 1ZELA 5E17F 2Q2EB 1XMXA 2O3FA 3OR2C 2MW8A 1JI8A 2GBYA 3HYIA 3RI4A 4HAMA 2ID6A 3PUFA 1OCRH 4M72A 5E8IA 4HNUA 2XPVA 4HF0A 3I3LA 2LR8A 1ETVA 1IV8A 5KAFC 2Y75A 2FMYA 2FBKA 1TWGJ 2JZYA 2FBIA 4HZFA 4I99C 3K4NA 4XRSG 3TW6A 3H9JA 4YFKF 1WVRA 2W4SA 2LY9A 4IJAA 4IOCF 4L18B 5GTHC 3OYAA 2EILH 2PMHA 4MQ9F 2VQHA 2VXZA 4B3AA 3QYEA 3MKWB 5FKNA 1YOVB 2O6GE 4JX4A 5ILSA 1S6LA 2EPFA 1GV5A 4I7HA 1T08B 1AWCA 2P4WA 3ULQB 2VQGA 2P6TA 1RI7A 1WJBA 2EIKH 2WAQA 2Z33A 1OYWA 4GDFA 3I4MJ 1NHAA 1YG2A 3IH3A 3JAMK 4EJOA 5TRDA 3PSIA 2QSHX 2HPMA 3EUKL 2CUZA 3BLYA 3E1SA 1J09A 1YFHA 4DBQA 1T2KA 2ECBA 5EZHA 1T38A 5HDKA 2LREA 2H27A 1IG7A 2LDUA 2D45A 1MDMB 2VKVA 1RR7A 1PDNC 2X6WA 3SFIA 1ZN2A 2RC4A 3JREA 2CWEA 3EUHC 2HZTA 1X58A 2MG4A 5LGTA 3B02A 2FUG2 4MFEA 1X3ZB 2X6OA 2M0MA 3L2QA 1P4XA 5D5UB 2EB7A 2EQRA 4OWRB 1C0WA 3VOEA 3MKYB 1LEBA 4N0BA 3CCRI 4XORA 1IZ1A 4UY8I 3OV8A 4KFCA 3TO6A 3OYIA 1MNEA 3CCQI 3OS2A 2JA6J 1MGTA 2Z99A 4A0ZA 3WG9A 2GXBA 1V4RA 4PGGA 3I5UA 3KYLA 2HOTA 1USSA 1R1TA 4NC6A 1YS6A 4WCGA 3HOVJ 1U0JA 2XAGA 2R7RA 1R58A 2VJIA 1VQ9I 2L54A 1VFCA 2R7TA 3SHFA 3CO7C 3MEXA 4OAYA 3HRSA 3W6JB 1QZEA 1YX5A 2P81A 4LGWA 2P5KA 1B1BA 1OYYA 3J7ZI 3RJPA 2K40A 3GMEA 2W57A 3PNVA 2Y30A 4HQEA 3HGGA 3E5QA 4PDKA 1TNSA 5F08A 1MDMA 4I09A 2VQLA 2FOKA 4HSRA 4XLEA 1XGSA 2Q8KA 4OU0A 3C7JA 2K9NA 3T0YA 3LL7A 3L2UA 4DYCA 2ISZA 1T6SA 1SD5A 2M8GX 3FXOA 3H1CA 4G7HF 2XC7A 3BG7A 2Y9YA 3LFKA 1MJ9A 1I5ZA 4F92B 2V9KA 3C2BA 4EGYA 4A0YA 3L2CA 3QP5A 2L0KA 1VQNI 2ELKA 2ECCA 5M5WJ 5CVIA 1K4SA 1K78B 1RESA 4LB5A 3C3WA 3R4KA 3K4MA 1LFPA 3HOTA 4E7JA 1FTTA 5FLXZ 1IXCA 3I55I 4J00A 3K10A 2CUFA 4RGSA 1PVEA 3GZ5A 4MEYF 3A01B 2E2HJ 3HDDA 2ZXWH 1TT5B 4KIBA 3E3VA 2FD5A 2RNGA 1D1BA 2A3SA 3SXYA 1TW3A 1MMDA 3QRFF 4U0WA 4ZDLA 3FISA 4E7ZA 3E6MA 4RGXA 3A0HC 4NB5A 1AKHB 1WZ2A 3G3ZA 5DDGA 1I1GA 3SZPA 2HOEA 1W0UA 3PNTA 3G6EI 1B9MA 4A3FJ 1ON1A 1IW7F 1N78A 2ZJPF 4HRIA 4AYBN 2ME0A 2ZXIA 4XIDA 2RGVA 5FB2A 3T8TA 1IXSB 3S15J 1MSEC 3F22A 3CMAI 3HOUJ 3U9GA 2IT0A 2V1UA 4Q48A 1H0MA 3L7WA 1LDKB 2DT6A 2ZXHA 1BI3A 4ZC3A 1GVDA 4FE4A 4G6QA 4WWCA 2CW0F 3JSOA 1PP8F 1YX3A 3OIPA 1XG1A 2YU3A 1TBXA 2Q1ZB 3CD6I 2VL8A 2HWVA 1I6HJ 2V4JC 5M5YJ 5M5XJ 2OD5A 1FIPA 5IYBJ 1WJAA 3F72A 1MSFC 2YX7A 3FK6A 4FETA 4UVCA 3AFHA 3N97A 3OYKA 2RQPA 5IP7J 2OF7A 2IS2A 5EGOB 5B1BH 3KETA 2OTLI 1VQLI 2DA3A 4XMYA 3JRIA 1ZLKA 1H9TA 1HSJA 3L2RA 4RB0A 2DO7A 1DQUA 3H5NA 1UFMA 1YQAA 2XF5A 3CDIA 1GDTA 5E3LA 1GHCA 1R4NB 3FWEA 3EDPA 3RKXA 2V26A 4UV9A 4DBRA 2BY1A 4ZZDA 4RB2C 1HKTA 5C4XJ 5TISC 1V54H 3EYIA 3BOQA 2OJED 1OR7A 1W4MA 3SEZA 2WAFA 2R0QC 4NDLA 4A3GJ 4A0XA 1FOWA 3BJOA 3M1EA 4LK0F 5BNGA 1MKMA 2WADA 1RETA 3D5SC 2DAOA 5D8LB 4ZTJA 3CJRB 2E5NA 3DXJF 4ENNA 1TT0A 3QOPA 2J5OA 2A6EF 3W2VA 5H20A 4I0BA 1S7EA 5D5XB 4RB3C 4DNCA 3TL4X 4FASD 2GLOA 3KEYA 3LQQA 2XF6A 4PGHA 3HPHA 2DMTA 1X19A 4ZDOA 2Q2EA 4PCQA 5CVJA 4ABZA 2QBYA 2VPLA 3FF5A 4KT5C 1QPIA 3G1MA 1T0FC 2VJ4A 3A4CA 3KCCA 4II3A 2TDXA 3HB9A 3F6VA 1CF7B 4JOMA 3LAJA 3G73A 1O3RA 3E97A 2G0EA 5ICCA 3V7RA 1XGNA 1MIJA 5JHFA 1NG7A 1ZARA 3O2PE 5DCMA 3W6KB 3COAC 2QKLB 1V5FA 1ZRCA 3B6AA 2D5VA 4YELA 2MC4A 1T95A 3DU5A 1MBFA 3G1LA 5FRMA 4M9XA 5GADJ 3FZVA 1FOXA 2HDCA 1ZK8A 4Y15A 5FKMA 4CCJA 2OV7A 4WK8F 2M8EA 2P5LC 3JRFA 1T8IA 5IT9Z 5BS6A 3WTUC 2H1LA 4RM3A 5ICFA 4YIRX 2WB1A 3BCAA 3GF2A 2FRHA 2MLGA 4HF2A 3RQ4A 4IVNA 3WE2A 1K7AA 4F3QA 1KQ0A 3S16J 2IW5A 2X0LA 3NARA 3TDZC 4YG2F 3BZCA 3JCUC 3CQZJ 3WTTC 2GIVA 4M9ZA 3S93A 3J80K 1R1VA 3PNYA 2BY3A 1ONVA 4RMNA 2KRFA 2H94A 3DF8A 2ETHA 2M87A 3OYJA 3HRUA 2PMUA 3EUHA 4PUSA 2DODA 1BA5A 1MNDA 2ZFWA 4Y7NJ 3CF5F 3ZQIA 4HLXA 1F43A 3A02A 4LJZF 1DPRA 2XB5A 2A5WA 2XVCA 3F8NA 2H8RA 4MHGA 1WI3A 3WHBA 3FXJA 5LFAA 1KA8A 2KRCA 2HR3A 1D8KA 3M8JA 4KYWA 3ASOH 1OJLA 2Z9OA 4OOIA 4UVBA 2NYXA 2ZC2A 3N05A 5CJ9A 2HDWA 2KP6A 1R5ID 5J6XA 1AU7A 5JLWA 2QA4I 3BR2A 1EH6A 1V5GA 2VC0A 1TWAJ 4LITA 1S7OA 1KYWA 4EMSA 5EEGA 1H9GA 5KK1A 3BPVA 4KT6A 1YI2I 3KP5A 1R5HA 4NNJA 1IGNA 2K86A 3F0CA 4ZYAA 1BC8C 4BY7J 2LKPA 2M4KA 2OZ6A 1MBJA 3ABLH 2BZTA 1J75A 3MZ8A 3C1DA 4M3DA 1UJ8A 1R00A 4CH7A 1A5JA 2FMLA 4KUMA 1I3AA 1Z0XA 3I53A 1N75A 1O4XA 2CUJA 1XCVA 3BG9A 1I6XA 3O8GA 4HPQA 4PSXA 4F93B 3ONQA 3F8FA 2EH3A 1LDDA 1PUEE 1GVJA 1UB9A 2ZMEB 4PFPA 2JA8J 1O7FA 1FMVA 1Z3YA 2DTRA 3R0AA 4BU2A 1ZAOA 1BR2A 4XLFA 1X3UA 1WHUA 2M45A 1JJ8C 1G3TA 3KX2A 3MAJA 3CCMI 2Z2SB 5CVRA 1ETKA 2V1XA 3ABUA 2F5FA 3HPGA 2O8XA 5LD2C 5GTIC 3ZMDA 3MZHA 2HVQA 4KJZA 4E7KA 5BPIA 1BOAA 2DCEA 2JWTA 1B72A 4EM0B 4V2FA 4C2TA 4H0EA 3OMYA 2DXIA 2M0CA 3FM5A 3TDUC 3KYDB 3TKYA 2M1BA 3RZDJ 2DJNA 3IWZA 1LKXA 4G6TB 3K2AA 3LA3A 1FY7A 2FQ3A 2LFBA 3P9CA 4E4HA 3A01A 2DA6A 1UG0A 2BE5F 1TP4A 3M7GA 3DBLB 3IAS2 3IAM2 1QVUA 4HX7A 1XC5A 2BVLA 2JSPA 1BL0A 3TO9A 2JVHA 1Y8RB 5B1AH 5K7HA 1R4MB 1J9IA 3H3VK 2WAQN 1GUUA 3QPSA 3RDIA 2DA5A 3T8RA 2QENA 1L3LA 3OS0A 4GRIA 2FBHA 3K7AJ 4FISA 3K4KA 5JR3A 4XKBA 1FWZA 3CZ6A 5L3BA 2DW4A 4QPQA 3PL8A 4XLCA 3KIOA 5FJ8J 4HX8A 1FPQA 3R6SA 4O3MA 1PUFA 1D1CA 2ESNA 3T5XA 5DUKA 5E79C 4JX5A 5L3EA 1HCRA 3C2HA 1IRXA 1JKPC 4IHWA 1B9NA 2X9DA 3BJ6A 1BJZA 2K9QA 3Q0WA 3CMEI 3CF2A 1XGMA 1Y1VJ 1FLIA 1SVMA 4BDYA 1F4KA 2VBWA 2VT2A 3C2GA 1KGSA 3HUGA 4BQOA 2I5UA 4XLHA 4U88A 4AVPA 4DW6A 2WWYA 3DFGA 3PIPF 1USTA 1X1CA 3ECHA 1WSUA 4KN7X 4A3LJ 2CU7A 4BE1A 4EM2A 4UV8A 5KCMA 5C44J 1YW9A 4AUXA 2HZDA 3M07A 2N8GA 1LDJA 4UUTA 4XONA 3ZMVA 3U21A 4V2GA 2M2EA 5IP9J 4WXHA 2NAZA 3HSFA 4MEXF 2O03A 3I4PA 2X4HA 4KDPA 1V3FA 5TJJA 2R7DA 4M9SA 1F36A 3O6BB 2HQAA 1XMKA 3WTVC 2CW8A 1RKWA 3S14J 1JKQC 3CUQA 3FMSA 2R93J 5E3OA 4J01A 2W00A 1FMWA 4XSXF 1YJNI 2O61A 3I56I 3JRHA 1QA6A 4HF1A 2COBA 2ADUA 3WG7H 4TV7A 2BGCA 4CDGA 3LQRA 3ZQCA 4B09A 4XKCA 2IBDA 5J1YA 1OMIA 2YU9J 5CPRB 3EYYA 1LJ9A 1RUNA 5ED4A
chains in the Genus database with same CATH topology
2RVCA 1ZG3A 1S3JA 4WXCA 2ZMEA 2G9WA 3RYRA 3VODA 1QBJA 3AAFA 3TGNA 5LEJA 5JI6A 2L4AA 2IRFG 1BBYA 4QLCU 2D1VA 3ZMSA 5K5RA 3GLXA 1F5TA 2L02A 3TO7A 1DUXC 3ELKA 2ISYA 4CHUA 4Q5SF 1KU9A 3JW4A 3Q5FA 1HBXG 2CGPA 3F21A 3FXQA 3BZ6A 2BYVE 2G7HA 4ESBA 1MZBA 1KU3A 3CUQB 2EA2A 2RN7A 2P7CB 1ODDA 5L3CA 1JE8A 4JQFA 1U6GA 2PN6A 4G9YA 5D5VB 3NQOA 2DLLA 1FP1D 5FD6A 3K9TA 2IA1A 2PQ8A 2ZKZA 3CTAA 2ACJA 2F5EA 5ILVA 1E17A 5AIQA 1W7PD 1U8RA 5K1YA 3RKWA 2XAQA 3J80Z 2R3SA 4L9JA 4XLPF 2GQQA 1B6AA 3P9IA 2G7UA 1XSDA 1FT9A 3SFZA 2FF4A 1T98A 2MD5A 3U1DA 3MQ0A 2STWA 2QYOA 2HKOA 2W25A 1P4WA 5BPDA 2DK8A 1I1SA 2YPRA 2GA1A 1I27A 3M8FA 4IRHA 4KNYA 2XAJA 2FE3A 1ZG1A 1Z1DA 4NQWA 3BY6A 3V7CA 1PP7U 1HSTA 5BMZA 1G3SA 3PQJA 1ZRDA 1E2XA 2ZNYA 2PI0A 4IHSA 3WODF 3GFIA 2FU4A 4K2EA 1Q1HA 3T1BA 1YIOA 3K2ZA 4I98B 4L9NA 3SQNA 5E1WA 1FP2A 4R79A 2HEOA 2F5CA 1BIBA 2EV6A 3KLNA 3D0SA 2KIUA 4B8XA 1TTYA 4M71A 5LHIA 1SD7A 1OKRA 3GFLA 4YIIA 4O5VA 5FFXA 2CG4A 1JXSA 1P2FA 5J8CA 1XSXA 2XUBA 1XDUA 1CF7A 3IRRA 3NEUA 2IJLA 2QUFA 5A2QK 2DPDA 1FYMA 4EJVA 2QVOA 4RGRA 4WX9A 1Y0UA 4HV5A 2DU9A 3E5UA 2L4MA 2XAFA 1EH8A 1Z7UA 4L5IA 3GEZA 2CO5A 5E8GA 4S05A 2WV0A 1FSEA 3HRTA 4E70A 1D5VA 3JTGA 4JBAA 1CGPA 4ETSA 3LSTA 4YIFA 2KKOA 3J81K 1LQ1A 1IRFA 4F7ZA 2VOOA 1T0FA 2HKXA 3FXUA 1FZPB 3F23A 4A6DA 4ASNA 5LHHA 4HW0A 2A68F 1ZGAA 3K0LA 1BI0A 2CFXA 2OQGA 5HLIA 3VEPA 1L0OC 1KU2A 2CQKA 2PJPA 2QBYB 4MTDA 5HDNA 3BWGA 3BPXA 3K1MA 4MNUA 2BBYA 1TQIA 4G8XA 2Y0MA 4ON0A 4EJTA 1XMAA 3WU0A 2LSOA 1MD0A 3BJAA 2W84A 3KEOA 3I0TA 3L09A 5HS9A 3IKVA 1ZHFA 4LMYA 4AD9A 3HRMA 2EV0A 2QQBA 4CGZA 4UUVA 1TW2A 4BXUA 3C18A 4O6JA 3QP6A 4YFNF 4JK1X 4YFXF 2EWNA 4LLNA 3FMQA 4L5JA 2Z3YA 1Z91A 3WGHA 5AIPA 3NRVA 4WXDA 3KEQA 4DQ2A 1F1ZA 5D6EA 2W85A 1BJAA 5A2QZ 1BC7C 1RNLA 2Y48A 1U78A 3RKYA 3CUOA 3EETA 4IPAA 4G6DA 3ZN0A 4BYYA 1WWXA 3KZYA 3BDDA 5FO5A 3CO6C 3ECOA 1R1UA 1U5TA 3H92A 4I01A 1FYKA 3V8JA 1G4DA 2VBZA 3I59B 4NHJA 2PFBA 4R8HA 3Q9SA 3WE3A 5CVVA 1S29A 4BHBA 5BQTA 4LFUA 3KP2A 3E6DA 3V4GA 1YO5C 1ZYRF 2BEOA 1HQCA 2K7LA 3HTUA 1O57A 2XKOA 2HQRA 3HIFA 1XDSA 3ERED 1Z05A 4KN4X 5DD4A 5AONA 2R7FA 2RNJA 1UHWA 4GCVA 2VODA 2ZXJA 2XROA 1YYVA 4XRFA 5ICGA 1SFXA 3HOSA 4IRIA 4M6XA 3BP8A 1IF1A 1TQMA 3L00A 3V8LA 1XB4A 3P9KA 2VC1A 3E6BA 4ENJA 1FX7A 2IA0A 3I59A 3IL2A 2PG4A 2XASA 3WTYC 3QPHA 5LRRA 2XGXA 2A61A 4AWXB 2A07F 5H6RA 1D3YA 2FNPA 4N9HA 1J59A 4EV0A 4S04A 1FBSA 2ESHA 4EJUA 3P7NA 4UXNA 1FOKA 3DPLC 3ZMUA 2FNAA 3JSPA 4U0VA 3REOA 3FM3A 1F9NA 3GZ6A 5E1XA 1EV7A 4GO1A 2VBXA 3DQVC 1O3SA 5L3FA 2NS0A 4HYEA 1ZRFA 3V7SA 5HS8A 5ILUA 2Q0OA 1STZA 2QZ8A 4IXAA 4EVIA 2CYYA 3QAHA 4RAZA 3LWFA 5HLGA 3L9FA 5DEQA 4L0ZB 2UWMA 3K1PA 1T39A 5F6FA 3WGGA 3HHGA 1IN6A 1SD4A 2VONA 2GWRA 1JHFA 3BROA 2IPQX 4U7DA 2OU2A 2CSOA 2E7XA 4OINF 1QQIA 2UXXA 3ML6A 5FGMA 1G3YA 2DT5A 2EFQA 1FSHA 1J7KA 2O0YA 3O3KA 4Z2YA 2ZBKA 4CICA 3R60A 3ZQ7A 2F5DA 1Z6RA 5DD8A 1O7LA 1IRGA 1R7JA 1IXRC 3J81Z 1JHHA 5K5QA 3ABTA 1P4AA 2P6SA 5LEKA 1A04A 2K4BA 2HYGD 4BNCA 2A5YB 5L3GA 4FX0A 1TLHB 