3EYSH

Pfa1 fab fragment complexed with pyro-glu3-a-beta (3-8)
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
223
structure length
215
Chain Sequence
AVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMGVGWIRQPSGKGLEWLAHIWWDDDRSYNPSLKSQLTISKDAARNQVFLRITSVDTADTATYYCVRRAHTTVLGDWFAYWGQGTLVTVSAAKTTAPSVYPLAPVSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords If kappa light chain
publication title Structures of Abeta-related peptide--monoclonal antibody complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 47
structure length 215
sequence length 223
ec nomenclature
pdb deposition date 2008-10-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eysH01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3eysH02
3VFNB 3WN5A 4RNRA 4HAGA 1H5BA 2VH5H 4LOUC 1I3UA 2YKLH 2AJZA 2DF3A 1MH5A 4OKVB 5IIEA 1B3JA 3HR5B 2F9BT 4E0RB 1DL7H 2VNCA 3VG0H 4D9LL 3JWOH 2CDGB 2O5XH 4TSCH 1VFBB 3K1DA 4Y4HD 1QFUH 2ED8A 3WNOA 2QHRH 4X6CB 4LU5L 1E6OH 3MO1B 4QCIA 2FHBA 5C92A 3GSQA 3PHQA 3U46B 1BFOB 3G6JA 4TTDD 2EH8H 4XPFH 3L3KB 1RIVL 2BSED 3S35L 1PYWB 1TPXB 1MFCH 4Y2DD 4KKAD 3CVHL 4X9BA 1IJ9A 3GI9H 5E5MB 2E9IA 4LQFL 3N50A 4P46A 1HHIA 5TQ0L 1NUNB 4XX1E 5C0EA 3R06B 4DK3A 2A77H 3ULVF 4PJIF 2HJFB 3S7GA 3FFCA 3PWPD 3ILPB 4MJIA 4N1HB 3D5OF 4K71C 2PW1A 2AEQL 1A5FL 3ZKNC 1INQA 2NY3D 1WF5A 4LLDB 3S97C 3LSOB 2DQCL 3B2UC 1M7XA 3TNMB 5T3ZL 3TN0A 4U0QB 3FCTB 2CIKA 3UXFA 4DGYL 3S37X 2XZQH 2GUOB 4YX2L 2YZ1A 4KI5D 4BZ1L 2ADGA 5FDYA 5MEPA 5T1KA 2DQFB 4JFQA 2F5AH 4HX1B 1OGAA 5CIPB 3C6SB 3GMOB 3UDWA 2FSEA 1PSKL 4F9PC 4Y4HB 1JNHA 2FDBP 4X6DB 3LDBB 3HR6A 3WLBB 3D3VA 2VLJA 1LWRA 4Z7UE 4N90E 4UDUA 3O6LL 4CU8A 3ARVA 4FFYH 1JTPA 5DUMH 3MLSL 5ESQB 2VITA 5DC4B 1AD0A 3DMMC 4EI6B 5FM5O 4NRXA 4Y2DB 4PR5B 1MJ7L 4GLRI 1I1AD 2DN7A 2XN9E 5JXEC 5DTFB 4GUPB 2VUYA 2AQ3A 5C09B 1Q1JH 3AY4C 4OUUB 1WWWX 5KSAD 1H0DB 3ISWA 3PWPB 2MQ3A 2NY1D 3RUGA 1H9VA 2AJVL 4JO1H 1J05B 2ITDB 4JFZL 5GZOC 2H32A 2NY3B 4U1NA 2PYFB 1F2XK 3ARDC 2YXFA 4Q97A 2DWEB 3BQUC 3MMEB 3VXTB 4F7CB 1MWAH 5JO5A 1UKQA 3QDGD 3HHRB 4FXGA 5MEQA 2IQAB 4WRLA 4X5XB 3W2DH 1G7QA 5ILTH 5KANG 4JKMA 2K1MA 4NNXA 1R0AH 4FRWA 2QQKH 3HFMH 3VGGA 5BXFB 4HC1L 4R3SA 4HKJA 4R97B 4LLUA 4XAKE 4BKLB 1B0GA 5IVXF 1CF8L 5I19L 1OTSD 3CCHB 2DDQH 3L5WA 2R4RL 3F6IA 3HCVB 2PO6D 2PTTB 4DQOH 3WFHB 2AJUL 4WO4C 3ZT5A 1G9MC 5CSZB 5FHAH 4XT1C 1RURH 1FO0H 2JJTC 1TZIA 3U83A 4OQTL 5TJWK 1CL7I 2F54E 5SWZA 1AJ7H 3RVTC 2HH0H 3OAYH 1WFTA 1ZK9A 1W72H 2UYLA 35C8H 5KSAB 4JZOA 2VZ3A 5DJ8A 3C5JA 1OM3H 2NY1B 3NZHH 1A4JA 4O9HL 4AIXA 1AGFB 5JW3H 2WUCH 2ZUUA 5DYOA 4LKXA 4BZ2H 1ITBB 3LQZA 5E1AB 5B39B 1A1NB 3ZHLA 3P4MB 4MNGE 1U8OA 4OFYA 1A7NL 2VXSH 4WDIB 3CDGA 3D39E 4TRPH 3VGDA 1K2DA 3LKSB 1QFWH 3QDGB 5JOPE 4X5WA 1XR8B 1ZA3A 1CFSA 5HVGB 3UO1L 5F3BB 1P7HL 5HGBA 3BP7B 3VD3A 2Z91B 3C8KB 4XP4H 4G6JL 5L2KA 3WDIA 1Q0XL 1YEDA 1HE7A 1NMBL 4GW1A 1RY7B 5E00A 3L7EA 3VXOB 2YPLE 5HBBA 4UUJB 2PO6B 5C86A 1KACB 4JFHE 3CPLB 4UQ2A 4ZDHB 1YEHH 4I2XB 3QUYD 3H3PH 4QNPE 2EDHA 5F96L 4YFEA 3MX0A 3TT1L 3FB7A 4F3FA 1DEDA 4ODXB 3VGHA 5D7SL 4JR9H 3PXHA 2CIIA 5KS9F 2BOCB 4ZTOH 3SGKC 1YC7A 1F3JA 4UILL 2FR4B 1IT9L 1DLHB 3E6HB 1A0QL 2DKUA 4ENEC 5FO9B 1LK3H 5HGHB 1F4XL 1KB9J 3CFDA 3SDAD 1E4WL 4HFWB 3GJFA 4WW2C 4XNQA 3KJ4B 1OD7A 2CDFB 1U8QB 3BXNA 1I9RL 7CGTA 4NT6B 5IVXE 1ZMYA 3HAEB 4GG6F 5FYKL 1U8HB 1ZSDB 3BP5A 5E4IA 3DYMA 5C0JB 5FUZH 4J23A 1PLGH 2NW3A 4POYA 5ACZB 1P4IH 4D94A 3GMQB 3HZKA 5EZJA 4IRSB 4HS3B 1I3RB 3WSQL 3KYMB 1T21B 2B5IC 5EU3A 5DWUH 2NX5A 2VZVA 1MJJA 3UC0L 5EOCJ 1DQJB 5IBTH 4X9FA 3C6LC 4PLKD 1S7VB 3QUYB 1EMTH 3UTSA 4QEGA 4HHAA 3ARGA 5JOEA 2QQNH 2GTWB 3RPIB 5J1AA 1G7MB 2Q1EA 3TVMA 5D7IA 3EFFA 4HIJA 4U1SA 3QFJE 4NKDA 1AI1L 4OIBA 7FABL 3MACL 3NN8B 2ATKB 4TSAH 3LEXB 5KN5B 3LEVH 4XCEA 5E8DL 1A6VH 4KAQH 4JGMA 3KR3L 3NFSH 2H1PH 3NPSC 3GHEH 5DJ2B 4FFVC 2VRAA 5CWSB 3MUGB 1OSPL 2BSSA 4ODTL 3SKNB 4Y5VA 4EOWH 3RWGA 2OTWB 2EYTA 4PGEA 5T3ZE 2EZ0D 4O51A 3R0MA 2FEEI 1VEOA 4Q74A 3SDAB 4FHBD 1U8JA 1KB9K 2DQIH 4PRHD 4Z9KB 1TVBA 4GKSB 1VFUA 5GRYA 5GGVL 2C1PA 2VN7A 4X6BB 4F7TB 5CIPH 2XQYK 1XCQA 3RKPA 2NY4D 4NNPL 5AUMA 5IB1A 2AV7B 1I9JH 4KPHL 1UADC 3VFGL 4RFEB 3PNWA 4LLQB 4X5LA 1MFEL 3MRKA 4XI5C 2VE6B 4EI5B 4C4KT 1FC1A 2L4OA 4XHQA 4HXAH 5C6TL 4KFZC 3IXTB 3NFPA 5L6YH 2ICWA 5FDWA 4IRZH 1U3HC 2FX8L 2GAZA 3P9LA 5ISZD 5HI3D 1WZ1H 3OF6A 1ZAGA 5GXBB 4LCYB 1D7FA 1G6RB 3QZWA 4XMPH 2MNUA 2GJ6A 1KN2L 1L0XA 2C1OA 1CGVA 3DTXB 4LSDA 2AEPL 5C0CB 4ZD3L 1I75A 3BGAA 4JQXC 1CYGA 5CMAB 2Y5EA 3GSRB 3ARFC 5D1ZC 1OWRM 1DUYA 4PRHB 3G04B 5DURD 1YMHA 3L3GB 3ROLA 2A74B 4PUBH 3B2VL 2HVJA 5F7DA 4HWEH 4YXHH 4OZIB 2NY4B 5FM8A 3DOSA 4ODBD 3S88H 2VO5A 3PP3H 2C7UB 3FRPA 5EIIA 2YRZA 5DI8A 3BAEH 3EYQC 4ZS6C 3S37L 1AFVH 2P44B 3AAZA 3KDMB 2MPAH 2SEBB 3B6SA 4WCYL 1ZVYA 1S7WB 3WFCH 1K4DA 1OAKH 1R3LA 5D7JA 5HDQL 1QHOA 2RFXA 4XP9L 1DQTA 4FQJL 3DLQR 3MNVA 1T0NB 3CVIL 4HKXB 1MCHA 3F62A 4Y5XB 4EDXB 4WHTB 5I71C 5ISZB 1TETL 3DYOA 4HMEA 4MQ7B 4MA8H 4Y2OA 4OIIL 1IQDB 1FC2D 4WUUE 5GGUA 4OB5H 3TJHC 3QCVL 1N5YH 2PW2B 1YMMA 4RAVB 1FVDA 2YN3A 5D1QA 4LVEA 1N0XL 3SDXA 3VW3H 4KMLB 3H9SE 1I4FA 