3EYYA

Structural basis for the specialization of nur, a nickel-specific fur homologue, in metal sensing and dna recognition
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
STDWKSDLRQRGYRLTPQRQLVLEAVDTLEHATPDDILGEVRKTASGINISTVYRTLELLEELGLVSHAHLGHGAPTYHLADRHHHIHLVCRDCTNVIEADLSVAADFTAKLREQFGFDTDMKHFAIFGRCES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative iron uptake regulatory protein
publication title Structural basis for the specialization of Nur, a nickel-specific Fur homolog, in metal sensing and DNA recognition
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eyyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3eyyA02
1J7KA 3CUQB 2A07F 1ZGJA 5TRDA 2M87A 4G8XA 4HX7A 2RQPA 1HKQA 5FO5A 4WXCA 2OU2A 3ABTA 1BC8C 3O6BB 4IRGA 1DUXC 4IHSA 1Z7UA 3IC7A 3TGNA 4A0ZA 2PMUA 2IRFG 1IXCA 1LB2A 3I59B 1HXDA 3GYHX 4HA8A 1O57A 4EM2A 3IL2A 3LSTA 3TO6A 2OQGA 4I98B 1XSVA 4KN4X 4ZZDA 2VODA 4OOIA 3KCCA 2HYGD 4KA4A 4G6DA 2O61A 1R1TA 1BI3A 4LLLA 1L0OC 4IXAA 4WX9A 3DV8A 2V79A 1SMTA 2L02A 1LEBA 1GVJA 4RGUA 4A0XA 3F6VA 4HLYA 2R3SA 2D45A 1SD6A 3DKWA 4LK0F 2UZKA 4WK8F 1R1UA 2D1HA 3W6JB 3CUOA 1DDNA 1LDDA 3KFWX 1DPRA 5FB2A 5D5UB 2OBPA 4G7OF 5E18F 1SD4A 3S2WA 3WTWC 3L9FA 4IRIA 3KP3A 2Y0MA 3WTZA 2HZTA 3R4KA 3L7WA 2HR3A 2M8EA 4U7DA 3I64A 4R79A 3C1DA 4G9YA 2JRTA 2XHKA 1ZHFA 4BHBA 1KYWA 3BZ6A 4A6DA 3GX4X 2QYOA 4U88A 3HSRA 2KKOA 2QZ8A 3P7NA 4KIFA 3RTRA 3BJAA 1I27A 5ERIA 4I2OA 5LBQA 5AIQA 4UVAA 1RIOH 4PCQA 2AXLA 4PGGA 4ENMA 4HDVA 3I71A 2KRFA 2QWWA 1T39A 1V3FA 2K27A 4HDUA 1D8KA 3SQNA 3E5QA 3HHHA 5A2QZ 1HW2A 4YFXF 4YFNF 4P55A 4A5MA 4O5VA 2OZ6A 3K1MA 1XGNA 2VT3A 4HV6A 4UHTA 3HRTA 1PP8F 2F5FA 1CGPA 3R60A 4OU0A 1DP7P 1D8JA 4UXNA 2FNPA 3RDIA 4ZH4F 2FMLA 2ZO4A 1F9NA 3SZTA 4BNCA 5BMZA 4ON0A 3HHGA 1PUEE 3N4MA 1B9MA 2D2WA 5HLHA 4LFUA 1U5TA 2JPBA 3WGIA 1O3RA 5CVJA 4ENKA 2XASA 2RNJA 5DYMA 2XAGA 4M9ZA 1D3YA 3DEUA 4D0PA 5K5QA 3L00A 5JI6A 1XB4A 4E70A 2YR2A 3HRUA 1J2XA 3BWGA 3RKWA 3CDHA 2LNBA 4UNOA 1ZAOA 4RGXA 4Y15A 4KMUX 5EEGA 3KZZA 3OV8A 2XAHA 1U3EM 1T98A 3G3ZA 1H9GA 2EA4A 5L3DA 1IN4A 5BPIA 3F72A 1OKRA 1ZLKA 1ZLJA 2RDPA 1U5TB 2NNYA 2COMA 3LA3A 4CGZA 3SXYA 4YG2F 1XSXA 2O03A 5J8CA 1Z91A 1HQCA 5H20A 5DV5A 3IKTA 4N0BA 5LGUA 5LHIA 4A6EA 2XVCA 2Z9OA 3QU3A 4HF1A 1USSA 1BN5A 1Y0UA 4G94A 5HOOA 3FHZA 3WTSC 1K6OA 1J75A 3P9IA 3J81K 2E7XA 4Z2YA 2PG4A 2HKXA 3ISPA 2LSOA 4M73A 5CYVA 3JSPA 1XN7A 3AAFA 2JT1A 3N97A 3KLNA 1QO0D 1TNSA 4AD9A 3M1EA 3FMQA 1LNWA 2FSWA 4CZZA 4MTDA 5A2QK 1AOYA 3RYPA 2VC1A 2JTVA 2Q2EA 2KJCA 5HDNA 4PDKA 4BQAA 1V4RA 2YSRA 2P5VA 4YFKF 1FOKA 2FBHA 5DD4A 4CDGA 1BBYA 3SHFA 4XBFA 4I02A 2FNAA 1TBXA 1NHAA 3JTGA 2J5PA 5FGMA 3TDUC 2UWMA 3FM3A 4L9JA 1UB9A 3RKXA 4UV9A 4P9FA 4LB6B 3MWMA 4IPAA 4ZYDA 5ICGA 1PDNC 5D5VB 2VXZA 1Z1DA 1EH8A 2XIGA 1BOAA 1P2FA 3IHUA 3I54A 4FX4A 4LJZF 1R22A 3C3WA 3ZMSA 3KEQA 1KA8A 2OD5A 3I4PA 4HLXA 2J5OA 1ZRDA 2OZUA 3WGGA 3BJ6A 2GQQA 5D8LB 1SD5A 3TOBA 1O3TA 1J5YA 2HTSA 5JVTA 4LD5A 2XRNA 2HS5A 3HOTA 2NNNA 2QQBA 1R00A 2V1XA 3GFMA 5ICCA 3HRSA 1USTA 2MA3A 5HDKA 4MEXF 3WE2A 4OMZA 2ACJA 2IVMA 1ODDA 1J0RA 2EFNA 1XD7A 2FQ3A 5LLQA 3LFKA 4MTEA 3M9AA 4M9SA 1HW5A 3ZN1A 4YIFA 2XROA 1P4XA 4IF4A 5IT9K 4L0YB 1ZG5A 3ULQB 3F3XA 3KZYA 3MEXA 4Q5SF 1XMAA 2OA4A 4U7BA 3EETA 4AIHA 2XGXA 2A61A 2AS5F 2EWNA 3F6OA 2H94A 2QQ9A 5EEHA 4S05A 1ZG3A 4L9NA 2P8TA 5K5OA 4HBLA 4ZYEA 2PI0A 2GIVA 2ZCWA 3MAJA 3B02A 2OAZA 1ZYRF 4M71A 4BXUA 1C0WA 5L3CA 3RPQA 3PQJA 5BS6A 4ZYGA 2F5DA 2M5WA 4WCGA 3WTVC 1KYZA 2FXAA 1XGSA 3V7SA 5ILSA 1KU3A 3H3ZA 2FEZA 1FBSA 2BV6A 2H27A 4F7ZA 1KU9A 4ESBA 3V8LA 5CVUA 1S6LA 4JK1X 5CVRA 3K1NA 5LHGA 3K2ZA 5ICFA 1TQIA 1HW1A 4OMYA 3ECOA 1LEAA 2DBBA 5ED4A 3F8FA 1FY7A 4EVIA 2L4AA 4WWCA 