3EYSH

Pfa1 fab fragment complexed with pyro-glu3-a-beta (3-8)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
215
Chain Sequence
b'AVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 215
sequence length 223
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eysH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eysH02
5SWSB 1J05A 4CN1A 5F1KC 4AENA 2BFVL 3RKDD 3NZ8B 1MVFA 4P3CH 2VXUH 1HXMB 2IAMD 4MX7B 4FMKA 3U7YL 1SVZA 4UZGA 3IKKA 5DQ9A 5LCVH 2CK2A 3IU3B 4LOUD 3B43A 1O7SA 1LO0L 2I25N 4WGWB 1N64H 1B9ZA 2AP2A 1ZV5A 4HKXB 4PY7B 5CP3H 5LXGH 4WI6A 3GK8H 1SQ2N 2A1WL 3GMRB 5EC1A 1OM3H 5C92A 1JNNL 3MRHB 3D39E 4U3CA 1IM3A 1IGTB 4DVRH 3K1DA 5HHVL 3WXVH 2EDEA 1AGBA 1DBKH 5ESVA 4HGWA 4ODUA 3QUKA 4G3YH 4HX1A 4IRZH 1NLBL 3LKRA 2VNCA 2EDFA 5D2NE 4PB0L 1J9CT 3VD3A 4C83A 1HOCA 5ETUA 3TIDB 3DUUA 3MLRL 1CK0H 4HWUA 4CGTA 2DIAA 1LE5B 1TZGH 5A1AA 4EI6B 4JLRB 1HHKB 4NCC1 4JFPA 5I1JH 1F3JB 4KGJA 2X70A 2VN7A 3WIIL 1S7XB 2RGSA 3M45A 5DI8A 4EXPX 2Q3AA 4U1NB 4XC1L 4B7LA 3SE9H 3C2AH 1CBVH 4ZFZB 4PJIA 3VXPB 5EIIA 5HYIA 2UYLB 1JMXA 3NPSC 3RA7L 4M1DL 2NQCA 3RTQD 3FZUD 5I15H 2V9QA 2NY1B 1U41A 4OCYL 1ZT7B 3U2SB 4ZFFB 1OGTB 1FCGA 3BDXA 4P48A 4CJ0A 4YUEL 2P49B 3DO7A 2I5YH 4XCNA 4Z7VB 4S1QH 4TUJB 5J1SC 3EYQC 3U7WL 1JGDA 5CJBA 3RWIA 1X5LA 1BFSA 3TO4B 1CVRA 2GKIA 4LEOB 2C3WA 4ZPTA 4JHWL 2A83A 2Q86B 5KW9H 1RFDH 4TVSa 2A0LC 1TVHA 2CDFB 1WGOA 2F8OA 3EYFB 3RZWA 1TVBB 2R2HB 2WINB 3KPRD 1Z5LB 3NCYP 1WZ1H 2W0FB 4LPTA 3SE8H 4O02H 1MHEB 2VO5A 4JFEE 4XVSL 2P24A 5HGAA 3I2CH 5DEGB 1C12B 1TFHA 3P9MB 1FNGA 3VXME 3T4YB 4PY8J 2YN3A 1JV5A 4P2RB 4TOYL 2GJ6A 4P5TB 2YKLL 1AQKL 4G6JH 4ONHB 3VFWA 1IEHA 5DJAA 1N59B 2VXSH 4PJHB 4YFLI 4UT9H 5TF1L 4QTIL 3HNSL 4G8EA 4JPIB 1G7PA 3NFSH 4TULL 5FYLE 3BPCB 4HWEH 1EHAA 4I2XB 3FRUB 3GB7A 5D8JL 3RWDB 4XXCA 1TETH 3Q3GA 1MFAH 3ESVF 4CW1A 1DQQA 2X9YA 1WFNA 5TQ0L 4KJQC 1GSMA 2ZWLT 5D96B 4NM4H 4XBPB 1JNJA 2BXZA 1P4LA 5EB9A 2DQJL 3UCRA 1RUAH 3IFOB 3NABH 2AERT 5CCKH 1CT8A 3SKMB 3C6LA 3QIWB 1TZHA 3H3BC 4R7NA 3VJ6B 3HNTH 3P4MA 1MHHA 2WBKA 4DFHA 1FBIL 2J8OA 5DMIH 2JCCA 4EI5B 4QWWC 1PKQE 1E28B 4Y4KA 1DQLL 3S4SB 1CZ8H 3JVGC 2BNRB 4APQA 5HHNA 4J6RH 1DEEA 1ZHNB 4GH7B 1BD2B 1Y6NR 5D71H 3QIBA 4OM0H 1WZLA 4GAYA 1G7HA 2XA8H 2PYEE 5IF0A 1MNUH 1QLRA 1HZHL 3ARGB 2HT2C 3BSZL 3HA0A 4MJ5A 5HDQL 5GGSY 5L88H 4N9GA 2NZ9D 3OGOE 4S1RL 4ZD3H 3PHQB 3MTRA 4DQOH 5C07D 3T0VA 2CR6A 4KTDH 4RGND 5EU3B 3C8DA 2Q76A 3GKWL 5GISH 3CH1A 5D7LE 1KLUB 5ELIA 1WT5A 3SDCD 3FQXA 2GHWB 3QIUA 4MD4B 4MS8D 5D72L 4WHDA 5IR1A 1TJHL 4UV7L 4WU5B 1S7WB 3SJVE 5IESL 2OMNA 2XRAL 2WIIB 5CGMA 3ARDD 5EZIL 1J18A 3K74B 1I8MB 1UCBL 4V2BA 2X4NA 1MIML 4KC3B 4NM8H 3P30H 4FQIH 4N68A 4P3DA 1MHPH 4Q2ZA 3MRQA 4D9RE 4RAVB 5DR5L 4EUPG 2EC9T 5IJVB 5FF6B 5D9SB 5F9JB 2CUIA 4XPAL 3KJ6H 3LKOA 5FUCC 3OR7B 4OKVB 5JUEL 4EJ1C 3DVNA 1F6FB 1AKJA 4TUOA 2PO6D 2APBA 5JHLH 3DX9B 3UMTA 3L5JA 3BP5A 1T83A 5CP7B 3GIVB 3D39B 3DXAD 4H1LB 4MB3A 3VI3F 2AGJH 3VFVB 4LAQL 5EOCL 1A6ZA 3C5SB 4WUKL 5CBEA 3V5HB 2ZKHH 1BQSA 1DBBL 2JIXD 1S5IL 4KXZH 3EJZC 2DB8A 4MD5A 2HRPL 1N5AB 3HMWL 4X98B 4QF1A 4Z7NF 2MQCA 3BW9A 3OKNA 4PTTB 3HPLB 4HS6B 5IFAL 1CI5A 4F7CB 4EEEA 3QO0A 3ROLB 4EXKA 3NFNB 4JZJC 5CS7A 1QLFB 2DL2A 3ULVE 5TDNA 3ZHLA 5E5MB 4IRSA 1B0GA 1FYHB 1LEKB 3GI8L 5IW1A 3O6FB 3X17A 4WWKA 5DVMA 2XT1B 4R9HA 1KTDB 1H5BC 3JSSA 5DWUL 4EZMA 5K9KA 4I18B 2A74A 4OGAC 1TTFA 2B1AH 4R90H 1XEDA 3WN5B 1RURH 4LHUG 2H32B 2FECI 4PJAF 4QHLA 2PW2B 1XF2B 3BZEA 1A6UH 3GBMH 1BOGA 3LQZB 4RFOL 3UJTL 1CQKA 5B22A 5BZWB 3VWKC 5BRZA 2OCFD 5KSAC 3SO5A 3IETB 4UT7H 3VE0B 1QEWB 3ZKSD 1T1ZB 2DYPD 2G9HA 5I1LA 4U3XA 5LG1A 3WIHH 1X44A 3H0TB 2ADGA 5B8CA 3A6CH 1INDL 3V4PH 1C1EL 1TJIH 5BV7L 4O9HL 4KMTL 3RWHB 1T22B 3CFJB 2E27H 5L7XH 1FC2D 3UTQB 4U2ZA 3I02A 4JFEB 2V17H 3VG9C 1NGQL 5E9DA 4ODHH 5T5NG 2DL9A 2HVJB 2DQEL 5TE4L 4YAQB 2EE6A 1NBZB 1IKNA 2NW3A 4MXQC 1VERA 1GGCL 2GT9A 5GRJH 4ZODA 3PJSA 3VXMB 4GT7A 4HIJB 2VKXA 3FQUB 1AP2B 2GYSA 5JTWA 3D3VD 3KLDA 4Z7UE 2DD8H 4E42A 1OY3B 3ARZA 1X5FA 3MFFA 4PJ9A 3E2HC 2QR0B 1J87A 4KI5C 4X4XA 2DM3A 1N7MH 3T3ME 2YRLA 2BCKB 5FA4B 5DD1H 4H1LH 3T2NH 4UOW1 4KJPC 4LLAA 1QOKA 2YUWA 3OAUH 2DIJA 3EYSH 2YUZA 1NCAH 2J8UE 2NYYC 3D85A 4PRIE 3S36X 5B4MD 1Z6JT 4WO4A 5LCVL 1HYSC 2D7PA 3MA7B 2B1HH 5HPMA 3TV3H 4LSPH 1CGXA 3HAEG 2HFEA 1CLCA 5I8EA 3P77A 5C3LD 3D5OF 1N64L 4KH2A 5H94B 4Y5VB 3IAPA 1PKQB 4YDIH 1IM9D 3ARXA 4LSRH 4NJAH 2BC4A 1Q9WB 2PYFB 3GK8L 4OZGA 1FL6A 3FOMA 3BEVB 1OM3L 1JK8B 3CZJA 4WV1C 4GAJH 3CSPA 4DVRL 3WXVL 4M5YH 2FECL 2X09A 2WZPD 4NRYB 3BH8A 2PYEB 5FKAB 1YMHB 2UWEE 4G3YL 4P2OC 3JWOC 4IRZL 4WFED 2AXHA 2QLVB 4M00A 3HI6H 1IFHL 5J7CC 4K7FA 43C9B 4QTHA 1CK0L 2WBJB 4OZHA 2MKLC 3AREC 4JKMA 1TZGL 4LPYA 3Q6GH 3QULB 1OCWL 2XN9E 5I1JL 1A1OB 4PLKD 5D7LB 3BPLB 2Z8RA 1DN2A 3MR9B 2EO1A 1WIUA 3SJVB 3KYKL 2XOTA 4RMUA 3SE9L 5ANME 3C2AL 4YHIB 3ZDXE 1KNOA 4JHZA 5ENWB 2FHCA 5AD0B 1CFSB 1SJXA 3SCMB 1W0WB 2VSDA 5B38G 5I15L 3PWPA 2QQNH 5JW4N 4OFYA 2FEEI 3SDDA 1U8LA 2APVA 3G5XA 1CGYA 2I5YL 5DJDB 2CRZA 1R3JA 4JFFE 4KQ4H 4X7TB 3SKUD 3PIQB 2FH8A 2XWJA 1BQHB 