3HSRA 5K5OA 2HTJA 3IRQA 5BOXA 3FXRA 2JPCA 3WTXC 1BI1A 3F3XA 3KE2A 3KP4A 4KMUX 2EK5A 5D8KB 3FMRA 3TOAA 3PFIA 3FX3A 2XIGA 2GAUA 3EQLF 1GXPA 1REPC 2D2WA 4BQAA 2Z5UA 2GXGA 4RAYA 5DCMB 3KLOA 5IT9K 3JTHA 1MJAA 1LB2A 1DPUA 2EFPA 5HVQC 4FX4A 5F64A 2BV6A 1SFEA 1WQ2A 3DPTA 2DFIA 4A5MA 2GZWA 5FLXK 1UCRA 1J5YA 3LA7A 3GW2A 5E18F 4G7ZF 2KJBA 2E1NA 3LA2A 3Q9VA 1U3EM 4PZJA 5DCFA 3ZP5A 4ESJA 3PQKA 2ELHA 4UVAA 5JVTA 4I0AA 2RKHA 1HKSA 4R1HA 5D6FA 3HSEA 1R22A 3HHHA 3IC7A 4WF2A 5D4RA 1QZZA 2A6HF 1R5GA 2RDPA 2XRNA 4IF4A 1RUOA 2E7WA 5KVRA 3ZPLA 1IN5A 2OBPA 3CUQC 4FHTA 2K27A 4KIGA 1FBQA 2YX4A 3K69A 2MH9A 5JFRA 1YW7A 2H09A 2XAHA 4LK1F 2UZKA 4N9IA 3V8KA 1K6OA 4ZYGA 2W24A 3KFWX 1ZREA 1U5TB 5LHGA 2FXAA 4D0PA 4HLYA 3RYPA 1O3QA 2L3DA 3WTSC 5HS7A 4M73A 2P8TA 3GFJA 2IA2A 4HV6A 3GWZA 1HW2A 1SMTA 1BM9A 3E5XA 3HTSB 2L01A 4MGRA 1XN7A 2KJCA 1QGPA 3LAPA 2AS5F 1OYIA 5IT3A 2HYFA 2JSCA 3CJNA 2MLKA 5LBQA 4MQVA 1K78A 3I58A 2F2EA 4ZYEA 1FYLA 2MC3A 2OAZA 4XBFA 1WKMA 2K4JA 4L0YB 3QU3A 3ROUA 5D5WB 4LB6B 2M30A 5DYMA 4CXFA 1KQ9A 2JRTA 1R36A 2YR2A 3IWFA 1P92A 1TNTA 2P5VA 1SAXA 1BIAA 2EJRA 2RV8A 1Z9CA 5FD5A 3QPTA 2DQLA 2QQAA 5J8FA 1GXQA 2LNBA 4ZYDA 2A69F 4L9TA 3VB2A 1P6RA 6PAXA 4XSZF 5E20A 3MZYA 1AOYA 3E6CC 1ZG5A 1W5SA 4LD5A 2FSWA 2QM3A 4AIJA 1EH7A 1LEAA 3U2RA 2HFHA 1ZLJA 4GYIA 3DKWA 4MTEA 4EQQA 2V6CA 2DI3A 3FHZA 3F8MA 4KICA 2B0LA 2EFOA 3RPUA 3MWMA 2GA2A 5CVUA 1YS7A 1VTNC 2VN2A 1SFUA 2XV4S 4Q4ZF 2JT1A 4ZH4F 3KP7A 4FT8A 3F6OA 1ON2A 1RZ4A 5E1ZB 1XGOA 2IP2A 2MH2A 3I54A 2HS5A 4XLNF 2COMA 3RTRA 3GFMA 3ZMTA 3GO5A 1B4AA 2VOPA 1XSVA 5ERIA 3ISPA 2PLYA 2P7VB 5CLSA 2WTEA 4HOBA 1IN7A 3H3UA 3RIRA 1WRJA 2ZNZA 4OIPF 2ZO4A 2DPUA 3RPQA 4A5NA 5L3DA 2LF8A 4P55A 2MA3A 4GXOA 4A12A 2FEZA 1S8NA 1KYZA 4HX4A 5LLQA 5JHUA 2E1CA 1G3WA 5ICEA 2QLZA 3R61A 1BN5A 3GXOA 3I71A 2PBIA 4BHPA 1HW1A 4G7OF 2V9VA 2H6BA 3F8BA 2VE9A 3M8EA 4I02A 1U2WA 5HLHA 2HTSA 2D1HA 3WTWC 1MJBA 2VBYA 4Y17A 3IKTA 3GUDA 3MFKA 1RIOH 2VT3A 2PEXA 4OIQF 3M9AA 4RB1A 2DQRA 3ZN1A 1XCBA 1YW8A 1KQ8A 1SD6A 4ZZLA 1D8JA 3F8CA 1FC3A 5LGNA 1HW5A 1QNTA 2K02A 4OMYA 3TQNA 2NNYA 2H6CA 4EM1A 2ZCWA 2JPBA 4GGGA 1IN8A 4KIFA 2EA4A 5FFZA 4ENKA 2QWWA 5EEHA 5D4SA 2LF7A 3ZMZA 4CO8A 4P5OA 5DV5A 3CLOA 2QQ9A 1FNNA 1UHMA 2V1DA 3D5LA 5LRSA 4OIRF 3KP6A 1YLFA 1BI2A 2KIFA 1YTYA 2AXLA 3TOBA 4KA4A 1KU7A 5LGUA 4OIOF 1G6NA 2HGCA 4LLLA 4HDVA 5DUIA 4ENMA 1HKQA 4KMFA 3OOPA 4BAYA 1LNWA 2UXNA 1S7AA 1JGSA 3S2WA 3B73A 3WU1B 4G94A 3WTZA 3R0JA 4HA8A 4HDUA 3KP3A 4QWQA 1OPCA 1U5TC 1ZGJA 1IN4A 4IHTA 2EFWA 1LVAA 3DEUA 3JAMZ 3J7AO 1FBUA 2J5PA 2V79A 4LLGF 2OZUA 1QZYA 2EV5A 4AIHA 1IUYA 2OQRA 1DDNA 1J0RA 1B59A 4P9FA 4OMZA 3I64A 1J2XA 2OA4A 2DBBA 1W5TA 4P9UA 1W7PA 4LG0B 1Z6TA 4LG0A 4M74A 5HOOA 4U0YA 5H6QA 3DP7A 4BHCA 3H3ZA 2KIMA 2MBFA 4M6YA 4EGZA 2YSRA 4ESFA 3QU6A 5F1RA 4HBLA 3VFZA 2VE8A 3GX4X 1ZH5A 3CDHA 5CYVA 1K79A 2M5WA 4EJWA 1QPMA 1HXDA 3MCZA 2DK5A 1WI9A 3K1NA 2XKPA 3DV8A 4Q47A 2FA5A 2XHKA 4CYDA 4I2OA 3KZZA 1IAWA 4UHTA 4A6EA 1SMYF 1R23A 3IHUA 3GVAA 1ULYA 1QO0D 4HQMA 4L9VA 3WGIA 4CZZA 4P96A 1O3TA 2NNNA 2NRAC 2C6YA 2ZJ2A 1W7PB 2STTA 4ZYHA 3N4MA 4UNOA 4IRGA 3GYHX 2HQNA 4RS8A 4GYGA 3SZTA 4A2UA 1DP7P 2IVMA 4AIKA 5HDGA 4Y13A 4RGUA 2WC2A 2JTVA 4U7BA 1TQPA 1XD7A 4BH9A 2EFNA 5E17F 2O3FA 3HYIA 3RI4A 4HAMA 4M72A 5E8IA 4HF0A 2Y75A 2FMYA 2FBKA 2JZYA 2FBIA 4HZFA 4YFKF 4IJAA 4L18B 2PMHA 4MQ9F 2VXZA 2O6GE 5ILSA 1S6LA 4I7HA 1AWCA 2P4WA 3ULQB 2P6TA 1RI7A 2Z33A 1OYWA 1NHAA 1YG2A 3JAMK 4EJOA 5TRDA 1YFHA 1T2KA 1T38A 5HDKA 2H27A 2LDUA 2D45A 1MDMB 1PDNC 1ZN2A 2RC4A 2CWEA 2HZTA 5LGTA 3B02A 1P4XA 5D5UB 2EB7A 1C0WA 3VOEA 1LEBA 4N0BA 1IZ1A 3OV8A 4KFCA 3TO6A 1MGTA 2Z99A 4A0ZA 3WG9A 2GXBA 1V4RA 4PGGA 3I5UA 1USSA 1R1TA 4WCGA 1YS6A 2XAGA 1R58A 2L54A 3SHFA 3CO7C 3MEXA 3HRSA 3W6JB 4LGWA 2P5KA 1B1BA 1OYYA 3RJPA 2W57A 4HQEA 3E5QA 4PDKA 1TNSA 1MDMA 4I09A 2FOKA 1XGSA 2Q8KA 4OU0A 3C7JA 3T0YA 2ISZA 1T6SA 1SD5A 4G7HF 3LFKA 1MJ9A 1I5ZA 4EGYA 4A0YA 3L2CA 3QP5A 5CVIA 1K78B 4LB5A 3C3WA 3R4KA 3HOTA 5FLXZ 1IXCA 4RGSA 3GZ5A 4MEYF 4KIBA 3E3VA 2A3SA 3SXYA 1TW3A 3QRFF 4U0WA 3E6MA 4RGXA 4NB5A 3G3ZA 5DDGA 1I1GA 3SZPA 2HOEA 1B9MA 1ON1A 1IW7F 2RGVA 5FB2A 3T8TA 1IXSB 3F22A 3U9GA 2IT0A 2V1UA 4Q48A 1H0MA 3L7WA 1LDKB 1BI3A 4WWCA 4G6QA 2CW0F 3JSOA 1PP8F 2YU3A 1TBXA 2HWVA 2OD5A 3F72A 2YX7A 4UVCA 3N97A 2RQPA 3KETA 1ZLKA 1H9TA 1HSJA 4RB0A 2DO7A 1UFMA 1YQAA 1GHCA 3FWEA 3EDPA 3RKXA 4UV9A 4ZZDA 4RB2C 1HKTA 3EYIA 3BOQA 1OR7A 1W4MA 4A0XA 3BJOA 3M1EA 4LK0F 1MKMA 2DAOA 5D8LB 3DXJF 4ENNA 3QOPA 2J5OA 2A6EF 5H20A 4I0BA 5D5XB 4RB3C 4DNCA 3LQQA 4PGHA 2Q2EA 4PCQA 5CVJA 2QBYA 3FF5A 4KT5C 3KCCA 2TDXA 3F6VA 1CF7B 3LAJA 3G73A 1O3RA 3E97A 5ICCA 3V7RA 1XGNA 1ZARA 3O2PE 5DCMA 3W6KB 3COAC 1ZRCA 4M9XA 3FZVA 2HDCA 4Y15A 4WK8F 2M8EA 2P5LC 5IT9Z 3WTUC 5BS6A 5ICFA 3GF2A 2FRHA 2MLGA 4HF2A 4IVNA 3WE2A 1K7AA 1KQ0A 2IW5A 2X0LA 3TDZC 4YG2F 3WTTC 2GIVA 4M9ZA 3J80K 1R1VA 1ONVA 2KRFA 2H94A 3DF8A 2ETHA 2M87A 3HRUA 2PMUA 3EUHA 2ZFWA 4HLXA 4LJZF 1DPRA 3F8NA 2XVCA 4MHGA 1KA8A 2HR3A 1D8KA 4KYWA 2Z9OA 4OOIA 4UVBA 2NYXA 5CJ9A 5J6XA 1EH6A 2VC0A 1S7OA 1KYWA 4EMSA 5EEGA 1H9GA 5KK1A 3BPVA 3KP5A 1R5HA 2K86A 1BC8C 2LKPA 2OZ6A 1J75A 3C1DA 1R00A 2FMLA 4KUMA 3I53A 1XCVA 1I6XA 3F8FA 1LDDA 1PUEE 1GVJA 1UB9A 2ZMEB 1O7FA 2DTRA 3R0AA 1ZAOA 1X3UA 2M45A 1G3TA 3MAJA 5CVRA 2V1XA 3ABUA 2F5FA 2O8XA 3ZMDA 3MZHA 5BPIA 1BOAA 4EM0B 4H0EA 3FM5A 3TDUC 3TKYA 2M1BA 3IWZA 3LA3A 1FY7A 2FQ3A 3P9CA 2BE5F 3M7GA 4HX7A 3TO9A 1J9IA 3RDIA 3T8RA 2QENA 1L3LA 2FBHA 5JR3A 1FWZA 5L3BA 2DW4A 4HX8A 1FPQA 3R6SA 4O3MA 2ESNA 3T5XA 5DUKA 5L3EA 1B9NA 3BJ6A 1XGMA 1FLIA 1F4KA 2VBWA 2VT2A 1KGSA 3HUGA 4AVPA 4U88A 2WWYA 3DFGA 1USTA 3ECHA 1WSUA 4KN7X 4EM2A 4UV8A 1YW9A 1LDJA 3ZMVA 4WXHA 2NAZA 3HSFA 4MEXF 2O03A 4KDPA 2X4HA 3I4PA 1V3FA 5TJJA 2R7DA 4M9SA 3O6BB 1XMKA 3WTVC 3CUQA 3FMSA 4XSXF 2O61A 4HF1A 2ADUA 4TV7A 2BGCA 4CDGA 3LQRA 4B09A 1OMIA 3EYYA 1LJ9A 1RUNA 5ED4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RVC A;  1ZG3 A;  1S3J A;  4WXC A;  2ZME A;  2G9W A;  3RYR A;  3VOD A;  1QBJ A;  3AAF A;  3TGN A;  5LEJ A;  5JI6 A;  2L4A A;  2IRF G;  1BBY A;  4QLC U;  2D1V A;  3ZMS A;  5K5R A;  3GLX A;  1F5T A;  2L02 A;  3TO7 A;  1DUX C;  3ELK A;  2ISY A;  4CHU A;  4Q5S F;  1KU9 A;  3JW4 A;  3Q5F A;  1HBX G;  2CGP A;  3F21 A;  3FXQ A;  3BZ6 A;  2BYV E;  2G7H A;  4ESB A;  1MZB A;  1KU3 A;  3CUQ B;  2EA2 A;  2RN7 A;  2P7C B;  1ODD A;  5L3C A;  1JE8 A;  4JQF A;  1U6G A;  2PN6 A;  4G9Y A;  5D5V B;  3NQO A;  2DLL A;  1FP1 D;  5FD6 A;  3K9T A;  2IA1 A;  2PQ8 A;  2ZKZ A;  3CTA A;  2ACJ A;  2F5E A;  5ILV A;  1E17 A;  5AIQ A;  1W7P D;  1U8R A;  5K1Y A;  3RKW A;  2XAQ A;  3J80 Z;  2R3S A;  4L9J A;  4XLP F;  2GQQ A;  1B6A A;  3P9I A;  2G7U A;  1XSD A;  1FT9 A;  3SFZ A;  2FF4 A;  1T98 A;  2MD5 A;  3U1D A;  3MQ0 A;  2STW A;  2QYO A;  2HKO A;  2W25 A;  1P4W A;  5BPD A;  2DK8 A;  1I1S A;  2YPR A;  2GA1 A;  1I27 A;  3M8F A;  4IRH A;  4KNY A;  2XAJ A;  2FE3 A;  1ZG1 A;  1Z1D A;  4NQW A;  3BY6 A;  3V7C A;  1PP7 U;  1HST A;  5BMZ A;  1G3S A;  3PQJ A;  1ZRD A;  1E2X A;  2ZNY A;  2PI0 A;  4IHS A;  3WOD F;  3GFI A;  2FU4 A;  4K2E A;  1Q1H A;  3T1B A;  1YIO A;  3K2Z A;  4I98 B;  4L9N A;  3SQN A;  5E1W A;  1FP2 A;  4R79 A;  2HEO A;  2F5C A;  1BIB A;  2EV6 A;  3KLN A;  3D0S A;  2KIU A;  4B8X A;  1TTY A;  4M71 A;  5LHI A;  1SD7 A;  1OKR A;  3GFL A;  4YII A;  4O5V A;  5FFX A;  2CG4 A;  1JXS A;  1P2F A;  5J8C A;  1XSX A;  2XUB A;  1XDU A;  1CF7 A;  3IRR A;  3NEU A;  2IJL A;  2QUF A;  5A2Q K;  2DPD A;  1FYM A;  4EJV A;  2QVO A;  4RGR A;  4WX9 A;  1Y0U A;  4HV5 A;  2DU9 A;  3E5U A;  2L4M A;  2XAF A;  1EH8 A;  1Z7U A;  4L5I A;  3GEZ A;  2CO5 A;  5E8G A;  4S05 A;  2WV0 A;  1FSE A;  3HRT A;  4E70 A;  1D5V A;  3JTG A;  4JBA A;  1CGP A;  4ETS A;  3LST A;  4YIF A;  2KKO A;  3J81 K;  1LQ1 A;  1IRF A;  4F7Z A;  2VOO A;  1T0F A;  2HKX A;  3FXU A;  1FZP B;  3F23 A;  4A6D A;  4ASN A;  5LHH A;  4HW0 A;  2A68 F;  1ZGA A;  3K0L A;  1BI0 A;  2CFX A;  2OQG A;  5HLI A;  3VEP A;  1L0O C;  1KU2 A;  2CQK A;  2PJP A;  2QBY B;  4MTD A;  5HDN A;  3BWG A;  3BPX A;  3K1M A;  4MNU A;  2BBY A;  1TQI A;  4G8X A;  2Y0M A;  4ON0 A;  4EJT A;  1XMA A;  3WU0 A;  2LSO A;  1MD0 A;  3BJA A;  2W84 A;  3KEO A;  3I0T A;  3L09 A;  5HS9 A;  3IKV A;  1ZHF A;  4LMY A;  4AD9 A;  3HRM A;  2EV0 A;  2QQB A;  4CGZ A;  4UUV A;  1TW2 A;  4BXU A;  3C18 A;  4O6J A;  3QP6 A;  4YFN F;  4JK1 X;  4YFX F;  2EWN A;  4LLN A;  3FMQ A;  4L5J A;  2Z3Y A;  1Z91 A;  3WGH A;  5AIP A;  3NRV A;  4WXD A;  3KEQ A;  4DQ2 A;  1F1Z A;  5D6E A;  2W85 A;  1BJA A;  5A2Q Z;  1BC7 C;  1RNL A;  2Y48 A;  1U78 A;  3RKY A;  3CUO A;  3EET A;  4IPA A;  4G6D A;  3ZN0 A;  4BYY A;  1WWX A;  3KZY A;  3BDD A;  5FO5 A;  3CO6 C;  3ECO A;  1R1U A;  1U5T A;  3H92 A;  4I01 A;  