2PBIA 3TO9A 1ZH5A 3KE2A 3I0TA 4FHTA 1YYVA 4YIIA 4GCVA 2QBYA 3ZMTA 4DQ2A 3EYIA 2GXBA 2FOKA 1MJAA 4EJWA 4KT5C 1FX7A 3R6SA 1QZZA 2G7UA 4A2UA 1LDJA 3K0LA 5E1WA 5L3BA 5FLXK 3SFZA 1B9NA 2EJRA 1MZBA 1IZ1A 2IA0A 1BC7C 4OIPF 3KP4A 1TNTA 4KUMA 1IW7F 2HKOA 5FD6A 5ILUA 2L4MA 2JZYA 1B4AA 4AIJA 1EH6A 4UUVA 4R8HA 1TW3A 4CYDA 3F8BA 1O3SA 2HOEA 5DD8A 2G7HA 1UHWA 3QPHA 5HS9A 2QBYB 3ELKA 3F8CA 4DNCA 4IHTA 1TW2A 3WTTC 3DF8A 4RB3C 2WWYA 3VODA 3QRFF 3NRVA 2P4WA 1BI2A 2A5YB 1XMKA 3ERED 2Z3YA 2GA1A 3E97A 1ON2A 2EB7A 1QZYA 1BJAA 1YG2A 2PFBA 3U1DA 5LEKA 4KDPA 1TQMA 4ESFA 1ZRCA 1P92A 3GLXA 1WQ2A 2P6SA 2XAQA 4AIKA 3Q9VA 1YQAA 3LQRA 3GZ6A 2K7LA 2P7CB 2XV4S 5HVQC 2FA5A 4I7HA 1W7PD 2MC3A 1R23A 1QGPA 3J81Z 4N9HA 4OINF 3ZQ7A 4P96A 2L54A 4I01A 5KVRA 1WI9A 2CGPA 3OOPA 2X4HA 2MBFA 2DPDA 1H9TA 2DW4A 2EFPA 1RUNA 2WTEA 2BYVE 3FX3A 1HSTA 5E20A 1IAWA 3TOAA 4MQVA 1UHMA 2VE9A 2A69F 4QWQA 1ZREA 1W5TA 2HFHA 3WG9A 1G3WA 3ZMDA 2DU9A 3J7AO 1U6GA 1U5TC 1YFHA 2RV8A 2FF4A 2MH2A 4KYWA 3E3VA 1T2KA 3J80Z 2DFIA 4MGRA 1JGSA 1MD0A 4RB1A 5FD5A 3MCZA 3GEZA 4LG0A 1I1GA 2WV0A 2K02A 5LGTA 1F4KA 2VOOA 2CW0F 1O7LA 3O2PE 1OMIA 3JW4A 4EJOA 5E1XA 5D6EA 3Q9SA 4WF2A 3VB2A 2V1DA 3WGHA 2EA2A 4EJUA 4RGRA 2W57A 2L01A 1MGTA 4EJTA 1IN7A 2Z33A 4AWXB 1REPC 3GUDA 3E6CC 3E5UA 5LEJA 3RIRA 1K7AA 2L3DA 2H09A 1BI1A 5D5WB 1TLHB 4GGGA 2DPUA 1K78A 4EM1A 3BPXA 2X0LA 3R0AA 2FRHA 4RB0A 1R1VA 3L09A 1YS7A 3MQ0A 3FXRA 4BH9A 2STTA 4LG0B 2QENA 2R7FA 2KIMA 2A68F 4NB5A 3BJOA 3ZN0A 2BBYA 2VONA 2XUBA 3GW2A 5E17F 4M6YA 3IWFA 5ILVA 2B0LA 1IUYA 3QU6A 5IT9Z 2PMHA 1QQIA 3D0SA 1X3UA 4LMYA 1FYLA 3HSEA 4LGWA 3H3UA 2VBZA 4EMSA 3JTHA 4I0AA 1LJ9A 3ZMZA 4L9VA 1JXSA 1S3JA 4L9TA 1EV7A 5H6QA 3GVAA 1K78B 3QAHA 4RGSA 5LRSA 2BE5F 3BROA 1DPUA 3ZP5A 3ECHA 4N9IA 4OIQF 1ON1A 1KQ0A 2YPRA 1F1ZA 4O6JA 2F5EA 1SFXA 5D4SA 5HS8A 3RJPA 1FPQA 2DK5A 5JR3A 1G3SA 4A5NA 4ASNA 5JFRA 1G4DA 3R61A 3LAPA 2MLGA 4OIOF 3J80K 3HRMA 1WSUA 3JAMK 1YIOA 4L5JA 2K86A 4A0YA 2QLZA 4RS8A 2EFOA 4IJAA 1U78A 4LLGF 3LA7A 3K69A 3ML6A 3V8JA 3ABUA 3T0YA 4L5IA 5L3FA 3GFLA 2ZJ2A 2IJLA 5HLIA 5FFZA 5HDGA 1KU2A 4LB5A 3KP5A 4GYGA 1LDKB 1GXPA 1FP1D 4HF2A 2DO7A 4UVCA 3D5LA 4IRHA 3P9KA 1IRFA 5DUKA 1ZGAA 4UV8A 3W6KB 1O7FA 3MFKA 2GAUA 4CXFA 4H0EA 3C18A 3IWZA 4OIRF 4M72A 2VOPA 3F8MA 4G7ZF 5FLXZ 1WKMA 3FWEA 1LVAA 1HKTA 1Q1HA 3I5UA 1GHCA 2BEOA 1PP7U 2RC4A 3WODF 1IN6A 3CJNA 3FZVA 5DCFA 1F5TA 1YS6A 1W4MA 3RKYA 4I0BA 4ENNA 5E1ZB 4BHPA 1R7JA 1HSJA 3V7CA 5IT3A 3ZPLA 4L0ZB 1OYIA 1SFEA 3EQLF 4CICA 3V4GA 2RN7A 4HQEA 1FSHA 1TTYA 3L2CA 3VEPA 2FE3A 1ZG1A 3SZPA 1HBXG 2IA2A 3KEOA 4XSZF 4B8XA 1SMYF 1S7OA 3COAC 2Y75A 4P5OA 2M45A 1ULYA 3LA2A 5BQTA 3DXJF 3LAJA 3K9TA 2CSOA 1BI0A 2GWRA 3QP6A 5HS7A 1B59A 1FBUA 2A6HF 3MZHA 4I09A 3ROUA 4P9UA 4BAYA 3V7RA 4KIGA 1HKSA 2HQRA 1YLFA 4PZJA 1IF1A 1XCVA 1RNLA 5BOXA 2CG4A 1JHHA 1ZRFA 1QBJA 1BIAA 1OYWA 4Y13A 1Z05A 3RI4A 1L3LA 1R5GA 5F1RA 2CWEA 1MJ9A 2XKPA 5CVIA 1SFUA 4NHJA 2PQ8A 3HSFA 1MJBA 2M1BA 1FWZA 3IKVA 1O3QA 2ZKZA 5LRRA 1B1BA 1J59A 2IA1A 4PGHA 2DQRA 5D4RA 4HOBA 2PJPA 2F5CA 4RB2C 2MLKA 1IN8A 1FYMA 3ZMUA 3HOSA 4EQQA 4ZZLA 4NQWA 1FT9A 2FMYA 2KIFA 1E17A 1QPMA 2ZNYA 1S7AA 3I53A 4WXDA 2A3SA 2VN2A 3RYRA 1P4AA 4G6QA 2OQRA 2D1VA 4ETSA 4CHUA 3IRQA 4HZFA 2W85A 4GYIA 4EM0B 4KMFA 2O8XA 2YU3A 4KFCA 3WTUC 3FM5A 3GWZA 1LQ1A 3E6DA 3TKYA 2P6TA 1YO5C 5L3EA 1FNNA 1G6NA 4HQMA 2V9VA 1E2XA 3DPLC 2DAOA 3IRRA 2FBIA 1U8RA 4IVNA 5DDGA 2DLLA 3CLOA 2HDCA 4FT8A 4RAZA 2H6BA 3DFGA 2O3FA 3BP8A 2JSCA 2G9WA 3NEUA 4JBAA 5F6FA 1S29A 5F64A 3E6MA 4RAYA 3WU1B 1AWCA 3E6BA 1WWXA 4MEYF 3HTSB 1FZPB 3U9GA 2ESHA 6PAXA 3R0JA 4UVBA 4HX4A 5E8GA 2PEXA 2DI3A 3QP5A 2WC2A 4HYEA 1ZARA 4B09A 2W84A 3FXQA 1P4WA 1RZ4A 2NYXA 1A04A 3G73A 4ESJA 4BYYA 2XKOA 