4PREA 2HT4C 3TFKC 4RBPH 5KW9L 4B41A 5FKPB 1RFDL 4L4VA 4M5ZH 4UUJB 3HI1B 4WUUE 1FVDB 2APTA 4KTYA 2XTJC 2ATKA 4FQXB 3TWCH 5FYLH 3LB6C 3CX2A 3VA6A 1T80A 1WZ1L 5HDOA 3G5VB 5A2LH 3SE8L 4O02L 5F44A 2DKMA 5KSBF 1IGYA 4NQDE 4QRRE 2W92A 5J1TC 1KJ2B 3I2CL 1YC7A 3GJFB 2L7JA 3O3DA 1QRKA 4JB9H 1AI1H 2KKQA 3VFTB 5J13B 4DN4H 1P5UA 4G9DA 3FL7A 2G75A 1CLOH 4FQJH 4AG4H 4MNQE 2YC1A 5I71C 4P4RB 4G43B 1T4KB 2B5IC 4G6JL 4N0UA 2D7NA 2VXSL 4KQ3H 4UT9L 3PUCA 1W72A 3NFSL 1XZ0B 1KPUA 5CEZE 4HWEL 3IDMB 4OIBA 3W11D 4F15C 5J1AB 1VENA 1TETL 3FB5A 3LS4L 4TN9A 3DLQR 1MFAL 3NCBB 2HLAA 4X5XB 5E70A 5E2UL 1NBYA 5GRWA 4KXZI 5JLZB 4NM4L 3MXWL 5HJ3B 1CGSH 3B2VH 1GHFH 3STLA 4NZUH 4QHNB 2I9TB 5F7WC 4NC0B 1RUAL 3NABL 2YPLA 3MRNB 3UTZA 1FZMA 2NY5H 3HNTL 2H1PH 1NCDL 1PX3A 1L4IA 3VWJA 4AM0A 2GJ6D 4XNYH 5DMIL 1LQSR 4LIQE 3ZE1E 1CZ8L 2ORBH 5J0BA 2AJXH 6FABL 1A64A 4J6RL 1DANT 3P9LB 3RNQA 3SDAA 4BFEA 2BSRB 3ES6A 4J8RB 5JDSB 4OM0L 3S8WA 2R2EA 3E6HA 3EOYG 2OJZH 4N5EC 3D25B 2ZUQC 2FEEL 2DLGA 2XA8L 5KS9A 3KYOA 3MACH 5DMYA 1MNUL 4Z8FH 4J4PC 5JW5A 4EDXA 4NO0A 5L88L 3OB0K 1XGUA 5C71A 4AEFA 3NZHH 1MLCB 3TZVB 2YPKB 4ZD3L 1DZBA 1YEDB 4CMHC 4DQOL 1HK6A 3ILQC 5IMOB 2LAGB 1A2YB 4KTDL 2VLJA 1Q1JH 4PJBE 4Z7UB 3B9KC 1N2RA 4W6XB 5GISL 1G7LA 4J2XA 2CLRB 1QD0A 5IEKA 4WNQA 3OAYH 3HRPA 5GSRB 3DROA 4APQD 4N0FA 5DJ8B 5CAYB 2CIKA 4DTGH 1S7SB 3QIBD 5D6DA 3HI5H 1UWXK 1IAKA 1FGNH 4F3FA 4U7MA 2J8UB 4NM8L 3P30L 4FQIL 4KUCF 4PRIB 5JXEC 1LK2B 3GMNA 1MHPL 2OTUA 3L3IA 3K80A 4B7IA 3T1FB 4IDJH 5CGTA 1QNZL 4P2RD 3B5HA 1JZ8A 3P4LA 4ZFGH 3KJ6L 5K9OA 3IJYA 4UDUA 1J0IA 2AXGB 3QQ9D 1NKRA 3DSNA 4F7MA 3VFPA 5SWZB 2N7AA 3IDNB 4X0KB 3BX7C 5JHLL 4UV4H 1CXIA 2Z31C 3T0DA 2ZCKH 1L7IL 5FOJA 3QIUD 4NZJA 4QGYA 2AGJL 3B8YA 5FYJH 1XCTB 2ZKHL 1M7XA 2UWEB 5E8NB 3OB8A 3QA3B 5D1XC 4ZAKA 3KLHC 3VXRE 1JYXA 5LQBH 5KSUA 3QIWD 3LKQA 3LPWA 5JZ7C 3T0EC 3OKMA 4XI5C 2WM0A 3BP6B 1BHGA 2XN9B 1RI8A 2A2QT 1U95A 2VERN 3LEVH 3QPQC 1T7ZA 1P84J 3RI5K 4WI3A 5DJZA 3WL9A 5C0NC 2X4SB 5A2JH 5T1LB 5EU4A 4ZFOB 1AKJD 4Y5XB 1BD2D 2IBGA 5ANMB 3ZLQC 2DQGH 3D69A 2X42A 2GK0B 2GAZB 3FT3B 4GAGH 3V6FB 4OZGF 4YHYB 5IHBA 4FQHA 4HDIB 1J8HA 1RURL 4KROB 4XP5H 1KCUL 2VL5A 2PXYA 4U1JB 4NKIH 1A6UL 4PJ8A 3GBML 4YZFE 3OAZK 2RBLA 2FO1A 4LQFH 2AABH 5GGRB 4UT7L 3AY4C 5J12B 1D3CA 2IPKA 1F11A 4IRSD 4R0LA 4JREC 2Z35A 4ZOBA 3A6CL 2PR4H 4WUUB 3V4PL 1TJIL 1MH5A 3B6SB 3WO3B 3W9EA 3CX5K 3OHXA 4ETQB 4Y16B 5D93B 1UVQB 2E27L 1XMWA 3PWNA 5L7XL 1EJOH 3CMGA 1U3HC 1R3LB 4ODHL 3KXFA 4NQDB 4QRRB 2E7BA 1S9VA 2ERJC 2K9UA 4X4ZA 1S9WA 1JGVH 4QHMB 2D7QA 4ISVA 5D1ZC 4YDJA 1MREH 3UYRH 1LVEA 2R29H 5GRJL 4GBXB 1U3ZA 2H2SD 5BRZD 2JJWA 5DHYA 5CGYD 3S97C 1B2WH 1IZKA 1Z2KA 4FG6C 3B5GA 4URTB 4LRIC 2IANA 3LOWA 2DD8L 2A6IB 3F58H 3KPNA 1I75A 3FFCD 4RISL 2MSPA 2HLFD 4LF3A 3RWEA 3OJMB 3RL2A 4K3GA 2D2OA 5ITFB 3QCVH 3IFLH 5DD1L 2EEDA 1KJMA 4X6CE 2DTSA 2BVPA 4OV5B 3OAUL 2XKNA 3EYSL 4L1HA 1NCAL 3MO1A 5F7LB 1JNHA 3HC4H 4R4BB 2B1HL 1G7MA 5CHNB 5L6YH 3TV3L 4LSPL 4GW5A 3O6FD 3WKNA 3ARFA 5HHME 3HG1E 3OZ9H 3BMVA 4L3CA 4XHJD 1M05B 4YDIL 2GEEA 3ZMRA 4NJAL 3VXQB 3MRBA 1RZJH 4P59L 2OS7A 1X5AA 5D1QB 4PJ9D 4ZNCD 3VH8B 1T7WA 3DOSA 1JWSB 2DDQH 4GAJL 2NXZD 4CMMB 4M5YL 2V5TA 5ILTL 1TIUA 4OCXH 2KUTA 5C2BH 2E9WA 4LCUB 4ZXBA 1OGAA 3H9SA 1H15A 2C1OA 3HI6L 4FFWD 4X8XA 2AV1B 1UT9A 3MNZA 3GNMH 3OX8A 1PG7X 3Q6GL 3NA9H 5IG7A 3LKPA 4LU5H 1I8LC 1MLBB 1YQVH 3QI9B 1MI5A 3QXAB 1ZK9A 3KS0H 3CU1A 3CXHJ 4JFED 4LCWE 5DSCA 4DN3H 5H37G 1OTTD 2ITDA 5HYJE 3M8OH 1U8NB 4Y1AE 5AYQA 4L9LB 43CAB 3SDYH 5GGQH 4P46A 5ESQA 3S88L 2X4QA 5KAQF 3TBYA 2QQNL 1I7RA 3RWJA 4QRSB 4X9HA 3LRHA 1LWRA 4H8WH 3QWRD 4ZUVA 4JJ5B 4KQ4L 1YY8B 2ADIB 2EDKA 4GW1A 4YEEA 1NCTA 2Y7QB 4K3HA 2LU7A 3LRGA 3TGXA 5E6IB 3T3PF 2DS4A 1INEH 3BDYH 1B6DA 4FFZH 3QUZA 3TWCL 3VXRB 3K8LA 4OZIE 4IMKC 1ACZA 4OD3H 1ZVHA 4HUXB 4L3EE 2XKSA 4LCIH 3FQRB 5H8DA 4KJYA 5DZNA 1Z9SA 3L1OH 4JB9L 1AI1L 5KZCD 4X4ME 1CLOL 4FQJL 4AG4L 3K8MA 3UX9B 3FJTA 5SX4I 2MQ0A 2FHFA 4MZ2A 3QFJE 4L4VD 5F7DB 1ZA6A 1IVLA 4OLWH 3RZCA 1V3MA 4NKMB 1NGXA 2JJVA 3M17B 3I6KB 5FGSA 4XH2A 1BVKB 1DBJH 3IDJA 4OZFA 4J3OC 5IVXA 2WBJD 5GGTA 4YGVB 1INQA 5IMLB 1CGSL 3B2VL 1GHFL 4L5FH 4NZUL 2BHZA 4PRPA 1SBSH 2A9NH 4HKBA 1V5JA 1FVEB 1MJJB 2NY5L 4R2GC 2H1PL 2AS5M 3MRGB 2DLHA 1IE5A 4I3RH 3VD4A 4XNYL 3RKDC 4G7YL 2ORBL 1S5HA 2AJXL 3BMWA 2MCG1 5FGBA 5JHDA 1I4FB 3C60A 1QSEA 3SCMD 1UXWB 2J6EA 4XVUC 3S3PA 1NEZA 4UIMB 3EHBC 1B6UA 1HHJB 3MRMA 1M71A 3BIBX 2OJZL 4OI7A 3MRFB 4LOUC 3VXNB 3V7AE 3FO9A 3MACL 1RMFH 1CFBA 4ZYKA 4Z8FL 1W72L 1W8NA 3NZHL 2ICEB 5IJKC 3ZKND 1A9EA 2YPLD 1Q1JL 3IF1A 2R0KH 1JE6A 4YK4B 5GGTH 5IEHA 5EO1A 2ADFH 4D9QE 4IOFD 4PGCA 1EA9C 4WW1B 3V79C 3TBTB 2ATPB 1ZGLM 3BVNB 4DTGL 1NBVH 4FMFA 3HI5L 5FO8B 4NGHH 1FGNL 3EFFB 1CXKA 4RGOH 4X99A 4MAYC 3U36A 1IQDB 4F9PC 3MQIA 4JQXC 1V7MH 1KLFA 2NPLX 3MYJB 4IDJL 2IADB 5DD0H 3QXWA 3BT2L 5LAXA 2EYSB 4XB8A 4OQ1A 1NFDA 1NKOA 3HG1B 5FYJD 1P9MC 5HHMB 4W4OA 4ZFGL 1PAMA 2OMBA 1V8HA 3R0NA 1AD0A 1ZMYA 2VLJD 1T89C 1TCRB 4H25B 5L2KE 1M6OA 4UV4L 3C5ZA 1OB1A 1R24A 3NCJH 4YPJA 5AZ2L 3L7FA 3KYMB 5FYJL 