1FYK A;  3V8J A;  1G4D A;  2VBZ A;  3I59 B;  4NHJ A;  2PFB A;  4R8H A;  3Q9S A;  3WE3 A;  5CVV A;  1S29 A;  4BHB A;  5BQT A;  4LFU A;  3KP2 A;  3E6D A;  3V4G A;  1YO5 C;  1ZYR F;  2BEO A;  1HQC A;  2K7L A;  3HTU A;  1O57 A;  2XKO A;  2HQR A;  3HIF A;  1XDS A;  3ERE D;  1Z05 A;  4KN4 X;  5DD4 A;  5AON A;  2R7F A;  2RNJ A;  1UHW A;  4GCV A;  2VOD A;  2ZXJ A;  2XRO A;  1YYV A;  4XRF A;  5ICG A;  1SFX A;  3HOS A;  4IRI A;  4M6X A;  3BP8 A;  1IF1 A;  1TQM A;  3L00 A;  3V8L A;  1XB4 A;  3P9K A;  2VC1 A;  3E6B A;  4ENJ A;  1FX7 A;  2IA0 A;  3I59 A;  3IL2 A;  2PG4 A;  2XAS A;  3WTY C;  3QPH A;  5LRR A;  2XGX A;  2A61 A;  4AWX B;  2A07 F;  5H6R A;  1D3Y A;  2FNP A;  4N9H A;  1J59 A;  4EV0 A;  4S04 A;  1FBS A;  2ESH A;  4EJU A;  3P7N A;  4UXN A;  1FOK A;  3DPL C;  3ZMU A;  2FNA A;  3JSP A;  4U0V A;  3REO A;  3FM3 A;  1F9N A;  3GZ6 A;  5E1X A;  1EV7 A;  4GO1 A;  2VBX A;  3DQV C;  1O3S A;  5L3F A;  2NS0 A;  4HYE A;  1ZRF A;  3V7S A;  5HS8 A;  5ILU A;  2Q0O A;  1STZ A;  2QZ8 A;  4IXA A;  4EVI A;  2CYY A;  3QAH A;  4RAZ A;  3LWF A;  5HLG A;  3L9F A;  5DEQ A;  4L0Z B;  2UWM A;  3K1P A;  1T39 A;  5F6F A;  3WGG A;  3HHG A;  1IN6 A;  1SD4 A;  2VON A;  2GWR A;  1JHF A;  3BRO A;  2IPQ X;  4U7D A;  2OU2 A;  2CSO A;  2E7X A;  4OIN F;  1QQI A;  2UXX A;  3ML6 A;  5FGM A;  1G3Y A;  2DT5 A;  2EFQ A;  1FSH A;  1J7K A;  2O0Y A;  3O3K A;  4Z2Y A;  2ZBK A;  4CIC A;  3R60 A;  3ZQ7 A;  2F5D A;  1Z6R A;  5DD8 A;  1O7L A;  1IRG A;  1R7J A;  1IXR C;  3J81 Z;  1JHH A;  5K5Q A;  3ABT A;  1P4A A;  2P6S A;  5LEK A;  1A04 A;  2K4B A;  2HYG D;  4BNC A;  2A5Y B;  5L3G A;  4FX0 A;  1TLH B;  3HSR A;  5K5O A;  2HTJ A;  3IRQ A;  5BOX A;  3FXR A;  2JPC A;  3WTX C;  1BI1 A;  3F3X A;  3KE2 A;  3KP4 A;  4KMU X;  2EK5 A;  5D8K B;  3FMR A;  3TOA A;  3PFI A;  3FX3 A;  2XIG A;  2GAU A;  3EQL F;  1GXP A;  1REP C;  2D2W A;  4BQA A;  2Z5U A;  2GXG A;  4RAY A;  5DCM B;  3KLO A;  5IT9 K;  3JTH A;  1MJA A;  1LB2 A;  1DPU A;  2EFP A;  5HVQ C;  4FX4 A;  5F64 A;  2BV6 A;  1SFE A;  1WQ2 A;  3DPT A;  2DFI A;  4A5M A;  2GZW A;  5FLX K;  1UCR A;  1J5Y A;  3LA7 A;  3GW2 A;  5E18 F;  4G7Z F;  2KJB A;  2E1N A;  3LA2 A;  3Q9V A;  1U3E M;  4PZJ A;  5DCF A;  3ZP5 A;  4ESJ A;  3PQK A;  2ELH A;  4UVA A;  5JVT A;  4I0A A;  2RKH A;  1HKS A;  4R1H A;  5D6F A;  3HSE A;  1R22 A;  3HHH A;  3IC7 A;  4WF2 A;  5D4R A;  1QZZ A;  2A6H F;  1R5G A;  2RDP A;  2XRN A;  4IF4 A;  1RUO A;  2E7W A;  5KVR A;  3ZPL A;  1IN5 A;  2OBP A;  3CUQ C;  4FHT A;  2K27 A;  4KIG A;  1FBQ A;  2YX4 A;  3K69 A;  2MH9 A;  5JFR A;  1YW7 A;  2H09 A;  2XAH A;  4LK1 F;  2UZK A;  4N9I A;  3V8K A;  1K6O A;  4ZYG A;  2W24 A;  3KFW X;  1ZRE A;  1U5T B;  5LHG A;  2FXA A;  4D0P A;  4HLY A;  3RYP A;  1O3Q A;  2L3D A;  3WTS C;  5HS7 A;  4M73 A;  2P8T A;  3GFJ A;  2IA2 A;  4HV6 A;  3GWZ A;  1HW2 A;  1SMT A;  1BM9 A;  3E5X A;  3HTS B;  2L01 A;  4MGR A;  1XN7 A;  2KJC A;  1QGP A;  3LAP A;  2AS5 F;  1OYI A;  5IT3 A;  2HYF A;  2JSC A;  3CJN A;  2MLK A;  5LBQ A;  4MQV A;  1K78 A;  3I58 A;  2F2E A;  4ZYE A;  1FYL A;  2MC3 A;  2OAZ A;  4XBF A;  1WKM A;  2K4J A;  4L0Y B;  3QU3 A;  3ROU A;  5D5W B;  4LB6 B;  2M30 A;  5DYM A;  4CXF A;  1KQ9 A;  2JRT A;  1R36 A;  2YR2 A;  3IWF A;  1P92 A;  1TNT A;  2P5V A;  1SAX A;  1BIA A;  2EJR A;  2RV8 A;  1Z9C A;  5FD5 A;  3QPT A;  2DQL A;  2QQA A;  5J8F A;  1GXQ A;  2LNB A;  4ZYD A;  2A69 F;  4L9T A;  3VB2 A;  1P6R A;  6PAX A;  4XSZ F;  5E20 A;  3MZY A;  1AOY A;  3E6C C;  1ZG5 A;  1W5S A;  4LD5 A;  2FSW A;  2QM3 A;  4AIJ A;  1EH7 A;  1LEA A;  3U2R A;  2HFH A;  1ZLJ A;  4GYI A;  3DKW A;  4MTE A;  4EQQ A;  2V6C A;  2DI3 A;  3FHZ A;  3F8M A;  4KIC A;  2B0L A;  2EFO A;  3RPU A;  3MWM A;  2GA2 A;  5CVU A;  1YS7 A;  1VTN C;  2VN2 A;  1SFU A;  2XV4 S;  4Q4Z F;  2JT1 A;  4ZH4 F;  3KP7 A;  4FT8 A;  3F6O A;  1ON2 A;  1RZ4 A;  5E1Z B;  1XGO A;  2IP2 A;  2MH2 A;  3I54 A;  2HS5 A;  4XLN F;  2COM A;  3RTR A;  3GFM A;  3ZMT A;  3GO5 A;  1B4A A;  2VOP A;  1XSV A;  5ERI A;  3ISP A;  2PLY A;  2P7V B;  5CLS A;  2WTE A;  4HOB A;  1IN7 A;  3H3U A;  3RIR A;  1WRJ A;  2ZNZ A;  4OIP F;  2ZO4 A;  2DPU A;  3RPQ A;  4A5N A;  5L3D A;  2LF8 A;  4P55 A;  2MA3 A;  4GXO A;  4A12 A;  2FEZ A;  1S8N A;  1KYZ A;  4HX4 A;  5LLQ A;  5JHU A;  2E1C A;  1G3W A;  5ICE A;  2QLZ A;  3R61 A;  1BN5 A;  3GXO A;  3I71 A;  2PBI A;  4BHP A;  1HW1 A;  4G7O F;  2V9V A;  2H6B A;  3F8B A;  2VE9 A;  3M8E A;  4I02 A;  1U2W A;  5HLH A;  2HTS A;  2D1H A;  3WTW C;  1MJB A;  2VBY A;  4Y17 A;  3IKT A;  3GUD A;  3MFK A;  1RIO H;  2VT3 A;  2PEX A;  4OIQ F;  3M9A A;  4RB1 A;  2DQR A;  3ZN1 A;  1XCB A;  1YW8 A;  1KQ8 A;  1SD6 A;  4ZZL A;  1D8J A;  3F8C A;  1FC3 A;  5LGN A;  1HW5 A;  1QNT A;  2K02 A;  4OMY A;  3TQN A;  2NNY A;  2H6C A;  4EM1 A;  2ZCW A;  2JPB A;  4GGG A;  1IN8 A;  4KIF A;  2EA4 A;  5FFZ A;  4ENK A;  2QWW A;  5EEH A;  5D4S A;  2LF7 A;  3ZMZ A;  4CO8 A;  4P5O A;  5DV5 A;  3CLO A;  2QQ9 A;  1FNN A;  1UHM A;  2V1D A;  3D5L A;  5LRS A;  4OIR F;  3KP6 A;  1YLF A;  1BI2 A;  2KIF A;  1YTY A;  2AXL A;  3TOB A;  4KA4 A;  1KU7 A;  5LGU A;  4OIO F;  1G6N A;  2HGC A;  4LLL A;  4HDV A;  5DUI A;  4ENM A;  1HKQ A;  4KMF A;  3OOP A;  4BAY A;  1LNW A;  2UXN A;  1S7A A;  1JGS A;  3S2W A;  3B73 A;  3WU1 B;  4G94 A;  3WTZ A;  3R0J A;  4HA8 A;  4HDU A;  3KP3 A;  4QWQ A;  1OPC A;  1U5T C;  1ZGJ A;  1IN4 A;  4IHT A;  2EFW A;  1LVA A;  3DEU A;  3JAM Z;  3J7A O;  1FBU A;  2J5P A;  2V79 A;  4LLG F;  2OZU A;  1QZY A;  2EV5 A;  4AIH A;  1IUY A;  2OQR A;  1DDN A;  1J0R A;  1B59 A;  4P9F A;  4OMZ A;  3I64 A;  1J2X A;  2OA4 A;  2DBB A;  1W5T A;  4P9U A;  1W7P A;  4LG0 B;  1Z6T A;  4LG0 A;  4M74 A;  5HOO A;  4U0Y A;  5H6Q A;  3DP7 A;  4BHC A;  3H3Z A;  2KIM A;  2MBF A;  4M6Y A;  4EGZ A;  2YSR A;  4ESF A;  3QU6 A;  5F1R A;  4HBL A;  3VFZ A;  2VE8 A;  3GX4 X;  1ZH5 A;  3CDH A;  5CYV A;  1K79 A;  2M5W A;  4EJW A;  1QPM A;  1HXD A;  3MCZ A;  2DK5 A;  1WI9 A;  3K1N A;  2XKP A;  3DV8 A;  4Q47 A;  2FA5 A;  2XHK A;  4CYD A;  4I2O A;  3KZZ A;  1IAW A;  4UHT A;  4A6E A;  1SMY F;  1R23 A;  3IHU A;  3GVA A;  1ULY A;  1QO0 D;  4HQM A;  4L9V A;  3WGI A;  4CZZ A;  4P96 A;  1O3T A;  2NNN A;  2NRA C;  2C6Y A;  2ZJ2 A;  1W7P B;  2STT A;  4ZYH A;  3N4M A;  4UNO A;  4IRG A;  3GYH X;  2HQN A;  4RS8 A;  4GYG A;  3SZT A;  4A2U A;  1DP7 P;  2IVM A;  4AIK A;  5HDG A;  4Y13 A;  4RGU A;  2WC2 A;  2JTV A;  4U7B A;  1TQP A;  1XD7 A;  4BH9 A;  2EFN A;  5E17 F;  2O3F A;  3HYI A;  3RI4 A;  4HAM A;  4M72 A;  5E8I A;  4HF0 A;  2Y75 A;  2FMY A;  2FBK A;  2JZY A;  2FBI A;  4HZF A;  4YFK F;  4IJA A;  4L18 B;  2PMH A;  4MQ9 F;  2VXZ A;  2O6G E;  5ILS A;  1S6L A;  4I7H A;  1AWC A;  2P4W A;  3ULQ B;  2P6T A;  1RI7 A;  2Z33 A;  1OYW A;  1NHA A;  1YG2 A;  3JAM K;  4EJO A;  5TRD A;  1YFH A;  1T2K A;  1T38 A;  5HDK A;  2H27 A;  2LDU A;  2D45 A;  1MDM B;  1PDN C;  1ZN2 A;  2RC4 A;  2CWE A;  2HZT A;  5LGT A;  3B02 A;  1P4X A;  5D5U B;  2EB7 A;  1C0W A;  3VOE A;  1LEB A;  4N0B A;  1IZ1 A;  3OV8 A;  4KFC A;  3TO6 A;  1MGT A;  2Z99 A;  4A0Z A;  3WG9 A;  2GXB A;  1V4R A;  4PGG A;  3I5U A;  1USS A;  1R1T A;  4WCG A;  1YS6 A;  2XAG A;  1R58 A;  2L54 A;  3SHF A;  3CO7 C;  3MEX A;  3HRS A;  3W6J B;  4LGW A;  2P5K A;  1B1B A;  1OYY A;  3RJP A;  2W57 A;  4HQE A;  3E5Q A;  4PDK A;  1TNS A;  1MDM A;  4I09 A;  2FOK A;  1XGS A;  2Q8K A;  4OU0 A;  3C7J A;  3T0Y A;  2ISZ A;  1T6S A;  1SD5 A;  4G7H F;  3LFK A;  1MJ9 A;  1I5Z A;  4EGY A;  4A0Y A;  3L2C A;  3QP5 A;  5CVI A;  1K78 B;  4LB5 A;  3C3W A;  3R4K A;  3HOT A;  5FLX Z;  1IXC A;  4RGS A;  3GZ5 A;  4MEY F;  4KIB A;  3E3V A;  2A3S A;  3SXY A;  1TW3 A;  3QRF F;  4U0W A;  3E6M A;  4RGX A;  4NB5 A;  3G3Z A;  5DDG A;  1I1G A;  3SZP A;  2HOE A;  1B9M A;  1ON1 A;  1IW7 F;  2RGV A;  5FB2 A;  3T8T A;  1IXS B;  3F22 A;  3U9G A;  2IT0 A;  2V1U A;  4Q48 A;  1H0M A;  3L7W A;  1LDK B;  1BI3 A;  4WWC A;  4G6Q A;  2CW0 F;  3JSO A;  1PP8 F;  2YU3 A;  1TBX A;  2HWV A;  2OD5 A;  3F72 A;  2YX7 A;  4UVC A;  3N97 A;  2RQP A;  3KET A;  1ZLK A;  1H9T A;  1HSJ A;  4RB0 A;  2DO7 A;  1UFM A;  1YQA A;  1GHC A;  3FWE A;  3EDP A;  3RKX A;  4UV9 A;  4ZZD A;  4RB2 C;  1HKT A;  3EYI A;  3BOQ A;  1OR7 A;  1W4M A;  4A0X A;  3BJO A;  3M1E A;  4LK0 F;  1MKM A;  2DAO A;  5D8L B;  3DXJ F;  4ENN A;  3QOP A;  2J5O A;  2A6E F;  5H20 A;  4I0B A;  5D5X B;  4RB3 C;  4DNC A;  3LQQ A;  4PGH A;  2Q2E A;  4PCQ A;  5CVJ A;  2QBY A;  3FF5 A;  4KT5 C;  3KCC A;  2TDX A;  3F6V A;  1CF7 B;  3LAJ A;  3G73 A;  1O3R A;  3E97 A;  5ICC A;  3V7R A;  1XGN A;  1ZAR A;  3O2P E;  5DCM A;  3W6K B;  3COA C;  1ZRC A;  4M9X A;  3FZV A;  2HDC A;  4Y15 A;  4WK8 F;  2M8E A;  2P5L C;  