2Q8BL 3B8SA 2JK5B 3A6CH 3VGFA 1YUHB 4XNUH 1LHZA 5C07E 4H5SA 4DWHA 4HDIA 4LRNL 4QHKI 2ARWA 3QIUC 4LPTA 2EIDA 5DURB 1NGXB 1ORQB 3LKOA 2YEZA 2Y9RT 1ROWA 3BHBA 4MSWB 2JB6B 4JFPA 5EOQH 3VRLF 1DBBH 4CJ1A 2O5ZL 1B0RA 4WFGD 2AI0L 1N64H 2CMRL 2ZZUT 3W11D 3G08B 4E41D 1WICA 3BP4B 5E5RB 5KVFL 1IMHC 1MVUB 3QEHA 4JCLA 4GBXC 1XF3B 2EKJA 1LEGA 5CILL 4LAQL 3SGJA 5EDXA 4LFHD 1IC7L 1B4JL 4PJXB 3GUTA 2H9GA 1R3KB 1RJYB 4ONGH 3RU8L 4U6XB 4LNRB 2XZCH 4NKOB 4J3VA 3RZCA 3G9AB 4BFBD 4NM4H 3SE3A 3GMMA 3DVNB 3ARQA 3S4SA 1E4XH 4QRRE 4QHMB 3MRHA 5IGXL 1KULA 5CP3H 5B8CC 1J8HA 4NUJB 1UT9A 1JFQH 1FGNH 3TYGH 2D4FA 4P0DA 4LVOB 3HMXH 3FFDA 1HIML 4G7YH 5E94A 2A9MH 2P5EA 2W59A 3BE1H 3BT2H 3LN5B 1HSBA 1OAUH 2AJXL 1FCGA 1KLUB 2XKSA 3BIKA 5DK2A 3FRUB 1KOAA 1S7TA 3NABL 3G6JF 4RRPG 3QNZA 2BNRB 5DUBB 1JPFB 2B0SH 4KK6C 4N0YL 1UYWH 2JJSA 1YJDL 2HT4C 3MJ7B 1XF5A 4M00A 2ADIB 4UTBL 5FK9B 1EZVX 1GC1C 1PG7X 1T7WA 2R15A 2NQCA 1CD8A 3SKOA 2V7HA 4E41B 4Y16C 2A6JA 1OARH 3SBWA 5J9PB 3QDME 4RWHA 5C0ND 3RY6A 1IGTB 4FQQA 3U2SA 2G60H 2HN7A 1VHPA 2ESVA 3TO4A 1GZQA 4QLRA 1CXIA 2EKSB 5E2JA 5J0BA 1BOGA 4P9HL 5GGSA 5D2LA 2KL6A 1BBJB 1ZLVH 4WFFE 1LO4L 3LQAL 1EVTC 4PY7B 3QFDB 4D3CH 3C2SA 3V4VL 3W0WD 5DD5H 2NXZD 1BVKA 3VWJD 1DFBL 5HY9A 2JTDA 3O3UN 4I0PD 5TF1L 1CLZL 4ODWA 3B9AA 4P5TD 5GISL 2VWEC 2I9LB 1ZVSA 4APQB 1WAAA 4KK8C 1CT8A 3MGOB 2WIIB 4Y88A 5HYJD 3GRWA 4KUCD 3MRFB 1BX2A 3EIFA 4G8FB 4QRQB 3SDCC 3EO9H 4E42A 5I9QC 4PB9H 3TWCL 5FOBA 4AENB 5HGGS 1XGPB 2NTFB 5CZVL 2AEIT 5BZWA 4U6VH 5TE6L 4AG4L 5EPMB 5C0BA 4NWUL 1JE6A 4GRMB 3ULUC 1M7DB 2H3NB 1JNNH 4J4PC 3VXQA 1VA9A 3RUGF 3MNZB 3I6LD 5T3XL 1NAKL 1KJVA 3K74B 3QSKB 5FA4B 4H25B 4IM8A 2YOCA 1G6RH 1TIUA 2H2PD 5EBLA 3MLVL 2QQLH 5F7NC 5FHBH 2X09A 3KAAA 1G7PA 3G6JE 2EO1A 4Z78A 4QXGL 1W2KT 2R1YB 1RHHA 2GT9A 1IM9D 3VWJB 3U7WL 1A9BA 5FGRA 1QR1B 2V9RA 4I0PB 1OB1A 1LD9B 2R69H 3RWDB 1NL0L 3DRTB 5T1MB 3AXLB 1FNEA 4P5TB 4OF5A 5JMRA 1MCPH 5IMKA 3BUTA 1FRGL 4NZRH 5HYJB 1NAMA 4URTB 2VAAA 2VC2L 4OSUH 2X40A 2RQ8A 4MJIE 1JK8B 2HJLB 4LSSH 2DD8H 1JGVL 3TBSA 3UTZA 5E95B 5B22A 5CINL 4Q7DA 1XZ0A 5F7EL 1MVFA 1NSNL 3MJ9A 2WUBH 2R0KL 4KHXH 3SDYL 1FL6A 2AP2A 4H26A 3W9EA 1S7UA 4FQXD 3GIVB 1FZMA 1CFBA 1OGAE 4HK0A 1TPXC 2VQ1A 4KTEH 1T0PB 2EDFA 4JFDA 3UP1A 1ZGLM 5IT2H 3I2CH 5DMJB 4Y1AD 1ADQA 3MJGX 5F93C 5FYJE 1RV6X 4JJ5B 3PHOB 3H6JA 1FFPB 5I0DA 1DP0A 1T0MA 3D3VE 3IDYB 3BDYL 2VLJE 5I74B 1A64A 4M1DL 5HGAB 3LCYA 4R7DB 5DEZA 1CGWA 3ARTA 4L4JA 2ADJA 1IM9B 1I3GL 4JM2C 1QQDB 1KV3A 2DQGH 3BH8B 1VPOL 1CBVH 5D1XC 5F6IC 1I8IB 2PYEE 1YN6A 4U1IB 3BZEA 3MRJB 2VDMH 3W5NA 2XZAL 3OSKA 3REVA 2VYRE 4M02A 4QGYA 3VI4F 4G5ZL 2HRPL 1WUNT 1QVOA 3RUGE 5DJ0A 4AEIL 5DS8B 3V0VA 2UZIL 4ZTPL 4C56D 3JWDC 1L7TL 2M2DA 4NRYA 4XHJC 1JYNA 2HFFB 1D6VL 2CQVA 3VG9B 3DRQA 4CU6A 3RL2B 1JGEB 3HRZB 5EBWB 1NFDB 3O11A 2E7BA 3KPSA 3O3DB 1ZHLA 3RIFF 1HQ4A 4FQXB 1YEIH 2O5YL 2IPUK 2D7QA 2ZOKB 3ARRA 3SDDA 4YHLL 1CGTA 1YEEL 2EDXA 3D48R 1K4CB 1T6VN 2HVKB 1XGUB 5FCUL 2VAJA 3UDWC 2CUHA 1D6EA 1N3NA 5I15H 3BRFA 4G8GD 4Z76B 4X6FA 2XG5A 1U91B 3P2TA 2Y72A 1WLHA 4JFFD 1KUMA 2MQ0A 2OSLB 3H7BA 1HK6A 5HVHC 1MIML 3U36B 4Y5YC 1K8DA 1OAZL 1A6TA 5IMLB 3HG1B 2W92A 3HI6H 1U8LA 3ILQD 1RZKL 3STLB 4F9LA 1KCLA 2B4CL 4X7TA 4HIEA 1B2WL 4RAUA 4X80L 1VFMA 4MDIA 5SWZE 3F7YB 4H20H 2ILLA 2HTLD 2ZPKL 4JPWL 1MUJB 2JF1A 4HKBB 5A1AA 1I1FA 4PGCB 1FIEA 4PJ9A 5AD0B 5JPNB 1DQDH 1HQRB 4RWYL 2V17H 4QWWD 1GAFL 4C56B 4JFXA 3G5XB 3O8XA 4E5XA 5BVPH 2GCYB 2AXGA 5D7IF 5DMIH 4NBZB 5FM4A 4KUZH 1A7RL 1H8NA 4ERSH 4R97C 2WBJA 3NCJH 2OYPA 3OAZH 3O81A 1SVZA 2R0WL 1DTUA 5LGJB 1G0DA 1MCQA 1CE6A 1ED3A 2DIJA 3V52L 5C7XL 3QQ3B 2MCG1 2Y1VA 3DSFL 4MAYA 4XP5L 3OR6A 4OGXL 5CLWA 4H1LB 5CJOL 1I9IH 1U95A 4G8GB 2YA0A 2Q76B 4QTHA 1X6NA 4JFFB 5EORH 3VWKD 2FWOB 1M71A 2MCPH 2GITB 4KRPD 4BH7B 1ACZA 4JG1H 3VI4E 4PP1D 4KJWC 3O3EB 1NH6A 4UV7L 2O93L 2RCSH 1WWCA 2Z9TA 5JHLH 4YHKH 3BPOB 2E3VA 4YWGH 1T1WB 2GY7B 3LMJH 5ICZA 2P45B 5BCAA 5IFAL 4PJBA 1IBGH 1UXSB 4X9HA 4TNVF 4G8EA 3P9MA 1A7QH 3UJJH 43CAB 2AJSH 1Q9LB 1AHWC 2X7LA 4N5ED 1VESA 3MCLH 1C5BH 1U58B 2HLFD 1S9XB 4NHCH 3VCLA 3EOAB 4POZC 4UT9H 3X11A 2R1WB 3WE6A 1LE5A 5CSGA 1R6VA 4YAQB 5TPWH 5IR1A 2BHYA 4NUGH 4HJGA 1EEYB 4JDVB 4LEOA 3BKYH 2XWBB 4JVUA 5T3XE 5C8JA 1RUPL 5I1GL 5DVLA 2YUZA 4YBLC 1MWAA 5FUOL 4LSPL 3F7RA 4H0HB 4YH6A 3VWKB 5C0FA 1IC5L 2XTLA 4PRIA 4KRPB 1RULH 3FQUA 3LQAC 4MVBC 1NBZB 2IFFL 2NX5E 4H8WH 1NCUA 3O9WC 1FV1B 4AZ8A 4F8QA 4HQQL 1OGTB 4D0BB 1F3DJ 3MRQA 1J12A 3UTSE 3DV4A 3MV8D 3TIDB 2Y7QA 1FNSL 1PAMA 5D7IE 4AH2A 1GGUA 2G75B 3NFNB 4M7LH 3WFBH 3O6KL 4U0RB 4MLIA 3VI3F 4N8PA 5ID1B 2X4PA 4GH7B 4V2BA 5IHZB 1FO0A 4ZFGL 1UCBH 2WP3T 5D96C 2HLAB 5GPRA 2VLRD 4I9WE 5I6XC 3SJVA 2VDOH 4IMLA 1W72A 2QSCL 3LH2L 1EH9A 3OV6A 3T8XB 4EJ1C 4NN5C 4FZ8L 1XFPA 4OD2A 4PJEA 5FCSH 2R2BA 4IRSC 3GRWL 3MLWL 3IFOB 5E2TH 1G7JA 2H2SD 4ZUWA 4WU7B 1A22B 4ODHH 5BQ7A 2X6MA 5DDHA 2N56A 3O4LD 1YEGL 2DBJA 2B1AH 3PV6A 1JPSL 1T2JA 1RD6A 3WEXB 2J8OA 3T77B 2YD5A 5I8KH 2DLFH 4PREA 1NLBL 4HK3N 3MRPB 4G9FD 3I02A 4D0CA 1A9EA 1ERNA 2ZOLB 2Z31C 1QSFA 2D31B 5HYEA 4P9MH 2FL5B 3OKDA 3N9GH 2FGZA 4HT1L 4M1GL 5LJYH 