1FG9C 5TF0A 1M1SA 4YO0B 5BZDB 2EECA 4FFVD 4S0TD 5A40E 2X4PA 3HFMH 2ZJSL 3QQNA 3T0WA 1B0RB 3L3JB 3UTPD 3UTTE 1EZVX 5ACMA 3LSOB 3GMQB 4I0PC 5EUOE 2UZYB 4EKXA 5KG9B 4XMPH 1XT5A 1T3FB 3IAGC 4J3UA 1XR8A 4G6MH 3TVMA 3ILPA 4WFGE 4ONOA 3C6SA 3TNNA 2NX5E 4Z7WB 4KDTC 2EDHA 5HYJB 3STZB 1AGCB 4Y1AB 5F89A 3RWGA 4GAGL 5CIPH 2DMBA 1XF1A 2AJSH 4XP5L 3CVHB 4YBLC 1B4JH 4NKIL 2FDBP 4YHNA 2VZVA 1JN6A 5J9PB 4KK6D 4TTDC 1R3IL 5HGBA 2O93L 5EUKB 3H6JA 5LGJA 2VZ1A 5DK0A 2AABL 5F88B 3IKCB 1ZLUK 2FBOJ 3OGCB 3N1PC 3X12B 4DZBA 3RP1A 1RUPH 3JV4B 4WI8A 3MRLB 4JDZB 2Z0BA 4NRXA 1A6PA 1FRGH 4XNMA 4Y19E 3GSVB 4PB9H 2IFFH 3A67H 3E3QE 2MTPA 3MPCA 2VDRH 4OZIB 5EBLA 1CTOA 4P2YA 1EJOL 3LN4A 4L3EB 5F7KC 5EBWA 2PXYD 4IRJA 5J6GB 5DMKB 1JGVL 1M7DA 1ZWIB 4PJ8D 5HYSA 4ONFH 2GTWA 1MREL 1KN4L 3UYRL 2R29L 4BH7B 5SWZD 2R4RH 3BP7B 1B2WL 4HFWA 5GGRY 1ORSA 5C0BA 5DD3H 1UADC 3O45B 1U8PB 1LD9A 2HFFA 3PL6A 3QFJB 3L3HB 4HLZG 2FJGA 2P5EA 3D1MC 1KT2B 1HHHB 4X7DC 2W07A 1OD7A 3QCVL 3IFLL 4HCRA 5IMKB 2QJDA 4Z77B 5C0FA 4JKLA 1KTLB 2OI9C 4GRWE 3BO8A 3CC5A 2QADB 4YPGA 2YPVL 1JI1A 3MROB 3DIFA 4RAUA 3HC4L 4Z0BH 4W81A 5T1LD 5I1HH 5L6YL 3SO3C 1FO0A 1P4IH 5FB8A 5I6XB 1UYWH 1XIWB 3F7YB 5SX5K 5HHQB 3OZ9L 3MRCB 5DA0B 4FOMA 4XRCB 5E5UB 4JM2B 2DQTH 4PGEA 3F8UB 1TPXC 4XP6H 3VFUB 1RZJL 4Y5YA 4ZFOL 3PABB 3QJHB 4KROD 3MLSH 2DDQL 5E94A 1OP3H 4WI7A 3TBWB 5L2JA 3OTTA 4Y88A 3Q5OA 5HHOE 4NP4H 4NO5B 4OCXL 2ADJB 5F9WC 5C2BL 1AH1A 3CLFH 4M6ML 1ES0B 3AC0A 2P43B 1JF1A 2EEBA 5D6CA 4MDIB 8FABB 1MQKH 4GAFB 4ZDHB 5DC4B 3VXUA 4LMQI 3GNML 4GQPH 5I1IH 1T0NA 3ULUE 3NA9L 4MHHI 4LU5L 5DTFB 1A1NB 4HV8A 3RUGF 1WLHA 4WEBL 4PJXA 2C4FT 3MLTA 1MUJA 3EO9H 4XWOD 3HE7A 3PXJA 4EN3B 2R1YB 3FO1B 4BM7A 2JB5H 4JZOB 1FJ1B 3DUHA 3SDYL 5GGQL 4OF3A 1XGPB 1I8KB 2QQQA 4ZXBD 4PG2C 3H9SD 4GBXD 4BQ6A 5K9QG 3S6CA 4JRYA 4EUPB 1AGDB 4WY7H 1PZUB 4M8QA 4PLNC 1MFCH 1HINL 4H8WL 4L8SA 3WUWA 4NBXB 1NAMB 1S7VB 3QHFL 5BVJB 4JFXB 2VLKE 2Q3ZA 3HC0A 3GZKA 4DVBA 3WNPA 2R9HD 3N85H 1LE5A 5L2KB 1XF4B 5ALCH 5KANI 1MI5D 1JBJA 2XY1A 2ICWB 3MJ8A 1I7UA 4CVZA 4PJ7E 5ESAB 1QBBA 3W39B 1INEL 3Q48A 5C2UB 2EYRB 3ZHDA 3BDYL 1FG2B 4FFZL 3HZKB 5D2LE 3ZO0A 3CMOH 3QUXB 1K2DA 2BSSA 5C09E 3UTTB 3MJ7A 4OD3L 5C8JB 5HDBE 5EUOB 2P5WE 4GKZB 4LCIL 3U30B 3SY0B 3BPOB 3W0WA 3L1OL 2HKFH 1QZ1A 4WCYH 1HKFA 2C5DC 4JO2H 1H3XA 2MNUA 1YMME 1EVUA 3BIKA 2BVTA 3JUYA 5DDHA 4KHTL 4CN4A 3ZDYE 2NX5B 4LVHB 5DMGC 3VFNB 5IV2A 4GG6B 3GEWB 4QHUB 3QDJB 3BQUA 2VDMH 2E3VA 5HI5D 4OLWL 4LSQH 1YUHA 3QUZD 4F7EA 4P5KA 4LHUB 3IXTB 4JE4B 2V5MA 1MELA 1T2QH 3D0LB 3U0TB 5CJ8A 5GS2H 1RUQL 1T6WA 1ZLSH 4L5FL 1JWUA 1P7HL 5F72S 3RNKB 3V5DB 3LRSB 3RDTB 4X8JB 4I3RL 1A7PH 1OWWA 2QL1A 2FZ3A 4HZAA 2CDEA 4NQEE 4IJ3B 3KPPB 3BWUC 2DQDH 1EEZA 2K1MA 1H9VA 3TO2A 2QTEA 3RZCD 3D18B 5JPNB 2P42B 5E4IA 2YRPA 4M9OA 5F7NC 5GQBA 4HT1H 1C5BH 1HIMH 3ZKMD 3RWDA 2NY6B 3QB7C 3K4ZA 1AHWC 3GSXB 4OFIA 2DQUH 4WFHD 5KVGH 3C87A 2VAAB 4HUMB 3U9UB 3MNWB 2XZCH 1T0MA 4X9FA 3IFOA 3QZWA 1G9ML 2R0KL 1NAMH 5GGTL 4JDTH 1WAAF 2ADFL 3ZKXB 1X5HA 2W0LA 4U1KA 4RFEA 2EICA 3U6RA 1KTRL 5DJ6A 4K2UH 1KEMH 2FYYA 5D5ME 1DN0B 5H2BB 3C60D 1QSED 1F00I 3FB6A 4UINH 1NBVL 4RIRA 4GRWB 4LBEA 5E2VH 5FDWB 4RQQB 2CIIA 4NGHL 1MRCH 1NAKH 4RGOL 1HSBB 4L3AA 5GZOC 2XQYK 3PQYE 4BQCA 5EZJA 1V7ML 4XWGH 5JOEA 4KKBD 2J5LB 2X4RB 4MLSA 1VFBA 4D8PA 4DOHE 3MUGB 5DD0L 3DYPA 3JTTB 4UQ2A 3HAEB 2A6KB 5C70A 4K7PX 3PWVB 3GSUA 5CZXD 3K0WA 3MLYH 2OLDA 3MLVH 1JZ6A 5BS0E 1EUTA 1ROWA 3QQ3B 3MBEB 5T3ZE 1LP9E 1QHOA 5FK9A 3T1WA 4X4YA 4NKOB 5HHOB 1KIPB 3CFDB 3VRIB 2P47B 4QXWA 3NMEA 4PV8A 1I1YB 3HFML 5I74C 1A4JA 4RZCB 4XMPL 5INCA 3V6OC 1UB5B 4P57A 3AAZA 3RHWF 2AJZB 4J3TA 3OR7A 3X13A 2XNAB 2C3HA 1JWMB 3K3QA 4YNYA 1KCSH 5HHPB 1I9EA 1OL0A 1DANU 3RY4A 1CXFA 4P0DA 3NCMA 5F7UA 4X6DE 1UWEL 4MA1C 5B38B 3RWCB 1B4JL 4ZQKA 5ICXB 3RVUD 4NQCB 4F37K 5D2NA 1U8QA 2VLKB 3FKUS 1S7UB 4NO2A 4QRQA 3X3FH 4KI1A 3TVMD 3UZVB 3HE6A 1R5VB 3DETD 3W11C 4PJ7B 2F5AH 1K3ZA 3RBGA 3RGVB 5KOMC 2VMFA 1LEKA 4PJFE 1FRGL 4JVWA 5D2LB 4O2FA 2Z91A 5JNYA 1KB5B 2AXFA 4YHLH 2IFFL 3A67L 4PJXF 3VGEA 1I1AA 2VDRL 3BEWA 2P5WB 5I0ZA 4KZDH 1Z9OA 4GRWH 2H32A 3NPSB 4HAGA 4ONFL 2YD9A 4LVEA 3MV9E 4PP2B 3F5WA 4KTEH 1CDCA 1X7QB 5I30H 1YMMB 5GRVL 3RY5A 1JF6A 4NKDB 4WDIB 5EA0H 5DD3L 3VE0A 4JPKH 2QHLA 3RKPA 2LU3A 4R4ND 3ETBF 4XXCC 1FIGL 2A73A 4K55A 3O8XA 1QSFA 4OQTH 2D4DA 1W0VA 1OW0A 2NY4C 2V2XB 1VSCA 5HHXH 4UQ3B 2PUQT 4U1GC 5BOZG 1E0OB 1U8JB 1FNSL 1QRNE 4WW2A 1JPSH 1TXKA 1HQRB 3REVA 3C6LC 1D5MA 3W5NA 4NQUA 1FCCA 3V0VB 1KCVH 3EYVA 5I18H 5I1HL 4PGBB 3OV6A 1P4IL 2Y36H 2XQYG 4Y4KC 3OL2A 1UYWL 3V6BR 1WWAX 5GRUH 4PYGA 2YR3A 4YDVB 4APQC 2A38A 5C0BD 3X14A 2ITCA 4NQEB 2DQTL 4Y1AD 2WSKA 4OTXH 1EGJA 4XP6L 3MNVB 2P5ED 4Z7VF 2EE2A 4FFYH 3IDYC 3MLSL 1A0QH 4MCZB 4I8DA 4HBCH 4Q0XH 5MENE 4D0CA 2X7LA 2WMPA 4MMZC 4NP4L 3MRIB 3MV8A 1A6TA 4ORGB 3WHXB 3B9VA 4U1LB 3BFOA 3LN5B 3TYFB 2WW8A 3F7VB 2F5BH 1K3IA 2Y6SC 4ZG1A 4JANA 4PRNB 1MQKL 3V6ZA 3T4AB 1WT5C 5I1IL 5E99H 2KL6A 3QJFA 2ZSVA 3GMOB 3O3UN 2VJXA 3QFDB 5LWYH 2Y07L 3MX0A 1K6QH 5D5MB 5SWQA 1GRWA 1I9JL 1OSPH 5EFIB 3EO9L 