3CTAA 4M6XA 1D5VA 2ZBKA 1XDUA 2VC0A 2TDXA 2VBXA 1K79A 5FFXA 1YTYA 5K1YA 1YW8A 4KIBA 1UCRA 2YX7A 2C6YA 1IN5A 1G3YA 1IXSB 2ISZA 1FC3A 3M8FA 4Y17A 1QNTA 2CQKA 2V6CA 2ADUA 3EUHA 2E7WA 3WTXC 3GFIA 3GZ5A 3T5XA 2EFWA 3GFJA 2RVCA 1RI7A 3JAMZ 2DT5A 1FP2A 2UXXA 1OYYA 2YX4A 3V8KA 2IT0A 4ZYHA 2NAZA 3HTUA 2CYYA 2PLYA 3P9CA 3PQKA 2LF8A 3E5XA 4XLNF 3KP6A 5CVVA 3HIFA 1GXQA 1XGMA 2VE8A 3DPTA 5LGNA 3F8NA 2H6CA 1IXRC 2ESNA 4KN7X 5ICEA 2W25A 5DCMA 2IW5A 1KU7A 3LQQA 4TV7A 4K2EA 4EGZA 2V1UA 4WXHA 5E8IA 2DTRA 2QM3A 2IP2A 1KQ9A 5J8FA 4KICA 3F23A 2MH9A 3F21A 3QPTA 4XLPF 1R5HA 3KP7A 1TQPA 2DQLA 3FF5A 2W24A 2Z5UA 5JHUA 1S8NA 2XAFA 1ZN2A 2HQNA 1FYKA 2NRAC 3WU0A 3BPVA 1Z6RA 1T0FA 2QQAA 3I58A 5HLGA 3WE3A 1BM9A 2EV6A 2GZWA 3Q5FA 3NQOA 1T6SA 4KNYA 1KGSA 4M9XA 3VOEA 3K1PA 3PFIA 4S04A 1OPCA 2QVOA 5KK1A 2UXNA 5DCMB 2EV5A 4GXOA 2IPQX 3ZMVA 2EFQA 3MZYA 1SAXA 3TDZC 1BIBA 1Z9CA 4Q48A 5BPDA 1FLIA 1SD7A 5DEQA 3KETA 4HW0A 3DQVC 3TO7A 4CO8A 3GXOA 2LF7A 2DK8A 5K5RA 2NS0A 2JPCA 2LDUA 3T8RA 3KP2A 2ELHA 4HV5A 1JE8A 2CO5A 3U2RA 4G7HF 2ZFWA 1YW7A 3C7JA 2HEOA 2GA2A 1J9IA 5CJ9A 2E1CA 3M8EA 5H6RA 3HUGA 4EGYA 5CLSA 1ONVA 2VBWA 2VBYA 2BGCA 4R1HA 2ISYA 2HTJA 1OR7A 1CF7A 5AONA 4HF0A 3QOPA 2QUFA 4GO1A 1EH7A 1T38A 1W5SA 2R7DA 3RPUA 3BY6A 3GO5A 1STZA 4U0VA 4AVPA 3B73A 4MHGA 2M30A 3BDDA 1XGOA 4EJVA 3CO6C 1B6AA 1FSEA 4Q47A 2EV0A 4MQ9F 3T8TA 5D5XB 2HYFA 3GF2A 1MDMA 5L3GA 5TJJA 1FBQA 2P5LC 1P6RA 1I1SA 2ZNZA 1UFMA 4XSXF 1IRGA 1KQ8A 2A6EF 4JQFA 2MD5A 3O3KA 2VT2A 4QLCU 2XAJA 2O0YA 4A12A 2RKHA 1CF7B 2O6GE 5J6XA 2Z99A 2STWA 5AIPA 4LK1F 1W7PA 4BHCA 1H0MA 2E1NA 3REOA 2EK5A 1XCBA 2RGVA 3DP7A 4O3MA 1I5ZA 2HWVA 2Y48A 3CO7C 2KJBA 1VTNC 2K4BA 1R58A 2HGCA 3M7GA 1MDMB 1Z6TA 1MKMA 4MNUA 4HAMA 2ZMEA 2FU4A 3CUQC 1I6XA 1WRJA 2KIUA 4M74A 3FMRA 1XSDA 3LWFA 1XDSA 1YW9A 3H92A 3EDPA 2PN6A 3FMSA 4FX0A 5D6FA 3FXUA 5LHHA 3CUQA 2P5KA 4EV0A 2ZXJA 2Q0OA 1W7PB 2K4JA 3HYIA 3WTYC 2P7VB 3VFZA 2Q8KA 3EYYA 4HX8A 3F22A 4ENJA 4U0WA 2GXGA 3T1BA 1R36A 1G3TA 5DUIA 3I59A 2F2EA 1U2WA 5D8KB 2ZMEB 3TQNA 4L18B 2LKPA 3BOQA 4XRFA 4U0YA 4LLNA 4Q4ZF 1RUOA 3KLOA 2ETHA 2FBKA 2CFXA 1JHFA 3JSOA
chains in the Genus database with same CATH superfamily
1J7KA 3CUQB 4QPOA 2A07F 3GMEA 1ZGJA 1Z2OX 5TRDA 1HA8A 1P8LA 2M87A 4G8XA 4E6KG 2QSHX 2JA7J 3CP8A 5KT4A 2JA5A 3BG6A 2TRTA 2VKEA 4HX7A 3OL4A 2R93G 3NARA 2RQPA 1ZQ7A 4A3DJ 4A3BJ 1HKQA 5FO5A 4WXCA 2DT7B 2OU2A 4BE0A 3ABTA 1R5ID 2HDDA 1BC8C 2V1NA 2PMZN 4CCMA 1VQMI 4V2FA 4OAYA 4F93B 4ECXA 2NS7A 4BBRJ 1BL0A 3K70C 1DQUA 3O6BB 4BEHA 1MNDA 3ORRA 2E1MB 4IRGA 1DUXC 4IHSA 3H9GA 4JI7H 1Z7UA 4M3BA 4XMYA 1CS0A 2V4JC 4OAZA 2EIMH 3IC7A 4W97A 3TGNA 4A0ZA 4PJJA 2PMUA 1XMQH 2IRFG 1SFOA 1IXCA 1LB2A 4QW8A 1RKWA 3LP8A 4AQYH 1KBLA 1MMGA 3I59B 1DV1A 4FM9A 1A36A 1HXDA 3GYHX 5FKMA 5HBRB 4HA8A 1O57A 4EM2A 2Z16A 3IL2A 3WG7H 1ETYA 3LSTA 3TO6A 2OQGA 3HGGA 4I98B 2W9BA 3H35A 1XSVA 4I99C 2L0KA 4ED0A 3RZOJ 4LFBH 4KN4X 4ZZDA 5GTHC 2VODA 1MBJA 2Y0SN 1S0OA 4OOIA 4MFEA 4F4XA 3KCCA 2HYGD 4KA4A 4C9YA 3G4SI 2ZXHA 4G6DA 2O61A 3FKIA 4LF6H 1R1TA 1NG7A 2V5AA 4X66H 1BI3A 1UC9A 1YJ9I 4LLLA 1L0OC 4IXAA 4WX9A 2O8KA 4O2BF 5KHDA 4IHVA 4ITVA 4AVZA 4B44A 1BW5A 3DV8A 3HJEA 1WJAA 2V79A 1VQ8I 2FPPB 1SMTA 1KONA 2L02A 1T94A 1IOVA 1LEBA 1GVJA 4RGUA 4A0XA 3F6VA 4HLYA 3RB3A 1S9FA 2R3SA 3I3LA 2D45A 3FHNA 3P5JA 4F50A 3HOYG 1SD6A 3DKWA 4LH7A 4LK0F 2UZKA 4WK8F 1R1UA 2XGQA 2IBDA 2D1HA 3CJTB 2YRWA 4XN3A 4Y4RA 3KYCB 2DXIA 2H1KA 3L2QA 3W6JB 3CUOA 4DGWB 4ECUA 1DDNA 3MD2A 3KX2A 4MFDA 1LDDA 1QA6A 3ABKH 3MVPA 1UG0A 1DPRA 3KFWX 3Q0WA 5FB2A 5D5UB 2JA6G 2W82A 4BEHB 2OBPA 2I10A 4G7OF 3CQZA 4QW9A 5IWAH 5E18F 4Y8VB 1SD4A 5LA6F 4Q8EA 3S2WA 1B6SA 1A6QA 3Q8SB 3KHHA 2ID6A 1XX5A 4F52A 2KZVA 1WJBA 3WTWC 