3P4LA 2FLRT 5DMKA 3AS2A 4LPUA 4CGTA 2C3HA 4TULL 5CJ8A 1RVFL 5E2VL 2DIBA 5T33H 1MHCA 4BUGA 2XOTA 4ZFZB 4UTAL 3LRHA 2GJ6E 4MNQE 3KPLA 3T0ED 1S5HA 2VLRB 4OCSL 3HS0A 4LASL 3HKFA 1TMCB 3VFNA 3GBML 4JGJA 1MNUL 3OQ3B 3VD5A 4EI5C 5C70A 1G7IB 1UA6L 3KS0H 1QA9B 1NAML 4UV4L 4HLZG 1ES0B 2A6KB 1IQWH 3HPJB 2IBZY 3HR5A 1JZ5A 4OZFG 2YC1B 3O4LB 4GO6B 3QCUH 4XNMB 1I7TA 4JO3L 3O6ML 4UU9A 4AT6B 5SWQA 2IF7A 2VDNH 4KDTA 1IEAA 4G9FB 1AO7D 1SYVA 3MJ9L 2BP3A 4PRBB 5F6HI 4RIRB 4X6CA 1SMAA 1U92B 3UZVB 2NYYC 2XA8L 1FYTD 5EUKB 1AH1A 1BFOA 5GRJL 1AXTH 1S7XB 3GSXA 1ADQL 1J7VR 1QBBA 3L3KA 5A40E 1H3XA 3EJZD 3ZTNH 4OBSA 4JRYD 2X89A 2EEBA 4EXKA 3K8MA 5E5MA 4BYHA 5HHME 3UMTA 2LE9A 2NY2D 5CZXC 4MA7L 1YMME 5K9JH 5TF0A 5JQ6H 1KYOJ 1S7RA 3SDXE 2HFGL 5GSVA 1NQBA 3DIFB 2HJFA 3FB6B 4DZBB 2Y6SD 4M62H 1PKQB 2WW8A 1NCAL 5J6HA 1MFBH 4HXBH 1NLDH 1DBJH 3D25B 4UIMA 2GUOA 4L5FL 5I73B 4G7VH 4MQXD 1HH9A 4H1LH 2E6JA 5D72H 2V2XB 5ICXB 1PGRB 6FABH 2ZWLT 2DQFA 1KELL 4IHOB 5CIPA 5A3IC 3MLTB 4X4ZA 1KPUB 1AO7B 1SM3H 1UB5B 4JPVH 3CMGA 1LO2H 4TUOB 4IRJA 2VH5L 5D7JC 1WT5C 5MERA 1DQQB 4WFED 3UCRA 3N1QC 4X99A 1AD9B 5KSBA 1FYTB 4JANA 2Z8VC 1DL7L 3F7QA 1T1YB 3QWOB 3CDYA 5ESQA 2Z8SA 5IKCA 1BIHA 3VG0L 3JWOL 5IQ7H 4Y2DA 2O5XL 1IGCH 3WDJA 4JRYB 1TENA 2AXHA 2NR6C 3MRGB 3EAKA 3FOLA 1QFUL 2NY2B 4BFEA 4WVRA 1I7RA 2QHRL 4GUPA 3CDCA 3MA7B 1J8HE 1E6OL 1KYOK 1FZKB 1DE4A 4OUUA 3AB0C 4OF0A 3QNXA 4JDZA 3PWPA 5FGCB 2EH8L 5I1AB 2V7NB 4A2LA 4F37K 4XPFL 5FYKU 2BNUB 1J05A 3OG6B 1F13A 2F53E 1WBZB 3G5VB 3KLSA 3VFWB 1ZEAL 3GI9L 3MRCB 2M8XA 5I16A 1Q0YH 3MMEA 3OKNA 4TSBH 3VXTA 5FECB 1SVCP 5F1OB 1F4HA 1JIBA 2DWDB 4F7CA 1A3RH 3OX8B 3QEGL 2A77L 2W9LA 2G5BB 3RWFA 3WXWH 5DF0A 2WAHA 3RGVD 3I3EA 2Y25A 1ETZB 4U6YA 1WIUA 1WWAX 4OCMC 3PWUB 5F72S 2Z93B 4ZYKB 5BXFA 3G9VA 2ESVE 5DRNB 2ZCLH 4ELMA 2XZQL 2YPKB 4PJ5D 1A14H 3CCHA 1WBXA 4LVOC 3CH1A 2F5AL 3OKEA 1TTGA 3HCVA 5D2LE 1MCOH 2PTTA 4F57H 1KIRA 3TP4A 1J0ZA 1A3QA 1DN0B 2R1XB 2ATPB 3BGFC 3RZCC 4CMHC 1I1AA 1TJHH 4YQXH 3SE3C 5CEXB 2P1YA 3MYJB 1CR9L 5KOVC 3FQXA 4R0LC 5IBUG 1FNHA 2GW5A 5KSAA 2HYMA 4K55A 2OI9B 4FFYL 5DUML 1WAAE 4X7DC 4LF3B 4IOFC 3EW3B 5E1AA 5B39A 3P4MA 3V95A 4LPCA 25C8H 5DRZA 4WDIA 3V5KB 4GAJH 4LCWA 4N0RA 1CDUA 3LKSA 1Q1JL 3QDGA 2COQA 1MAKA 4XCYB 5FM5M 2LVEA 1XR8A 3RGVB 4HPOH 5F3BA 5C0BE 2VISB 4OT1L 3BP7A 3C8KA 1QZ1A 3H2WA 4XCNB 2NY5L 1GHFH 1NCNA 2I07B 3U30B 3NVQA 3SKUD 4GSDH 5GS0D 1IGFH 4XC1L 1OD9A 4KKLC 1DBAH 1MWAL 4NRZB 3VFTB 3VXOA 1NCCH 4MXVE 5J11B 4RFNC 1IAOB 4K7PY 4K9EH 4UUJA 1SEBB 4APQC 1F5WA 1QFHA 5ILTL 1U9KA 3NCYP 3TIEB 4KV5F 1EEQA 3QWQB 2VKXA 2QQKL 3HFML 5EU4B 3IS0X 3S5LG 4ODXA 3K7UA 1KCRH 1IKNA 3VH8A 2BOCA 4Z7QE 2YA2A 2DDQL 2FR4A 1DLHA 3E6HA 5CP3A 5INCB 4M61B 1X5HA 5FO9A 1E27B 4DQOL 3TGXA 3QI9B 3M1BB 5D5ME 3HMXA 1RURL 1FO0L 1IARB 1IAKB 3HMWH 4I0CC 3DNKA 1II4E 4NT6A 5E99H 1AJ7L 2F19H 2HH0L 5DFTA 1W72L 4P2YA 1T1XB 35C8L 4FQIH 4M7JH 5SX4I 3HA0A 2YK1H 4L9LB 1OM3L 3WKMH 5C0JA 2AKRB 5JW3L 2WUCL 3WNLA 4BZ2L 1BHGA 2IC2A 5KG9B 2XNAB 3Q0HA 5HYIA 1I3RA 1A1MA 1BM3H 4JFDE 5JORB 2VXSL 2P24B 1T21A 3GMPB 4MHHG 5E8OA 1Q9KA 4TRPL 1QFWL 1FH5H 5HI4C 3V5DB 5C0AD 5M95B 3BPNB 3UPRB 1S7VA 2Q20A 4EQ3A 4EN3D 2GTWA 3RPIA 3BZ4B 1MSPA 4AM0B 4XP4L 1GGBH 3IRPX 4RGNE 5IV2B 3NN8A 5JTWA 3LEXA 4X8JB 5KN5A 4HV8B 3DYPA 3GEWB 4NFBA 4YHPA 4LVHC 2UWEB 5DJ2A 1MREH 5CWSA 5D6CB 5E8NB 1HCVA 1EXUB 2E7LA 2OTWA 1YEHL 3H3PL 3CFEB 4DN3H 3T1WA 5INDB 3CMOH 5DK0B 4X6BA 4F7TA 4WTZG 3V7AG 3ZE1F 4LRIA 4L8DB 3CSYB 1YEFH 4JR9L 2FZ3B 4PJGB 1D9KC 2AV7A 1BJMA 4ZTOL 4CW1A 5GZND 4RFEA 2JJVA 4PJBF 2R39A 3RVVD 4DVRH 4KJPC 2NW2A 1HHJA 2VE6A 3P9WB 4ZUSB 3UJTH 2CK2A 1LK3L 3I9GH 4M7ZB 2DYPD 4OFVA 3OMZA 5FYLL 12E8H 2L0DA 3ELAT 4LBEA 1C5CH 3BD4A 3VDAA 5HXMA 2AS5M 3P77B 5E6ZA 1HEZA 5C0AB 3BZDA 5A2JH 4EN3B 4QRSB 5FUZL 4JVPA 4LCYA 1NBVH 2X4NA 5BMFH 1PLGL 1UENA 1G6RA 3VMNA 1P4IL 5KZCD 1FYHB 3HE7D 2NZ9C 3KYNA 2BSTB 1PG7W 5J7CC 1G7LA 3DTXA 5B38A 1T20B 4RGNC 5DWUL 3IXAB 2VQUA 4M6OH 4YHYC 3NACL 4R4FH 5CMAA 5IBTL 3GSRA 1D5ZB 5I66B 1UJ3B 1NGYB 2OR8A 3QR2A 3FMGH 3QG6A 1RZ7H 4WWKD 4OAWB 1C5DA 2QQNL 4JM4L 2LTQC 2J8UB 4PJCB 2VL5B 3L3GA 5E6YA 5M7QA 3QULA 5AZ2L 4WUKH 1HILB 1HYSC 4PJAB 1WIPA 2YD8A 1N59B 2MSPA 4TSAL 5BV7B 3LEVL 3F12A 1A6VL 4KAQL 2HKFH 2D2OA 2H1PL 3GHEL 2SEBA 4JZNA 2A9NH 4XVJH 5H37G 1S7WA 4LCIH 4EOWL 3BIAX 4JPKL 2DYPB 2C3XA 1S9WB 3HB3C 1MAJA 1FFNB 1T5WB 2DQIL 2NY7H 3C08H 4J8RB 4FOMA 5DJDB 3ZSSA 4K7PH 1T0NA 4KTDH 4EVNB 4Y5XA 4WHTA 5ADOH 4ZG1A 3ARUA 1CGSH 4PJEF 5TE7H 1IGMH 1I9JL 4MQ7A 4TQEH 3BMWA 5EBMB 4YC2B 3RTQC 1OY3B 3HE7B 3QUXA 2PW2A 2VZUA 4JFED 4HXAL 3ALPA 4RAVA 3P4OB 5L6YL 2OZ4H 4OLZH 4NQED 2RR3A 4O02H 4IRZL 2JK5A 3IDUA 1YUHA 3OZ9L 3WDHA 5CBAB 3MCG1 1J9CT 2CGRH 1WZ1L 5DMYA 4XNZB 4WWKB 1I1CA 5E4EB 2I25N 1NGXA 2JJUA 4HEPG 2Z8RA 4XMPL 1FFQA 4N8CH 4ZOAA 5B3JF 3O2VL 4MSWA 4JFYB 5I76B 2JB6A 1KPRB 3FRPG 4B7LA 5I17B 4JY4B 4HG4J 5HSFA 4NC1E 1X5AA 3D18B 3I3BA 3G08A 5J6GB 1S9YB 3ECBB 1MVUA 3KPNA 3ESVF 4Z7OF 5I2IB 4KK5C 4PJ7F 5DMGD 2BVQB 3T1FB 1CG9B 5EG6C 1QSEE 4PUBL 4HWEL 4YXHL 4PJXA 5E6IC 5F88B 1R3KA 1RJYA 2YWZA 3S88L 1B6DA 5IHBA 5BJTB 5T5NF 3BAEL 1U3JA 2R2CA 