5IT9 Z;  3WTU C;  5BS6 A;  5ICF A;  3GF2 A;  2FRH A;  2MLG A;  4HF2 A;  4IVN A;  3WE2 A;  1K7A A;  1KQ0 A;  2IW5 A;  2X0L A;  3TDZ C;  4YG2 F;  3WTT C;  2GIV A;  4M9Z A;  3J80 K;  1R1V A;  1ONV A;  2KRF A;  2H94 A;  3DF8 A;  2ETH A;  2M87 A;  3HRU A;  2PMU A;  3EUH A;  2ZFW A;  4HLX A;  4LJZ F;  1DPR A;  3F8N A;  2XVC A;  4MHG A;  1KA8 A;  2HR3 A;  1D8K A;  4KYW A;  2Z9O A;  4OOI A;  4UVB A;  2NYX A;  5CJ9 A;  5J6X A;  1EH6 A;  2VC0 A;  1S7O A;  1KYW A;  4EMS A;  5EEG A;  1H9G A;  5KK1 A;  3BPV A;  3KP5 A;  1R5H A;  2K86 A;  1BC8 C;  2LKP A;  2OZ6 A;  1J75 A;  3C1D A;  1R00 A;  2FML A;  4KUM A;  3I53 A;  1XCV A;  1I6X A;  3F8F A;  1LDD A;  1PUE E;  1GVJ A;  1UB9 A;  2ZME B;  1O7F A;  2DTR A;  3R0A A;  1ZAO A;  1X3U A;  2M45 A;  1G3T A;  3MAJ A;  5CVR A;  2V1X A;  3ABU A;  2F5F A;  2O8X A;  3ZMD A;  3MZH A;  5BPI A;  1BOA A;  4EM0 B;  4H0E A;  3FM5 A;  3TDU C;  3TKY A;  2M1B A;  3IWZ A;  3LA3 A;  1FY7 A;  2FQ3 A;  3P9C A;  2BE5 F;  3M7G A;  4HX7 A;  3TO9 A;  1J9I A;  3RDI A;  3T8R A;  2QEN A;  1L3L A;  2FBH A;  5JR3 A;  1FWZ A;  5L3B A;  2DW4 A;  4HX8 A;  1FPQ A;  3R6S A;  4O3M A;  2ESN A;  3T5X A;  5DUK A;  5L3E A;  1B9N A;  3BJ6 A;  1XGM A;  1FLI A;  1F4K A;  2VBW A;  2VT2 A;  1KGS A;  3HUG A;  4AVP A;  4U88 A;  2WWY A;  3DFG A;  1UST A;  3ECH A;  1WSU A;  4KN7 X;  4EM2 A;  4UV8 A;  1YW9 A;  1LDJ A;  3ZMV A;  4WXH A;  2NAZ A;  3HSF A;  4MEX F;  2O03 A;  4KDP A;  2X4H A;  3I4P A;  1V3F A;  5TJJ A;  2R7D A;  4M9S A;  3O6B B;  1XMK A;  3WTV C;  3CUQ A;  3FMS A;  4XSX F;  2O61 A;  4HF1 A;  2ADU A;  4TV7 A;  2BGC A;  4CDG A;  3LQR A;  4B09 A;  1OMI A;  3EYY A;  1LJ9 A;  1RUN A;  5ED4 A; 
#chains in the Genus database with same CATH topology
 1P9Q C;  1MBK A;  2RVC A;  2PJR B;  1ZG3 A;  1S3J A;  4WXC A;  2ZME A;  2QQ8 A;  2G9W A;  4M3G A;  3RYR A;  1FTZ A;  2VKH A;  3VOD A;  2PX9 A;  1QBJ A;  3AAF A;  3TGN A;  5LEJ A;  1JUM A;  3TBI A;  5JI6 A;  2L4A A;  2AXT C;  5FRO A;  3VSL A;  1IUF A;  4XN3 A;  4XNF A;  2IRF G;  4XOT A;  2LG4 A;  1BBY A;  4QLC U;  5J47 A;  2D1V A;  3DBR B;  2FJ1 A;  3ZMS A;  4ZTF A;  5K5R A;  3GLX A;  2XGD A;  1F5T A;  2L02 A;  1X2M A;  3TO7 A;  4DYR A;  2VIX A;  4M3F A;  1DUX C;  3ELK A;  1IDY A;  2ISY A;  4CHU A;  3IH4 A;  4Q5S F;  1KU9 A;  3JW4 A;  3LSK A;  1V55 H;  3Q5F A;  1XX5 A;  2O7O A;  1HBX G;  2QCO A;  3OSF A;  2CGP A;  3F21 A;  3FXQ A;  3BZ6 A;  2BYV E;  2G7H A;  3CMM A;  4ESB A;  4LIV A;  1YE9 A;  3CDL A;  2KQR A;  3GTM J;  2NXN B;  1MZB A;  2Z16 A;  1KU3 A;  3L2W A;  3CUQ B;  3JRB A;  2QSF X;  3Q3S A;  2EA2 A;  2RN7 A;  2P7C B;  1ODD A;  5F27 A;  5L3C A;  1AKH A;  2HU9 A;  1JE8 A;  4JQF A;  4L5E A;  1R71 A;  1U6G A;  5HLT A;  1UAA A;  4BQQ A;  3M3Y J;  1VQ8 I;  2QSG X;  2PN6 A;  2VQC A;  4G9Y A;  1ETY A;  4XKW A;  4QPO A;  3NQO A;  5D5V B;  3CP8 A;  3OYM A;  2IS4 A;  4RM2 A;  2DLL A;  1FP1 D;  5FD6 A;  3K9T A;  2IA1 A;  1UG2 A;  3S2D J;  2K5C A;  3HL2 A;  2PQ8 A;  4HG2 A;  2ZKZ A;  3CTA A;  2XGE A;  1HLV A;  2ACJ A;  2F5E A;  1LE8 A;  5ILV A;  3AL0 B;  1E17 A;  3CJQ B;  3FBN B;  3PFY A;  5AIQ A;  3SJM A;  1W7P D;  1U8R A;  5K1Y A;  2O5R A;  4IZZ A;  2CQN A;  3RKW A;  2DTZ A;  2XAQ A;  2L7Z A;  3J80 Z;  1PYV A;  5GAE J;  2X6Y A;  2WAE A;  2O8K A;  1VQP I;  5EJC A;  2R3S A;  1DU0 A;  3BQY A;  3P5J A;  4XKV A;  4L9J A;  2E1M B;  4BEH B;  1S9H A;  4C3I J;  4XLP F;  1SAU A;  5IY5 H;  2GQQ A;  2KIQ A;  4KIT B;  1B6A A;  1WFX A;  3P9I A;  4A3M J;  2IS6 A;  2G7U A;  1XSD A;  1FT9 A;  4DZP A;  1NH3 A;  3LNQ A;  3SFZ A;  1MMS A;  2FF4 A;  3FK7 A;  4CCM A;  1VQ5 I;  5M3M J;  1T98 A;  2VXD A;  2MD5 A;  3U1D A;  3PIO F;  3MQ0 A;  3IP4 B;  4IL6 C;  2EZK A;  4DZJ A;  2KT0 A;  2STW A;  2QYO A;  3CC2 I;  2HKO A;  2W25 A;  5EF6 A;  4IKF A;  2R5Y B;  1P4W A;  5BPD A;  2DYR H;  4EEF G;  3S32 A;  2DK8 A;  1A35 A;  3RPU D;  1I1S A;  3KPH A;  2YPR A;  3S17 J;  2HOS A;  2IS1 A;  3G2B A;  2GA1 A;  1I27 A;  2QF7 A;  3M8F A;  4IRH A;  3CC4 I;  4KNY A;  3ERM A;  2XAJ A;  2BXZ A;  2FE3 A;  4XOP A;  1ZG1 A;  1Z1D A;  3DTK A;  4NQW A;  3BY6 A;  2V7F A;  3UKG A;  3V7C A;  2DA4 A;  4RDU A;  1PP7 U;  1HST A;  5BMZ A;  1G3S A;  3PQJ A;  4NQW B;  1ZTR A;  1ZRD A;  2R7S A;  1E2X A;  2ZNY A;  2PI0 A;  2LRD A;  4IHS A;  3BG5 A;  3WOD F;  3GFI A;  3ZRG A;  3OYF A;  2FU4 A;  4XRS A;  1HOM A;  3AL0 C;  4K2E A;  2BOL A;  1Q1H A;  3Q0V A;  3T1B A;  1YIO A;  2JVG A;  1MBH A;  2ZJR F;  3MN2 A;  4XLA A;  1YRN B;  3K2Z A;  2CH0 A;  3DU6 A;  4I98 B;  2HXO A;  1M1E B;  4L9N A;  3SQN A;  2KMU A;  3HXL A;  2LVS A;  5E1W A;  1G59 A;  1W1W E;  3RCO A;  1FP2 A;  4R79 A;  2HEO A;  4B47 A;  2F5C A;  1BIB A;  2EV6 A;  5EEA A;  3ABK H;  3KLN A;  4M3B A;  3D0S A;  3PSF A;  2KIU A;  2WB1 N;  3DLL F;  4B8X A;  1TTY A;  5HNH A;  4M71 A;  3W2W A;  5LHI A;  1SD7 A;  3HOX J;  2E35 A;  1OKR A;  3GFL A;  1VND A;  1Y39 A;  3DEW A;  4O5V A;  4YII A;  2ELJ A;  5FFX A;  2CG4 A;  2CQ7 A;  4G12 A;  1P2F A;  1JXS A;  3BZK A;  3OS1 A;  5J8C A;  1XSX A;  2XUB A;  1XDU A;  1CF7 A;  1LFU P;  3FDY A;  4NC7 A;  2ICW G;  2X1C A;  3IRR A;  3NEU A;  2IJL A;  2LD5 A;  2QUF A;  1YIJ I;  5A2Q K;  2DPD A;  2M7B A;  1FYM A;  3GTK J;  3AG4 H;  4EJV A;  1R9T J;  2QVO A;  3O8H A;  4RGR A;  4WX9 A;  1Y0U A;  4HV5 A;  4E7L A;  2DU9 A;  2OCE A;  1D5Y A;  3E5U A;  2L4M A;  2XAF A;  2H1K A;  1WPK A;  5J1R A;  1EH8 A;  1Z7U A;  4L5I A;  4F55 A;  3GEZ A;  4UB6 C;  2CO5 A;  5E8G A;  4S05 A;  1IDZ A;  4QIW N;  2WV0 A;  1UEL B;  1AHD P;  2DMU A;  2HOA A;  1FSE A;  4N4N B;  3HRT A;  4E70 A;  1D5V A;  3JTG A;  3OYC A;  1ORK A;  4JBA A;  1CGP A;  3LSG A;  4ETS A;  3M4O J;  4BUP A;  2V6E A;  1WJ5 A;  3LST A;  4YIF A;  2KKO A;  2ME6 A;  3J81 K;  1LQ1 A;  4B48 A;  4W97 A;  1XTA A;  1IRF A;  3D5R C;  3JRG A;  4F7Z A;  1H88 C;  4XIC A;  1S5L C;  2LYC A;  4I76 A;  2R7W A;  1T0F A;  2E2J J;  2VOO A;  2CV1 A;  2HKX A;  5F0H A;  3FXU A;  3GTL J;  1FZP B;  3F23 A;  1PUF B;  3MMY B;  4A6D A;  3LSP A;  2IAI A;  1HDP A;  4ASN A;  5LHH A;  3VYT B;  3G4S I;  1ACI A;  3QPL A;  4A3J J;  3CCL I;  4HW0 A;  2A68 F;  4S0H B;  3ZQH A;  1ZGA A;  3H35 A;  3K0L A;  1BI0 A;  2CFX A;  2QGU A;  4HST A;  4E7H A;  2OQG A;  4MFD A;  1D0Y A;  5HLI A;  3VEP A;  1L0O C;  1KU2 A;  4RAG A;  2CQK A;  4A3E J;  2TCT A;  2PJP A;  3OL4 A;  5KNL A;  2QBY B;  4MTD A;  1S72 I;  5HDN A;  3BWG A;  3S2H J;  2E2I J;  1YIT I;  2Z1D A;  3HKZ A;  2YUS A;  5KHD A;  3BPX A;  3K1M A;  2M4G A;  3JR9 A;  4KIS A;  1JTY A;  4MNU A;  3UNG C;  4RAF A;  2BBY A;  1TQI A;  4G8X A;  4DIQ A;  3RZO J;  2Y0M A;  4ON0 A;  3BTI A;  2CQQ A;  4EJT A;  1XMA A;  3WU0 A;  2LSO A;  1MD0 A;  2AQE A;  3BJA A;  2W7N A;  2XSD C;  1A36 A;  3LOC A;  2W84 A;  3KEO A;  3I0T A;  4YRV A;  3L09 A;  5HS9 A;  3IKV A;  4AU7 A;  4LG3 A;  1ZHF A;  5DM7 F;  4LMY A;  4AD9 A;  2LKX A;  3HRM A;  2KDZ A;  2EV0 A;  2QQB A;  4CGZ A;  5GP9 A;  4UUV A;  1TW2 A;  4BXU A;  3C18 A;  4O6J A;  4II2 A;  1HF0 A;  4IHY A;  3HBL A;  3QP6 A;  4YFN F;  3I4N J;  1FEX A;  4PJN A;  4JK1 X;  3V42 A;  4YFX F;  1TWC J;  2KHM A;  2MD0 A;  5IP6 A;  2XAU A;  2EWN A;  1BR1 A;  2KRH A;  4Y33 A;  1MH3 A;  4LLN A;  3OOU A;  4BKX A;  2JN6 A;  4C2U A;  3FMQ A;  3LFU A;  3OR1 C;  4L5J A;  2ZSI B;  2Z3Y A;  5H2F C;  1Z91 A;  3WGH A;  5AIP A;  3NRV A;  4NC8 A;  4WXD A;  3NAU A;  3BR3 A;  2LBF B;  3KEQ A;  1OCT C;  3FXK A;  4DQ2 A;  4IHX A;  2L5Q A;  2NOJ B;  3GTJ J;  4BEH A;  3H9G A;  1F1Z A;  5CQG A;  5D6E A;  4Z6Y A;  3IV5 A;  1KZH A;  1GV2 A;  2W85 A;  3OY9 A;  1BJA A;  3ZR8 X;  1I3Q J;  5FKL A;  5A2Q Z;  1BC7 C;  1RNL A;  2Y48 A;  1U78 A;  5CQE A;  3RKY A;  3CUO A;  3MVP A;  3EET A;  4IPA A;  4G6D A;  3ZN0 A;  4BYY A;  1WWX A;  1WH7 A;  3KZY A;  3HJE A;  3BDD A;  5FO5 A;  1U9N A;  1ERD A;  3CO6 C;  1ZKG A;  3ECO A;  3BR6 A;  3FKJ A;  2BY0 A;  1R1U A;  1U5T A;  4CYC B;  2WV1 A;  4F52 A;  1E3H A;  3OYE A;  3H92 A;  4I01 A;  1FYK A;  3V8J A;  1HC8 A;  1G4D A;  3DEE A;  2VBZ A;  3I59 B;  2ID3 A;  4NHJ A;  2E71 A;  2PFB A;  4R8H A;  3Q9S A;  2XGC A;  3WE3 A;  5CVV A;  1S29 A;  4BHB A;  5BQT A;  4LFU A;  2JJ7 A;  2ZJQ F;  3KP2 A;  3E6D A;  3V4G A;  1YO5 C;  3A0B C;  2NVY J;  2NVX J;  1ZYR F;  3JRC A;  2BEO A;  2KLO A;  2LH9 A;  5E3M A;  2DOE A;  1HQC A;  2K7L A;  3HTU A;  1O57 A;  1CQT A;  4A3C J;  1DU6 A;  3DKY A;  4IO9 F;  2XKO A;  2HQR A;  2JK3 A;  3HIF A;  1XDS A;  3K4C A;  3KYC B;  4XR6 A;  3ERE D;  1Z05 A;  4KN4 X;  2XDV A;  2DFH A;  5DD4 A;  5AON A;  2R7F A;  5IYD J;  4ZJZ A;  4J19 A;  2RNJ A;  2A6T A;  1UHW A;  4GCV A;  2Y31 A;  2DT7 B;  5GPC A;  2VOD A;  1T33 A;  2ZXJ A;  3S1Q J;  4B1R A;  3E7L A;  1YYV A;  2XRO A;  3A03 A;  