5EU6B 2ARJA 1ZVYA 1WTGT 1FO0L 4LDOB 2KBGA 1J10A 2MQ3A 4IMLB 2JB5L 3D0VB 1HI6B 3TPUB 3PQYB 5F1NA 3L3GA 4QNPF 4PJHF 1KB5H 4NRYA 1WBYB 4DOHB 4U49A 2Z93A 4WY7L 3K2MC 1MFCL 1G7QB 3TN0A 2GTZA 4M7LH 3VXUD 1HSAB 3QFJD 1ERNA 3C09C 1T83C 5IMMB 5BS0B 3L3DA 4JFYB 4LEXH 4LLQA 5ALCL 1QR4A 1AJ7H 1A1OA 5D7LA 1OAUH 25C8H 4U1SB 4G6AC 1BFOB 3UO1H 4XNQA 4WTWA 4K07A 1UQSB 2QADD 2VZ3A 1WCBA 2ZG2A 2JLLA 2XWBB 2A77H 2GFBA 3LD8B 3FT2B 1FGVH 2CKBB 4ODTL 3K2UH 2ICWI 4JKWA 3SPVA 3IJSB 2DKUA 2BJMH 4N0YH 1KEGL 5CWSA 4CU7A 1XIWD 3OF6A 4IDLA 1RK1A 3SDXA 5ISZE 1BIHA 1KXVC 1RZIB 4IRSC 4HJ0D 1KCKA 3FQTA 4QY8A 4R7DB 4WCYL 3RL1B 4PG9A 1YYMH 4WWKC 1PG7H 3MV11 3C8KA 3TJHC 5DJDA 1AD9B 5CSBA 2VQ1A 1CG9A 4L8BA 2FJHB 4LPXA 1S7RB 3L3OA 2CXKA 1WC7A 5MP6H 3FONA 1UZ8A 3RVVD 5KN5A 4M7ZC 5E2WH 3T04D 4F57H 1C08A 4PIRF 3PGCB 1BFVL 3NFPB 4U1HA 4ODWB 4X6DB 1DUYB 2NLJB 1FVDA 4PV9A 2DWEA 2QQLH 1TLKA 4G6FD 4PRHE 1QA9B 1VGKA 2QBWA 4HWZA 5ID0B 3DHJA 3CFEA 3MBXH 2YD4A 2XG5A 1ZLSL 3O4LA 3LN9A 5B8CC 3QSKB 1TJGH 2J88H 2HLFC 1T20B 1F58H 4MJIE 5I16B 1A3QA 5I8CA 2NTFB 4I13B 1A7PL 2H2PC 4JZJB 2HTKC 4D0BB 1EDQA 4PJFB 4IOIA 4XMKH 5GPRA 2DQDL 3EO1B 1RUMH 3KWWB 1H5BB 1IKNC 3SKNB 3TCXA 4WHTB 4HT1L 1C5BL 1HIML 1U93B 5DEFA 3PGFH 3T2OA 3MV9B 2EDWA 3VMPA 2DQUL 4JRWA 1I9IL 4LLWA 1N0XH 4XPBH 4PJEA 5HJ3A 1QBLH 4YHZH 5DRXA 4CKVX 2CLZB 2DBLH 4QHNA 2XZCL 4PJ9C 1CIDA 3VWKB 5KSAB 4JFQB 1NAML 3I50H 1HHIA 4JDTL 4O51B 5JPMB 4RSVA 4JAMB 4Z9KB 3TP4A 1JJUA 1LDPL 4DCQA 1HILB 2Y5TB 4MB5A 4K2UL 4B0MM 1KEML 4N90D 4UINL 4HZLB 2MWCA 3PXHA 4PTUB 1QRNB 5BCAA 4H26B 5L0QB 5E2VL 3HZYB 4Y0GA 1A3RH 4UBDC 4WO4C 2BSRA 4FFWC 4MXVE 1MRCL 1NAKL 3MRJB 1OWRM 4J1UA 4XWGL 5C0EB 1J0KA 1A02N 2VDOL 3QDGE 1Q9OA 4L29A 2GSIA 4Y4FA 1BF2A 4NOBA 3L7EB 2HFGH 2XFXB 3MLYL 3IT8D 5T1MB 3U9PH 3QDJD 4YBQD 4MA3A 3MLVL 1OTTC 3OKYA 3IXAB 1H0DA 1A2YA 2FIRT 1ZT1B 2R69H 1IEAA 5IK3B 5MENB 3IDXL 3QO1A 3E2HB 1XGRB 2DOCA 3DBXB 5DJ8A 1N3NB 5IOPB 1OLLA 5F7HA 5FOBB 3GSOB 7CGTA 1RHFA 5DJXA 4G8FA 5M94B 1EFXA 4J12A 5SV3A 4F7TB 4Z6AT 2DLFH 1U91B 4Q9RL 3IB4A 4EVNA 4OCNC 1J1XH 2OQJA 3WEXB 1KCSL 1JGEB 4K9EC 2V6HA 2ESVA 1T1YB 3S5LA 1QPPA 3GSQB 2EH8H 2BDNH 5AAMA 4WV1B 3SDDC 5A3ID 4WVRA 2E9IA 5C0AE 3MCLH 4KAQH 2UWEA 1TZIA 4YR6A 1NGYB 3UTSA 3VW3H 4Q58C 5DYOB 4QRPE 5IROC 1ZANH 2I9LA 2V7NA 5I1DA 2R1XB 1CLZH 5F6IC 3GHEH 1YEGH 4YC2B 3MRPA 4U7SA 1VCAA 4M9PA 3UP1A 3AREB 1J0YA 3GUTB 3UAJC 5I66A 1OAXH 2F5AL 2R56H 4RMTA 3VFMB 1BLNB 1XF3B 2RIKA 3WHE0 4YHLL 1FV1B 5J11C 5DJYB 2J4WL 2P7TB 1I3GH 2UVEA 4NYLA 2DWDB 1DP0A 4JDVA 4CBPA 4UIKH 2R0WH 2JJSC 3DYOA 1WFUA 4KTEL 2YD2A 4GRLB 5I30L 2IH3A 4OFVA 5EOCJ 4MD0A 1I1CA 1JZ3A 2K7QA 4HPOL 1UWXH 5EA0L 4JFFA 2CK0H 3I75A 1U8MB 4JPKL 3HE6D 4HIIA 3BGFC 5HHOD 1T1XB 2AEPH 1OT1A 4OQTL 1NCBH 4M93C 1DCLA 5D7IA 3WLBB 5HHXL 4GRMB 2D31B 4PRHB 1ZLVH 1JGUH 4Y16A 1AO7E 3QAZC 1JPSL 3EOBA 4GG8B 4P4KB 3BGMB 2WANA 1OHQA 4NQDA 1XF5B 2VIRB 1KCVL 1YA5A 2YS4A 5I18L 3VWJC 4Z78B 4MJIB 4XP4H 2Y36L 3E1F1 4BSVB 1ZS8A 4DK3A 5GRUL 4KV5E 4J7RA 3WE6B 2FB4H 1XH3A 2BOBA 3SDAC 4ACPA 1PYWA 4GOSA 2XXMB 4MNQA 1D7FA 2EZ0D 3X11A 1KYOJ 5D7JC 2C7UB 3O8XD 2B5IB 3T2PA 1QSFD 4FFYL 1A0QL 4HBCL 4Q0XL 4BFIA 5C0RL 1R5WB 1XCQB 4JKKA 2BVQB 4MGXA 4NQCD 4XNZC 5KOVC 5H37H 4F15B 1KGCE 3TCLA 3CDGB 4FQQB 2F5BL 4RWYH 5EORH 5EO0B 3HKFA 5JO5B 4V1DA 3U0PB 3TA3B 4DW2H 5LKNA 1WBXA 4WRLA 5E99L 3JWOH 2YD1A 4P2QB 5LWYL 5I17A 1K6QL 1LE9B 4FFVC 5DQJB 3QNZA 1QBAA 1OSPL 1X5GA 2Q6WA 3ULVF 2BVOB 4MQSB 3VH8A 5C86A 3MV8D 1KF9B 5EBMB 1NMBH 1KB5L 5F3HB 4PS4L 2ZUQB 4BQBA 3QDGB 2EXWD 4MNGA 3GJEB 4D3CH 3FFDB 1RV6X 5MERA 1C7TA 4ZSOE 4M7LL 4RDQF 1QQDB 2EDDA 4LEXL 4CMHB 4PJBA 4XGZB 3PDOB 5FCUH 1AJ7L 3GSWA 3BZFA 3OJ2C 1OAUL 3B9KB 3WD5H 4QYOB 25C8L 4U6XA 4ZAKC 4LLVA 3UO1L 3Q6FA 4GFTB 1P6FA 1OQOA 2FIKB 3JV6B 4HUWA 5JMOC 2YEZB 1D5BB 2A77L 4HF5H 4JRXE 3QWOB 1FGVL 3K2UL 3VRJA 4LNRB 2BJML 4N0YL 4OCSH 5BXFB 1ZEAH 2F54E 3PNWA 3VRLE 1S8DA 3G9AB 5DHXB 4ZTOH 2IMNA 2JTDA 1KBGL 4BH8A 1UH2A 3TN0D 1YYML 1JUFB 2JB6A 3HZMB 1IEBA 4PJCE 3V0WH 3G5ZA 3MRDA 4JJ5A 2FLBT 3P40A 3LDBC 5FV2A 3OKKB 1F13A 3EOAA 1G7JA 4RBPK 4U1MB 2Z31B 5E2WL 4F57L 1IC5L 2PXYC 4Z7UF 4ZTPH 4LKCA 5C0AB 4PJ8C 3OR6A 5MEQA 2QQLL 3VFRA 4KJQD 5T5FH 2FD6H 3MBXL 1UKSA 3O3EB 5D1XB 2FATH 3T3MF 3L95B 3K46A 4NHUA 4HIXH 4R0LC 4AIZB 1LGVA 2Y4SA 1TJGL 2J88L 2J8UF 3WFHB 5AG8A 1T7XA 3EYOA 2ZSWA 1HHGB 4JO1H 5EU6D 4YFDB 4QWWD 1OF2A 1JPGB 3NACH 1OAYH 4JN2A 4DKDC 5F9AC 4OAWB 5ALBH 4CDGC 4XMKL 5EN2B 4MNHB 3PQYD 5DRWA 4POZD 4PJ5A 4S10A 3O3AA 3QUMA 3V4UH 1FFOB 3U46B 4KK9C 3QT2A 2DM7A 1FL5B 5GGUB 2HT2D 1BREA 4C4KO 4C56B 1NLDH 1N0XL 2UWEF 2O5XH 4XPBL 2PETA 4FQCL 1QBLL 4P49A 4YHZL 5FUOH 4NSKB 5J89A 2OL3B 2DBLL 1MWAA 3H7LA 4UTBH 3QXTA 4JFHD 3L5IA 1MJJA 3I50L 5L8JB 5DUPH 2RCSH 5E8DL 2B20A 1ETZA 4JREB 5ACZA 3MGOB 3GSNA 3KNBA 2AKRA 1U58B 1AO7B 1UXWA 4GW4B 1A3RL 3NOIA 4Z18A 4OSUH 1NH6A 2EE9A 3KYAA 1G9NC 3ARFC 1HEZA 1UJ3B 2IBBA 3ZDXF 3VXNA 3NN8B 5BQ7B 5D1ZB 4U6HB 5JQ6L 2A6DA 2HFGL 1A9BB 2GITA 3KLSA 3U9PL 4XWOC 1WZKA 4OGZA 4OB5H 1LDSA 1JTTA 2R0ZH 2D03H 5IB3B 3GMMB 1GGBH 1X5ZA 2O5ZH 