1ZA6B 1AFVL 4LNRA 4OFDA 4LGPB 3HNSH 2DTMH 2L7UA 2MPAL 3X3GH 2FRGP 4ORGA 3WFCL 3O2DA 3HC3H 1OAKL 1QLFA 3DVNA 3V6BR 4GLRH 3VDBA 4QHMA 2H6PA 3T0XA 3KXFA 5C08D 4NUJA 1UEYA 4C57C 4S2SA 4Z0XB 3KG5A 2DLHA 1F4WH 3PF2A 1FLTX 3VDCA 4X6CF 3LN5A 1INDL 4MA8L 1FG9C 1KLUA 1VEPA 3L1OL 4L4VE 4OB5L 1K8IA 3FRUA 4PJFE 3QHZL 5L2JB 4CVZB 1ZS8B 5KVGH 3SJVE 4J2XA 1N5YL 3Q6FB 4QO1A 5EU5B 1NJ9B 2J4WH 4R96A 4XPBH 2ADIA 4D8PB 3VW3L 4OZHA 4PJEE 4HG4K 4LSTH 3OKKB 3A6CL 5BS0B 4E41A 3O6FD 4XNUL 1T7YA 2D9CA 1Q9OA 2F8VA 2X4QB 5GS0H 5J9PA 3CFKA 3C2AH 4YZFF 4KQ4H 5CEYB 1IGTA 1UB6B 2CLVA 1CLOH 4J6RH 2NY5C 4X4XA 2AV1B 2D9QB 4OFKA 2FEDC 4OV5B 2CKNA 3TF7C 2EKSA 3E1F1 5EOQL 1GGYA 1DBBL 3TESA 5IK3B 1N64L 1BBJA 1JWSB 4FQCH 8FABB 1EGJH 4XP6H 4CMMB 2YD7A 4PY7A 3S4SG 3HI5H 4ZMAT 3TH4T 4ZFFA 2ZCHH 1CU4H 1HSAB 5C08B 2D0HA 4CADB 4ZS7L 4ONGL 2W65B 1OP5K 1A8JH 3PDDA 1SYSA 3SGDH 2V2TB 3DROB 5EO1B 2E9WA 4OCNC 2XZCL 4ZXBC 4N0FB 4Z7OE 3MGOA 5KSBF 4NM4L 3MRRA 5EUOB 3WIHA 4U6HB 4G8FA 4QRQA 5HJ3B 1E4XL 3TZVB 2GI7A 4AENA 3KVQA 3E6FB 4OGAD 1FGNL 1L0YA 1XGPA 2NTFA 2R23B 3O6FB 4WI4A 3ZKMC 4JRXE 3HMXL 4G7YL 2A9ML 5DA0B 3ZYIA 5CJQH 1LEIB 3BT2L 1OAUL 4GRMA 5FYLE 5IJKA 3OJDB 4P2OD 4HZLB 1M7DA 2FX7H 2H3NA 5DD1H 2NY6C 3MNZA 2B0SL 3NH7H 2F8XC 1UYWL 1P53A 4CVUA 3QIWD 1G0YR 2GSGA 3P0VH 4X6CE 3CH8A 4KI5F 1JWMB 1TZGL 2OL3A 4KMQA 5BVJB 1OARL 1BQHB 3AS1A 3DGCR 3G6AB 1MCDA 1F4YH 3IDIA 4LCCB 3W0WA 1D5IH 3LD8C 2WWKO 2G60L 1D5BA 4BH8B 3UYRL 3AFLA 1QR1A 4I0PA 1LEKB 2QKIB 3RWDA 5T1MA 1J11A 4Z18A 2XXCB 4YZFE 4UDTA 5HYJA 1IC4H 4PY8I 4N0CC 4YLQT 4S1DC 5BV7H 4KZDL 4D3CL 2HJLA 2EICA 1FZOB 5DD5L 3TV3H 4PJ8C 1SHMA 1CLCA 1J87A 5EC2B 5HVFB 3V9FA 2A0LC 3MSPA 4DKDC 4EEEA 3U9PH 4C83B 2NNAB 2ICES 2IGFH 1CN4A 1B90A 1U8MB 4P2OB 1JV5B 1FG2B 3C09B 3MV7D 3QHTC 3NA4A 4P4KD 4IIQC 3EO9L 3VFSB 4PB9L 3QPXH 4KDTC 2BCKA 4M43H 1T4KB 2CJUH 1NC4A 3IGAB 4JJ5A 3MR9A 1KJ3H 3PHOA 3SE4C 5JA9A 1AGEB 3OTTA 2H8PB 3IAQA 1FFPA 4BSWB 4U6VL 4X7EC 5KSBE 5HGAA 1I7UB 4G6KH 2VLMD 3MFFB 1IM9A 1JNNL 4DUXA 3I75B 5IF0B 4HKZB 4UMGA 1QQDA 3VXMB 3BH8A 1QLRB 4OGYH 3S3SA 1I8IA 1UACH 4RMWA 3T2PA 1G6RL 4U1IA 3MRJA 5GS1B 5E56A 4XVUC 1MRCL 2C3VB 2HFEB 1FSKC 3L3OA 1VADB 2QQLL 2I60H 4ZOBA 5FHBL 1P2CB 4R4NC 3ZKSD 1OTTC 5E03A 5DS8A 2DM2A 4OI7A 5L7XH 3TO2B 4BELD 2F74B 4JPIB 5H2BA 4OI9A 4QTIL 2R69L 3BRDA 1MCPL 3RL2A 4KI5E 1ZT4B 2HT2C 3S34L 3MBEC 1JGEA 1SJVA 3D69B 4P2QE 3EYVA 3ES6B 5EBWA 3EOBB 5DJYB 4JY6A 1NFDA 3O3DA 2DQTH 4NZRL 2GTZB 3BFOA 4FQXA 2EXYD 3WHE1 2VZTA 3RX5A 4P4KB 1ZANH 2ZKHL 4OSUL 1YDPB 1PEZA 2ZOKA 4WI6A 4LSSL 2EXWD 4Y1AA 2DD8L 1K4CA 2HVKA 1XGUA 4MNHA 2GJJA 3QXUA 1UZ8B 4CJ0A 1U91A 2J12B 2X41A 3LKRB 4ELME 4IRJC 2YD4A 1ND0B 5J89A 2WUBL 5EA0L 5CEZD 1P5VA 5K9KB 2VSCA 1AXIB 4KHXL 4UT6H 2DL9A 3D6GA 3BWAA 2P7TB 4KTEL 2DQJH 1XH3B 3GO1H 4MD0B 3I2CL 5IT2L 2YMXH 4IMKC 4NO2B 2B2XH 1YNKH 3O41B 4Z7WB 2L7JA 4Y4FD 4PLOB 2UY6A 1EBAA 4W6YB 1Y18B 3SO3C 3CNKA 2PCPB 3UAJC 2YHGA 2GK0B 1MUJA 3PJSB 3IDGB 2ZUQB 5KSUB 4PGCA 5AD0A 3ZE2F 1HQRA 1ZLUK 1RJZB 3H7LA 1A7BA 4NQCD 4LHJB 3VE0A 2DQGL 3GMRB 1W8OA 2VABB 1C12B 1QD0A 4HLZH 3E3QE 1KCUH 2BDNH 4LCWE 4F15B 2VDML 4KXZI 4PG2A 1SJHB 3QDGE 4NC0B 5LGJA 5EOTB 4KJQD 1BVLB 1BJ8A 1L6ZA 4H1LA 5ELIA 2WLZA 3OJVC 1U41A 3BEVA 5FGBA 4G8GA 4AY0A 4LARH 1C16B 2IPKB 4JFFA 4K7FB 2FWOA 1A6ZB 3MODH 4UQ3B 1ZVHA 1LP9E 1UM6H 4BH7A 2GITA 1YEKH 4JREB 1YEIL 1QR4A 3WFEH 1N5AB 4MJ2A 5HHPA 2JJWA 3FT3A 4FTVA 1ZT1B 1UZ6F 1H8SA 1UM5L 2XV6B 4HS6B 5I1CH 1PEWA 1GIGH 1T1WA 4UBDC 1SMOA 1T03H 2DQDH 2IH3A 4Y4FB 5ANMB 5I15L 3WO4B 3N85H 1UXSA 2ICWI 5DJAB 3EO1B 2BY2A 4PY8J 1YY9C 4B53A 2W07A 2HTKD 5EFIB 1MLBA 43CAA 2W0FA 1TJGH 5D7KE 3MLXH 1KNOA 3HI6L 4MX7B 1P7QD 1U58A 1FN4B 3KPRD 4MAUH 4NQCB 4ZUUA 5BZDB 2EDTA 5MEOB 4MB3A 1LVEA 1S9XA 1JF6A 1OL0A 2R1WA 5A2LH 1R3HB 5ITBH 4P3CH 5ALCH 4H20L 4YAQA 4RDQF 1XF2A 1EEYA 4HUWB 4JDVA 1P6AB 2XWBA 3VXNB 3PDGA 4AYFA 3GBNH 1DQDL 2V17L 2VDRH 3ZYOA 1NFIB 3RVWC 5BVPL 3TM6A 5EZOL 3VWKA 4OF6A 5C3LD 5DMIL 4YXKH 3QEQD 1QRND 4ERSL 5DRXA 3NCJL 4BSVA 4O5LH 4LOUD 1JUFB 3BVNA 1OGTA 3JWNC 3ZE2E 2UVFA 3DX9B 4D0BA 1MLCA 1BD2D 3N1PC 4KI1A 4J7RA 1BJ1J 3EBAA 3QI9C 2P8PA 3DI2B 3PDOB 2G75A 4XPTH 1T7VA 4CDHA 5EORL 5ID1A 1PFCA 4LP5A 4ONHA 5JW4M 5DFVC 2MCPL 4JG1L 4U1KB 2HLAA 3WUWB 5DQ9A 1P7QB 3O45B 3KPRB 1N8ZB 2RCSL 4N0UB 5A16B 5LBSH 1IEHA 2D7PA 5JHLL 4YHKL 3DO7B 3T8XA 3OKYA 3MV11 2VLKD 1T2XA 3U6RA 4YWGL 3GI8H 4QXTB 3LMJL 1PY9A 3WIHL 1U6AH 1IBGL 1UFUA 4NQVA 4RGMC 4WU7A 1A7QL 3UJJL 3VFVA 2IBZX 4P23C 3C5ZC 2AJSL 1UZ6E 3WEXA 1HOCB 4ZO8A 4MXQC 3MCLL 1C5BL 1F2QA 1RFDH 3P11H 3MRPA 5I1IH 2FO4A 1R5VB 1FFOB 4NHCL 1G9NC 4Y7MA 5TDNB 2DQUH 2ZOLA 3QEQB 1QRNB 2D31A 2APXA 2FL5A 3B2UD 3EOYG 4XWOC 3QRFM 4OBRA 2FBJH 5TPWL 4A2MA 4NUGL 5ETUB 3TBVB 1BD2B 3BKYL 5CD5C 2V9TA 4OJFH 2IFGA 5HHXH 3MV8A 4GMSH 5H94B 4HUVB 3SCMC 1MHHA 5MEND 4ZFZA 4NQXB 5DHVB 1GOHA 3RAJH 4H0IA 4PJXF 1RULL 5D8JH 5E8EB 4H8WL 2VLRA 2ZCKH 1KLGA 2IANA 2W9DH 4YHMH 5GRWA 2HFTA 4GS7B 3SN6N 1V3KA 4N9OB 1NDGB 4AEHH 5FFLA 2GHWB 1X5YA 2VLKB 3CZFB 5CLTA 1LE9A 2Y5TB 3QJHA 3H42H 1G7IA 1AIFB 1QA9A 3DMMD 5ERWA 3WFBL 4M7LL 1H3UA 1C08A 5F89B 2A6KA 3F7VB 