2M34 A;  4XRF A;  5GPA A;  5ICG A;  1SFX A;  2R7Q A;  2Y0S N;  3HOS A;  1KON A;  3FKI J;  2E36 A;  4IRI A;  3GTQ J;  4AC0 A;  3VPR A;  3W6V A;  4M6X A;  3BP8 A;  1IF1 A;  4GFB A;  1TQM A;  3L00 A;  3V8L A;  1TZL A;  1XB4 A;  1BW5 A;  3P9K A;  2VC1 A;  3E6B A;  3VYR B;  4ENJ A;  3E0J B;  5IOZ A;  4XM3 A;  2VKD A;  1FX7 A;  2IA0 A;  3I59 A;  1WCM J;  3KZI C;  5IYC J;  3IL2 A;  2JA7 J;  2PG4 A;  2XAS A;  4BE0 A;  3WTY C;  4PSW A;  3QPH A;  3S3N A;  5LRR A;  2LKS A;  2XGX A;  2DFE A;  2A61 A;  1DGW Y;  4AWX B;  2A07 F;  5H6R A;  1D3Y A;  2P0W A;  1UMQ A;  2FNP A;  3DKX A;  4N9H A;  1J59 A;  3ZQQ A;  4BJ5 C;  4EV0 A;  4S04 A;  1FBS A;  2ESH A;  1BW6 A;  2L9N A;  3WHC A;  4EJU A;  2UV1 A;  2NVQ J;  3P7N A;  4MIM A;  4UXN A;  1FOK A;  1MW7 A;  3DPL C;  3ZMU A;  2FNA A;  3JSP A;  3BG6 A;  4U0V A;  1AA7 A;  3REO A;  1Y8Q B;  4D5C A;  1JKR C;  3FM3 A;  1F9N A;  3GZ6 A;  1DGR M;  5E1X A;  1V5E A;  4X0G A;  2BXY A;  2OPT A;  2CV2 A;  2E34 A;  1EV7 A;  2R7X A;  4GO1 A;  3OIQ A;  1FOY A;  2HQ5 A;  1XS9 A;  2B63 J;  2VBX A;  1SFO J;  3DQV C;  1X1A A;  1O3S A;  1D0X A;  4B3X A;  3BG3 A;  5L3F A;  2NS0 A;  4FQG A;  4HYE A;  3V7S A;  1ZRF A;  5IPA A;  4ITV A;  2X85 A;  5HS8 A;  3AKZ A;  1BR4 A;  5ILU A;  3ASN H;  2Q0O A;  1STZ A;  2QZ8 A;  4IXA A;  4EVI A;  4MO7 A;  2CYY A;  1IJW C;  1HDD C;  2E5Z A;  3QAH A;  4RAZ A;  3LWF A;  5HLG A;  3L9F A;  2X48 A;  2DJI A;  3QOD A;  5DEQ A;  4D1Q A;  3OYG A;  4L0Z B;  4ANJ A;  3OYB A;  1YRN A;  1N77 A;  4F91 B;  3GCM A;  2UWM A;  3HC7 A;  3K1P A;  3S3O A;  1T39 A;  5F6F A;  2HNH A;  2F6C A;  2XRL A;  3WGG A;  3HHG A;  1IN6 A;  1SD4 A;  2NOG A;  2VON A;  2GWR A;  1JHF A;  2W82 A;  3BRO A;  2IPQ X;  3CJT B;  4U7D A;  3ZXS A;  2OU2 A;  1Y1W J;  2CSO A;  2E7X A;  3AG3 H;  2LOO A;  4OIN F;  1QQI A;  2UXX A;  3ML6 A;  1ETO A;  5FGM A;  1G3Y A;  4BGD A;  3CC7 I;  3A2K A;  2DT5 A;  2CFO A;  2EFQ A;  4E7I A;  1FSH A;  4QSH A;  1J7K A;  3QYB A;  2O0Y A;  5J3L A;  3LSJ A;  3O3K A;  2R92 J;  3GTP J;  1E3P A;  4Z2Y A;  3ZCO A;  2EBI A;  2ZBK A;  3X2Q H;  4CIC A;  2R5Z B;  3K70 C;  3R60 A;  2R7O A;  3ZQ7 A;  2F5D A;  2OCC H;  4BL0 B;  2F5V A;  1ETW A;  1Z6R A;  2I8D A;  5FRN A;  2LK2 A;  5DD8 A;  2Y2Z A;  1O7L A;  2CRG A;  5JLX A;  1IRG A;  2EIM H;  1R7J A;  1IXR C;  2JUG A;  3J81 Z;  1JHH A;  5K5Q A;  3ABT A;  1P4A A;  3CCU I;  2P6S A;  5LEK A;  2RRE A;  2ZB9 A;  4X1E A;  2VB6 A;  1A04 A;  1VF9 A;  3HKZ N;  2K4B A;  3LSH A;  2BHZ A;  2VJJ A;  2QKM B;  1X3W B;  2HYG D;  4BNC A;  4UUS A;  2A5Y B;  1IO2 A;  4CA0 A;  5L3G A;  4W1U A;  4FX0 A;  1TLH B;  4DJA A;  3HSR A;  5K5O A;  2M7A A;  2VJ5 A;  4PJL A;  2CUE A;  4RBO A;  2HTJ A;  3IRQ A;  5BOX A;  1JKO C;  1EKE A;  3FXR A;  1W5C C;  2JPC A;  3WTX C;  3GTO J;  3MKZ A;  1BI1 A;  3F3X A;  1H8A C;  3KE2 A;  3KP4 A;  1MBG A;  4KMU X;  2CV0 A;  2EK5 A;  3RSN A;  3OL3 A;  3FMR A;  3TOA A;  5D8K B;  3CLQ A;  3PFI A;  2V9P A;  1OLT A;  3FX3 A;  2XIG A;  5DS9 A;  2GAU A;  4C9Y A;  3EQL F;  1GXP A;  1K83 J;  1POG A;  5B5E C;  1FJL A;  3VWB A;  1G8X A;  1YJW I;  2OUM A;  1REP C;  2PJR A;  2AO9 A;  4AID A;  2D2W A;  3CCS I;  3OWT A;  4BQA A;  4NBQ A;  2Z5U A;  2GXG A;  1SVO A;  2BY2 A;  1JJ6 C;  1ETX A;  3G71 I;  4RAY A;  1JUS A;  5DCM B;  5FLV A;  3KLO A;  2IXS A;  5IT9 K;  2EZL A;  1MJA A;  3JTH A;  4Y4R A;  1LB2 A;  1IV6 A;  1DPU A;  2EFP A;  1JT0 A;  5HVQ C;  2L9R A;  4C3J J;  2RQQ A;  5IOY A;  1OQY A;  4FX4 A;  4JP0 A;  5JVG F;  3HGY A;  4FE7 A;  1BOB A;  3MD2 A;  5GAG J;  2OC6 A;  3JRD A;  2I10 A;  5F64 A;  2HI3 A;  2BV6 A;  2QEX I;  1SFE A;  1WQ2 A;  3DPT A;  2Y9Z A;  4YEJ A;  2DFI A;  2R7U A;  4CZC A;  3QOE A;  4A5M A;  3HEF A;  4LOC A;  1LFB A;  1X1B A;  3TED A;  2GZW A;  5FLX K;  1UCR A;  3CP2 A;  1J5Y A;  2WA0 A;  3FBI B;  3LA7 A;  3SYT A;  1X1P A;  3GW2 A;  5E18 F;  4G7Z F;  2KJB A;  2HXI A;  3BTL A;  2E1N A;  3LA2 A;  3Q9V A;  4CYC A;  3HM5 A;  1U3E M;  1OCP A;  4PZJ A;  5DCF A;  3ZP5 A;  4N4O B;  2DDB A;  4ESJ A;  1JTX A;  3A1Y A;  1QHG A;  2ELH A;  3ABM H;  3PQK A;  3CCJ I;  4UVA A;  5JVT A;  4I0A A;  2RKH A;  2FOW A;  1HKS A;  2XB0 X;  3BTC A;  4M3E A;  2X6X A;  4R1H A;  5D6F A;  3HSE A;  2XPU A;  1TWH J;  1R22 A;  3G1O A;  1UHS A;  3HHH A;  3MKL A;  3IC7 A;  1YJ9 I;  1VQK I;  4WF2 A;  3BTJ A;  1MMG A;  5D4R A;  1QZZ A;  2A6H F;  1R5G A;  4A69 C;  2RDP A;  3CMY A;  2IGK A;  4XL9 A;  3TW7 A;  1A31 A;  2XRN A;  3LMM A;  4PK4 A;  4IF4 A;  2LBF A;  4QTR A;  1RUO A;  3ESW B;  2YS9 A;  2R4G A;  2NVU B;  2E7W A;  3K4L A;  5KVR A;  4B44 A;  1VQ4 I;  2L2O A;  3ZPL A;  3CUQ C;  1IN5 A;  2F4O B;  2OBP A;  4FHT A;  2LLK A;  2FQ4 A;  2GXA A;  2K27 A;  3AG2 H;  4KIG A;  1FBQ A;  2YX4 A;  3K69 A;  1APL C;  5M3F J;  2MH9 A;  5JFR A;  1YW7 A;  2H09 A;  2XAH A;  3GBG A;  4LK1 F;  4CCO A;  1HA8 A;  2UZK A;  4N9I A;  1K61 A;  2JA5 J;  2HYJ A;  3V8K A;  4BBS J;  3DBH B;  1K6O A;  1QRY A;  4ZYG A;  4RLF A;  1NK3 P;  2W24 A;  3KFW X;  1ZRE A;  1U5T B;  5LHG A;  1NTC A;  1P7I A;  5F04 A;  4UUS B;  2FXA A;  2F48 A;  4D0P A;  2XPW A;  4HLY A;  3RYP A;  1O3Q A;  2L3D A;  2GIZ A;  3WTS C;  1MNM C;  2CS3 A;  4M73 A;  5HS7 A;  2P8T A;  3DCF A;  3GFJ A;  2IA2 A;  4HV6 A;  3GWZ A;  1HW2 A;  2CQX A;  3FXL A;  3S1R J;  1SMT A;  2RAE A;  3IUO A;  1BM9 A;  3E5X A;  2KZV A;  3HTS B;  2L01 A;  3EPZ A;  4MGR A;  1W36 D;  1XN7 A;  2KJC A;  5TGT A;  3TP3 A;  1QGP A;  2R7Z J;  3W3C A;  2IGO A;  2KL4 A;  3LAP A;  2AS5 F;  1OYI A;  5IT3 A;  2HYF A;  1WGX A;  2JSC A;  3CJN A;  2MLK A;  5EG0 A;  2BW3 B;  5LBQ A;  4MQV A;  2EIJ H;  1B8I A;  1K78 A;  3I58 A;  4BXF A;  2E1M C;  2X1D A;  2F2E A;  2JQ7 A;  4BDZ A;  1TWF J;  2EIN H;  3ZQF A;  2NVT J;  3F9K A;  4PJM A;  5B3S H;  1FIA A;  4ZYE A;  3H5R A;  3PM1 A;  3JRA A;  2L9V A;  1FYL A;  2JUC A;  1RR8 C;  2VKE A;  2MC3 A;  2OAZ A;  5CKT A;  4XBF A;  5EDN A;  2CW7 A;  1WKM A;  2K4J A;  4AYB A;  4L0Y B;  4ZDP A;  1Y56 A;  5J4Y A;  3QU3 A;  3ROU A;  5D5W B;  4LB6 B;  2M30 A;  5DYM A;  4DGW B;  4CXF A;  4IOA F;  1A6I A;  1JGG A;  1KQ9 A;  3H36 A;  3OYN A;  2JRT A;  1R36 A;  2YR2 A;  3IWF A;  1ZR4 A;  1P92 A;  1VZ0 A;  1TNT A;  2DMP A;  2P5V A;  3GTG J;  2E19 A;  1BIA A;  2KZG A;  1ZGW A;  2EJR A;  1SAX A;  1G2H A;  2IGM A;  2RV8 A;  1Z9C A;  5FD5 A;  3QPT A;  3ZQL A;  2DQL A;  3LSI A;  1QU3 A;  2KIS A;  4BAC A;  2QQA A;  5J8F A;  1EF4 A;  1GXQ A;  2LNB A;  4V19 K;  1DP3 A;  4ZYD A;  3H5A A;  3S1M J;  1SVL A;  4C2M J;  2UUZ A;  3H0D A;  2A69 F;  4UB8 C;  4A3B J;  3HUG B;  4L9T A;  3VB2 A;  3OYL A;  1P6R A;  1R49 A;  6PAX A;  4XSZ F;  5E20 A;  2LP0 A;  3MZY A;  4HNT A;  2X1E A;  1AOY A;  3SDG A;  1XPX A;  3HOW J;  3E6C C;  1ZG5 A;  1Q1V A;  1W5S A;  4LD5 A;  2FSW A;  2QM3 A;  1W0T A;  4AIJ A;  4BE2 A;  1EH7 A;  1LEA A;  3U2R A;  2HFH A;  3DPU A;  2DOA A;  1ZLJ A;  4GYI A;  3DKW A;  2VAS A;  4MTE A;  4EQQ A;  2PMZ N;  1OCO H;  5F1J A;  3DWL E;  1ETQ A;  2NS7 A;  2V6C A;  2DI3 A;  3I9V 2;  3PO2 J;  2VPR A;  3OYD A;  3FIW A;  3UR3 C;  3FHZ A;  3F8M A;  4KIC A;  2A05 A;  2EZI A;  4A3I J;  2B0L A;  4IHV A;  2EFO A;  3RPU A;  1A6Q A;  3U1K A;  3MWM A;  1I50 J;  2GA2 A;  5CVU A;  4M6V A;  1YS7 A;  1VTN C;  2KDO A;  3Q0U A;  2VN2 A;  1OIS A;  1SFU A;  1E0E A;  1VI0 A;  3ZOB A;  4AM3 A;  3LSR A;  2XV4 S;  3J7Y J;  4Q4Z F;  5K7Z A;  2JT1 A;  3FHN A;  3S8P A;  1T56 A;  2DYS H;  4ZH4 F;  4RA2 A;  4NUB A;  3KP7 A;  2DA1 A;  4FT8 A;  5DM6 F;  4D9J A;  3WU2 C;  2BVM A;  3F6O A;  1LVK A;  1ON2 A;  1RZ4 A;  2MFZ A;  5E1Z B;  2DN0 A;  1XGO A;  3OIO A;  3GZN B;  1MBE A;  2IP2 A;  2MH2 A;  3I54 A;  3OYH A;  3DTI A;  5DTD A;  3OSG A;  2HS5 A;  4XLN F;  2WBM A;  2COM A;  3SEQ A;  3RTR A;  3GFM A;  3ZMT A;  3GO5 A;  3S1N J;  1B4A A;  4BS9 A;  1U9O A;  2VOP A;  1XSV A;  1WJC A;  5ERI A;  2JMW A;  3ISP A;  1YHQ I;  2PLY A;  3DLA A;  3VYS B;  4U87 A;  2P7V B;  3RKQ A;  5CLS A;  1PJR A;  1K4T A;  1WJD A;  3S3M A;  3CES A;  2VI6 A;  1Z21 A;  1QVT A;  2WTE A;  4HOB A;  1VQO I;  1IN7 A;  3D1N I;  3K6G A;  3H3U A;  3RIR A;  4CSW A;  2V1N A;  1WJF A;  1WRJ A;  4XQF A;  2ZNZ A;  2GOM A;  4OIP F;  2ZO4 A;  2E60 A;  2DPU A;  3RPQ A;  4A5N A;  2MSY A;  5L3D A;  3J7A Y;  2PMZ A;  2LF8 A;  4P55 A;  2MA3 A;  2FX0 A;  4GXO A;  1X1D A;  4A12 A;  4Y52 J;  2FEZ A;  2K9L A;  5EZG A;  5HOD A;  1S8N A;  2JA2 A;  1I39 A;  1KYZ A;  2DA7 A;  4HX4 A;  4XN0 A;  5LLQ A;  5JHU A;  2E1C A;  1G3W A;  2DDA A;  4D7M A;  5ICE A;  4IX7 A;  2QLZ A;  9ANT A;  3NWS A;  3R61 A;  1BN5 A;  3GXO A;  3I71 A;  2PBI A;  5F0F A;  1HW1 A;  4BHP A;  4LIU A;  2BW3 A;  2R7V A;  5J40 A;  2B9S A;  1ITY A;  3PUB A;  1OFC X;  4G7O F;  2V9V A;  4E7S A;  