5EO9A 1NMAH 4A6YA 3OAYK 3TBTA 2KH2B 4QXTA 4H0IA 4NCC2 1OTUC 1BOYA 3MODH 3DI3B 1G1CA 4X6CA 3BKCH 3W9DB 1EZVY 1A6VH 4UTAH 2RR3A 1MCNA 4ZS6D 3BJ91 4YIQA 5DRNB 3GM8A 5IQ9B 4OFKA 3RPIA 2R9HC 3KPOA 2CH8A 3HUJE 5FHBH 5JDJA 3AY4A 5MEOA 4JCMA 4Y4FD 1R0AL 2DLFL 1UKTA 1ED3A 1YECH 1A3LL 3LCYA 1MEXL 3G6JA 1JPFB 2Q20A 1J12A 1FFNA 4OGAD 4P46C 4JHAL 5A16B 2EH8L 5D7SH 3GGWB 1ACYH 2BDNL 3OKOB 1MCQA 1P7KB 1U3HA 1XGYH 3KYMA 2P48B 1KSRA 3MCLL 4M1CC 4KAQL 3PF2A 1UKQA 3VW3L 4QOKE 1AFVH 2AEQH 4LASH 1ZANL 5FO9B 2WLZA 4JFOB 2XWTB 1KPRB 2YD6A 4ZSOB 3VWKD 5KSAD 1B0WA 3LSOA 4ZUUB 1CLZL 5CEXA 3GHEL 4M6OH 1YEGL 1RHHB 1K85A 1EFXD 4XNXH 4K7PH 1B3JA 4QRUA 5C08A 4CU8A 1RZ8A 2YXMA 3QUZC 1OAXL 2OL3H 3ZE2E 1C5DB 3L9RB 3P4NA 3RY6A 2BMKB 5AWNH 1NUNB 4A2MA 2ESVD 3O4OC 4HLZH 4LCWA 2ZUXA 4E0RB 1XGTA 3KPRE 4JRXB 3ZE1F 1YN7B 1AQDA 1I3GL 2PTVA 1GZQA 3U4AA 4MXQD 1MVUB 2F54B 3UTSD 1K4CA 2OK0H 4UIKL 1T2XA 2R0WL 1DQMH 1EPFA 3BN3B 3KAAA 2BK8A 4CVWA 3FT4B 4PJCB 2YSSA 1NDMA 1K5NB 3RZCC 3L3KB 3SOBH 1CFNB 2F19L 1J88A 1CFQA 4S1DC 2VLLB 5GS1A 5IVNA 2AEPL 3KHQA 4KI5D 3ZKMC 4IEFB 4Z76A 2FH6A 1G9MC 1KELH 1NCBL 2MHAB 1ZHLA 4XCYA 4KJPD 1JGUL 4Z5RB 1QO3B 3O3BB 4G42A 1FAIH 3SKOA 2NYYD 3V4VH 1NCWH 1HYSD 3WUZA 5E8PA 3NH7H 1VADA 5AAWA 4OD1H 5IB4B 5EU7C 4XP4L 2HTLC 4NPYB 3S7GA 2YBRA 4AT6B 4UU9A 5FGBC 2FB4L 1NC4B 4X4MA 1JHTB 1F5WA 1G6VK 2H6PB 3E0GA 3O45A 3NCYS 1U8PA 5J3HC 5DLMH 2J2ZA 1KPVA 1KJ3H 1EAPB 3NIFE 2O61B 4N8VA 2Y06H 5CMAB 1UEYA 1EUUA 2CRIA 5L9DH 3TNMA 4PJGE 4MSWB 4P2OD 1KT2A 1R5IA 4GUPA 2OZ4A 4O2CA 1KACB 4D0DA 5AEAA 4FTVE 1S7TB 2V5YA 4LVNC 3V52H 3FB7B 4RWYL 5BO1H 5EORL 5GGVY 3ARED 3H42H 5DA4A 1HQ4B 2IBZY 1EHNA 4DW2L 2Q7YB 5C07E 3MRRB 3JWOL 1FZKA 4RGNE 3T77A 4JZNB 4O2EA 4L8CA 3MMEB 4N5UA 3CJJA 4YDLC 1BM3H 4TSBH 4OF5A 5FM5M 5DUBB 2APFA 1YN6B 1NFKA 5DS8B 3V8OA 4LQ1A 3CUPB 2IAMB 1EERB 1Q9LA 4NDMB 3OKEB 5HI3D 2CD0A 4PY8I 1A4KB 1CYGA 4W4OC 1WJ3A 3DV6B 4D3CL 4I3GA 1RIVH 5JW4R 1EEQA 1BBJB 4XBEH 3C5ZC 4JFDA 3WO4B 3EOTH 4YZFF 4ZDHA 3TFKD 5J06A 4HUNB 1UZ6E 2VQTA 1CICA 5FCUL 3CCHA 4LGPB 3DXAE 4PRHD 3WD5L 2RFXB 3TM6A 3JWDC 2ZCLL 1G0YR 2XTJD 2X4TB 5C0DA 4XZUB 4OD2A 4HF5L 5IGXH 1RJYA 2R1YA 4BQ8A 1WTLA 2JELH 3VXTB 4OCSL 5F1SA 1ZEAL 1CD8A 3HUJB 4MAYB 5HYQB 3TVMC 4ZTOL 3CZFB 3E8UH 5GGVL 3O9WC 3QPXH 1FZJB 1I7ZA 4N0RA 3V0WL 3S3JA 3PHOA 5IB2B 5B3NA 2PCPB 2D3VA 2FR4B 1LEIA 4XAWH 1AXSA 1LK3H 3BZ4B 3OXRA 3N06B 1MCPH 5SX5H 5T5FL 5HVHB 4P9HC 4QOKB 5C0JA 2FATL 3O41A 4YXLH 4XPFH 4ODBD 4X6CF 5TH2B 3UPCA 5IJKA 4P2QD 3TT1H 1I1RA 1AGEA 5C0CE 3DMMC 1IZJA 5E4EC 1R3HA 5E2JA 3SY0A 1IGML 1LEGB 5EC2B 3WIFB 4GXVH 1KG0B 3TBVB 3QEUB 4JO1L 1ONQA 1CD1B 1DL7H 3LEYH 5H35A 3NACL 1BZ7A 1OAYL 5CJXC 4LPUA 5ALBL 1NJ9A 3H7BA 3KG5A 3NCFB 3U7YH 3KPRB 4IRJC 4N5ED 4X6FA 4KKCC 1F4AA 2VZSA 5E95B 3V4UL 4ERSL 1XR9A 3RAJH 4MJ2A 1RJLA 4CAGA 3IXTA 2VISA 1CF8H 3HMXH 4YBLB 5BVPH 4X7CC 4U0RB 1Q38A 4I0KA 2O5XL 4BSWA 3ILQD 3PL6C 5FUOL 3B9KD 3GRWA 4UTBL 3D3VE 5DUPL 3DVGA 2RCSL 3B9EA 2PTTB 1CR9H 5F1IA 1B88A 4NJ9H 2AEWA 1GVIA 1P7QB 4GMSH 2UZIH 1T04B 4PJ5D 3LPGA 4MMXC 3VFSA 1UWGH 4Y19A 2HWZH 2DQHL 3F6LA 3ME0A 2LU4A 1K8DA 2W0PA 3CFKA 1IAIM 4Z7WF 4NC1C 4I0PA 3SGDH 2AK4A 4K3EH 4JY4B 4PJDE 3OKDA 2LAAA 4K7PY 5LGKA 2FX9H 1VACA 2R1WA 3T65B 3G5YB 4Y5YC 3LZFH 2ID5A 4OB5L 2Z31D 5EIQA 2R0ZL 2YZ1A 3GMLA 4NO3B 2D03L 5F9DC 4NT6B 1EXUA 4M1DH 5C0AD 1TQBB 3S96B 1GGBL 3MREA 1NMAL 3BIAX 4PJGB 1CS6A 1MCDA 2HJFB 1T66C 2UUDK 3BKCL 4FTVB 4CADA 1A6VL 4WFEE 4UTAL 4MAUH 3SGJA 4XNUH 5JZ7D 5MEPA 3T0ED 4CUCA 5JOFB 2EDRA 3QPQD 5FHBL 5C07B 4OZIF 5C0ND 5JW4Q 1YECL 3CSYA 3HE7C 4L4JA 1A7BA 3SDCB 3MV01 2XACC 4Z95H 4G80B 5DK2B 1FL3B 2EDXA 1D9KA 1X5IA 4JGUA 1TPXB 5D7SL 4LGSB 4M3JA 2W65A 4C56D 1MCFA 1KIPA 2YOCA 4HGMA 5DRZB 3PGDA 2MMXA 1MCKA 4BELD 5J4MA 5F9WB 1AFVL 2AEQL 5EDXA 4LASL 4A6YL 2VITA 1S9XA 3BE1L 3V5KB 2GUOB 1ZGLA 3HNSH 1BJ1H 4K7PL 1MQ8A 4XNXL 3RVVC 2GCYB 3CK0H 5D8JH 4YEFA 5IW6A 5A2FA 5F6HJ 2AJZA 1DE4A 3P3YA 4M7LT 1C16A 5AWNL 1JWMA 2BY1A 2JIXB 1E27B 1Z3GH 1GZPA 4PJIE 4JM2F 4PGDB 1U3HD 4JGJA 5I1GH 3HTLX 3M1BA 3FOLA 3PWLB 2OK0L 5D1ZD 2EDNA 1DQML 4JY6B 35C8H 4Z7QE 3L6FB 1QLEH 5C9KA 3PV6A 3RWFB 3S37L 4MDJA 3H9YA 3BQUC 5C9JB 5C08D 5C0GB 2W60B 2E6QA 1GC1C 5DFTA 3REWA 1YDPA 2NR6D 4MHHG 4PJ7A 1U8KB 1KELL 3GMPB 3RGVA 3DSFH 4WI5A 2Q8AH 5EWIH 1K4DB 5HDQH 2OSLB 1G7IA 3RVTC 3V4VL 5C09A 3OJDA 2M26A 4HH9A 2FSEB 1QR1B 4PRDA 3NH7L 4LLMB 1DVFA 4OD1L 5C0CB 5INDB 1FP5A 5DJ0A 4WEMB 4WU7B 1RK0B 2FL5A 4HK3J 4UV7H 3LV3B 5GRVK 4P5TC 4HEPG 2H3NA 4M8VA 3HCVA 3DV4A 2GJ6E 1GPOH 1LHZA 3BN9D 3G6AB 3ZTJH 4R96A 4DUXA 1MIMH 4CRPA 1VKXB 1KJ3L 4UOJA 2Y06L 4DGYH 1CU4H 5L9DL 4OZFG 1SJHB 3AXLB 2XTLA 4PG2A 2R23B 3EDJA 4XVJL 4HXBH 4G8IA 2V2WA 2ZOKA 3H42L 4PR5B 3DURB 3KDMA 4Y89A 3QH3B 4P99A 1VEOA 3D3VB 4M1GH 5EUOF 2ZZUT 2FWOB 2LE9A 2JCCE 1BM3L 4TSBL 1IAOB 5I2IB 1EO7A 3CPLB 1NEZG 3U4EB 4ALAH 1LO5B 1O7VA 4MWFB 2D4FA 1OP3K 1T1WA 2YUXA 1ZHKA 4TSAH 4AZ8A 1Q94A 2P8LA 4XX1E 3ARGC 4YLQT 4PJDB 3S34L 4P5MB 1SMAA 4NZRH 1BVZA 2XIDA 1UC6A 4P2RE 1RIVL 3HRZA 4QO1A 4PLJC 1QVOB 4XBEL 3JV5A 5CBAB 3EOTL 4QXGL 1Q0XH 