2LAGB 2YC1A 3O4LA 5JXED 4LRIC 5IEHB 4XNMA 4PJDB 1UCBL 4XP1H 4AT6A 1KIUA 2VDOL 3IU4H 2XY2A 1T80A 4U4BA 2HMIC 3ZKQD 4K71B 4NQSB 1SY6H 4RIRA 1SQ2N 1U92A 1QEWB 5GZOD 5H8DA 3LKNA 5E2TL 1CK0H 3VFPA 2FGWH 3GDBA 4WW1B 4M93C 5L8KB 1RUMH 3ARDD 4D9RD 4OZHF 1S7XA 3BQUD 2B1AL 3OR7B 1M6OB 1UJ3C 5KSVA 1C7TA 5C2UB 5I8KL 3OB0K 1X5IA 2ICWJ 4P3WA 5MENB 1FL3A 2VSDA 4MB4A 3MXVH 3DECA 4TVPL 1T7ZA 1P84J 4F7MB 5EN2A 4QXUH 4AJ0A 5E08L 3JV4B 5ID0B 5JW4N 3T0EA 1RIUH 4P9ML 4X6EB 1JPTH 1KJMB 3FB6A 3N9GL 3RI5F 4DZBA 3FONA 1PKQA 4I3RH 3DGGB 5T5NG 3BRGC 3DMMB 5GRZA 3D25A 1GOFA 1H15B 5E70A 4HWUA 1FAIH 4OF8A 2UY7A 5BRZD 5TGBA 5HHNB 3MRBB 4M4PA 2V2XA 5ICXA 4PRPA 4Q0XH 5A43C 3RVTD 2ENYA 3MLTA 1KPUA 2CD0A 1AO7A 3R8QA 1UB5A 4FFWC 1X3DA 5CEZH 3DV6A 4TUOA 3QYCA 4YDJA 1F00I 1DQQA 4G8IA 1V8HA 3R4DA 1WFUA 4PJXE 1GGIH 1IQWL 5JIKA 1AD9A 5AEAA 1FYTA 3RGHA 3S6CA 1NANH 4PP2B 2ZUYA 3BQUB 5LWYH 3QWOA 5JW5A 3QCUL 3B9DA 5SV3A 4XNZC 2FJFB 3GJEA 4XBPB 1P4LA 5E4EC 2J6EH 4M6MH 2J88H 2VDNL 3OKOA 3AM8C 3MRGA 3OL2A 1FVCA 1F3DH 4YK4C 1P84K 3RKDC 3QUXC 3KXFE 1YN7A 1X5FA 3G5ZB 3M17B 1FZKA 3V0WH 4L3CB 3UYOD 4JZJC 2V7NA 2BNUA 4JFOB 4Z7UB 3TYFA 3ZTNL 1FNAA 2Q6WA 1WBZA 2XA3A 3VFWA 2LU7A 4PD4J 3LVEA 4S10A 1OTUC 1CD1A 1S5IL 4DZ8B 5BRZB 2BHZA 3LEYH 3JTSB 5FECA 5K9JL 2ORBH 4LLAA 3VFOB 1QFWM 1KN4H 5JQ6L 2DWDA 3OX8A 4PGJA 1PBYA 4OZHE 5GHWH 2R9HC 2XN9B 2R56L 4NJ9H 1RZ8A 4M62L 5HYQB 2F54D 2ICEB 4R2GC 5DEFA 2FNBA 1NMCC 1JMXA 1MEXH 3THMH 1ETZA 1CS6A 1MFBL 4HXBL 4KUCF 1NLDL 4PBVC 1DBJL 5I1JH 3QDJA 3Q1SH 4ENED 2Z93A 2BVOB 3MRLB 5DRNA 3AS0A 4GKNB 2A1WL 3KGRA 1KEMH 4G7VL 4BFIB 4QRTA 5D72L 2RAMA 4JHWH 3NCCB 1J0HA 4PJIA 3BP6B 3AREB 2BC4B 4MXWH 4HSQA 4JKWA 1E4KC 2B1HH 2R1XA 4K7PX 3CSGA 1SM3L 4JPVL 3P0YH 3H9HA 5JOPD 5KAQF 1LO2L 1DQMH 1FZJB 1MI5A 4TUKH 4WNQB 3IDNB 1JF5A 3PG2A 5I8OH 3MYJA 2YWYA 4YGVA 1QO3A 2OZ4A 5IQ7L 4LF3A 3IVKB 2HAZA 1DCLA 1IGCL 4JQIH 5HHOD 4HD9A 4FZEH 4PD4K 1I9EA 2K7PA 3C6LD 3WS6A 5C0IA 3O3BB 4JFHD 2OR9H 1UH2A 3MZTA 5C0DB 3KLDA 3TPKA 5IB3B 4HIXH 1MCEA 3ZSTA 3BW9B 3GMLA 2F54B 3RGVA 1FCCA 2VISA 1BIIB 4FFVD 2X42A 4XCNA 5C6WH 2I07A 4AQOA 1LO5B 3FHQA 2Q3AA 4R90H 1Q0YL 4PJ5A 4TSBL 4WW2B 3IF1B 1A3RL 4MNGB 1A6UH 3O2WH 5F9WC 1EAPB 2DOCA 2BERA 4WY7H 3QXDA 3WXWL 4J12A 1B88A 1HHHB 5GGSY 4ZAKC 5F7KC 32C2B 1NFDF 3TIEA 4NO0D 3NBNA 4ZO6A 5DXWA 3W0WE 3IDJB 5EU4A 1ZLWK 4XI5D 3CU7A 3TZVC 5LXGL 1MQ8A 3DVIA 4YFLF 2ZCLL 3W39B 5F7UA 1A14L 3DVGB 4M7KH 3J8F7 3NCEB 3IFPA 4M61A 2A6DB 4PJHA 5B39G 4F57L 1MCOL 1E27A 5HHOB 1U3HD 2Z92B 1KBGH 5FKPB 3M1BA 3MJ6A 3C6LB 5BW7C 2YPLB 5K93A 2R2HA 2V5MA 3ZDYE 1TJHL 5DEGA 1PDKA 1QP1A 4YQXL 3FZUC 3GB7B 2D7TH 2IAMA 1JYXA 5JOFB 3UTQA 4K2UH 1FJ1B 1NEZB 2V5TA 3U82B 3STBA 4FQ2H 2P42B 4L9LA 1MHPH 5JDSB 2AKRA 2RB8A 1RK0B 5CP7A 2GSIA 3NPSB 4UB0H 1I85A 1OF2B 4ZO9A 4U1GC 2XNAA 5IVZB 5DZLA 3ARFD 5IJKC 3TCLA 2WP3O 5D1ZD 5GGRB 3I6LE 5JORA 25C8L 3SPVB 5F3HB 1QYGH 4OCXH 5T3ZD 3ESUF 4U31A 1C7SA 3RZWA 4B41A 3V5DA 1ZHNA 3IU3B 3UPRA 1N6QL 1LO3H 2B39A 4HPOL 4R7NA 3EYQD 4LAJH 4ZS6D 4WGWB 4NO0B 4OM0H 4TVPE 3S35X 1MQKH 2BXZA 4AM0A 3EYUH 4DKEH 1GHFL 1YQVH 3RWCB 1EGJA 5IV2A 4K3DH 4X8JA 1IGFL 4Y4KA 4JHBA 4BSJA 1DBAL 3RHWF 1UM4H 1P5UA 1QBAA 2UWEA 1NCCL 2RHEA 2IQ9H 5F9OH 1YQ2A 4K9EL 5D6CA 4WHDA 1RJCA 1XCTB 1U3HB 1EXUA 1GCFA 5I0ZA 4XWGL 5KW9H 4I0KA 2ENSA 2VLLB 2VR9A 2F58H 3HAEG 4KVCL 3TJHD 4L8DA 3KWWB 3WJLC 3QFJB 1JL8A 5GRVK 4FQHB 2ZUWA 1BBDH 2LV4A 4G6MH 1UG9A 4O4YH 4WHCA 3DX7B 1JF1B 3DURB 1LNUA 3LRGA 3ARFB 4MJ6A 3PGCB 1NGPL 3IFNH 3QIBB 3HMWL 4Y1AE 3T3MF 2OTUA 5E99L 1J5OH 2F19L 3V6OA 4FQIL 3LOWA 2Z8WC 5KS9A 4M7JL 3P77A 5C0AA 4DW2L 2YK1L 4XTRC 1YYLH 3QT2A 4OCRH 4OLWH 1T83A 1ZWIB 3WKML 4EN3A 4RZCB 1Z2KA 2YD3A 2UZXB 3T2NH 2BSTA 1XGRA 1Q72L 1BM3L 1T20A 5EC1A 2B8OT 4GBXD 4ZPVA 3LS4L 1NMAH 4OZGB 2X4SB 3QXVA 1FH5L 1BWWA 1G9MH 3T2QA 4GJTB 5IBLC 1D5ZA 2W0PA 5I66A 1NGYA 2AXFA 2XKNB 3BKJH 5I71B 2J5LC 3E0GA 3VGAC 2VDQH 1HINH 3NZ8A 2JCCE 3U4BL 3TJEL 2MJWA 5FO7A 5TQ2H 1GGBL 4ZQKB 3DBXB 1EFXD 1N59A 3ARBB 5E9DD 4TPRH 4I18B 2VXQH 1QRKA 3AROA 1MREL 3UTTD 3DHMA 3BN3B 4CNIB 2PETA 2DYPA 1S9WA 1T5WA 2XKUA 1YPZE 3DHJA 1ZLSL 4J8RA 5C07D 3JUZA 4J3XA 5DJDA 4CVXB 2DM7A 4S1RH 4R8WL 5JPMB 3SO5A 3VRIA 1SBSL 4G8GE 1YEFL 3TBYB 4K94C 3OKMA 4KK6D 2BX5A 4MGXA 4D0DA 3UPCA 4MZ3A 3BJLA 2G2RA 2EE3A 4PTUB 4DVRL 2HT4D 5EBMA 1CVSC 3UJIH 2ZUQC 3TA3A 3UJTL 4JN1H 3WHE0 2FHCA 1H8OA 1JGLH 3I9GL 2P47B 4Y16D 1A6WH 1F90H 3HE7A 3OGCB 4UNVA 3NOIA 2IBBA 2PXYC 1O7SA 3L3IB 3NA9H 4FTVE 4RBPK 4RDQG 3P4OA 2VB5A 4GBXB 4F58H 5JIHA 5I1KH 1C5CL 1GZPB 5CBAA 3HC4H 3TT3H 4RMTA 3MNWA 3B5HA 2CSPA 4U3HA 5E8PA 4I77L 4WWKA 5IMOB 2FATH 4LLWB 1NBVL 1JRHH 3RVXC 5BMFL 4U1LB 4X83A 4YHIB 2VKWA 1L0QA 2ZJSH 5GGQH 3RDTB 3L7FA 3T3ME 4JFYA 4WV1A 3WBDA 1KPRA 5I17A 1EFXB 1DEEB 1CDJA 3HZYB 4HFUH 1DQLH 5B8CB 4M6OL 5C71A 4ZSOE 4QRRD 3UTTB 1K9TA 4PB0H 2OCFD 2IPTH 4R4FL 2IG2H 5J6GA 1S9YA 3ECBA 3VXUE 2EC9T 2YA1A 4JREC 3Q2CA 4OLXH 5I18H 3TBWA 5I2IA 1GJIA 5C07B 2OJEB 2BVQA 4DGVH 1UKTA 3T1FA 3K4AA 4WUKL 4DFIA 1JCKA 3SDCD 3IDMB 3FN0H 5TFSH 1OPGH 3INUL 2VOTA 3WO4C 4P57B 5TDOB 1S8DA 4QHUB 2A9NL 4XVJL 4LCIL 4GKZB 4QHNB 1BGXH 4Y16B 