2E71A 3VYTB 3MKWB 3L9FA 4IRIA 2KPMA 3KP3A 2Y0MA 5J4VA 3WTZA 3HOYJ 3VPCA 3GTQA 2HZTA 3JRBA 1JUPA 3R4KA 4MAMA 2W9BB 4C3HJ 3L7WA 1RYSA 2HR3A 2M8EA 1C30A 3KPHA 4X0GA 2C2EA 2Z1DA 2UVUA 4U7DA 3I64A 1SFKA 2F4VH 2UUCH 4R79A 3C1DA 1LFPA 4G9YA 2JRTA 2XHKA 1ZHFA 2R7TA 4TV9F 4BHBA 1KYWA 3ERMA 1TWGA 1GO3E 4PJNA 2FK2A 3OYKA 2DTZA 4DV4H 3BZ6A 2DA7A 4A6DA 3OOUA 3CJQB 4JYKA 3JR9A 3GX4X 3TINA 2E19A 3GTKJ 4PJMA 2JSPA 2QYOA 2OTJI 2QK4A 4XRMA 4U88A 4YR0A 1I7LA 1VFCA 3CLQA 4NBQA 3ETJA 1HDPA 4XM3A 4WBNF 4IZOA 3HSRA 1RETA 2KKOA 1LKXA 2QZ8A 3P7NA 1ERDA 4A3FG 4DUYH 3DF7A 5LYJF 5KFXA 3SZGA 3OL3A 4KIFA 2KQRA 3RTRA 4CUGA 2W6PA 4PSXA 1B8IA 3BJAA 1I27A 5ERIA 4I2OA 4Q8FA 5LBQA 3CCJI 5AIQA 4A3GJ 4UVAA 1TZLA 2AQ4A 1RIOH 1ZHQA 1VQOI 4PCQA 1X1AA 2AXLA 5B5EC 4PGGA 4ENMA 4LSXA 4HDVA 2E1OA 2B63A 2XGDA 3PO3G 4UCSA 3Q3SA 3B6CA 3I71A 3PR4A 2KRFA 2OF7A 2QWWA 1T39A 2XF6A 3PVXA 1R9TA 1X58A 1V3FA 3BQ1A 2YYAA 4LF7H 3PSFA 4ED3A 5KFFA 2C28A 4DYRA 2K27A 4HDUA 1D8KA 4LG3A 4A3FJ 1GYFA 3SQNA 2ASDA 2FJZA 4GKKH 4PFOA 3ZQFA 1WSCA 3E5QA 2W6OA 2XF7A 3HHHA 5A2QZ 4YHHH 5KCMA 1HW2A 4YFXF 5HNHA 4YFNF 4P55A 1C3OA 3FXKA 4R8UA 1GT0C 4A5MA 3N42B 4O5VA 4F4YA 2OZ6A 3K1MA 1XGNA 2VT3A 2WAQA 5KFLA 2LYCA 3SDBA 4HV6A 4UHTA 4DR6H 3HRTA 1PP8F 2F5FA 1N34H 5F04A 1VQ4I 3KAJA 3MR6A 5HV6A 2RF4A 3PO3J 1CGPA 3H9JA 3R60A 2EIJH 4OU0A 1DP7P 2YZNA 1D8JA 4UXNA 2FNPA 1E4GT 3RDIA 4D5FA 4ZH4F 2DODA 2FMLA 2ZO4A 5B3SH 1FOXA 5KT3A 4BJTA 1X1CA 1F9NA 3SZTA 3MFIA 3C2BA 4BNCA 1SVLA 3VYSB 5BMZA 4ON0A 2BQRA 2W6MA 4GKJH 3HHGA 4RUAA 2XPUA 2JA8G 1PUEE 3D1NI 3N4MA 1B9MA 5F0FA 1B8IB 2D2WA 1QRYA 5HLHA 3GCMA 4LFUA 1U5TA 2E5ZA 1IUFA 2JPBA 3WGIA 1O3RA 4IWXA 3T1YH 5CVJA 4ENKA 2XASA 3G1OA 1SANA 4Y33A 2HOTA 3Q8RB 5IOYA 2RNJA 5DYMA 4F4WA 2AQEA 1A5JA 2H8WA 2XAGA 1Z67A 1VI0A 2V6EA 2R82A 2IS2A 4M9ZA 2W9AA 4MV4A 3VMMA 4J9PA 1D3YA 2FJ1A 3DEUA 3A03A 4PSWA 4D0PA 2GPSA 5K5QA 2ME0A 2HHHH 2W6ZA 1WH5A 5KFTA 3L00A 1JT6A 1T0FC 5JI6A 3GTPA 4BKXA 2UVVA 2RREA 1XB4A 1JUMA 1UMQA 2DN0A 3PNTA 1OCOH 4E70A 3N41B 4EG0A 3F0CA 2I8CA 2RNGA 3BTLA 2YR2A 1TWCJ 2CS3A 2FLPA 2LMDA 3ASOH 1J2XA 3BWGA 3HRUA 3RKWA 3CDHA 3FBIB 2LNBA 5J4YA 4II3A 5C1OA 2WAFA 4R8UB 4XLCA 4UNOA 2WAQN 1FMWA 4ZHQF 2R92G 3HL2A 1XNRH 1ZAOA 1UNNC 3PW4A 1VKZA 4IHXA 4QWCA 2E36A 2Y2ZA 3CD6I 4JOMA 3WU2C 4RGXA 4A3KG 2XCPA 2X6WA 1JJ6C 3PZPA 4Y15A 4N4OB 2X9DA 4KMUX 2CRGA 4UUSB 2M34A 5EEGA 1EHIA 1D0ZA 3VPBA 3KZZA 1WCMA 2DIKA 1QZEA 3LSHA 4O3SA 3OV8A 1TL8A 2XAHA 1U3EM 1T98A 4KJZA 1LUJB 2R7QA 4XKBA 2J6UA 3S2DJ 4A93J 3MWEA 3G3ZA 1H9GA 1TWHJ 2EA4A 5L3DA 4J9NA 1IN4A 5BPIA 2DDBA 3F72A 2R0QC 1S97A 1OKRA 3PUFA 2ICWG 1ZLKA 3ESWB 1ZLJA 2KFDA 3MMYB 2RDPA 1IOWA 1U5TB 3CJRB 2NNYA 2COMA 2ZM6H 3LA3A 2JVHA 4XNFA 4CGZA 2R92J 4ECZA 3SXYA 1HR0H 3CP2A 3QWLA 4YG2F 4EBCA 1WI3A 1XSXA 2O03A 1GVDA 2RAEA 5J8CA 1Z91A 3JREA 1HQCA 3HDDA 3GTKA 4A3KJ 5H20A 4E7HA 1OCPA 5DV5A 3IKTA 4N0BA 1R6RA 5LGUA 4NNJA 2XB5A 5DM7F 5LHIA 5C8YF 4A6EA 2XVCA 2Y9YA 3K4NA 2Z9OA 3QU3A 2R7SA 3ZRGA 5KFPA 4HF1A 1USSA 2XSJC 3RUPA 1BN5A 1Y0UA 4G94A 5HOOA 1DU0A 2KDZA 2R7RA 3FHZA 3DTKA 3WTSC 2LVSA 1K6OA 3P9IA 1J75A 2AGPA 4U6PA 3J81K 4YJ3F 2YL2A 2E7XA 2BQ3A 1JI8A 3JRWA 4NXNH 4TUYF 4Z2YA 2PG4A 4JX5A 2GBYA 2HKXA 2C2DA 4M3DA 1DGRM 1QHGA 5JQWA 5L1LA 3ISPA 2LSOA 4M73A 5CYVA 3JSPA 2DJIA 3FKJA 4EEFG 1XN7A 2KISA 4F92B 2BOLA 3AAFA 2BXZA 4XLAA 3GV8B 2JT1A 3N97A 5DQIA 3KLNA 1QO0D 1TNSA 4C2UA 4AD9A 2OLSA 3M1EA 3ONQA 2NU7B 4IQJA 4RBOA 5KT6A 5KKNB 3FMQA 4ZDPA 5KT5A 4B3SH 1LNWA 2FSWA 4CZZA 4MTDA 1IDYA 2VJJA 5B1AH 5LFAA 4UCUA 2AHQA 5A2QK 2CH0A 1AOYA 4B3TH 3LSMA 2DOEA 3RYPA 2BW3A 1SVOA 2VC1A 3LSKA 4NDLA 5GPAA 2XCLA 2R5YA 2JTVA 4M3FA 3SE7A 3TQTA 3KHLA 3OIQA 2Q2EA 2KJCA 5HDNA 4PDKA 4QWAA 3NAUA 1M6VA 2R7ZJ 1DGSA 