3BHBB 4TSCL 1IM9B 2F74A 5DUML 4HMEA 3QUYA 4I2XE 4NN5C 1U8OA 3QDMA 3QG6B 1J05B 5I76A 2FGZA 4YQXH 4AENB 5JOPD 1YY9C 4P23A 5IGXL 3PP3H 4IMLA 4JR9H 3N1QC 5IVZA 3D0VA 1QFWM 4KRMB 2Y72A 5DQ9B 5DJ2A 4FXKA 5HTSA 1G0DA 5BOPA 1INDH 4C58B 4O9HH 1NCCH 3QPXL 5T5NF 2R15A 4ZUSA 4JFDD 4HUVA 2B4CH 1T7VA 1OAQH 4I5BA 3O2DA 1BD2E 1CICD 4GSDH 5EC1B 4C4KT 4QCIA 2BSTA 1IM3B 1LP9A 4QHKJ 1DDHA 1YEHH 3MV7D 1AGBB 4XAWL 2DTML 5ESVB 3ROOA 1LK3L 4HGWB 2R2BB 4ODUB 3QUKB 1MCPL 3BI9X 4TTGA 4HX1B 5D2NC 4NN6C 3LKRB 4UDTA 5JR1H 1NDGA 4KRPD 2OXHA 1HOCB 5ETUB 1E4XH 5I74B 4YXLL 4XPFL 1EEUA 4GRWF 1RJZB 1WWBX 3HE6C 3QRGH 3QRFM 4R2GD 4JFPB 2X70B 1NC2A 4GXVL 3ARRA 1DL7L 3LEYL 5AZEH 4U6TA 5TFSH 1MPAH 4JJHA 1I1AC 3FB8A 2FEDD 4XVUD 4PRBB 4RGMC 3EHBD 4PJIB 4XVTH 5EIIB 2HRLA 1URLA 1FZOA 4CVXA 1XAUA 3RAJL 1ND0A 3JBG7 2I60L 4MA1B 3K4DA 1CF8L 3DO7B 3HMXL 1L6ZA 5BVPL 4XCNB 5GS0C 4K3JH 1JGDB 5BRZE 1CE6A 3A6OA 3ARBA 3RWIB 1IL1A 4L8DA 2EZ0C 15C8H 4ZPTB 3O8XC 4PJAA 1SHMA 2A83B 1OW0C 4K3DH 4GQ9H 3FFCE 1CR9L 4NJ9L 3ULUF 1TVHB 4FRWA 4WW2C 3EDKA 4M03A 4GMSL 4OUUB 2K3TA 2UZIL 1KB9J 3TESA 1IFHH 4YDKH 1UJTA 1UWGL 2HWZL 1JHLL 1BZ9A 2VLRD 4MAYD 5E9DE 4OV6F 3SGKA 1OCWH 2GK2A 5HYSG 2P24B 3MJGX 5HGAB 2QSQA 4K3EL 3FTGA 3OQ3B 1G84A 1OT2A 1BX2A 1FNGB 3U83A 3V6OA 1PSKH 2FX9L 3KYKH 1JV5B 3UROR 2GJ6B 1F6AA 1CDGA 3LZFL 1T21A 3TBSA 3VFWB 5DJAB 3MCKA 4G8EB 1G7PB 1H3VA 1GAFL 1NEUA 4HLJA 1D6EA 1S7QA 3GB7B 8CGTA 4ZPVA 4QOKD 1OAKH 5LBSH 4OZ4B 1TTGA 3FO2A 3ARQA 4CW1B 1DQQB 2LV4A 2EXWC 3MRKA 2B8OT 3BUYA 4PJ7F 4PTUA 1ADQA 2NY4B 3NCEB 4RMRA 4U1GB 4MAUL 5ECJE 3B3IA 4I0PD 4XNUL 4CNIA 5D2LF 2AK4D 4M62H 1KCLA 1CT8B 3C6LB 3BUTA 5HGDA 1TZHB 1PZ5A 4R7NB 3P4MB 4U6VH 4Z0XA 5HDBF 1MHHB 4Y5VC 2YWYA 5I0DA 3CXDH 2JCCB 3KLAA 4Y4KB 4M7KH 1UENA 4FNLL 5EZLA 4Z95L 4APQB 5HHNB 1DEEB 2OM5A 3RJQB 2L4OA 4Y4HA 3QIBB 4DUWA 5FUZL 4JCLA 3ZDYF 4GAYB 1IBGL 4ELME 3JTSA 3IDYB 5IF0B 1JZ2A 1QLRB 2PKDA 3TN0C 4KY1L 3H9ZA 4MJ5B 4TTDD 1UGNA 4N9GB 4Y2OA 2ENYA 2AV7A 1T5WA 4OZHE 1EIBA 1ZAGA 2Q76B 3UJIH 5HPOA 3CK0L 1P7QD 3LS5H 4S1SL 3RIAK 3FQXB 3LS4H 3QIUB 3F7QA 3S35X 4PBWD 4DZ8A 5IR1B 5D7KD 5K59E 5E2UH 2X2YA 3L5WA 3MXWH 5GSVB 3DRTA 1Z3GL 4WFFD 2X4NB 5I1GL 3GSQA 4P3DB 2X10A 4Q2ZB 1G1YA 3PWPE 1NCDH 4R26H 3V2AR 5I73C 4NKQB 5E8OA 3WUWG 35C8L 1MY5A 4JO4H 1QLEL 3RVXC 1RZGA 3LKOB 3WNNA 6FABH 4FXGA 1QHPA 1QFPA 3DVNB 4Y2DA 2GW5A 1AKJB 3ARTA 1NFIA 4TUOB 1MAKA 4LK4A 3QXDA 4POZC 2EKSA 3C09B 4BQ9A 1F8TH 3BP5B 1MAML 1ULVA 2G2RB 2JK5A 4LNVA 1AY1H 4L4VE 1E4KA 1A6ZB 2GJZA 5B3JE 5CBEB 4FTVD 3QNXA 3DSFL 1YEEH 5E1AA 2Q8AL 5EWIL 4MD5B 3WFBH 4E9LA 4QF1B 3JV0A 4QEGA 5D5MF 3BW9B 1CWVA 4XP9H 3QO0B 1Y6MR 3IDIA 2CR3A 3ULVC 5ISZA 3QDHA 4L4TA 1S78C 5TDNB 3K4AA 4IRSB 2EDJA 1PX4A 5F70A 5IW1B 4Q6IA 5KSBA 4AJ0A 4WWKB 1GPOL 4IIQA 4N0UE 4X7EC 5T1KA 4PP1D 5DGRA 3VXOA 5K9KB 5EG6C 2A74B 4DGYL 1B4RA 5ICZA 1CU4L 1QACA 4M7ZB 1QNZH 1JVKA 1LP9F 4LDEB 4GRMA 4KUZH 4PD4K 3BZEB 5E8EA 4HXBL 4G8GA 1S9YA 2HVKA 3EZJB 3VA2C 5BRZB 1DVFD 2DMKA 4ODXA 1L7IH 4E5XA 1E4XI 3R0MA 5I1LB 2YPLE 4M1GL 1LILA 2ADGB 3R1GH 2WAHA 3I3EA 3FFCB 3OWEA 2C3XA 2WWKT 5FYKU 5HY9A 1Y18A 3MGTA 3WFCL 3KPMA 1NUGA 2RHEA 5HVWA 1D5XA 4ALAL 4ZS6C 2JJUA 2FO4A 5HBBA 3I02B 4TSAL 5E9DB 1ORQA 2AK1H 5IKCA 4NNYA 4D9LH 2NW3B 5KS9E 4Y4FC 2GT9B 1BQUA 2V5RA 4NZRL 3PJSB 1ZT4A 1N5YH 3TZVC 4X6DF 2J3SA 4AQ1B 5FYJE 2YD5A 5EPMA 3QZWG 5JO5A 1Q0XL 2VLJE 4E42B 1KN2H 3P2TA 4U6YA 3MFFB 2F58H 4PJ9B 2E9JA 4X4XB 1KCUH 2NXZB 4HXAH 4J23A 4YQXL 1LE9A 2R4SH 3X3GH 3UC0H 4DKEH 3GDBA 1G9EA 5EOTA 3ELAT 4JR9L 5C0CD 1GGIH 4HPYH 4PJFF 1BBDH 3D85B 4GMTH 3UTPE 3DUSA 3LKSA 4OM1H 4WO4B 3TT3H 5HPMB 4HJGA 1U92A 2EYTA 2VTFA 3QDGA 2HFEB 5I8EB 3KPLA 3P77B 1NCCL 3P73A 2R2CA 3G08A 4U33A 2B4CL 3WNLA 5DMGD 1OAQL 1JF5A 1DTUA 1KJVA 4GXUM 4OZGB 1FL6B 4GSDL 3FOMB 4HIHB 1AXTL 3BXNA 1P53A 3FN9A 3QDMD 1J1PH 4M6NH 1YEHL 2A6JA 3BYTA 4ELMB 3BH8B 2V7HA 1U0QA 1YC8A 1HH6A 1QBMH 5JR1L 1BIIA 1VB9A 4OBRA 3CVIH 5BW7A 5JMRA 3QWOA 1E4XL 4EDWL 4K7FB 4QTHB 4XPGH 2O5YH 3KJ4C 4I48A 4LNRA 4OZHB 1X5XA 4IHOB 4RISH 3QRGL 4KFZC 2KDGA 3E6FA 4LLUA 4F2MA 2H9GA 2VE6A 1MIEH 2RAMA 5I8OH 5AZEL 5TFSL 1IGJA 1MPAL 4WI4A 3GI9H 4U1IA 4NQVA 3QDAA 1A6AA 4XVTL 1KNOB 3RQ3A 5LGHH 1J8HE 4NRZA 3PWPB 3SDDB 1U8LB 3G5XB 4MQ7A 1Y0LA 1UXSA 3HZVA 3HLAA 3GIZL 4QRPA 5SWZE 2D9QB 1R3JB 2D0GA 4K3JL 1SBBA 2CJUH 2QKIA 4XTRC 4P59H 4Z7OE 5I75B 5KZCB 1D5ZA 4MCYA 2XWJB 4PREB 15C8L 3ZYZA 5CFHA 5DJCA 1C8PA 5F6IB 4AIZA 2BNUA 4LLDA 1QPXA 4NIKB 5DVLA 2I07A 4K3DL 5ILTH 4GQ9L 4L4VB 4LHQB 1CDUA 1HHGA 1FLRH 1JPTH 1P1ZA 4X7FC 4Y16C 1P4BH 1YNTB 3OMZA 3AU1B 5D93C 3OG6B 4OAWA 2N56A 3JXAA 4YDKL 3SGEH 5GZOD 1L0XA 3DGGA 4PPTA 1YYLL 1ZTXH 1IGYB 1EJ6A 5C0IA 3W82A 2IF7A 4PUBH 3RI5F 4JQIH 2PW1A 3O3DB 3D87B 1PSKL 4G9DB 2IH1A 4BKLA 4NN7C 3CLEH 2G75B 1ZHBA 2B39A 3BOVA 3MJ9A 2YC1B 2XA3A 1NMCC 3SN6N 2EIDA 4N0UB 3IVKA 5CEYA 1ZKAA 5B39A 1AGFA 1W72B 5J6HA 1KPUB 3S88H 4LCYA 3EO0A 4KVCL 5HI3C 1OAKL 5LBSL 3ORJA 3MLZH 4WHYG 3FB5B 1WWWX 2EC8A 3WDHA 2HLAB 3DX8B 1NBYB 3QEQA 2G5BA 1REIA 1NQBA 5IROA 2AJYH 3QAZB 3STLB 2NMSA 4WTZG 1BMGA 1WIPA 4M62L 2YPLB 