1MRDH 4JFEA 1JHTB 1M05B 2NY7L 3B3IB 3C08L 4NO3A 2FYYA 1KCSH 4K7PL 4NQEA 3QDMD 4KTDL 3UBXB 5I8EB 4Z0XA 4EXPX 4FXKB 2FJHB 4RMQA 4J4PD 1CGSL 5TE7L 1IGML 3F6LA 4WI3A 1IAMA 4TQEL 2ZP0T 1OT1A 5ICYB 3VMOA 5HGDB 1ZS8A 1IE5A 1NKRA 3AS3A 3Q6FA 1WVZA 4WFFD 4GMTH 5EU5A 2OK0H 2OMNA 4PRNB 2OZ4L 4OLZL 1HXYB 2VXUH 4QRRB 3G5YB 3PL6A 4O02L 2ARJQ 4YUEH 2CGRL 2X4QA 1W0VA 3S96B 3VJ6B 1CGYA 5DJZA 3QQ9C 1YECH 5CEYA 5C0RH 1UB6A 3NIGF 3ME0A 4OLUH 1IGIH 4HWZA 4N8CL 4RA0C 3SKMA 1MCNA 4OV5A 5SV4A 3SDCB 5GSRB 2BOBA 5I9QB 1CDCA 3BH9B 5IK3A 1V3LA 1JWSA 2FJGB 1A3LL 8FABA 3U0TA 1CFTB 4CMMA 3GSNB 4OCYH 4RCAA 2EDJA 1A47A 3PIQB 2X1WL 2CXGA 3U7AA 5C08A 3MV8E 4CADA 3QDMB 1S9VB 1U8KB 3LKQA 4KQ3H 4AIZA 4OZFB 5AYUH 3RWHA 2K3TA 3JV5A 1BREA 2V2TA 2QR0B 5EO1A 3T04D 3HNSL 2DTML 3CC5B 1IGYB 3X3GL 4N0FA 4QT5A 4U2YA 5EUOA 3HC3L 2IANE 5HJ3A 3X3FH 3NCBB 3E6FA 2V5SA 1F4WL 2R23A 3O6FA 4JM2D 4Z7VB 2Q8AH 4FXLA 1LEIA 4K8RL 1UGNA 4JN2A 3S3PA 5D1XD 5T3ZH 5I1DB 3O4LE 3L6FB 2C9AA 4LFHG 3DUUB 1RI8A 5KVGL 2BZDA 4JEGB 3OXSB 4JKPH 2E6PA 2J4WL 5KTEH 3QNYB 4XPBL 2WQ8A 4LSTL 4MS8C 1S78C 1PSKH 1JWMA 2EEAA 2ICCA 4XHJD 3L5XH 5GS0L 4HUXB 3G6AA 4KQ4L 4LPXA 1CLOL 3IDXH 4GS7C 4J6RL 1MH5B 3MQIA 4TN9A 2R4SL 5M94B 1EJOH 1TCMA 5J12C 4BH8A 3NAAL 1OAQH 2QKIA 2X70A 3GGWA 2PUQT 1K3IA 3ARPA 4FQCL 3T0EE 3T2OA 4M6NH 1EGJL 4XP6L 5FYJD 3NIGE 5C09D 1T1ZA 1WC7A 3PQYE 2ZCHL 3FL7A 1CU4L 1MCLA 3D3VD 4GXUM 3VFMA 3E2HC 5IG7B 3GSQB 4HF5H 5J13C 2Q7NA 3G6JB 2VR5A 4JM2B 1DDHB 1KTKE 2G5RA 2DRUA 3HZVB 5D1XB 1MCCA 1BAFH 2NNAA 5F6IB 5I30H 3OAYK 4P2OA 1JV5A 4NSKB 1FG2A 4PRPE 1NUFA 2XPGA 4N1EA 2I5YH 2PYED 2VDKH 5C0EB 3VFUB 5F8QC 1AO7E 5DSCA 3QIWA 3NGBC 1BP3B 2FX9H 1T4KA 1U93B 2DB8A 3EYOB 4FQ1H 4CAGA 4MJIB 3WMSA 1GXEA 1QBMH 1FYTE 5CJQL 3IJSB 1I7UA 4YDLC 2A83B 4WI8A 2CIKB 3PWJB 3MFFA 2YUXA 2FX7L 3BKCH 4DUWA 2YN5A 5IF0A 3U0WH 2XWTA 4GAYB 1JGDB 4XXDB 5MEPB 3NH7L 2OXHA 2DICA 2DMBA 1DVFA 1OGAB 3IJYA 3P0VL 4UZGA 1F6AA 2FSEB 2C3VA 2HFEA 2YR3A 1OP5H 1VADA 3QQNA 5B21A 5FOJA 2OJZH 3U4AA 4OTXH 2JIXD 5FGCE 3IETB 1F4YL 5HVHB 3D3VB 4MDJA 1D5IL 1X5LA 4Y5YB 4GQPH 4KJWD 3BD3A 3TO2A 1CLYH 1JZ3A 2EC8A 5DA4A 1NFKA 1ZT4A 3U0PB 3SE9L 4YE4H 5KAQG 3ES6A 4IS6B 5DJYA 1E4XI 1L4IA 3MV7A 1HXMB 1IC4L 2EYSB 1YNLH 2GTZA 4LGRB 1F8TH 1A7NH 2PYEB 1FHGA 4P4KA 5BV7L 1AGDB 3QUKA 4Z77B 3H0TB 5SWZD 5EU6A 5HYSB 4PJHF 4WFHD 5IBUB 1GC1H 3MGTA 1XF4B 3TV3L 4CN1A 5A2FA 3QDJE 1UZ8A 1L7IH 5DZOA 5IMMA 4WFEE 3LKRA 2GY5A 1AGCB 3U9PL 4POZD 2MKLC 2OXGA 2IGFL 3ULVE 4PJIE 3B4NA 1XH3A 4MD0A 1J1PH 3RY5A 1C1EH 5JO5B 3O41A 4FXGB 4WU5B 2CJUL 1MI5E 4LEXH 2WBWB 3QUZA 1KJ3L 5DO2C 1Y18A 2PCPA 4D9QE 5F96H 3KLAA 2GK0A 4XMKH 3PJSA 3IDGA 4AL8H 2JIXB 3S5LA 2OBGA 3N1MC 4JJHA 2P8LA 4G6KL 4MVBD 4NKQB 1RJZA 4R3SB 4HKJB 4GXUN 3O9WD 4I1NB 4LLUB 1B0GB 5CJXA 5EWIH 3VRJB 3L5WB 1GL4B 4OGYL 1RZJL 3JXAA 4Z8FH 1D5MA 1UACL 2Y07H 4YPJA 1FORH 2E7MA 1SJHA 2DI8A 2VR4A 2I60L 3MPCA 3AREC 2UWEF 5SWZB 2UYLB 1J0KA 4ZO7A 4JZOB 5L7XL 1AHWB 4GAGH 5AAWA 5JIIA 3GSNH 3IB4A 3MJ8B 1AXSB 1C16A 2NPLX 2QHLA 4K7FA 5IEKB 5DYOB 1BQLH 4HGMA 2ERJC 4PJ5E 3OHXB 4IRSD 4KU1A 3ULSA 2DQTL 2XICA 4PJGF 1RIHL 1ZANL 1ZT1A 3ULVC 4W4OA 1XF1A 4KVNH 4Y4FA 2BSRA 4X5WB 5ANMA 4YBLB 1NGWB 1ZA3B 2EDNA 5JUEH 2J6EA 1F42A 5DJAA 1EERB 3EO1A 2FB4H 5EFIA 1YEDB 4UT6L 2Z31D 4GW1B 3MACH 3QHFH 4S1SH 4MX7A 4HS8H 5E00B 3O9WB 2EEDA 1FN4A 1OSZB 4PJHE 5BZDA 2DQJL 3GO1L 5GRUH 3KR3H 2YMXL 3FOMB 4PG9B 2B2XL 1YNKL 4W81A 4Q6IA 1TCRA 5IROA 1CWVA 2X4TB 4U7MA 1J0YA 1SJXA 3BO8B 3F5WA 1X5KA 4WEUD 3UYPA 2Z4QA 3V8OA 1BECA 4MA1C 4KMTH 4UAOB 5GGVH 3QJFB 4H1LG 4WTZA 1S7SA 5JNYB 1F97A 1ZTXH 2WWKT 1OW0C 1F58H 5D96B 2X9XA 5I6XB 1F3JB 3VXRE 3FB5B 4PJCF 4I9WD 3FQRA 4I4WB 4NN5B 1UCTA 4X98B 3GBLA 4EI5D 4PJAF 1KCUL 2BDNL 3GSOB 4R4BA 4HIHB 1FIGH 4JDTH 5F8RC 1P9MA 4XNQB 2A2QT 3DX9A 2Y36L 2YXMA 4K3JH 5IHLB 1D5XB 1Z9SA 5B4MD 4OQ1A 1KPVA 2W0LA 3X14A 5D93B 1S3KH 4LARL 5F1IA 3VU2A 4V1DD 4DEPC 3PXJA 4UINH 3MODL 3JVGA 3K80A 1EX0A 1UM6L 1XIWA 4KZEH 1YEKL 4U1KA 2Z31B 1EAJA 3FT4A 3WUWA 3WFEL 1I8LA 1P7QA 3O45A 3KPRA 1N8ZA 4N0UA 5C0CD 2NYYD 1EA9C 2YSSB 2NX5B 2EE9A 3KYKH 4Z7NF 4QRPE 3DO7A 4DAGH 5I1CL 2I24N 4HUMB 1IFHH 2DQDL 3IKCA 1ZLUH 4OLYH 1A7PL 1LDPH 1WEJH 1Q9WB 3N85L 3UTSB 4HHAB 4K8RC 3B83A 3LV3B 4JKKA 4U1SB 2IAMC 2EDEA 2MHAB 5CZXD 2WLYA 2P43B 1TJGL 2GJ6D 3MLXL 1GSMA 3TFKC 3JWDH 1QBLH 4MNQD 5D2NE 3ZKXC 4MAUL 2P4AB 1RUKH 1KXVC 1JMZA 5TH2B 1R5VA 1FFOA 2H26B 2DLIA 4KKNA 3C60A 2BSSB 4Y5VB 2ZNWA 1QRNA 1KT2B 1DN2A 4PGEB 5ITBL 5DD3L 3MV9D 4DGIH 1TVBB 1IL1A 3V6OE 5ETUA 5KS9E 3TBVA 2C1PB 1BD2A 3CVIH 5F1NB 1XCQB 5H94A 3GBNL 5AUMB 2VDRL 5IB1B 3GIZH 3LB6C 1GOGA 5FYJH 4V1DB 5A3ID 4M8QA 2BK8A 3PNWB 4M7LT 4NQXA 4KROB 1AE6H 3CXDL 4YXKL 3CFIC 3V6ZB 5D7JD 1Z6JT 4O5LL 5E8EA 5IESH 1FLRH 2VUOA 4Y4KC 5HDOA 3NFPB 1WWBX 4GG6E 2ICWB 1N0XH 1X4YA 1JWUA 2VLKA 3CZFA 3HI1A 4WI9A 2GAZB 1AIFA 3LHPH 3P9LB 1UWEH 4XPTL 3QIBC 3I3DA 2FIRT 3F7VA 2FBOJ 1VGEH 2NR6D 4OF7A 5TE4L 3RWIB 1BFTA 3S36H 4WIQA 4L8SA 3QZWB 1WCQA 4PJDA 2GJ6B 4U05A 5HHMD 1I1YA 2DJSA 3WIFB 4MNQB 1VFOA 5HYFA 4FG6C 4S0SD 5LBSL 4PBWD 4NWTH 5D2NC 1T66C 3GI8L 5E7FA 5CGTA 5KVFH 3KYOB 1T6WA 1U6AL 4UNTA 