4BQAA 3S2HJ 1ETOA 4UB8C 4LF9H 2NU9B 1V4RA 2YSRA 1NK3P 2VASA 2PJRA 2P5VA 2JA5G 4IR9A 4YFKF 2FB9A 1FOKA 2CV2A 3M3YJ 1BR4A 2FBHA 5DD4A 2DPJA 4CDGA 3HOUG 1BBYA 3SHFA 2ZB9A 5FKOA 2DLNA 4XBFA 4CCOA 1RR7A 1VS0A 4I02A 5KT2A 5F27A 2FNAA 3TL4X 1TBXA 2HZDA 5C1PA 5IP9G 1S0MA 1K83J 1NHAA 3JTGA 4B3RH 2J5PA 5FGMA 3TDUC 1BR2A 3OSGA 2UWMA 4HRIA 2CQYA 3FM3A 3SFIA 3S1QJ 4C3IJ 2DFFA 4L9JA 4F3QA 1UB9A 1GV5A 2L7FP 3RKXA 4A3LJ 2EILH 1MBFA 1CQIB 1W0UA 4UV9A 4P9FA 4LB6B 1XPXA 3MWMA 4IPAA 2KL4A 4ZYDA 2WY8Q 3GLKA 4B3XA 2NUAB 5KFKA 5C3EG 3BC8A 5KFMA 4J9LA 5ICGA 1PDNC 5K7FA 5D5VB 3PFYA 3W3CA 2VKDA 2JA5J 2VXZA 4JI0H 2DT6A 4BU2A 4QPQA 1Z1DA 1V51A 3H0GG 1EH8A 2XIGA 4IR1A 1BOAA 3G1LA 1M7JA 4ED7A 4BDYA 1P2FA 3IHUA 3M8JA 4BY1J 3I54A 3FKIG 4FX4A 2R7KA 1ACIA 2A05A 4CYCA 4XRSA 2UXBH 4LJZF 1R22A 3C3WA 3LMMA 3KEQA 3ZMSA 2K9LA 4QSHA 4A3EJ 1OCTC 3M4IA 4M3GA 1KA8A 2BW3B 2OD5A 3I4PA 4HLXA 2J5OA 3V6HA 1ZRDA 2OZUA 3WGGA 2R5YB 4ANJA 5C3EJ 3V42A 4FS2A 4PJLA 2Q2EB 3RB0A 3SI8A 3BJ6A 3M1CA 2GQQA 1OCZH 5D8LB 3C2HA 2X51A 1SD5A 3TOBA 4XLEA 1O3TA 2PJRB 1W93A 1J5YA 2BZTA 2R85A 2HTSA 5JVTA 4LD5A 3OYBA 2EH3A 4F55A 2XRNA 1TP4A 4J0MA 2HS5A 4HNTA 3Q0VA 3PW5A 1QPIA 2F6CA 3BJYA 3HOTA 3GTJA 2NNNA 2EPFA 2FX0A 2QQBA 1R00A 2Q2UA 2ZMEC 5KAFC 3FKIJ 5EWFA 2V1XA 3CDIA 2VL8A 3GFMA 1EF4A 4GC6A 5ICCA 3HRSA 2R7UA 1TWHA 1USTA 2MA3A 5HDKA 4MEXF 3WE2A 3S14J 4OMZA 1WGXA 4FS1A 4O3RA 3GIQA 2HYJA 5KAIC 4DW6A 2ACJA 3HOZG 2WAEA 2IVMA 2I80A 1ODDA 4BJ6C 1J09A 1J0RA 1XMOH 3F9KA 2EFNA 3K10A 3LSJA 3Q1KA 5J2UF 1XD7A 2XC7A 1R4NB 2FQ3A 5JLXA 3UQ8A 5LLQA 3LFKA 2JJ7A 3CMMA 5IPAA 2R7LA 5KG7A 4MTEA 4AU7A 1AHDP 1NG6A 2VI6A 3M9AA 3HOWJ 4A3JG 4M9SA 1HW5A 3ZN1A 4YIFA 2LG4A 2XROA 3S1MJ 3MJFA 4CSWA 1P4XA 1E3OC 4IF4A 5IT9K 1UZCA 2ID3A 3WNZA 5FROA 4L0YB 3C0FB 1MNMC 4MLOA 1BNCA 2DA1A 2L2OA 4A3IJ 4EEYA 4A69C 3QQAA 4DOZA 1ZG5A 2BHYA 3ULQB 4CYCB 3F3XA 2Y31A 1W36D 3K5IA 4AYBE 1KJQA 4LIVA 3KZYA 3MEXA 5EZHA 1XMAA 4E4HA 4Q5SF 2OA4A 3J81W 3QYFA 2CUZA 5K7HA 4U7BA 3EETA 4AIHA 2XGXA 2A61A 5KG6A 2LP0A 3B6AA 2KMUA 4CCKA 2AS5F 1TWFA 2EWNA 3K3PA 4DLKA 3F6OA 2H94A 2V9WA 2YU9A 3GTLJ 2QQ9A 4N4NB 5EEHA 4S05A 1ZG3A 4DYCA 4A3JJ 4L9NA 1PJRA 2VXDA 2P8TA 2UUZA 1QHHD 3DLAA 5K5OA 3G1MA 1Y8QB 4HBLA 4ZYEA 2M3AA 3CCYA 3I4NJ 2PI0A 2GIVA 4W1UA 1TWGJ 2ZCWA 3MAJA 1Y8RB 2MYSA 4C5BA 3J7ZI 3B02A 4HSRA 3K4BA 3ORQA 2OAZA 1ZYRF 3N43B 1Y1WJ 3OYDA 4M71A 4XYMB 3OYMA 4BXUA 3GIMA 1JX4A 1C0WA 1Y14B 5L3CA 3I4NG 3RPQA 4X1EA 3OTOH 3PQJA 5BS6A 2R7ZA 4ZYGA 1MSFC 2BR0A 2JEGA 2F5DA 2M5WA 3TP0A 1HNXH 4WCGA 2R7NA 5F9NA 2E35A 3LL7A 4BDZA 1R49A 2W8LA 3WTVC 1KYZA 2FXAA 1XGSA 2HOAA 3V7SA 2VUGA 5ILSA 2NVYA 1KU3A 4A3BG 3FBNB 3DKXA 3H3ZA 4UY8I 2FEZA 1FBSA 3J80W 5F0CA 1KC7A 2BV6A 3A2KA 3JAMW 2H27A 3LSIA 4F7ZA 1WZ2A 5K7ZA 1CQJB 1GLNA 1KU9A 2PX9A 4ESBA 3V8LA 5CVUA 1S6LA 4JK1X 5L1IA 1GGOA 2IEKA 3GIPA 5CVRA 2JRMA 3K1NA 5LHGA 4ME6A 3K2ZA 1R4MB 5ICFA 4GFBA 3S16J 3SYTA 4MIMA 1EYZA 1Z21A 4FETA 5IYCG 1TQIA 1HW1A 4O3QA 1N56A 4OMYA 4XN0A 3ECOA 2B63J 1LEAA 2DBBA 5CQEA 5ED4A 5EZYF 3F8FA 1FY7A 1N78A 2DWCA 4E7JA 4A3CG 4EVIA 1R9TJ 5BNGA 3CMEI 2L4AA 4WWCA 3VPRA 5L9XA 3DU5A 1FJLA 2PBIA 3TO9A 2MSYA 1ZH5A 2K9MA 3KIOA 3KE2A 3I0TA 4FHTA 1YYVA 4YIIA 2E5LH 4B4CA 3S17J 3LMLA 1HDDC 4FTHA 2VPRA 4EATA 1DU6A 4GCVA 1YI2I 3H4DA 3S93A 3JSLA 2QBYA 5EDWA 3ZMTA 1MMDA 4DQ2A 3OYAA 3EYIA 3AFHA 2GXBA 2PVPA 2FOKA 5IYCJ 2RDIA 1X1PA 1MJAA 4C30A 3OSFA 3BTCA 5GAEJ 4EJWA 3H40A 4KT5C 3FDSA 1BA5A 4TQSA 4GDFA 1FX7A 1X2MA 1MIJA 4RAFA 3R6SA 2FMAA 3MWDA 1QZZA 1K4TA 5KG3A 4DV5H 3QFFA 2G7UA 4A2UA 1LDJA 4A3CJ 3K0LA 5E1WA 5L3BA 3L2VA 5FLXK 3SFZA 5DLFA 1QVTA 1B9NA 1T95A 2EJRA 1X3ZB 4IHJF 2R8IA 3H1CA 1VQ6I 3PR5B 1EA3A 4UCOA 3UFXB 1MZBA 1IZ1A 5L1JA 3Q8QB 2IA0A 3SEZA 