1UJ3A 1ZA3A 3UTZB 1FZMB 3NIDE 4U6VL 1OARH 3LEXA 4AM0B 5FECA 5EU5A 3CXDL 1EHLH 1D5IH 4M7KL 4YHOH 2R0LH 3RX5A 2NW2A 1ZGLP 2X4OA 4JM4H 4DEPC 3MLPA 3C5JA 3RNQB 3VFOA 3RBSA 3EJJX 1UM6L 3ES6B 3U4BH 3MFGB 3E6HB 1YZZA 2LVEA 5DEZA 4U0QB 2YD8A 3RGHA 3IJHA 5FFLA 5KS9B 4ONGL 3KYOB 5JQHC 3HS0A 3H9SE 2D7MA 1SEBA 4XNZB 2JJSA 2NY7H 5JW5B 4K9EH 4EDXB 4NO0B 1XGUB 4ZUTA 2HT3D 2M8XA 1N8ZA 3TYGH 2XPGA 1VFAA 5IQ9A 1X4YA 4QXUL 2VLJB 1N2RB 3UJIL 5CSGA 1ADQL 2SEBA 3IRZA 3FHAA 3LS5L 5IEKB 2DQFA 4WNQB 1MI5E 3VG0H 3DROB 4N0FB 3GO1L 4Y4HD 2CIKB 1IAKB 1JPFA 4F3FB 2BOCA 1F3RB 4TVPH 4CJ1A 2C9AA 2P46B 5KVFH 2J12B 3GMNB 2OTUB 4NQXA 3RX8A 3L3IB 1ITCA 3S98A 5CLWA 4R26L 1IC7H 2EIEA 1TMCB 2VXVL 1SYVB 3DX6A 4JO4L 4G7YH 3IJYB 1PQZB 4LVOB 3ULSA 1KPRA 4JHBA 4UDUB 3UPRA 4F7MB 3FQNA 3VFPB 2CMRH 4ZUUA 1F4WH 4DUVA 1F8TL 3V9FA 1FC1A 1A1MA 5D7JA 2G5RA 4LMQE 1AY1L 5A2IH 4GKSA 3THML 2NY4D 1YEEL 4PBVC 1W72H 4ZAKB 5CKGA 4YGAB 2CUMA 3WFBL 5KSUB 2BNQA 3C6LD 2AJ3B 2FBJH 3LKQB 4XP9L 5IB1A 3OKMB 4M7JL 4MXVF 1U95B 4I9WE 4Y4KD 3SBWA 3TLRA 2VYRE 4FZ8L 4KDWA 5DJZB 3VXSA 3WL9B 5EU4B 4OCLC 1YNLH 3H9HA 2C1PA 4K71C 2C3VA 4OF0A 4LPVA 4H5SA 3IFPA 1S3KH 3D69B 5I1AA 4LCCA 3HHRB 2FGWH 3QEHA 5JORA 4FQHB 1J8HB 1NSNH 3BT2H 5C3TA 2VL5B 2PXYB 1ZLVK 5IVXE 2W0KA 4KUZL 4PJ8B 2ED9A 5SX4H 2Y6SD 4G9FA 4MQXD 1MY7A 1PVHA 4WFHE 3KYNA 2IJ0C 1CD0A 2WNGA 3UJJH 4L4TD 5AZ2H 2IPKB 1F11B 4R0LB 2Z35B 3R1GL 5FO7A 1MAJA 4G5ZH 3PWUA 3GBLA 1PY9A 1MH5B 3W9EB 3TJEH 3OHXB 4JY5H 2ZJSH 5DHVA 5JHDE 1QSEE 1BVLA 2P8MA 3PWNB 1EEYA 1F3DH 4TNVK 3B4NA 2AK1L 2J7LA 4D9LL 1S9VB 3K7UA 1S9WB 4AH2A 4ISVB 4OFDA 4YDJB 3R8BB 4KK8C 4DGVH 2DQIH 3EGSA 3I3BA 3R06A 1N5YL 1QKZH 5DHYB 3D2UA 1UB6A 2IPUG 1HQ4A 4HS3A 2ARWA 2CO7B 1P2CA 2DN7A 4QT5A 5IFHH 3KPNB 4X6BA 5BJTA 1KN2L 4LF3B 3RWEB 2F58L 4M61B 4G6AD 3ARVA 3RL2B 2ARJQ 5I1CH 2H26B 4HXAL 3B9AA 1PG7W 4W70A 1NPUA 2R4SL 3X3GL 1KJMB 3UC0L 4DKEL 1R3IH 5DVKA 2UVFA 2BVPB 2X4UA 3NAAH 3ARYA 4F7PA 1JNLL 2XKNB 2PN5A 1GGIL 1PEWA 3CUPA 4HPYL 2IAMA 1BBDL 4GMTL 4OM1L 3MO1B 3CSGA 3SGEI 3TT3L 2VB5A 1G7MB 2DICA 5EH1A 1Z9MA 3ARFB 1FQ9C 4WWKD 5CSZA 3G04A 1NFDE 1WITA 3TJHD 4L3CB 1KENH 4J3VA 3MRBB 1QTYT 2W91A 3GM0A 2F53A 1J1PL 4M6NL 4NNXA 5IFJA 3NCCB 3BP4B 1SMOA 1FNEB 2QSTA 1KN4H 3SEPA 4ZXBB 4JVUA 1OGAB 3H9SB 1H15B 3GSRA 5FAAA 1QBML 2C1OB 1Q9KA 3CFBA 1FPTL 5L8KB 3CVIL 4X5WA 3ARUA 4XPGL 2O5YL 1ZLWH 1BWMA 2LFGA 3MNZB 3OX8B 3BRDA 5IG7B 5JA9A 3LKPB 2VAJA 1TNMA 2NR6C 2EXYC 3RY6C 1MIEL 2H2PD 1MI5B 2HTKD 1T6VN 5BMFH 5I8OL 4H20H 1FN4A 5DSCB 3GI9L 5E9DD 3S5LG 2X1PA 2ITDB 4KV5F 2OTPA 2YPVH 2HMIC 4R8WH 2Y5EA 1J1OH 1JYVA 4P46B 4N1CA 5LGHL 1OSZA 3J8F7 3EFDH 5ESQB 2X4QB 3ECBA 4RRPA 1HXYB 3RTQA 1I7RB 3UDWA 4NQSA 5E2TH 3RWJB 5DMJB 5E24E 4ZUVB 1CDIA 2CJUL 3QQ4A 3BN9C 3C9NA 1SJEA 2ENSA 5TH2A 2WLYA 3FO0L 5GS1C 1FYTA 4GW1B 3IYLW 4FP8H 3WIFA 1FLRL 2EIZA 1JPTL 1P4BL 4M6MH 3QUZB 3D85D 4UBDD 4WO4D 1CVSC 1I8IA 3O4OB 4ETYA 1R3KA 1ZTXL 2XQBL 4FQ2H 5DD6A 2AJUH 5IBTH 4PUBL 4KJYB 4JQIL 3HPJA 1J7VR 4ZOAA 4KKLC 2CRYA 5DK3A 4WEBH 3O2WL 4KZEL 2JJTA 3CLEL 3BESR 4Z7WE 5C0BE 3CNKA 3UBXA 2E6JA 1G9NH 4HG4K 1JP5A 2GSGA 1ZA6B 2P5EE 3RZCB 5KBNC 1MF2H 2W9DH 1NGXB 2HN7A 2PTTA 4XBGA 3MLZL 3NGBC 4XH2B 3IDJB 4OZFB 4LSTH 1HINH 5IVXB 2VDLL 3QHFH 3D48R 3BDBA 2J8HA 2Z92A 1INQB 2AJYL 4HGKC 4HC1A 4PRPB 1EVTC 1AR1C 4HKBB 1MCLA 1MJ7H 4NC1E 5GJSH 1CGVA 5ICYA 4MJ6A 4S2SA 2XZAH 1OARL 2IQAA 2X44D 3VRLF 2HH0H 1EHLL 1D5IL 2CGRL 3C8HA 4YHOL 2R0LL 1S5HB 5ID1A 3G5YA 2FJFA 2VQUA 3G9VA 4JM4L 5JHDB 3C60B 1QSEB 1NEZB 4PJCF 2K7PA 3U4BL 3PWPD 3MRMB 4OFYD 1M71B 3SDDD 3T0AA 3MJ9L 1DJSA 4N8CH 1JYWA 3IDGA 1G6RA 3FO9B 5ERWA 3QHTC 1T5XA 4ZYKB 2H8PA 1XGQA 2NY7L 5TDPA 4K9EL 5IB5A 4KHTH 1X6NA 2HYMA 3FN0H 3TYGL 1A9EB 5GZND 4LVNB 1CICC 3VXUE 3IF1B 5IEHB 5EO1B 1F2QA 3WJLA 4TVPD 3ZTNL 3UAJD 5F3BA 4K8RH 1DQJA 2N7BA 5IW3A 3VG0L 4TNWK 4EN3C 1CL7H 3V95A 5FDYA 3GFUA 1J0HA 5DK2A 4KRPC 1RUQH 4AK1A 4TVPL 4X99B 5GS3A 3U36B 3ARDA 3RUGA 5KVFL 5DZOA 3ZDZE 1IC7L 5KSVA 5LAXB 1NFDB 5AUMA 5CIPB 1EH9A 1AD0B 1BPVA 4B53A 3V5KA 5FCSH 1U8IA 2CMRL 2FEDC 4LKXA 1F4WL 1M6OB 4N8PA 2VKWA 2PO6A 3C5ZB 1OB1B 2OP4H 3WFDH 1R24B 2ZOLA 1AIFA 4M4RA 3BKMH 1A6WH 4X9IA 3L7FB 3DXAA 4ZO7A 2NNAA 3DTXA 1A47A 2X4PB 5GIRA 5GGSA 2KQNA 2OR8A 5IHZA 4U31A 2Z4QA 3K81A 3ET9F 5FGRA 2FBJL 1CGTA 4OZFH 1G9MH 3VWJD 2Z8SA 4HH8A 4NFCA 1I3VA 1XR8B 3TVMB 3ILPB 3L6FA 1F97A 3SDAD 1YNLL 4X6EA 2AQ2A 3HR6A 2UUDH 4KU1A 3TNNB 5IHLB 3MOAL 3I6GA 3VDCA 1BJMA 3S35H 2NY2C 5C0GA 5D7JD 2WQ8A 4UMGA 2UV3A 1S3KL 3FCTA 5F89B 2FGWL 1LNUA 1CFTA 1VEPA 3P0YH 3AGVA 4NO0D 2J6EH 1NSNL 4I3SH 4YHNB 1JN6B 2P45B 4H88L 5HGBB 2RJMA 5TGBA 1DFBH 5CD3B 2DM4A 5LGJB 5DK0B 3NBNA 2CSPA 2GY5A 4HBQA 3UYPA 2I26N 1WICA 3UJJL 5IIEA 2DYPA 1DLHA 4G5ZL 5E4EB 2JE8A 1RK0A 5ADOH 1HWGB 4XHQA 4DZBB 3HUJF 4E41A 1K8IA 4NRXB 3TJEL 1FFPA 4JY5L 4XNMB 4N90E 1IQWL 2VABA 3B83A 5EBLB 1MHCA 3LN4B 2NY6C 4X7SH 5EBWB 4IRJB 1M7DB 5HYSB 3QCUH 4DGVL 2DQIL 4O5LH 4G9FD 1UA6L 3O9WA 1QKZL 4KKAD 1BZQK 5FM8A 1ORSB 2IFGA 5C0BB 4GG6E 1CD9B 3QDJE 1LD9B 1I3RA 2YN5A 5FGCB 2HFFB 3PL6B 3QH3A 5IFHL 2FJGB 2P5EB 1F90L 