4DK6A 3MV9B 1DUYB 1VFAB 2HT3C 4WW1A 3QBTB 1XGTA 1BF8A 4XB7A 3BN9C 5F7DB 5JDJA 1H3TA 4XVTH 15C8H 5DD0H 2MMXA 4NCC1 1RFDL 3BZFB 3BI9X 3P11L 3MRMB 5MENA 4XH2B 5I1IL 3IAPA 4NN6C 4F9PA 2DQUL 4F7MA 1U3ZA 3ARBC 5ID0A 1R3LB 2RJMA 5D7JB 1TXKA 2V5YA 4I18C 4X6EA 3H9ZA 2QSQA 1KJMA 2FBJL 1Z9MA 4KKBC 1CICC 3MNVB 2NMSA 3OKLB 1KB5B 4OJFL 5HHXL 1ZLVK 4O2EB 3DGGA 4GMSL 1EJ6A 2N4IA 3RL1A 3DMMA 3JZ7A 2P8MB 1H15A 4QGTA 4HW6A 5ACLA 3RZCD 4NM8H 5HHNA 1CZ8H 3MRBA 4G42B 5JXEA 3Q5YA 5H35B 2QADC 3RAJL 4ZNEA 2BNRD 1PZUB 3MXWL 4KRLB 5D8JL 5HHMB 4N0YH 3AY4A 2W9DL 4YHML 3AB0B 3SDXB 4AEHL 1I4FB 4X4YB 3I6GB 5EUOF 4KGLA 3H42L 1MAMH 5IWLC 4NYLB 4IOFD 5E2WH 1XAUA 1P1ZB 3AU1B 2EDQA 3KHQA 2F53D 3FQWB 4PP2A 3ARDA 3BQUA 3WCYA 1NCBH 1Z5LA 3BHBB 4XP1L 2FJFA 5C9JB 4P2RA 3KLHC 4GKOA 2D03H 3FO2A 3ZMRA 3QAZC 2NCMA 1KTDB 3B9KC 3STZB 2DQHH 4LMQE 4JFEE 3TA3C 2OQJB 3RDTC 1BJ1H 3LQAH 1WGOA 5BO1H 4NQEE 4KHTH 3G5ZA 1CK0L 3M17A 4L3CA 3QEUB 3FJTA 2FGWL 4AEEA 1RUML 3NIFF 5LVEA 5DUPH 4KDVA 2LQRA 4KKLD 4LCUB 3MLUH 4JFOA 3SKJH 5TF1H 4Z7UA 2GFBB 4KJYA 1EHLL 5D7LD 1NGZB 1RZJC 4APQD 4WO4A 3RWJB 1KGCD 4LSVL 5BRZA 3MXVL 3BGFB 1WBYA 3BEWA 3RZCB 3JTSA 4CMHB 3HAEH 3VFOA 4D2NA 3UTPD 3MOAH 5I1HH 2JJTA 3GMMB 1RIUL 3KNBB 4HZAA 4NCDA 5FYKE 4R0LB 4ZPTB 4ODSH 2R0LH 4H0GA 3UPAA 1DUZB 1J8HB 5E2UH 5HYQA 5I75C 2ICEA 1JTOA 1GPOH 3Q3GB 1WZLA 4KK9C 2BVOA 1FAKT 4IEFB 2WMPA 3MRLA 1HSBB 5GJSH 1FAIL 4Y89A 4BFIA 2F53B 3BIKB 5DK2B 4GRLC 1R5IB 3K4DA 4XNXH 4Q0XL 3BP6A 3EKCA 2IH1B 3QNZB 3TC9A 3EHBC 5F9JA 3JSSA 1WFOA 1C8PA 5J8OA 5CEZL 4K3HA 3SKOB 1FZJA 2V7HB 4WNQA 2A6JB 1WCBB 3FQTB 5C08E 3VXSE 2BRRH 3OB0H 5C0BD 3UROR 1GGIL 3MUHL 4FQQB 3U2SB 1AY1L 2HN7B 3VRLE 5LWYL 5IW1A 5KANI 4YR6B 4FNLH 3LPFA 4XC3H 3TO4B 1OAXH 1CCZA 3EO0A 4G6FD 5DGRA 3IVKA 1WISA 2J6EL 2J88L 4M6ML 4RFNB 2XFXB 4WEMB 3LN4A 3OAUH 5D7LB 4IOIB 1RU9H 2RIKA 3ORJA 5HI4D 3ZT6A 1JZ2A 1TQBC 5D2LB 4B0MM 2X1PA 4MQTB 4GT7A 1VGKA 4HAFA 1CXEA 5C0DA 1P7KA 5IB3A 3V0WL 3ROOB 5F71A 4Z95H 1MJ8H 3GM0A 1JZ6A 3BW9A 4XPGH 2F54A 3PL6C 3SGKA 3BESR 5HY9B 3FT2B 3EYFA 3MZGB 4Q9RH 4ODWB 5IP4A 5DQJA 3P73A 1LILA 1ZVSB 4MZ2A 3LEYL 1CT8B 2ORBL 4WW2A 2HKHH 4WHYH 2EDBA 1KN4L 2BMKA 3QO0B 3BDBA 4MNGA 1BX2B 3NIFE 1EAPA 5GHWL 4NJ9L 1HDMB 4Y19D 5FOBB 1D9KD 1RK1A 3BISA 1UVQB 3LY6A 1MEXL 3D1MC 3RQ3A 3A6OA 4YFLI 5I1JL 3L3HB 1AGBB 4BQCA 3IDJA 4EIZC 4KJPD 5C0BB 3W39A 5DJCB 5KJRL 1ZGLP 1KEML 1J1OH 3V4PH 2JB5H 4YPGA 1JHLH 4HWNA 3DVGA 1XGQB 4JHWL 2A6DA 4G6FB 4QHKJ 2YBRB 5HHOA 2Z92A 3LN9A 2XTJE 2B1HL 2G9HA 1KIPA 2UVEA 3C6LA 3P0YL 1DQML 2CKBB 4A6YB 4TUKL 4R9HA 3FFCE 5I8OL 5JOFA 1FJ1A 1IEBB 1BZQK 2NZ9D 4TTGA 1RHHB 2GT9B 4FQPA 3PP4H 2UZIH 4KRNA 3WN5C 1JZ4A 4RGND 1A9BB 1RK0A 1H5BC 2J8HA 1OB1B 4LVHB 4L1DA 3M07A 1OF2A 1FNEB 4FZEL 3U48A 5GGRA 2NZIA 2OR9L 3SPVA 5F3HA 4ZNCD 3VA6A 5D5MB 1Z0NA 4RMUA 4GW4A 4HIXL 1HYSD 4AMKH 4BA8A 4Y19B 3IU3A 3LS5H 1D9KB 2IALB 3D0LB 3OAZK 4NO0A 3CFJA 4Q6YA 1XZ0B 3B5TA 3RI5K 2Z35B 5BOPA 4I13B 3HB3D 1FL6B 3HG1D 5EU7E 4ZUVB 4R90L 1KB5H 4F8TA 5FA3B 1OAZH 4XZUA 1ORSA 2ED7A 1A6UL 3O2WL 5DHXB 1FZMB 3GKZA 1EEUA 1XCTA 1U3HA 4WY7L 3ZYJA 1V3JA 3MBXH 2GJZB 4NOFA 4P46C 4X80H 4ETQA 2XTJC 4B5EA 1OLZA 2VLLA 2APBA 1J86A 3ARYA 5GS3A 3RTQD 2FO1A 1JTTA 2CLZB 3GMNA 1Z9OA 3KWWA 3REWB 3GSWB 2ADJB 3A6BH 4RWYH 4FQHA 1W0YT 4M7KL 4RGNB 1ACYH 1OHQA 4LSUH 4M5ZH 2LFGA 4YHYB 3DX7A 3TN0C 3MV7E 3ZDXF 1KBGL 5HD8C 3ARFA 1FBIH 4YO0B 3PGCA 2HWZL 5D1ZA 3GZKA 3BZEB 4KKCC 5FEBA 2LTQB 5EU6E 2X1QA 2D7TL 1RUQH 4K2UL 3ZE0F 2HG5A 4FQ2L 2VZ1A 1MHPL 1A1OA 1FFRA 3GK8H 4RZCA 4NRYB 3SQOH 4JAMB 4F33B 4UB0L 3V5HA 1OCWH 2XQBH 3MRIB 4LSRH 2FD6H 4NDMA 1ZHLB 1QYGL 4KK5D 4OCXL 3L5IA 4OZGA 1ZLWH 2VZSA 1DVFC 5E6ID 1CQKA 5K9QG 2XKNA 3VA2C 1N3NB 1LO3L 3FHAA 4X6FB 2C3GA 4JO2H 1U42A 4OM0L 1MQKL 5DC0A 3EYUL 1S7QB 4OI8A 1RZFH 1W0WB 1YQVL 3RTQB 4ZQKA 1JNLH 1K8DB 1Z3GH 1A6TB 3N1GC 1UM4L 3PWVB 4YBQC 1CDBA 5F9OL 2IQ9L 4M5YH 1REIA 4XBGA 5KBNC 4ZOCA 3K3QA 4P99A 5FKAA 5MP6H 3HE6A 3QIUA 5KW9L 3DO3A 4ONOA 1EDQA 1PG7H 2F58L 5CCKH 1OOAA 1I1FB 3JV6A 5FIEA 2NY0C 5J57B 1T04A 5I1GH 1CDYA 4PTUA 2AK1L 1QACA 4JFXB 4E5XB 5L2KE 5AZEL 1BBDL 4UOJA 5F44A 3V4UH 3BUYB 4TUJB 3L3IA 1JBJA 1G9EA 3QWRD 4GBXA 3SY0A 5E0QA 1J5OL 3WNMA 4I5BA 5ANME 1GZPA 4NP4H 5F1SA 5GJTH 2FEDD 5E6IB 4MD5B 3OR6B 3C5SA 1QSED 1YYLL 3QUZC 4OCRL 4OLWL 1JZ7A 3ZDXE 1U95B 4CBPA 5CAYB 3BYTA 4LLWA 4QTHB 3T3PF 3VMPA 4YHIA 2OTPA 5T1DH 3T2NL 4FABL 1EFXA 3BWUC 5E9DA 1DEEA 3ZE0E 5B8CA 1NMAL 1YJDC 1E28B 4J1UB 3EDKA 1WK0A 3UTTA 3R8BB 2W38A 1G9ML 3L3JA 1U8IA 2FHFA 3BKJL 3D2UD 5CHNA 1BEYH 1HINL 5C07A 3EJYC 3V7AE 2OJEA 1F02I 4ZXBD 2NXYD 4EUPB 5TQ2L 1JPSH 1UC6A 4L4VD 4TPRL 3S3JA 2VXQL 2X7LB 4YBHA 5B3NA 1KENH 4HH9B 4Q2ZA 5TDOA 1FDLH 4QHUA 4P9HC 1VERA 4LIQH 4QHNA 1EHXA 3X11B 4Y16A 1MCJA 3GSUB 3ZKMD 4PJDF 1JHTA 3VD7A 2ADFH 1M05A 3B3IA 2BNQA 1V7MH 4XPHH 1MCRA 3VD4A 4S1RL 3ZL4H 3UBXA 5I8EA 4HJGB 2FJHA 4LEOB 3LIZH 2NY6D 1QSEB 2D0GA 2BFVH 3Q6GH 4POUB 4DN4L 2CKBH 4A6YH 3WL9B 3UJIL 4UAOC 5ICYA 1RUAL 1URLA 4FMFA 4JN1L 5HGDA 3SHSA 5C0FB 1JGLL 4EKXA 1F90L 3KPRE 4N0UE 3FQUB 3NA9L 4NIKB 4F58L 4L3ED 3G5YA 3GBMH 3MRQB 4MMZC 4Q6IC 3TT3L 1VSCA 1E0OB 