3H9Q A;  2H6B A;  2K3F A;  3F8B A;  2LY2 A;  4C30 A;  2VE9 A;  3BC8 A;  3M8E A;  2E1O A;  2F4I A;  4IEJ A;  2GOX B;  2LY1 A;  1U2W A;  4I02 A;  2ZSH B;  5HLH A;  3CCE I;  5EGO A;  2HTS A;  2HPI A;  2D1H A;  3WTW C;  1GT0 C;  1H89 C;  1UZC A;  1MJB A;  2VBY A;  4Y17 A;  3IKT A;  3GUD A;  3MFK A;  1RIO H;  2M9H A;  2VT3 A;  1IC8 A;  2PEX A;  2XF7 A;  1NG6 A;  1NK2 P;  3HOZ J;  4OIQ F;  3M9A A;  1X4O A;  1JUP A;  3M1C A;  4RB1 A;  2DQR A;  4JX6 A;  2AHQ A;  5KAI C;  3ZN1 A;  1XCB A;  1YW8 A;  4BY1 J;  1KQ8 A;  1D0Z A;  1SD6 A;  3VDX A;  4ZZL A;  1D8J A;  3F8C A;  1FC3 A;  3DTE A;  5J4V A;  5J1U A;  5LGN A;  1HW5 A;  2K9S A;  1QNT A;  2K02 A;  4OMY A;  3TQN A;  2NNY A;  4A3K J;  2TRT A;  3AG1 H;  2H6C A;  4EM1 A;  2ZCW A;  2Y69 H;  2JPB A;  3CCV I;  3K4B A;  2Y0S A;  4GGG A;  3PO3 J;  2VUM J;  4BJT A;  1IN8 A;  4KIF A;  2EA4 A;  5FFZ A;  3TP0 A;  4ENK A;  2NS8 A;  1K6Y A;  2QWW A;  2OTJ I;  3QWL A;  2DMN A;  5EEH A;  1LUJ B;  3HG9 A;  5D4S A;  3H0G J;  2LF7 A;  3ZMZ A;  4CO8 A;  1WJE A;  4MLO A;  2K3P A;  4P5O A;  5DV5 A;  4DYQ A;  3CLO A;  2LTP A;  2QQ9 A;  1FNN A;  1TC3 C;  1UHM A;  2V1D A;  3D5L A;  3NWT A;  3TMO A;  5LRS A;  4OIR F;  4PFO A;  5HNF A;  1RKT A;  3KP6 A;  5K7F A;  1D1A A;  3BR0 A;  3L1P A;  1YLF A;  4AVZ A;  1BI2 A;  1B8I B;  2F4M B;  2KIF A;  1SC7 A;  1ENH A;  3VYU B;  1YTY A;  1LE8 B;  2AXL A;  3TOB A;  4E6K G;  4KA4 A;  1KU7 A;  2HVS A;  5LGU A;  4FTH A;  1MMN A;  3EUA A;  2O9L A;  4OIO F;  3SZG A;  1G6N A;  2HGC A;  4LLL A;  4HDV A;  5DUI A;  4ENM A;  1HKQ A;  1P7J A;  1WH5 A;  4KMF A;  3OOP A;  4BAY A;  1LNW A;  2UXN A;  1S7A A;  4I6Z A;  1JGS A;  3S2W A;  3B73 A;  3WU1 B;  3BT9 A;  2IGN A;  4G94 A;  5C3E J;  1JT6 A;  2W1O A;  3WTZ A;  4CCK A;  3R0J A;  4HA8 A;  4HDU A;  3BQZ A;  2L9S A;  1RC9 A;  3KP3 A;  2MGQ A;  4QWQ A;  1OPC A;  1U5T C;  4XK4 A;  1OCC H;  1IN4 A;  1ZGJ A;  2KFD A;  1E3O C;  2R5Y A;  4IHT A;  2CJJ A;  2EFW A;  3VSK A;  1LVA A;  2HVR A;  3DEU A;  3JAM Z;  4B4C A;  3J7A O;  1FBU A;  2J5P A;  2V79 A;  2LMD A;  4LLG F;  2EZH A;  2OZU A;  1QZY A;  5GAH J;  2EV5 A;  4Y3O A;  1IRZ A;  4AIH A;  1X2N A;  1IUY A;  2OQR A;  1DDN A;  3HOY J;  1J0R A;  1EJ9 A;  1B59 A;  2H8W A;  4P9F A;  4D7N A;  4OMZ A;  3I64 A;  1TL8 A;  1J2X A;  1SAN A;  2OA4 A;  2DBB A;  1W5T A;  4P9U A;  2AQF A;  1ZR2 A;  1W7P A;  4LG0 B;  1Z6T A;  4LG0 A;  4M74 A;  4HEA 2;  5EG0 B;  4B43 A;  4FCY A;  5HOO A;  2B7E A;  2MYS A;  3BR5 A;  2K9M A;  4U0Y A;  5H6Q A;  3DP7 A;  2BHY A;  3H3Z A;  4BHC A;  2KIM A;  4CCL A;  4IQJ A;  2JRM A;  2MBF A;  1QHH D;  3ZQG A;  4M6Y A;  5E3N A;  1ZQ3 P;  4EGZ A;  1N25 A;  2HDD A;  2YSR A;  4ESF A;  4BJ6 C;  3QU6 A;  5F1R A;  4HBL A;  3VFZ A;  2VE8 A;  1W36 C;  3QQA A;  1SEU A;  3GX4 X;  1ZH5 A;  1Y6I A;  3CDH A;  1Z77 A;  5CYV A;  4PJJ A;  4BBR J;  2DFF A;  5EYR A;  1K79 A;  2MAB A;  2M3A A;  4H4K C;  2M5W A;  1SFK A;  2IEK A;  4EJW A;  5C4J J;  1QPM A;  4BQN A;  1HXD A;  4XRM A;  3GLL A;  3MCZ A;  4A93 J;  2DK5 A;  3K70 D;  1MMA A;  1WI9 A;  1Z3X A;  2CMP A;  4D5F A;  3K1N A;  2XKP A;  4EAT A;  3W2A A;  4C3H J;  3DV8 A;  4Q47 A;  1OR7 C;  2FA5 A;  3B6C A;  4CCN A;  4JYK A;  1RRJ A;  1MH4 A;  2R5Z A;  2XHK A;  2X51 A;  4CYD A;  4I2O A;  1VQ7 I;  2DA2 A;  1Z7L A;  3KZZ A;  3CCY A;  1IAW A;  1OCZ H;  4UHT A;  5F0C A;  4A6E A;  3SDB A;  2WY8 Q;  2KPM A;  2L7F P;  4PJ0 C;  1SMY F;  1R23 A;  3IHU A;  3GVA A;  1GLN A;  2XSJ C;  1B72 B;  1ULY A;  1QO0 D;  4HQM A;  4L9V A;  4CUG A;  3L2V A;  2DOF A;  3WGI A;  3ZGK A;  4RLQ A;  2DMQ A;  3K4J A;  4CZZ A;  1Z67 A;  4X6A J;  4P96 A;  2K85 A;  5FLM J;  3IH2 A;  1O3T A;  2NNN A;  2NRA C;  2C6Y A;  2ZJ2 A;  1VQM I;  1W7P B;  1VQ6 I;  4P1W A;  4DOZ A;  2STT A;  3RQI A;  1RPW A;  2W48 A;  4ZYH A;  1EA3 A;  4A3D J;  3BR1 A;  4HNV A;  3N4M A;  4UNO A;  4IRG A;  3GYH X;  2HQN A;  1U8B A;  4RS8 A;  3LSM A;  5FKO A;  1Y0N A;  4GYG A;  2ZME C;  3SZT A;  2L7K A;  4A2U A;  5B66 C;  4BXX J;  3BCB A;  1R6R A;  1DP7 P;  4IQ4 A;  2IVM A;  4AIK A;  3HZJ A;  5HDG A;  3FXM A;  4Y13 A;  2WY7 Q;  4OAZ A;  1X4P A;  4RGU A;  2WC2 A;  2LC2 A;  2JTV A;  2GM4 A;  4U7B A;  1TQP A;  3PJR A;  1XD7 A;  2L7M P;  2ZFU A;  3QYF A;  4BH9 A;  2EFN A;  2VLA A;  1LPQ A;  5FKK A;  1ZEL A;  5E17 F;  2Q2E B;  1XMX A;  2O3F A;  3OR2 C;  2MW8 A;  1JI8 A;  2GBY A;  3HYI A;  3RI4 A;  4HAM A;  2ID6 A;  3PUF A;  1OCR H;  4M72 A;  5E8I A;  4HNU A;  2XPV A;  4HF0 A;  3I3L A;  2LR8 A;  1ETV A;  1IV8 A;  5KAF C;  2Y75 A;  2FMY A;  2FBK A;  1TWG J;  2JZY A;  2FBI A;  4HZF A;  4I99 C;  3K4N A;  4XRS G;  3TW6 A;  3H9J A;  4YFK F;  1WVR A;  2W4S A;  2LY9 A;  4IJA A;  4IOC F;  4L18 B;  5GTH C;  3OYA A;  2EIL H;  2PMH A;  4MQ9 F;  2VQH A;  2VXZ A;  4B3A A;  3QYE A;  3MKW B;  5FKN A;  1YOV B;  2O6G E;  4JX4 A;  5ILS A;  1S6L A;  2EPF A;  1GV5 A;  4I7H A;  1T08 B;  1AWC A;  2P4W A;  3ULQ B;  2VQG A;  2P6T A;  1RI7 A;  1WJB A;  2EIK H;  2WAQ A;  2Z33 A;  1OYW A;  4GDF A;  3I4M J;  1NHA A;  1YG2 A;  3IH3 A;  3JAM K;  4EJO A;  5TRD A;  3PSI A;  2QSH X;  2HPM A;  3EUK L;  2CUZ A;  3BLY A;  3E1S A;  1J09 A;  1YFH A;  4DBQ A;  1T2K A;  2ECB A;  5EZH A;  1T38 A;  5HDK A;  2LRE A;  2H27 A;  1IG7 A;  2LDU A;  2D45 A;  1MDM B;  2VKV A;  1RR7 A;  1PDN C;  2X6W A;  3SFI A;  1ZN2 A;  2RC4 A;  3JRE A;  2CWE A;  3EUH C;  2HZT A;  1X58 A;  2MG4 A;  5LGT A;  3B02 A;  2FUG 2;  4MFE A;  1X3Z B;  2X6O A;  2M0M A;  3L2Q A;  1P4X A;  5D5U B;  2EB7 A;  2EQR A;  4OWR B;  1C0W A;  3VOE A;  3MKY B;  1LEB A;  4N0B A;  3CCR I;  4XOR A;  1IZ1 A;  4UY8 I;  3OV8 A;  4KFC A;  3TO6 A;  3OYI A;  1MNE A;  3CCQ I;  3OS2 A;  2JA6 J;  1MGT A;  2Z99 A;  4A0Z A;  3WG9 A;  2GXB A;  1V4R A;  4PGG A;  3I5U A;  3KYL A;  2HOT A;  1USS A;  1R1T A;  4NC6 A;  1YS6 A;  4WCG A;  3HOV J;  1U0J A;  2XAG A;  2R7R A;  1R58 A;  2VJI A;  1VQ9 I;  2L54 A;  1VFC A;  2R7T A;  3SHF A;  3CO7 C;  3MEX A;  4OAY A;  3HRS A;  3W6J B;  1QZE A;  1YX5 A;  2P81 A;  4LGW A;  2P5K A;  1B1B A;  1OYY A;  3J7Z I;  3RJP A;  2K40 A;  3GME A;  2W57 A;  3PNV A;  2Y30 A;  4HQE A;  3HGG A;  3E5Q A;  4PDK A;  1TNS A;  5F08 A;  1MDM A;  4I09 A;  2VQL A;  2FOK A;  4HSR A;  4XLE A;  1XGS A;  2Q8K A;  4OU0 A;  3C7J A;  2K9N A;  3T0Y A;  3LL7 A;  3L2U A;  4DYC A;  2ISZ A;  1T6S A;  1SD5 A;  2M8G X;  3FXO A;  3H1C A;  4G7H F;  2XC7 A;  3BG7 A;  2Y9Y A;  3LFK A;  1MJ9 A;  1I5Z A;  4F92 B;  2V9K A;  3C2B A;  4EGY A;  4A0Y A;  3L2C A;  3QP5 A;  2L0K A;  1VQN I;  2ELK A;  2ECC A;  5M5W J;  5CVI A;  1K4S A;  1K78 B;  1RES A;  4LB5 A;  3C3W A;  3R4K A;  3K4M A;  1LFP A;  3HOT A;  4E7J A;  1FTT A;  5FLX Z;  1IXC A;  3I55 I;  4J00 A;  3K10 A;  2CUF A;  4RGS A;  1PVE A;  3GZ5 A;  4MEY F;  3A01 B;  2E2H J;  3HDD A;  2ZXW H;  1TT5 B;  4KIB A;  3E3V A;  2FD5 A;  2RNG A;  1D1B A;  2A3S A;  3SXY A;  1TW3 A;  1MMD A;  3QRF F;  4U0W A;  4ZDL A;  3FIS A;  4E7Z A;  3E6M A;  4RGX A;  3A0H C;  4NB5 A;  1AKH B;  1WZ2 A;  3G3Z A;  5DDG A;  1I1G A;  3SZP A;  2HOE A;  1W0U A;  3PNT A;  3G6E I;  1B9M A;  4A3F J;  1ON1 A;  1IW7 F;  1N78 A;  2ZJP F;  4HRI A;  4AYB N;  2ME0 A;  2ZXI A;  4XID A;  2RGV A;  5FB2 A;  3T8T A;  1IXS B;  3S15 J;  1MSE C;  3F22 A;  3CMA I;  3HOU J;  3U9G A;  2IT0 A;  2V1U A;  4Q48 A;  1H0M A;  3L7W A;  1LDK B;  2DT6 A;  2ZXH A;  1BI3 A;  4ZC3 A;  1GVD A;  4FE4 A;  4G6Q A;  4WWC A;  2CW0 F;  3JSO A;  1PP8 F;  1YX3 A;  3OIP A;  1XG1 A;  2YU3 A;  1TBX A;  2Q1Z B;  3CD6 I;  2VL8 A;  2HWV A;  1I6H J;  2V4J C;  5M5Y J;  5M5X J;  2OD5 A;  1FIP A;  5IYB J;  1WJA A;  3F72 A;  1MSF C;  2YX7 A;  3FK6 A;  4FET A;  4UVC A;  3AFH A;  3N97 A;  3OYK A;  2RQP A;  5IP7 J;  2OF7 A;  2IS2 A;  5EGO B;  5B1B H;  3KET A;  2OTL I;  1VQL I;  2DA3 A;  4XMY A;  3JRI A;  1ZLK A;  1H9T A;  1HSJ A;  3L2R A;  4RB0 A;  2DO7 A;  1DQU A;  3H5N A;  1UFM A;  1YQA A;  2XF5 A;  3CDI A;  1GDT A;  5E3L A;  1GHC A;  1R4N B;  3FWE A;  3EDP A;  3RKX A;  2V26 A;  4UV9 A;  4DBR A;  2BY1 A;  4ZZD A;  4RB2 C;  1HKT A;  5C4X J;  5TIS C;  1V54 H;  3EYI A;  3BOQ A;  2OJE D;  1OR7 A;  1W4M A;  3SEZ A;  2WAF A;  2R0Q C;  4NDL A;  4A3G J;  4A0X A;  1FOW A;  3BJO A;  3M1E A;  4LK0 F;  5BNG A;  1MKM A;  2WAD A;  1RET A;  3D5S C;  2DAO A;  5D8L B;  4ZTJ A;  3CJR B;  2E5N A;  3DXJ F;  4ENN A;  1TT0 A;  3QOP A;  2J5O A;  2A6E F;  3W2V A;  5H20 A;  4I0B A;  1S7E A;  5D5X B;  4RB3 C;  4DNC A;  3TL4 X;  4FAS D;  2GLO A;  3KEY A;  3LQQ A;  2XF6 A;  4PGH A;  3HPH A;  2DMT A;  1X19 A;  4ZDO A;  2Q2E A;  4PCQ A;  5CVJ A;  4ABZ A;  2QBY A;  2VPL A;  3FF5 A;  4KT5 C;  1QPI A;  3G1M A;  1T0F C;  2VJ4 A;  3A4C A;  3KCC A;  4II3 A;  2TDX A;  3HB9 A;  3F6V A;  1CF7 B;  4JOM A;  