3A0HC 4QWEA 1MMNA 4RLFA 1H88C 2PMZE 4Q45A 3E0JB 3OYCA 2W4SA 2VB6A 1BC7C 1JKPC 4OIPF 3FIWA 3KP4A 3N8DA 3LWBA 1TNTA 2CQXA 4KUMA 2DA2A 1T08B 1V55H 3H9QA 3FXJA 2M0CA 1J5EH 1POGA 1IW7F 2HKOA 2R4GA 5FD6A 5ILUA 2L4MA 2JZYA 1O4XA 3BQ0A 1B4AA 4AIJA 1EH6A 4FASD 3GTGJ 4BQQA 5M5YJ 5EDNA 4UUVA 5KG0A 2KT0A 1E4FT 4R8HA 1VBGA 5FKKA 1WCMG 4LITA 1AU7A 4BGDA 1TW3A 4CYDA 2LRDA 2HVSA 1XS9A 3F8BA 2AU0A 4RA2A 1O3SA 2HOEA 2IGKA 1LFBA 3DEEA 5DD8A 2G7HA 1OLTA 4YB8B 5IT9W 3S15J 4RM2A 4GC7A 3GLLA 2WY7Q 1UHWA 2VQGA 3QPHA 5HS9A 2QBYB 2VR1A 3K4CA 3ELKA 3F8CA 3VSKA 4DNCA 1I6HJ 1YJWI 1TW2A 4IHTA 1FMVA 3PUBA 4BQNA 3WTTC 3DF8A 2NVXA 3IN5A 4RB3C 2WWYA 3VODA 1YHQI 4DV3H 3M9NB 3QRFF 3EUAA 3NRVA 2P4WA 3OYIA 1BI2A 2A5YB 2OJED 1XMKA 3ERED 1UELB 2Z3YA 4YP3A 1WCMJ 2R7WA 3GTLA 3MZ8A 1AUVA 2GA1A 2UUAH 3FK7A 4ZC3A 3E97A 2H1LA 2R8HA 1ON2A 3IP4B 2EB7A 2O9LA 1QZYA 1YJNI 4EFBA 1I6UA 1BJAA 3BR2A 1IV6A 1AA7A 2DMPA 3E5NA 1MBKA 1YG2A 4IOAF 2PFBA 3U1DA 3DU6A 5LEKA 4KDPA 4IRKA 4A3GG 3V4SA 4ZDLA 1TQMA 5BPFA 2E2HA 4ESFA 1IDZA 1ZRCA 4DV6H 1P92A 2KDOA 3GLXA 1WQ2A 2YS9A 1Y1WA 2YW2A 3OMYA 2P6SA 2XAQA 5KFDA 4AIKA 3Q9VA 3FK6A 1YQAA 2YUSA 1HNWH 1D5YA 5CAEB 3LQRA 2ZJQF 3HKZE 2FK3A 1HOMA 1K1QA 3RJ0A 5E3LA 2W8KA 1RC9A 3KZIC 2LKXA 3N6XA 2C00A 3GZ6A 2K7LA 2DMQA 2A6TA 2P7CB 3HOXG 2XV4S 3OR2C 1HC8A 5HVQC 2FA5A 3JRAA 1PYVA 4I7HA 4EGQA 1W7PD 2MC3A 4DR5H 1R23A 3N05A 5LL6b 1QGPA 2EQRA 2A5WA 4N9HA 4OINF 3J81Z 3ZQ7A 3Q2OA 4DUZH 4P96A 2L54A 4GLXA 1N77A 2ZDGA 1WJ5A 4I01A 2VPSA 5KVRA 3HPGA 2CZGA 4PK4A 1WI9A 2L5QA 3OOPA 2CGPA 1JT0A 2X4HA 2MBFA 3IV5A 3W6VA 2XGPA 2Y69H 3OYJA 2DPDA 1H9TA 2DW4A 2PBZA 3LFUA 5C4XJ 2EFPA 1RUNA 1TC3C 4BXXJ 3K6GA 2R7XA 2WTEA 4OWRB 4TQRA 2BYVE 3FX3A 1HSTA 2BY2A 5E20A 1SEUA 3JRXA 1IAWA 3TOAA 2KLOA 4KT6A 1X4OA 4MQVA 2QKMB 1UHMA 3FXMA 5B1BH 3K5HA 1N75A 4HEA2 3KHRA 3J7AK 2K85A 3HOXJ 2VE9A 1YE9A 2A69F 3OS2A 4D1QA 4YQWA 2L7MP 4QWQA 2K9NA 1ZREA 2VQFH 1W5TA 4XYLB 4BY7J 2HFHA 1VQKI 4EFEA 4O4HF 3WG9A 3G71I 3EPGA 1G3WA 4KITB 3RBEA 3ZMDA 2BVMA 2G0EA 4ECVA 3S1NJ 2HDWA 3V6JA 3C2GA 3GV7B 1XMXA 3ETHA 2DU9A 1EUCB 5HODA 5I47A 2MW8A 2ELKA 4UUSA 3I4MG 3J7AO 1U6GA 1U5TC 2NS8A 5DG7A 1YFHA 4HSTA 2RV8A 2FF4A 5DQGA 2MH2A 5FLXW 4KYWA 3E3VA 1T2KA 2J6SA 3J80Z 3HC7A 1JIHA 3DCFA 1Y1VA 3S32A 1EUDB 2DFIA 4MGRA 4RNOA 2EZIA 2FKLA 4M6VA 2VKVA 2CKZB 4IHYA 3U1KA 1JGSA 1ETVA 1MD0A 4RB1A 4XRSG 5FD5A 3MCZA 3D5SC 2ATLA 5EJCA 3GEZA 4JI1H 1MW7A 4LG0A 2IMWP 1I1GA 2QSFX 1ETKA 2VPQA 3OR1C 3BG9A 2WV0A 2K02A 2XD4A 1Z77A 5LGTA 2FOWA 1TAEA 4PUSA 1F4KA 2JVGA 3CCRI 1UAAA 2VKHA 3I9V2 2NU8B 2VOOA 2ECBA 3RQIA 2CW0F 2F4IA 1O7LA 3O2PE 5EGOA 5GAHJ 1OMIA 1Z7LA 3JW4A 4EJOA 4YRVA 2OCEA 3I4MJ 1WJDA 2LH9A 3M07A 5E1XA 4YJ2F 5D6EA 3O8GA 1A9XA 3HB9A 3GTGA 3Q9SA 4WF2A 3VB2A 2OPTA 2V1DA 1W0TA 3KTMA 1ETWA 3BZKA 2HPMA 2EINH 3K4LA 1Z3YA 3WGHA 1SEIA 2EA2A 4EJUA 1FTTA 4RGRA 5K2MA 4RAGA 4A93G 3EUKL 3S3OA 2W57A 2L01A 3T5HA 3BA9A 5DG9A 4HYKA 1MGTA 4EJTA 1IN7A 2Z33A 2HQAA 4JI3H 2L9VA 4AWXB 3GUDA 3E6CC 1REPC 2HJWA 1X9NA 4JYAH 4ABZA 3E5UA 1TT0A 5EG0A 1T3NA 5LEJA 2CQQA 3QPSA 3RIRA 3JZIA 3RFCA 4LF8H 2ZJPF 1K7AA 2L3DA 2H09A 5C44G 3RB4A 1S7EA 5J40A 3OSNA 4RDUA 3PO2J 4J9SA 4ZQIA 1BI1A 5D5WB 4XKWA 1TLHB 4GGGA 2DPUA 2WYOA 1K78A 3RAQA 4XORA 4EM1A 3BPXA 3BABA 3H3VH 3WHCA 2COBA 3GTJJ 2X0LA 4O3NA 3R0AA 3DPUA 2XDVA 2FRHA 4RB0A 3AL0B 4C5CA 1R1VA 4DL2A 3L09A 1KEEA 1YS7A 4X6AJ 3MQ0A 5FPOA 3OSPA 2L9RA 1IRXA 3CCSI 3FXRA 4RZRA 4JV0A 2VA2A 1JUSA 2VQHA 2QA4I 4BH9A 2NVQJ 1RYRA 3EPIA 1RJQA 2STTA 4LG0B 2OH2A 2QENA 2R7FA 2KIMA 3HM5A 1MH3A 2A68F 3CMYA 4NB5A 3BJOA 3SJMA 4XOTA 3ZN0A 1P7IA 2BBYA 1KJIA 3KHGA 1EJ9A 1JKJB 2VONA 3N40P 3JRHA 2WA0A 5C44J 2XUBA 1KZHA 1DV2A 3GW2A 5E17F 5EGOB 4M6YA 4YEJA 3IWFA 5D1PA 3BQYA 