3D2UB 2BJMH 2FATL 3HLAB 4NPYB 1JRHL 4P3DA 3HC0A 1N0LA 4ZXBB 1KTLA 2NXYB 1HWHB 1UWXK 3CUPB 5HPMB 2ZJSL 5GGQL 2LAAA 4N0CD 2ITCB 5D93C 4S1DD 1FO0B 3SDCA 4L4VB 3WHXA 1QNZH 4OFPA 1X5JA 4PJFB 1ZHKB 5AWNH 4HFUL 5FF6B 1DQLL 3BH9A 1QRNE 2I9TA 2FJGA 3QB7C 4O2FB 4PB0L 4PJ8D 4NZDA 5CZKA 2IPTL 2IG2L 3GFUA 1ZV5A 1NCWL 3GSNA 4OD2B 1GGTA 3WNPA 3T3PE 2A0LD 2B20A 4R6UA 4OLXL 5DT1H 3HUJB 5I18L 3PIQA 4OFIA 1G7JB 3HRPA 4JRXD 4ZUWB 4GG8B 4DGVL 5DDHB 1U8KA 5FYLD 4J4PA 4F7EB 2EYRA 1A02N 2NY6B 1TJIH 3FN0L 5TFSL 1OPGL 2QR0A 1L9NA 3ARGC 5HHVH 3TVMC 4PREB 3SEPA 3CC5A 2VXVH 3I02B 4D0CB 1IAIH 1A9EB 4M3JA 1XIWC 1BGXL 4MA7H 1IVLA 1MRDL 4OF3A 1R24B 4LPWA 2VDLH 4PJ7A 4P59H 3BKMH 1KCSL 4L3EB 3LD8B 1CFNB 4Y5VC 5DMKB 3BIBX 5EO0B 4Z7VA 2WANA 5DR5H 3RBGA 2Z0BA 4JHAH 1XEDA 4OKVA 2X89D 1H3PH 3L6FA 2YUVA 3QDAA 4DKAA 5B4MC 4E0RA 5IB2B 3DUUA 4XVUD 3KPLB 1T7XA 5C0GB 3OXSA 2CDGA 1S5HB 4GMTL 5JXAH 4Z7UF 3PE9A 2OK0L 4I3GA 4R4ND 1VFBA 3SE8H 1OTTD 2HJKB 2ZG3A 3VGEA 3WXVL 2VXUL 4KROC 4PJ8B 4YUEL 3C60C 1MOEA 3G6DH 3VI3E 4HUXA 2ZUVA 1YECL 3MO1A 5C0RL 2HT2D 3MBED 4JRXB 3U46A 4OLUL 1IGIL 4IIQB 1PYWA 5MENE 1GH7A 1I7TB 1YYMH 4UU9B 2X44D 4Y8DC 5SWQB 2LABA 3ARSA 2WM0A 1IEAB 1SYVB 3UZEA 4OCYL 3R06A 5EZIH 4IRJD 5J4MA 1KFAH 4FMKA 4RQQB 1DLFH 1EPFA 5IG7A 3ILPA 4JHZA 4KQ3L 3GSXB 4JM2A 1MRFH 2MOVA 1DDHA 1A21A 5AYUL 4LLMB 4LLDA 3FB8B 3TNMA 3LSOA 3FCTA 3HZVA 5D1XA 1ZEAH 4ZNEE 4NSKA 2D3VA 1NCDH 4L8SC 1FSKB 3UAJD 5SX5K 3VFUA 4TVSa 4LK4A 1S7RB 4HX1A 1BZ9B 3QEGH 5GSVB 3C6SA 4WI5A 5HTSA 3X3FL 3SOBH 1U93A 3GMOA 3EYOA 2JE8A 4Y4HA 4M48H 4X6DA 1JI1A 1BQHG 4MJ4A 4S1QH 2IPUG 5AAMA 4G3YH 5J6HB 1QKZH 5FAAA 4OV6F 2Q8AL 1CTOA 2YKLL 3MGAA 3WLBA 3IJSA 4D9RE 1WITA 2A83A 5HDBF 3MBEB 3PWJA 2WWMC 4UIMB 5DJXB 1CFVH 4GAYA 1HH9B 1JGDA 4P2QD 4XXDA 2J7LA 4P2RE 3X12B 5D71H 2A6IB 4EI6A 1RZKC 4JKPL 5F97E 4PR5A 4TSCL 5KTEL 1PW3A 2B4CC 4Q9BA 1EUUA 5DTFA 3CIQA 3L5XL 4WW2F 5C09A 4IRJB 3T0VA 1CR9H 5MERB 3IETA 3IDXL 5D1QC 1H0DA 4IDJH 2X1OA 2YPVH 2A73B 4X99B 4Y5YA 5KSBB 2AK4D 1EJOL 4JGUA 4JANB 2P5EE 2ITDA 1OAQL 1MFCL 2R29H 3O0RH 5IKCB 4U1JB 2PYFA 5BRZE 3DX8B 3U0PA 4N1CA 4UBDD 4I8DA 2R8SH 3U4EB 4IS6A 4EUPH 2DWEA 3CGTA 1HXMA 2EYSA 3FOLB 4M6NL 3SO3B 4RMSA 2PYEA 1I7RB 1YY9D 1AGDA 4Z77A 3H0TA 3PGDB 5HYSA 1DE4B 1MFDH 2IQAA 4X5XA 1XF4A 3QNXB 3V79C 4HF5L 4JDZB 2XACC 3S36X 4GAFB 4HWBH 4CUCA 3SQBA 5K9OB 3I50H 1ODAA 1AGCA 1MFNA 4OT1H 3QP3A 2QSTA 4QNPF 1BAFL 5I30L 2BXYA 2NY5H 3SGJC 1CFQB 4BKLA 2I5YL 5I16B 4XC1H 3OKNB 4HBQA 4P2QB 2VDKL 4LCWD 3LZFH 1KC5H 1MPAH 3WFHA 4WGVB 4WU5A 2FX9L 5CSZA 3RWFB 4FQ1L 3SGEH 2O61B 3RVWD 1PY4A 1KCVH 1N4XH 4M1CC 1BQUA 1QBML 1RHFA 1CIUA 4U6YB 2IWGA 2JIXA 3RWEB 4ELMB 3CX2A 2AK4B 2ZSVB 3BKCL 3MREB 5I1LB 3U0WL 1S9KC 3TH2T 1AGFA 1WBXB 3H9YA 3VRJA 3QXAB 3CH1B 3OKEB 5DLMH 4YEEA 4BQ9A 1A1NA 3QI9D 1KIRB 4LPVA 4H88H 1I1AB 1P6FA 5HDBE 3L9RB 3K46A 3MCKB 2BVPB 4F7PB 2OJZL 2JJSC 4OTXL 5DFVD 2IMMA 3V8CA 3VD9A 3FQXB 3MLPA 5MI0C 3JTTB 5K9QI 2CPCA 1AHWA 3SGDI 4JO1L 5F6HJ 1CLYL 3MJ8A 1PX4A 1AXSA 4ETYA 5D7KD 3SBWC 5DRWB 4YJZL 2Z91A 3AC0A 5IEKA 3RY6C 5DVMA 3EYSH 3OHXA 4NHUB 4YE4L 4ORZC 1YNLL 1F8TL 1CD0A 4M4RA 4PV9B 3TO4C 2OS7A 4XNYH 5DRZB 4LCWB 1V5JA 3EUUA 3RVUC 2PO6A 3QH3B 3CPLA 4CVWA 2YD6A 4ZDHA 4I2XA 4P23D 3C5ZD 1GC1L 3MRNB 3W2DL 4XCFH 5JZ7C 4M9PA 3KJ6H 1NGWA 4MXQD 1L7IL 4J3WA 3EGSB 4OGZA 1R0AL 4EDWH 2KH2B 2WK2A 1L6XA 4DVBB 1LP9B 3O9WA 4XWOD 1OSZA 4DKFH 4ISVB 3KPPB 5HHOE 5LAXB 4DOHB 1J1PL 1C1EL 3FOMA 4G6AC 4PG9A 4RGOH 5ACMA 5CD5D 5FHAL 5HGHA 4LEXL 4B50A 4GXVH 3SCMD 2X4TA 5JLZB 2E9BA 4HFWA 4LHQB 3BO8A 4NCC2 2CDFA 1U8QA 5J06A 4XMKL 3HTLX 3QJFA 4AL8L 4OZGF 5JNYA 2EIEA 3HAEA 2VL4A 1OT2A 1U8HA 1ZSDA 3T0WA 3NZHL 1UXWB 3VH8B 2FECL 5CS7A 5DQDH 5EWIL 1A6AB 3FB5A 2F8OA 5ACZA 4Z8FL 4I4WA 1F45A 4X98A 3GMQA 1WJ3A 2Y07L 1FORL 4IRSA 4HS3A 3GSOA 4JY5H 3KYMA 4HIHA 5FYLH 4RGMB 4JCMA 1D5XA 4ODUB 1DQJA 1CDHA 5AG8A 4P23B 1UWGH 1M4KA 3C5ZB 3QUYA 3I85A 4GAGL 3GSNL 4L4TD 1G7MA 1SBBA 5KVEH 4QOKD 2HMID 1BQLL 5IW3A 2ATKA 2Z31A 1A1MB 4HK3J 5LG1A 5E8OB 2YSSA 1Q9KB 4N8VB 3MUGA 3SKNA 3NACH 4KVNL 3SCMB 3SDAA 5JUEL 1Q9WA 2QV2A 3MUY1 3Q48A 4GKSA 2A38A 3H3BC 2EH7H 4JM4H 1I7ZB 3LV3A 2FB4L 4WTXA 2MHAA 5AZ2H 2F5BH 3ARXA 1PD6A 1GVIA 5CGYC 4U33A 4LGSB 5CSBA 3QHFL 4S1SL 2P49B 4HS8L 5GRUL 4LLQA 4YHPB 5TH2A 2H26A 3KPSE 4KV5E 4EI5A 1KT2A 4JPKH 5CKGA 1RMFH 1FNFA 3IXTA 4K07A 5FXCH 2OP4H 1OP9A 3O4OC 3K1KC 2EE2A 2PR4H 3GKWH 4KMTL 3OJ2C 5F1NA 2QSVA 1ZTXL 4MWFB 2BY0A 1F58L 4L4TB 4CW1B 4J3TA 4V1DA 3MFGB 5AYQA 2AAVA 1GYAA 1LQSR 2J1KA 4QOKB 4FFWD 2NW2B 1HHJB 2X05A 3WUWG 3V6ZA 5D4QA 1FIGL 4JDTL 4OZGE 1RSFA 1ZHBB 5C0CA 3ULUD 4LBEB 3GSVB 4M93B 4K3JL 4X7FC 2Q87A 5SWSD 4LLYB 4OLVH 3OZ9H 4LMQI 5J1SC 1S3KL 1EMTL 1HEZB 3BPLB 4PRHA 2DJ4A 1LMKA 3G04A 1G6VK 1OAYH 4UINL 3RWIA 2A74A 2X4NB 3MOBH 4OZIA 3HNTH 1NPUA 1NCTA 4KZEL 4QKXB 3RKDD 3O2VH 3QUXD 2C7UA 3WIFA 3KYNB 4BM7A 4MNQA 2XT1B 1G7LB 5B38B 3NFSL 5EULV 3KDMA 1Z9LA 3KYKL 4DAGL 4GQ9H 3P3YA 4XB8A 1IFHL 3KYOA 3EDFA 4OLYL 2DI7A 3AGVA 4LHUD 1WEJL 1LDPL 4M8VA 3QG6B 3MV9A 4UT7H 4TNWF 1C5DB 1UH4A 1VFAA 5IFHH 4L8CB 1O7VA 4HJ0C 1OTUD 4NZTH 3TNNB 2X2YA 4HKXA 3QULB 4GW5B 3SDDC