3LAJ A;  3G73 A;  1O3R A;  3E97 A;  2G0E A;  5ICC A;  3V7R A;  1XGN A;  1MIJ A;  5JHF A;  1NG7 A;  1ZAR A;  3O2P E;  5DCM A;  3W6K B;  3COA C;  2QKL B;  1V5F A;  1ZRC A;  3B6A A;  2D5V A;  4YEL A;  2MC4 A;  1T95 A;  3DU5 A;  1MBF A;  3G1L A;  5FRM A;  4M9X A;  5GAD J;  3FZV A;  1FOX A;  2HDC A;  1ZK8 A;  4Y15 A;  5FKM A;  4CCJ A;  2OV7 A;  4WK8 F;  2M8E A;  2P5L C;  3JRF A;  1T8I A;  5IT9 Z;  5BS6 A;  3WTU C;  2H1L A;  4RM3 A;  5ICF A;  4YIR X;  2WB1 A;  3BCA A;  3GF2 A;  2FRH A;  2MLG A;  4HF2 A;  3RQ4 A;  4IVN A;  3WE2 A;  1K7A A;  4F3Q A;  1KQ0 A;  3S16 J;  2IW5 A;  2X0L A;  3NAR A;  3TDZ C;  4YG2 F;  3BZC A;  3JCU C;  3CQZ J;  3WTT C;  2GIV A;  4M9Z A;  3S93 A;  3J80 K;  1R1V A;  3PNY A;  2BY3 A;  1ONV A;  4RMN A;  2KRF A;  2H94 A;  3DF8 A;  2ETH A;  2M87 A;  3OYJ A;  3HRU A;  2PMU A;  3EUH A;  4PUS A;  2DOD A;  1BA5 A;  1MND A;  2ZFW A;  4Y7N J;  3CF5 F;  3ZQI A;  4HLX A;  1F43 A;  3A02 A;  4LJZ F;  1DPR A;  2XB5 A;  2A5W A;  2XVC A;  3F8N A;  2H8R A;  4MHG A;  1WI3 A;  3WHB A;  3FXJ A;  5LFA A;  1KA8 A;  2KRC A;  2HR3 A;  1D8K A;  3M8J A;  4KYW A;  3ASO H;  1OJL A;  2Z9O A;  4OOI A;  4UVB A;  2NYX A;  2ZC2 A;  3N05 A;  5CJ9 A;  2HDW A;  2KP6 A;  1R5I D;  5J6X A;  1AU7 A;  5JLW A;  2QA4 I;  3BR2 A;  1EH6 A;  1V5G A;  2VC0 A;  1TWA J;  4LIT A;  1S7O A;  1KYW A;  4EMS A;  5EEG A;  1H9G A;  5KK1 A;  3BPV A;  4KT6 A;  1YI2 I;  3KP5 A;  1R5H A;  4NNJ A;  1IGN A;  2K86 A;  3F0C A;  4ZYA A;  1BC8 C;  4BY7 J;  2LKP A;  2M4K A;  2OZ6 A;  1MBJ A;  3ABL H;  2BZT A;  1J75 A;  3MZ8 A;  3C1D A;  4M3D A;  1UJ8 A;  1R00 A;  4CH7 A;  1A5J A;  2FML A;  4KUM A;  1I3A A;  1Z0X A;  3I53 A;  1N75 A;  1O4X A;  2CUJ A;  1XCV A;  3BG9 A;  1I6X A;  3O8G A;  4HPQ A;  4PSX A;  4F93 B;  3ONQ A;  3F8F A;  2EH3 A;  1LDD A;  1PUE E;  1GVJ A;  1UB9 A;  2ZME B;  4PFP A;  2JA8 J;  1O7F A;  1FMV A;  1Z3Y A;  2DTR A;  3R0A A;  4BU2 A;  1ZAO A;  1BR2 A;  4XLF A;  1X3U A;  1WHU A;  2M45 A;  1JJ8 C;  1G3T A;  3KX2 A;  3MAJ A;  3CCM I;  2Z2S B;  5CVR A;  1ETK A;  2V1X A;  3ABU A;  2F5F A;  3HPG A;  2O8X A;  5LD2 C;  5GTI C;  3ZMD A;  3MZH A;  2HVQ A;  4KJZ A;  4E7K A;  5BPI A;  1BOA A;  2DCE A;  2JWT A;  1B72 A;  4EM0 B;  4V2F A;  4C2T A;  4H0E A;  3OMY A;  2DXI A;  2M0C A;  3FM5 A;  3TDU C;  3KYD B;  3TKY A;  2M1B A;  3RZD J;  2DJN A;  3IWZ A;  1LKX A;  4G6T B;  3K2A A;  3LA3 A;  1FY7 A;  2FQ3 A;  2LFB A;  3P9C A;  4E4H A;  3A01 A;  2DA6 A;  1UG0 A;  2BE5 F;  1TP4 A;  3M7G A;  3DBL B;  3IAS 2;  3IAM 2;  1QVU A;  4HX7 A;  1XC5 A;  2BVL A;  2JSP A;  1BL0 A;  3TO9 A;  2JVH A;  1Y8R B;  5B1A H;  5K7H A;  1R4M B;  1J9I A;  3H3V K;  2WAQ N;  1GUU A;  3QPS A;  3RDI A;  2DA5 A;  3T8R A;  2QEN A;  1L3L A;  3OS0 A;  4GRI A;  2FBH A;  3K7A J;  4FIS A;  3K4K A;  5JR3 A;  4XKB A;  1FWZ A;  3CZ6 A;  5L3B A;  2DW4 A;  4QPQ A;  3PL8 A;  4XLC A;  3KIO A;  5FJ8 J;  4HX8 A;  1FPQ A;  3R6S A;  4O3M A;  1PUF A;  1D1C A;  2ESN A;  3T5X A;  5DUK A;  5E79 C;  4JX5 A;  5L3E A;  1HCR A;  3C2H A;  1IRX A;  1JKP C;  4IHW A;  1B9N A;  2X9D A;  3BJ6 A;  1BJZ A;  2K9Q A;  3Q0W A;  3CME I;  3CF2 A;  1XGM A;  1Y1V J;  1FLI A;  1SVM A;  4BDY A;  1F4K A;  2VBW A;  2VT2 A;  3C2G A;  1KGS A;  3HUG A;  4BQO A;  2I5U A;  4XLH A;  4U88 A;  4AVP A;  4DW6 A;  2WWY A;  3DFG A;  3PIP F;  1UST A;  1X1C A;  3ECH A;  1WSU A;  4KN7 X;  4A3L J;  2CU7 A;  4BE1 A;  4EM2 A;  4UV8 A;  5KCM A;  5C44 J;  1YW9 A;  4AUX A;  2HZD A;  3M07 A;  2N8G A;  1LDJ A;  4UUT A;  4XON A;  3ZMV A;  3U21 A;  4V2G A;  2M2E A;  5IP9 J;  4WXH A;  2NAZ A;  3HSF A;  4MEX F;  2O03 A;  3I4P A;  2X4H A;  4KDP A;  1V3F A;  5TJJ A;  2R7D A;  4M9S A;  1F36 A;  3O6B B;  2HQA A;  1XMK A;  3WTV C;  2CW8 A;  1RKW A;  3S14 J;  1JKQ C;  3CUQ A;  3FMS A;  2R93 J;  5E3O A;  4J01 A;  2W00 A;  1FMW A;  4XSX F;  1YJN I;  2O61 A;  3I56 I;  3JRH A;  1QA6 A;  4HF1 A;  2COB A;  2ADU A;  3WG7 H;  4TV7 A;  2BGC A;  4CDG A;  3LQR A;  3ZQC A;  4B09 A;  4XKC A;  2IBD A;  5J1Y A;  1OMI A;  2YU9 J;  5CPR B;  3EYY A;  1LJ9 A;  1RUN A;  5ED4 A; 
#chains in the Genus database with same CATH homology
 2RVC A;  1ZG3 A;  1S3J A;  4WXC A;  2ZME A;  2G9W A;  3RYR A;  3VOD A;  1QBJ A;  3AAF A;  3TGN A;  5LEJ A;  5JI6 A;  2L4A A;  2IRF G;  1BBY A;  4QLC U;  2D1V A;  3ZMS A;  5K5R A;  3GLX A;  1F5T A;  2L02 A;  3TO7 A;  1DUX C;  3ELK A;  2ISY A;  4CHU A;  4Q5S F;  1KU9 A;  3JW4 A;  3Q5F A;  1HBX G;  2CGP A;  3F21 A;  3FXQ A;  3BZ6 A;  2BYV E;  2G7H A;  4ESB A;  1MZB A;  1KU3 A;  3CUQ B;  2EA2 A;  2RN7 A;  2P7C B;  1ODD A;  5L3C A;  1JE8 A;  4JQF A;  1U6G A;  2PN6 A;  4G9Y A;  5D5V B;  3NQO A;  2DLL A;  1FP1 D;  5FD6 A;  3K9T A;  2IA1 A;  2PQ8 A;  2ZKZ A;  3CTA A;  2ACJ A;  2F5E A;  5ILV A;  1E17 A;  5AIQ A;  1W7P D;  1U8R A;  5K1Y A;  3RKW A;  2XAQ A;  3J80 Z;  2R3S A;  4L9J A;  4XLP F;  2GQQ A;  1B6A A;  3P9I A;  2G7U A;  1XSD A;  1FT9 A;  3SFZ A;  2FF4 A;  1T98 A;  2MD5 A;  3U1D A;  3MQ0 A;  2STW A;  2QYO A;  2HKO A;  2W25 A;  1P4W A;  5BPD A;  2DK8 A;  1I1S A;  2YPR A;  2GA1 A;  1I27 A;  3M8F A;  4IRH A;  4KNY A;  2XAJ A;  2FE3 A;  1ZG1 A;  1Z1D A;  4NQW A;  3BY6 A;  3V7C A;  1PP7 U;  1HST A;  5BMZ A;  1G3S A;  3PQJ A;  1ZRD A;  1E2X A;  2ZNY A;  2PI0 A;  4IHS A;  3WOD F;  3GFI A;  2FU4 A;  4K2E A;  1Q1H A;  3T1B A;  1YIO A;  3K2Z A;  4I98 B;  4L9N A;  3SQN A;  5E1W A;  1FP2 A;  4R79 A;  2HEO A;  2F5C A;  1BIB A;  2EV6 A;  3KLN A;  3D0S A;  2KIU A;  4B8X A;  1TTY A;  4M71 A;  5LHI A;  1SD7 A;  1OKR A;  3GFL A;  4YII A;  4O5V A;  5FFX A;  2CG4 A;  1JXS A;  1P2F A;  5J8C A;  1XSX A;  2XUB A;  1XDU A;  1CF7 A;  3IRR A;  3NEU A;  2IJL A;  2QUF A;  5A2Q K;  2DPD A;  1FYM A;  4EJV A;  2QVO A;  4RGR A;  4WX9 A;  1Y0U A;  4HV5 A;  2DU9 A;  3E5U A;  2L4M A;  2XAF A;  1EH8 A;  1Z7U A;  4L5I A;  3GEZ A;  2CO5 A;  5E8G A;  4S05 A;  2WV0 A;  1FSE A;  3HRT A;  4E70 A;  1D5V A;  3JTG A;  4JBA A;  1CGP A;  4ETS A;  3LST A;  4YIF A;  2KKO A;  3J81 K;  1LQ1 A;  1IRF A;  4F7Z A;  2VOO A;  1T0F A;  2HKX A;  3FXU A;  1FZP B;  3F23 A;  4A6D A;  4ASN A;  5LHH A;  4HW0 A;  2A68 F;  1ZGA A;  3K0L A;  1BI0 A;  2CFX A;  2OQG A;  5HLI A;  3VEP A;  1L0O C;  1KU2 A;  2CQK A;  2PJP A;  2QBY B;  4MTD A;  5HDN A;  3BWG A;  3BPX A;  3K1M A;  4MNU A;  2BBY A;  1TQI A;  4G8X A;  2Y0M A;  4ON0 A;  4EJT A;  1XMA A;  3WU0 A;  2LSO A;  1MD0 A;  3BJA A;  2W84 A;  3KEO A;  3I0T A;  3L09 A;  5HS9 A;  3IKV A;  1ZHF A;  4LMY A;  4AD9 A;  3HRM A;  2EV0 A;  2QQB A;  4CGZ A;  4UUV A;  1TW2 A;  4BXU A;  3C18 A;  4O6J A;  3QP6 A;  4YFN F;  4JK1 X;  4YFX F;  2EWN A;  4LLN A;  3FMQ A;  4L5J A;  2Z3Y A;  1Z91 A;  3WGH A;  5AIP A;  3NRV A;  4WXD A;  3KEQ A;  4DQ2 A;  1F1Z A;  5D6E A;  2W85 A;  1BJA A;  5A2Q Z;  1BC7 C;  1RNL A;  2Y48 A;  1U78 A;  3RKY A;  3CUO A;  3EET A;  4IPA A;  4G6D A;  3ZN0 A;  4BYY A;  1WWX A;  3KZY A;  3BDD A;  5FO5 A;  3CO6 C;  3ECO A;  1R1U A;  1U5T A;  3H92 A;  4I01 A;  1FYK A;  3V8J A;  1G4D A;  2VBZ A;  3I59 B;  4NHJ A;  2PFB A;  4R8H A;  3Q9S A;  3WE3 A;  5CVV A;  1S29 A;  4BHB A;  5BQT A;  4LFU A;  3KP2 A;  3E6D A;  3V4G A;  1YO5 C;  1ZYR F;  2BEO A;  1HQC A;  2K7L A;  3HTU A;  1O57 A;  2XKO A;  2HQR A;  3HIF A;  1XDS A;  3ERE D;  1Z05 A;  4KN4 X;  5DD4 A;  5AON A;  2R7F A;  2RNJ A;  1UHW A;  4GCV A;  2VOD A;  2ZXJ A;  2XRO A;  1YYV A;  4XRF A;  5ICG A;  1SFX A;  3HOS A;  4IRI A;  4M6X A;  3BP8 A;  1IF1 A;  1TQM A;  3L00 A;  3V8L A;  1XB4 A;  3P9K A;  2VC1 A;  3E6B A;  4ENJ A;  1FX7 A;  2IA0 A;  3I59 A;  3IL2 A;  2PG4 A;  2XAS A;  3WTY C;  3QPH A;  5LRR A;  2XGX A;  2A61 A;  4AWX B;  2A07 F;  5H6R A;  1D3Y A;  2FNP A;  4N9H A;  1J59 A;  4EV0 A;  4S04 A;  1FBS A;  2ESH A;  4EJU A;  3P7N A;  4UXN A;  1FOK A;  3DPL C;  3ZMU A;  2FNA A;  3JSP A;  4U0V A;  3REO A;  3FM3 A;  1F9N A;  3GZ6 A;  5E1X A;  1EV7 A;  4GO1 A;  2VBX A;  3DQV C;  1O3S A;  5L3F A;  2NS0 A;  4HYE A;  1ZRF A;  3V7S A;  5HS8 A;  5ILU A;  2Q0O A;  1STZ A;  2QZ8 A;  4IXA A;  4EVI A;  2CYY A;  3QAH A;  4RAZ A;  3LWF A;  5HLG A;  3L9F A;  5DEQ A;  4L0Z B;  2UWM A;  3K1P A;  1T39 A;  5F6F A;  3WGG A;  3HHG A;  1IN6 A;  1SD4 A;  2VON A;  2GWR A;  1JHF A;  3BRO A;  2IPQ X;  4U7D A;  2OU2 A;  2CSO A;  2E7X A;  4OIN F;  1QQI A;  2UXX A;  3ML6 A;  5FGM A;  1G3Y A;  2DT5 A;  2EFQ A;  1FSH A;  1J7K A;  2O0Y A;  3O3K A;  4Z2Y A;  2ZBK A;  4CIC A;  3R60 A;  3ZQ7 A;  2F5D A;  1Z6R A;  5DD8 A;  1O7L A;  1IRG A;  1R7J A;  1IXR C;  3J81 Z;  1JHH A;  5K5Q A;  3ABT A;  1P4A A;  2P6S A;  5LEK A;  1A04 A;  2K4B A;  2HYG D;  4BNC A;  2A5Y B;  5L3G A;  4FX0 A;  1TLH B;  3HSR A;  5K5O A;  2HTJ A;  3IRQ A;  5BOX A;  3FXR A;  2JPC A;  3WTX C;  1BI1 A;  3F3X