5ILVA 5EWEA 4RLQA 3G6VA 4ECWA 3CF2A 2B0LA 3VDXA 1W1WE 2M7AA 3IUOA 4BQOA 1R71A 1IUYA 3QU6A 4MA0A 5IT9Z 3BR1A 4M7EA 4B3AA 4Q43A 5E79C 2X1EA 2PMHA 3GIKA 4QJFA 1QQIA 3D0SA 2LR8A 1X3UA 4LMYA 1FYLA 3V6KA 5LMUH 2JEIA 2W9CB 3HSEA 3GTMA 4I4TF 3I56I 4APMA 4LGWA 3TQ1A 3H3UA 1BW6A 2VBZA 4EMSA 3JTHA 4I0AA 3QYEA 4BACA 1LJ9A 4MV8A 3GQCA 1PK8A 2X0SA 1TWFJ 2R7ZG 3GIJA 5EG0B 2IGOA 3ZMZA 2YU9J 4L9VA 4RNMA 1JXSA 1S3JA 4L9TA 2MD0A 2DMTA 2WDTA 2R8KA 2IXSA 5IYBG 1EV7A 5H6QA 3GVAA 4CC5A 1K78B 3A02A 3G6EI 4BJ5C 3QAHA 4RGSA 1VQPI 5LRSA 4E7SA 2BE5F 3BROA 4IEJA 1Y56A 5EWGA 2VQEH 1Q1VA 3BG5A 5DM6F 1G2HA 1DPUA 2V26A 4GRIA 5J1RA 3ZP5A 3ECHA 4N9IA 4OIQF 1ON1A 1ZHSA 4ED2A 1KQ0A 3CDLA 4JX6A 4A3LG 3MKZA 3OY9A 2YPRA 1OFCX 2V58A 1F1ZA 2CUFA 2UV1A 4O6JA 1V5GA 2F5EA 2R5ZA 1SFXA 2DYSH 2FPIB 5D4SA 3LSRA 5HS8A 1DIKA 3RJPA 4CCJA 1K1SA 2CUJA 1FPQA 2DK5A 5JR3A 3RBDA 1G3SA 4A5NA 4U87A 2NVYJ 4ASNA 5IYBJ 1OJLA 5JFRA 1G4DA 4ECQA 4CH7A 1FJGH 3R61A 3LAPA 2MLGA 4OIOF 2HNHA 2L9SA 2OCCH 3BTIA 3HRMA 2K5CA 3J80K 1WSUA 2OTLI 1RJRA 5KFCA 3PW7A 3JAMK 1YIOA 3KAKA 3K4MA 3QOEA 4L5JA 1V9PA 2K86A 2CQ7A 5FJ8J 4BY1G 3BLYA 1Y6IA 5KFYA 1JTYA 4YIRX 4A0YA 2QLZA 1X1BA 3ZOBA 3E7LA 2BHZA 4RS8A 2K40A 1S0NA 2EFOA 4IJAA 1U78A 3FDYA 3LA7A 4LLGF 4ECTA 3K69A 3ML6A 4A3EG 3V8JA 3ABUA 3T0YA 4L5IA 3A1YA 5L3FA 1ZQ3P 3GFLA 2KP6A 2ZJ2A 5KFHA 5KT7A 2IJLA 1KJJA 2Z2SB 5HLIA 5FFZA 5HDGA 1KU2A 4LB5A 3OYHA 1I7NA 2YS6A 1N36H 2WV1A 2NU6B 2VQCA 4IQ4A 4P1WA 1G8XA 3KP5A 2LY2A 4GYGA 1OQYA 1ZTRA 2M7BA 1LDKB 5EYRA 1FOWA 1FP1D 3IH2A 2DO7A 4AYBA 1GXPA 4HF2A 3T1HH 3K2AA 3SEQA 1S72I 3J7AY 1VAJA 1MMAA 3D5LA 4UVCA 4DV1H 3DBLB 4IRHA 1BJTA 4AUXA 5JHFA 4XOPA 4DR7H 3P9KA 3ASNH 5JH7F 2E5NA 1XTAA 4C2MJ 5JVGF 2E2HJ 3LSGA 1IRFA 2R7OA 5DUKA 1ZGAA 4UV8A 3W6KB 3G8CA 1O7FA 1WR2A 3S3MA 4RU9A 4XLHA 3GTOA 4B47A 3MFKA 5F08A 4E7IA 1RKTA 2GAUA 5EZGA 4CXFA 3C18A 2R5ZB 5M3FJ 4H0EA 3IWZA 1B33N 4OIRF 4M72A 2VOPA 1H8AC 3F8MA 4G7ZF 1Z2NX 4U7CA 3JRGA 1A6IA 2GLTA 4MV1A 2VQLA 1WKMA 3UNGC 3FWEA 2EIKH 2DA5A 5FLXZ 1LVAA 1F36A 1HKTA 3WO1A 1I50A 1S5LC 1Q1HA 4YBZB 5IYDG 4E7LA 3I5UA 1GHCA 2BEOA 1ZK8A 2JEJA 5GONF 1PP7U 2RC4A 3WODF 4NLGA 3LOCA 1IN6A 3ZQQA 4JI5H 5IY5H 3HOWG 3CJNA 3TEDA 2IS6A 1SYXB 1DP3A 2KHMA 1Z0XA 2QF7A 2LBFA 2JEFA 3FZVA 4RM3A 5DCFA 1A35A 1F5TA 1YS6A 3S1RJ 4EGJA 4JP0A 2ZDHA 2FK1A 1W4MA 5KFZA 4A3IG 4QWDA 4YELA 2VA3A 3RKYA 2QCOA 3H36A 3TMOA 1VF9A 3FMAA 4I0BA 4ENNA 5E1ZB 2DZDA 4NC8A 4BHPA 4JV2A 3CCQI 1R7JA 5FLMG 1HSJA 3O8HA 2YZMA 4DV0H 3V7CA 3CC4I 5IT3A 1M0WA 3RV3A 5IP7J 4LOCA 2Y9ZA 4IWYA 3ZPLA 2RDJA 4L0ZB 4NXMH 1OYIA 3H5NA 4LFCH 2ME6A 1SFEA 2HXOA 3EQLF 3JRCA 4CICA 3V4GA 5IYDJ 2X1DA 1X19A 4I50F 2RN7A 4AYBN 2E2IA 3MR2A 4HQEA 1FSHA 1TTYA 3L2CA 4X65H 5J1YA 3VEPA 2FE3A 1ZG1A 3DEWA 3SZPA 3HOVJ 5KFSA 1SVMA 3KEYA 4BUPA 5CA0F 1HBXG 2IA2A 1SAUA 1A0IA 1JGGA 3E1SA 3KEOA 4XSZF 5DTDA 4B8XA 1SMYF 1S7OA 3BQ2A 3COAC 1X4PA 2Y75A 3FXOA 3AG3H 4P5OA 2DOAA 2NVXJ 2CFOA 1VBHA 1Y1WG 2QKLB 2M45A 1ULYA 3LA2A 5FLMJ 3WHBA 3DXJF 5BQTA 3LAJA 5BMVF 4K0KH 5KG1A 4II2A 2L7KA 3K9TA 4XK4A 4E7ZA 2CSOA 1BI0A 4IRDA 4B48A 4Z6YA 2WB1E 3OYLA 3UKGA 4ED1A 2X48A 1WH7A 2GWRA 3QP6A 1IO2A 4ECSA 2ELJA 5HS7A 4IKFA 3PIPF 3CCMI 1B59A 2XPVA 3BTJA 1DGWY 2CU7A 1FBUA 3BT9A 2QGUA 5EF6A 3OS1A 2LBFB 1V5FA 3HPHA 1IJWC 5KG2A 2IBKA 2A6HF 2IP4A 4DR1H 2B7EA 3HGYA 3HXLA 3ZQIA 1X3WB 3MZHA 4I09A 3ROUA 2GPWA 2MG4A 4P9UA 1XDNA 4BAYA 3V7RA 1E4EA 4KIGA 1HKSA 5GADJ 2O7OA 4HQ6A 1V54H 2HQRA 2B63G 1YLFA 4PZJA 1IF1A 1XCVA 1RNLA 5BOXA 4XQFA 2CG4A 1OCRH 5FRNA 1CQTA 1JHHA 1ZRFA 1QBJA 2CW7A 3BR6A 4Y3OA 2HI3A 3CESA 2W00A 5FRMA 3OHBA 2UU9H 1QVUA 1YITI 2Q1ZB 1VQLI 4O4IF 4DL5A 4QIWE 1HLVA 1BIAA 1OYWA 3PJRA 1BGWA 1AKHA 2NVUB 1KJ9A 4Y13A 1Z05A 3RI4A 1PVEA 2BY0A 