4ZAKD 1UWEH 1KXTB 5I1CL 1YQ2A 4PRAB 4OGYH 4I4WB 4M3KB 4RNRA 3SGJC 5C0FB 3NAAL 3BO8B 3CC5B 1FVCA 1MCSA 4HIEB 2VDNH 3U4EA 3BKJH 1NGZA 3ZE2F 3BRFA 1WAAA 4YPGB 2J5LC 3DIFB 3IGAA 3JWDH 4RAUB 1VA9A 4W6YB 3WKMH 4NZDA 1FO0B 3DMMA 1IJ9A 3BWAA 4P5MA 4PJDA 5FB8B 2B7DT 5DFVD 3U48A 1PW3A 1KFAL 2OTWA 1KENL 3LY6A 3O11A 1RIUH 4OLVH 1D9KC 4PGEB 5CBAA 4FHBD 5CJXA 3MBEC 1KIQA 5JXAH 4Y5YB 1J8HD 1NGWB 2QSVA 5IVOA 2OJEA 2CLVB 5E94B 5L2JB 3PWJA 1H8SA 4CL7A 2DI9A 3HR5B 2G60H 3SE3A 1EAJA 3LPFA 2V5SA 4YHMH 1I7TA 4F33A 2ICES 3DX7B 1JF1B 2HJKA 5D6CB 1Q72H 5K93A 3ULUC 3PE9A 4HJJH 1DUZA 1F6LL 3VXUB 1M7IA 1T0NB 1FIGH 1HH9A 4P9HH 4JEGB 4HV8B 3LQAL 4KRLB 3TIEA 3UPAA 3VCLA 4HUUA 2ZUVA 3MC0A 4PJXB 3KPSA 3MLTB 5BMFL 4OCWH 4H20L 1FNSH 1WBZA 1MUJB 2FLRT 1PD6A 3HE7B 2F53D 1W0YT 4UNVA 4BA8A 3KXFD 2VN4A 2KQMA 4HKJA 3CSBA 3LKNA 1TITA 4R8WL 3CX5J 1J1OL 1CXEA 4KK9D 4R3SA 3EFDL 2R2BA 3NIFF 3FHQA 2BRQA 4JRYB 4RA0C 5E2TL 4M8QB 3UBXI 4TQEH 3ZSTA 4L8SB 4PJGF 3WUWB 4MB4A 2IAND 3LHPH 2P1YA 3LH2L 2Y25A 3HC0B 4DVBB 3BH9B 1RJZA 4PP1C 1CIUA 2X40A 4YHPA 4F8QA 4FP8L 3RGVC 3MJ8B 1I7UB 5SWSA 4CVZB 2QV2A 5K33A 4P3WA 3NZ8A 4LSVH 1HXMA 4MX7A 4WJ5B 4KHXH 3CH8A 4G6FB 2O26U 1CL7I 4PRBA 4ENED 1K2DB 2BSSB 2X1OA 3MJ7B 1DVFC 2NY3D 4HCRH 1A7QH 4FQ2L 2AJUL 3ARFD 5HYFA 2NXYD 2XI9A 3IU3A 2IBZX 4OI9A 5IBTL 5ITBH 3W0WB 2Y07H 4B50A 4N9OB 3ZYIA 2FNBA 3MCG1 4YFLF 1I9JH 3MLXH 2WUCH 3BIKB 4HKXA 4PY7A 1FYTD 1FO0H 5DDHB 4HEME 1G9NL 3GMRA 5IV2B 3MRHA 4PBXA 4OCMC 3TH2T 1IGTA 1JMZA 3BQUB 1MJ8H 1P69B 1MF2L 1OGAD 2W9DL 1YUHB 1QSFE 4XCEB 4F7EB 5FYKH 1OTUD 4M6AA 4P5KB 1UZ6F 4NQCE 4F37F 4LSTL 2EO9A 4OUUA 5HVGB 1EHXA 3TIDA 5I1KH 1JWUB 5FHAH 5L8LB 3SHSA 4EI6A 4JLRA 1HHKA 1GIGH 1F3JA 2YA2A 1MJ7L 3N50A 5GJSL 2YHGA 2GQHA 2XZAL 5E00B 1S7XA 2XICA 4N1HB 3WXWH 2HH0L 4MJ4A 4U1NA 2FZ3B 2CDEB 3AB0C 1EEZB 4ZFZA 4ODTH 4P46D 3TO2B 3VXPA 3DJ9A 4N8VG 5LJYH 2UYLA 1L6XA 2B4CC 1KEGH 4N8CL 4AEHH 4JQVA 1ZT7A 4M1CD 3U2SA 3MV8E 4ZFFA 1OGTA 4OZ4A 4HG4J 2DF3A 4Y7MA 3HNVL 4K8RD 4Z7VA 4TUJA 3WV0A 5HGHB 3FN0L 4JFZH 3TO4A 3QUYC 4LEOA 1C5CH 1T0MB 3PG2A 1TQCC 4Q74A 3O2VL 3QZWB 2Q86A 2WV3A 1BFVH 4U1KB 4RFEB 3U6RB 4K8RL 2CDFA 5DJ6B 2VLMD 2FYYB 4HC1L 3EYFA 1CL7L 1EV2E 1TVBA 2R2HA 2WINA 4P23C 3FB6B 1Z5LA 4YJZL 4RIRB 2W0FA 4LBEB 5E0QA 1MHEA 2CIIB 1AC0A 4RCAA 2LTQC 2HG5B 4I9WD 2VWEC 5EZJB 5DEGA 1C12A 3P9MA 5F7EH 1CFVH 5E7FA 3V7AG 2NY0C 4F80A 1VFBB 4D8PB 3W5MA 2C3GA 3T4YA 4DJMA 1I9RH 3HB3C 4UQ2B 4P2RA 3GSUB 3TH4T 4P5TA 4ONHA 1QFHA 1G6RL 1N59A 1PY4A 4PJHA 4JPIA 4S1DD 1GCFA 5SV4A 2OP4L 3WFDL 3BPCA 3EDFA 5FK9B 3BKML 4I2XA 1A6WL 3FRUA 4X4YB 4OLYL 4NN5B 4HQQH 1SY6A 3LD8C 1I9IH 4PV8B 3T0BA 3KPQB 4PRPD 4XBPA 1GGTA 5GSVA 1GC1H 1P84K 4HKZB 1CQYA 1RU9H 1IAIH 2D7TH 1A4JB 3SKMA 4OIIH 3QIWA 5E1HB 3SDXE 3VJ6A 3CDCA 5INCB 1FE8H 2DJ4A 1LDPH 2HTLD 4P57B 4S0SD 3AAZB 4EI5A 5JHDD 1E28A 3S4SA 3QP3A 3WNOA 5EU6E 2BNRA 4PJDF 3S3SA 3X13B 4YNYB 5J3HD 1ZHNA 1BD2A 3QG7H 3S35L 2ZNWA 2D7OA 2G2RA 2YXFA 1FDLH 3P0YL 3AS0A 2VDOH 2J6EL 4I3SL 3I6LE 5T1DL 1WFTA 3ARGA 4ZQKB 3WIHA 3ZL4H 2AEIT 3ARBC 2P44B 4G6KH 5D2NB 1DFBL 2Z8VC 4NN6B 2H45A 3PHQA 1U8QB 3SKJH 3O4LE 4QRQB 4NO2B 4KKNA 5EU3A 1Q8MA 2WWMC 1SY6H 4WHCA 1N4XH 1CE1L 1KLUA 1WEJH 3IDXH 3HE6B 4JFHE 1KV3A 3EZ8A 4MD4A 5TDOB 5ADOL 4LRNH 4OF8A 4WU5A 1S7WA 1CXLA 1A5FH 5T3XH 1J86A 3AM8A 2WIIA 2Z91B 4O2FB 4FA8A 5JNYB 2AXFB 1I8MA 5DQDH 5IBLC 3SGKC 1I1AB 3BEWB 2E7CA 4RGMB 4RAVA 4X7SL 4LPCA 2XV6B 5HYEA 5IJVA 5FF6A 3S37X 2DJSA 5D9SA 1EBPA 5F9JA 3QCUL 4Q9RH 3VU2A 4F58H 3F5WB 2EDOA 4JGMA 4O5LL 4OKVA 4PJEE 9CGTA 5FUCE 4XCFH 5AYUH 3C5ZD 3DX9A 4HSQA 5CP7A 3GIVA 5HVFB 3D39A 4H1LA 1PDKA 3VFVA 2MJWA 4E41D 2A73B 3C5SA 3O8XB 1FORL 3V5HA 1QSFB 3FFCA 1W0VB 1AE6H 4OGYL 5L0QC 4XPHH 4WW2B 1N5AA 4IS6B 4X98A 2VDNL 2HT3C 3BKJL 4PTTA 3HPLA 4HS6A 3REVB 4F7CA 2DBJA 1D5MB 2GIYA 4WGVB 3ROLA 4OLZL 3JWDL 4MZ3A 3WKML 3EYVB 4PJIF 4NZTL 3NFNA 3VGGA 3Q1SH 3ZT7A 5TE6H 1QLFA 3O9WD 2W9EH 3DRQB 5E5MA 4KGLA 4RX4A 3O6FA 5I1EH 3X14B 1C7SA 2ITCB 4JPVH 1KTDA 2ED8A 4Y4HC 1RIUL 4OLVL 5JXAL 5FM5O 2J4WH 4Z7QF 1E4WH 4I18A 3EJYC 2DIBA 1OPGH 1BP3B 3WN5A 4D0CB 2X7LB 1UM5H 2G60L 1A6TB 3MV8B 2PW2A 1XF2A 5DD5H 4YHML 3LQZA 4P3CL 2VXUL 4I77H 5DFWH 1ZOXA 3VMNA 3PP3K 4HPOH 3CFIC 5BZWA 4JANB 1Q72L 3IETA 1QEWA 1T1ZA 4OLEA 3V6ZB 4R97C 3DMMD 4HJJL 1HYRC 4NFDA 3CXHK 3H0TA 3QJFB 2ZSVB 4P9HL 4O00A 1RUKH 1GOFA 2DAVA 4F8TA 3ARWA 3RWHA 5TPWH 1T22A 4OCWL 5SWQB 3CFJA 4TRPH 4C55A 1MSPA 2ARJB 5LXGL 3UTQA 2ESVE 4HIHA 4IRJD 4JFEA 1TCMA 4KKCD 2HVJA 4JKPH 5F1NB 4YAQA 3L3GB 1NBZA 1DBKL 4AL8H 4ELMA 3UTSE 2Z93B 3VXMA 2X9XA 4Y2DC 4TQEL 2VL4A 4HIJA 3FQUA 2M2DA 3TN0B 1RZ7H 2GTZB 3LHPL 1AP2A 4YC2C 2H32H 3PL6D 1A7NH 3SE4A 3QWRA 4X9BA 3L3DB 4LLQB 3F65A 4IHOA 1E4KC 5C0RH 2QR0A 3WHE1 1L9MA 2WUBH 3KPSD 3ALPA 2EKJA 5GS0H 4KI5E 2BCKA 4XNQB 5FA4A 2V9TA 4LSVL 1WCBB 4GKNB 1EO5A 4KHXL 2GFBB 1CBVL 2JCCF 1PGRB 3R8QA 4MQXC 3FQWB 2E8YA 4RMQA 3SPVB 4HCRL 4HK3N 1A7QL 3MA7A 3EDDA 3PP4H 4WHYH 2AW2A 2BHYA 5CWSB 3ZTJG 4JN1H 1RK1B 3SDXB 2OR7A 5ITBL 3AVEA 2EE3A 1MRDH 3FQTB 4QY8B 5F7YC 4GRLC 5DC0A 4Q6IC 4PG9B 5H94A 4Y5VA