A;  3KE2 A;  3KP4 A;  4KMU X;  2EK5 A;  5D8K B;  3FMR A;  3TOA A;  3PFI A;  3FX3 A;  2XIG A;  2GAU A;  3EQL F;  1GXP A;  1REP C;  2D2W A;  4BQA A;  2Z5U A;  2GXG A;  4RAY A;  5DCM B;  3KLO A;  5IT9 K;  3JTH A;  1MJA A;  1LB2 A;  1DPU A;  2EFP A;  5HVQ C;  4FX4 A;  5F64 A;  2BV6 A;  1SFE A;  1WQ2 A;  3DPT A;  2DFI A;  4A5M A;  2GZW A;  5FLX K;  1UCR A;  1J5Y A;  3LA7 A;  3GW2 A;  5E18 F;  4G7Z F;  2KJB A;  2E1N A;  3LA2 A;  3Q9V A;  1U3E M;  4PZJ A;  5DCF A;  3ZP5 A;  4ESJ A;  3PQK A;  2ELH A;  4UVA A;  5JVT A;  4I0A A;  2RKH A;  1HKS A;  4R1H A;  5D6F A;  3HSE A;  1R22 A;  3HHH A;  3IC7 A;  4WF2 A;  5D4R A;  1QZZ A;  2A6H F;  1R5G A;  2RDP A;  2XRN A;  4IF4 A;  1RUO A;  2E7W A;  5KVR A;  3ZPL A;  1IN5 A;  2OBP A;  3CUQ C;  4FHT A;  2K27 A;  4KIG A;  1FBQ A;  2YX4 A;  3K69 A;  2MH9 A;  5JFR A;  1YW7 A;  2H09 A;  2XAH A;  4LK1 F;  2UZK A;  4N9I A;  3V8K A;  1K6O A;  4ZYG A;  2W24 A;  3KFW X;  1ZRE A;  1U5T B;  5LHG A;  2FXA A;  4D0P A;  4HLY A;  3RYP A;  1O3Q A;  2L3D A;  3WTS C;  5HS7 A;  4M73 A;  2P8T A;  3GFJ A;  2IA2 A;  4HV6 A;  3GWZ A;  1HW2 A;  1SMT A;  1BM9 A;  3E5X A;  3HTS B;  2L01 A;  4MGR A;  1XN7 A;  2KJC A;  1QGP A;  3LAP A;  2AS5 F;  1OYI A;  5IT3 A;  2HYF A;  2JSC A;  3CJN A;  2MLK A;  5LBQ A;  4MQV A;  1K78 A;  3I58 A;  2F2E A;  4ZYE A;  1FYL A;  2MC3 A;  2OAZ A;  4XBF A;  1WKM A;  2K4J A;  4L0Y B;  3QU3 A;  3ROU A;  5D5W B;  4LB6 B;  2M30 A;  5DYM A;  4CXF A;  1KQ9 A;  2JRT A;  1R36 A;  2YR2 A;  3IWF A;  1P92 A;  1TNT A;  2P5V A;  1SAX A;  1BIA A;  2EJR A;  2RV8 A;  1Z9C A;  5FD5 A;  3QPT A;  2DQL A;  2QQA A;  5J8F A;  1GXQ A;  2LNB A;  4ZYD A;  2A69 F;  4L9T A;  3VB2 A;  1P6R A;  6PAX A;  4XSZ F;  5E20 A;  3MZY A;  1AOY A;  3E6C C;  1ZG5 A;  1W5S A;  4LD5 A;  2FSW A;  2QM3 A;  4AIJ A;  1EH7 A;  1LEA A;  3U2R A;  2HFH A;  1ZLJ A;  4GYI A;  3DKW A;  4MTE A;  4EQQ A;  2V6C A;  2DI3 A;  3FHZ A;  3F8M A;  4KIC A;  2B0L A;  2EFO A;  3RPU A;  3MWM A;  2GA2 A;  5CVU A;  1YS7 A;  1VTN C;  2VN2 A;  1SFU A;  2XV4 S;  4Q4Z F;  2JT1 A;  4ZH4 F;  3KP7 A;  4FT8 A;  3F6O A;  1ON2 A;  1RZ4 A;  5E1Z B;  1XGO A;  2IP2 A;  2MH2 A;  3I54 A;  2HS5 A;  4XLN F;  2COM A;  3RTR A;  3GFM A;  3ZMT A;  3GO5 A;  1B4A A;  2VOP A;  1XSV A;  5ERI A;  3ISP A;  2PLY A;  2P7V B;  5CLS A;  2WTE A;  4HOB A;  1IN7 A;  3H3U A;  3RIR A;  1WRJ A;  2ZNZ A;  4OIP F;  2ZO4 A;  2DPU A;  3RPQ A;  4A5N A;  5L3D A;  2LF8 A;  4P55 A;  2MA3 A;  4GXO A;  4A12 A;  2FEZ A;  1S8N A;  1KYZ A;  4HX4 A;  5LLQ A;  5JHU A;  2E1C A;  1G3W A;  5ICE A;  2QLZ A;  3R61 A;  1BN5 A;  3GXO A;  3I71 A;  2PBI A;  4BHP A;  1HW1 A;  4G7O F;  2V9V A;  2H6B A;  3F8B A;  2VE9 A;  3M8E A;  4I02 A;  1U2W A;  5HLH A;  2HTS A;  2D1H A;  3WTW C;  1MJB A;  2VBY A;  4Y17 A;  3IKT A;  3GUD A;  3MFK A;  1RIO H;  2VT3 A;  2PEX A;  4OIQ F;  3M9A A;  4RB1 A;  2DQR A;  3ZN1 A;  1XCB A;  1YW8 A;  1KQ8 A;  1SD6 A;  4ZZL A;  1D8J A;  3F8C A;  1FC3 A;  5LGN A;  1HW5 A;  1QNT A;  2K02 A;  4OMY A;  3TQN A;  2NNY A;  2H6C A;  4EM1 A;  2ZCW A;  2JPB A;  4GGG A;  1IN8 A;  4KIF A;  2EA4 A;  5FFZ A;  4ENK A;  2QWW A;  5EEH A;  5D4S A;  2LF7 A;  3ZMZ A;  4CO8 A;  4P5O A;  5DV5 A;  3CLO A;  2QQ9 A;  1FNN A;  1UHM A;  2V1D A;  3D5L A;  5LRS A;  4OIR F;  3KP6 A;  1YLF A;  1BI2 A;  2KIF A;  1YTY A;  2AXL A;  3TOB A;  4KA4 A;  1KU7 A;  5LGU A;  4OIO F;  1G6N A;  2HGC A;  4LLL A;  4HDV A;  5DUI A;  4ENM A;  1HKQ A;  4KMF A;  3OOP A;  4BAY A;  1LNW A;  2UXN A;  1S7A A;  1JGS A;  3S2W A;  3B73 A;  3WU1 B;  4G94 A;  3WTZ A;  3R0J A;  4HA8 A;  4HDU A;  3KP3 A;  4QWQ A;  1OPC A;  1U5T C;  1ZGJ A;  1IN4 A;  4IHT A;  2EFW A;  1LVA A;  3DEU A;  3JAM Z;  3J7A O;  1FBU A;  2J5P A;  2V79 A;  4LLG F;  2OZU A;  1QZY A;  2EV5 A;  4AIH A;  1IUY A;  2OQR A;  1DDN A;  1J0R A;  1B59 A;  4P9F A;  4OMZ A;  3I64 A;  1J2X A;  2OA4 A;  2DBB A;  1W5T A;  4P9U A;  1W7P A;  4LG0 B;  1Z6T A;  4LG0 A;  4M74 A;  5HOO A;  4U0Y A;  5H6Q A;  3DP7 A;  4BHC A;  3H3Z A;  2KIM A;  2MBF A;  4M6Y A;  4EGZ A;  2YSR A;  4ESF A;  3QU6 A;  5F1R A;  4HBL A;  3VFZ A;  2VE8 A;  3GX4 X;  1ZH5 A;  3CDH A;  5CYV A;  1K79 A;  2M5W A;  4EJW A;  1QPM A;  1HXD A;  3MCZ A;  2DK5 A;  1WI9 A;  3K1N A;  2XKP A;  3DV8 A;  4Q47 A;  2FA5 A;  2XHK A;  4CYD A;  4I2O A;  3KZZ A;  1IAW A;  4UHT A;  4A6E A;  1SMY F;  1R23 A;  3IHU A;  3GVA A;  1ULY A;  1QO0 D;  4HQM A;  4L9V A;  3WGI A;  4CZZ A;  4P96 A;  1O3T A;  2NNN A;  2NRA C;  2C6Y A;  2ZJ2 A;  1W7P B;  2STT A;  4ZYH A;  3N4M A;  4UNO A;  4IRG A;  3GYH X;  2HQN A;  4RS8 A;  4GYG A;  3SZT A;  4A2U A;  1DP7 P;  2IVM A;  4AIK A;  5HDG A;  4Y13 A;  4RGU A;  2WC2 A;  2JTV A;  4U7B A;  1TQP A;  1XD7 A;  4BH9 A;  2EFN A;  5E17 F;  2O3F A;  3HYI A;  3RI4 A;  4HAM A;  4M72 A;  5E8I A;  4HF0 A;  2Y75 A;  2FMY A;  2FBK A;  2JZY A;  2FBI A;  4HZF A;  4YFK F;  4IJA A;  4L18 B;  2PMH A;  4MQ9 F;  2VXZ A;  2O6G E;  5ILS A;  1S6L A;  4I7H A;  1AWC A;  2P4W A;  3ULQ B;  2P6T A;  1RI7 A;  2Z33 A;  1OYW A;  1NHA A;  1YG2 A;  3JAM K;  4EJO A;  5TRD A;  1YFH A;  1T2K A;  1T38 A;  5HDK A;  2H27 A;  2LDU A;  2D45 A;  1MDM B;  1PDN C;  1ZN2 A;  2RC4 A;  2CWE A;  2HZT A;  5LGT A;  3B02 A;  1P4X A;  5D5U B;  2EB7 A;  1C0W A;  3VOE A;  1LEB A;  4N0B A;  1IZ1 A;  3OV8 A;  4KFC A;  3TO6 A;  1MGT A;  2Z99 A;  4A0Z A;  3WG9 A;  2GXB A;  1V4R A;  4PGG A;  3I5U A;  1USS A;  1R1T A;  4WCG A;  1YS6 A;  2XAG A;  1R58 A;  2L54 A;  3SHF A;  3CO7 C;  3MEX A;  3HRS A;  3W6J B;  4LGW A;  2P5K A;  1B1B A;  1OYY A;  3RJP A;  2W57 A;  4HQE A;  3E5Q A;  4PDK A;  1TNS A;  1MDM A;  4I09 A;  2FOK A;  1XGS A;  2Q8K A;  4OU0 A;  3C7J A;  3T0Y A;  2ISZ A;  1T6S A;  1SD5 A;  4G7H F;  3LFK A;  1MJ9 A;  1I5Z A;  4EGY A;  4A0Y A;  3L2C A;  3QP5 A;  5CVI A;  1K78 B;  4LB5 A;  3C3W A;  3R4K A;  3HOT A;  5FLX Z;  1IXC A;  4RGS A;  3GZ5 A;  4MEY F;  4KIB A;  3E3V A;  2A3S A;  3SXY A;  1TW3 A;  3QRF F;  4U0W A;  3E6M A;  4RGX A;  4NB5 A;  3G3Z A;  5DDG A;  1I1G A;  3SZP A;  2HOE A;  1B9M A;  1ON1 A;  1IW7 F;  2RGV A;  5FB2 A;  3T8T A;  1IXS B;  3F22 A;  3U9G A;  2IT0 A;  2V1U A;  4Q48 A;  1H0M A;  3L7W A;  1LDK B;  1BI3 A;  4WWC A;  4G6Q A;  2CW0 F;  3JSO A;  1PP8 F;  2YU3 A;  1TBX A;  2HWV A;  2OD5 A;  3F72 A;  2YX7 A;  4UVC A;  3N97 A;  2RQP A;  3KET A;  1ZLK A;  1H9T A;  1HSJ A;  4RB0 A;  2DO7 A;  1UFM A;  1YQA A;  1GHC A;  3FWE A;  3EDP A;  3RKX A;  4UV9 A;  4ZZD A;  4RB2 C;  1HKT A;  3EYI A;  3BOQ A;  1OR7 A;  1W4M A;  4A0X A;  3BJO A;  3M1E A;  4LK0 F;  1MKM A;  2DAO A;  5D8L B;  3DXJ F;  4ENN A;  3QOP A;  2J5O A;  2A6E F;  5H20 A;  4I0B A;  5D5X B;  4RB3 C;  4DNC A;  3LQQ A;  4PGH A;  2Q2E A;  4PCQ A;  5CVJ A;  2QBY A;  3FF5 A;  4KT5 C;  3KCC A;  2TDX A;  3F6V A;  1CF7 B;  3LAJ A;  3G73 A;  1O3R A;  3E97 A;  5ICC A;  3V7R A;  1XGN A;  1ZAR A;  3O2P E;  5DCM A;  3W6K B;  3COA C;  1ZRC A;  4M9X A;  3FZV A;  2HDC A;  4Y15 A;  4WK8 F;  2M8E A;  2P5L C;  5IT9 Z;  3WTU C;  5BS6 A;  5ICF A;  3GF2 A;  2FRH A;  2MLG A;  4HF2 A;  4IVN A;  3WE2 A;  1K7A A;  1KQ0 A;  2IW5 A;  2X0L A;  3TDZ C;  4YG2 F;  3WTT C;  2GIV A;  4M9Z A;  3J80 K;  1R1V A;  1ONV A;  2KRF A;  2H94 A;  3DF8 A;  2ETH A;  2M87 A;  3HRU A;  2PMU A;  3EUH A;  2ZFW A;  4HLX A;  4LJZ F;  1DPR A;  3F8N A;  2XVC A;  4MHG A;  1KA8 A;  2HR3 A;  1D8K A;  4KYW A;  2Z9O A;  4OOI A;  4UVB A;  2NYX A;  5CJ9 A;  5J6X A;  1EH6 A;  2VC0 A;  1S7O A;  1KYW A;  4EMS A;  5EEG A;  1H9G A;  5KK1 A;  3BPV A;  3KP5 A;  1R5H A;  2K86 A;  1BC8 C;  2LKP A;  2OZ6 A;  1J75 A;  3C1D A;  1R00 A;  2FML A;  4KUM A;  3I53 A;  1XCV A;  1I6X A;  3F8F A;  1LDD A;  1PUE E;  1GVJ A;  1UB9 A;  2ZME B;  1O7F A;  2DTR A;  3R0A A;  1ZAO A;  1X3U A;  2M45 A;  1G3T A;  3MAJ A;  5CVR A;  2V1X A;  3ABU A;  2F5F A;  2O8X A;  3ZMD A;  3MZH A;  5BPI A;  1BOA A;  4EM0 B;  4H0E A;  3FM5 A;  3TDU C;  3TKY A;  2M1B A;  3IWZ A;  3LA3 A;  1FY7 A;  2FQ3 A;  3P9C A;  2BE5 F;  3M7G A;  4HX7 A;  3TO9 A;  1J9I A;  3RDI A;  3T8R A;  2QEN A;  1L3L A;  2FBH A;  5JR3 A;  1FWZ A;  5L3B A;  2DW4 A;  4HX8 A;  1FPQ A;  3R6S A;  4O3M A;  2ESN A;  3T5X A;  5DUK A;  5L3E A;  1B9N A;  3BJ6 A;  1XGM A;  1FLI A;  1F4K A;  2VBW A;  2VT2 A;  1KGS A;  3HUG A;  4AVP A;  4U88 A;  2WWY A;  3DFG A;  1UST A;  3ECH A;  1WSU A;  4KN7 X;  4EM2 A;  4UV8 A;  1YW9 A;  1LDJ A;  3ZMV A;  4WXH A;  2NAZ A;  3HSF A;  4MEX F;  2O03 A;  4KDP A;  2X4H A;  3I4P A;  1V3F A;  5TJJ A;  2R7D A;  4M9S A;  3O6B B;  1XMK A;  3WTV C;  3CUQ A;  3FMS A;  4XSX F;  2O61 A;  4HF1 A;  2ADU A;  4TV7 A;  2BGC A;  4CDG A;  3LQR A;  4B09 A;  1OMI A;  3EYY A;  1LJ9 A;  1RUN A;  5ED4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...