5DGAA 1L3LA 1TA8A 4FU0A 4L1KA 5T14A 3OIOA 1R5GA 2V7FA 2KIQA 5F1RA 1T33A 2CWEA 2K9SA 1MJ9A 2XKPA 2E60A 4CA0A 4MV9A 5CVIA 1SFUA 4NHJA 1VZ0A 2PQ8A 2X6YA 1FTZA 3HSFA 1MJBA 1VQ7I 2MFZA 3BR3A 4ZI7F 3H5RA 2N8GA 3OS0A 2M1BA 1LPQA 3AG4H 4J9KA 1FWZA 4DL7A 4DL6A 2EZKA 2W7PA 3IKVA 5LD2C 1O3QA 2ZKZA 5LRRA 1B1BA 3PIOF 1Y1VG 4WD3A 5KFQA 3ZGKA 1OCCH 1I94H 3NGDA 3JRIA 3L2WA 1J59A 2IA1A 4EEQA 2EZLA 1JKRC 2C2RA 2C22A 4PGHA 5HLTA 3AYHB 2DQRA 3NWSA 5CB4F 3VSLA 3QYBA 4DV7H 5D4RA 4HOBA 2PJPA 2W71A 4DL4A 2F5CA 4RB2C 2MLKA 4IZZA 1I39A 4G6TB 3R5HA 1U9OA 1IN8A 3CCVI 2WE6A 2MABA 3RV4A 3H5AA 4JI4H 1FYMA 2GXAA 2BXYA 1N25A 4C2MA 1GUUA 4PFPA 1JDEA 1AN7A 3ZMUA 2QYZA 1FIAA 1E4EB 4M3EA 2XF5A 2XCAA 1ZR4A 3AG1H 3HOSA 4M9UA 1RESA 5LP6F 2F4MB 2MGQA 4EQQA 2IA6A 4ZZLA 3QPLA 4NQWA 1FT9A 5KNLA 2FMYA 1Z3XA 5CPRB 3OYGA 3L2PA 1MBEA 1D0XA 1Y1VJ 5JVDF 3SDGA 2KIFA 1E17A 4PWQA 1QPMA 2ZNYA 1S7AA 2XAUA 3I53A 4WXDA 1WJCA 2A3SA 2VN2A 1AKHB 3RYRA 1P4AA 4G6QA 4FE4A 2OQRA 2D1VA 4ETSA 3K4KA 4CHUA 3IRQA 5KFOA 5M5XJ 1GSOA 1HCRA 4HZFA 2W85A 4GYIA 3TW7A 1YOVB 2P0AA 4EM0B 3T5LA 4KMFA 5KFNA 2O8XA 1VQ5I 2FUG2 3HKZA 2YU3A 4F91B 4J19A 2R93J 2J9GA 1FVIA 3H0GA 4IRCA 4HNUA 4KFCA 3WTUC 1FKAH 3EPZA 2HQ5A 3FM5A 4C2TA 3GWZA 1LQ1A 4O4LF 3E6DA 2CW8A 2P6TA 3TKYA 3L2RA 2E2JJ 1K6YA 1YO5C 5L3EA 5BR8H 3JCUC 4B1RA 1FNNA 1IRZA 3VYUB 1QU3A 2XPWA 1G6NA 1RPWA 4HQMA 2JN6A 2V9VA 2Q2TA 3GZNB 5J2TF 1E2XA 3QZ7A 1BXRA 2HXIA 3PN1A 2Y0SE 2VJ5A 3DPLC 4IL6C 4HG2A 3OYFA 2DAOA 3IRRA 4XICA 2FBIA 2KZGA 4AC0A 1T8IA 2R7MA 1U8RA 3RPUD 3BR0A 4IVNA 4JV5H 2FD5A 3GBGA 5DDGA 3JRFA 2DLLA 1ENHA 1WVRA 3CLOA 4ED6A 2K9QA 2HDCA 4DBRA 5JLWA 3CCLI 2CV1A 4LFAH 4FT8A 3G6YA 1U8BA 3V4ZA 4RAZA 3DBRB 3DKYA 1RR8C 2OWOA 4EYHB 1MBGA 2ZFUA 2H6BA 3DFGA 4NQWB 4ZTJA 4V19K 5D8DA 3N44B 4CCLA 1D1AA 2O3FA 3BP8A 2JSCA 2G9WA 3NEUA 4JBAA 3TIGA 5F6FA 1S29A 2DA4A 1D1CA 5F64A 1MBHA 3E6MA 1JKOC 4RAYA 2M2EA 2I5UA 4I76A 3WU1B 3ZQLA 1E0EA 1AWCA 4ECRA 4LF5H 5BPHA 3E6BA 1WWXA 2W1OA 3HZJA 4MEYF 3HTSB 4NC7A 1FZPB 4Y52J 1SC7A 2BY3A 3HKZN 1BR1A 2ESHA 3U9GA 6PAXA 5C5JA 5FLVA 3R0JA 4UVBA 1HF0A 2VOBA 2I8DA 3DTIA 4HX4A 2ZJRF 1EKEA 4J9OA 1RK6A 4O3OA 5C4XG 5E8GA 4JI6H 1ZGWA 2PEXA 4LSAA 4BXXG 3KYLA 2VUMA 2FPGB 2DI3A 3FXLA 4BBSG 1VNDA 2JA6J 3HG9A 2WC2A 3QP5A 4HYEA 1ZARA 5TGTA 5TISC 2W84A 3FXQA 4B09A 2NYXA 1P4WA 1RZ4A 1A04A 4L5EA 2CV0A 4IHWA 3G73A 3T5JA 2UVRA 3GTMJ 2VIXA 3RIZA 4ESJA 1SCUB 3IH3A 4BYYA 2HVQA 2XKOA 4BY7G 3CTAA 4HR7A 4M6XA 1D5VA 1VQNI 4DL3A 2ASJA 2ZBKA 2RQQA 5CQGA 1XDUA 2VC0A 3W2VA 3PW2A 1YX3A 3L4KA 1S03G 1I3QJ 2VLAA 2DMUA 1N33H 3VYRB 1WPKA 2TDXA 4B43A 4Q0YA 4ED8A 2VBXA 1K79A 4C5AA 5FFXA 3EUHC 5K1YA 1YW8A 4FCYA 1UHSA 4KIBA 4UB6C 1YTYA 3CVZA 1UCRA 2XGEA 2YX7A 4DR4H 2UXCH 4D5CA 2C6YA 1IN5A 4BBSJ 1G3YA 1IXSB 2ISZA 1M0TA 3BR5A 1FC3A 1P7JA 5F0HA 2DMNA 3HEFA 4MV3A 3M8FA 4Y17A 1IGNA 1QNTA 1X1DA 1WJEA 5J3LA 3PNYA 2CQKA 2V6CA 2ADUA 3MFHA 3H0DA 3EUHA 5KFWA 1L2ZA 2E7WA 5LXTF 3WTXC 3GFIA 3AL0C 2UVWA 2JA7A 3RAXA 3QODA 2AGQA 3GZ5A 3ZXSA 4CCNA 3T5XA 2M4GA 4IX7A 2YS7A 2WTFA 2H8RA 2AGOA 4QTRA 3GFJA 2EFWA 1W36C 2IS4A 2JQ7A 3RB6A 2M05A 2RVCA 2NOJB 1K4SA 1RI7A 1I3AA 3JAMZ 3ZR8X 3U9SA 2XC9A 4HPQA 2DT5A 3OWTA 4MA5A 4DZJA 1FP2A 2NVTJ 2UXXA 1OYYA 2YX4A 3V8KA 3PL8A 4XZ3B 2IT0A 5JUMA 5B66C 3QZ8A 4ZYHA 4XLFA 1X2NA 2NAZA 3HTUA 3OHAA 2CYYA 2PLYA 5EOYA 3G6XA 2OC6A 3P9CA 2LF8A 3E5XA 3PQKA 5KFAA 5F9LA 2JK3A 1D1BA 1NK2P 2TCTA 4XLNF 2R7VA 2R8JA 5IP6A 1JXLA 3KP6A 5CVVA 3X2QH 4A2BA 2LTPA 5DQHA 3HIFA 1GXQA 4H4KC 3L1PA 2R93A 3TIIA 2DCEA 3S3NA 3PM1A 1XGMA 2VE8A 3DPTA 5LGNA 4R7RA 3WO0A 2R86A 5KG4A 3PO2G 1JKQC 2AO9A 1JDBB 4ZTFA 3F8NA 2H6CA 5E3OA 1IXRC 2ESNA 4KN7X 5ICEA 2W25A 5DCMA 2IW5A 3U9TA 1N32H 3IAS2 1KU7A 3LQQA 4TV7A 4K2EA 4DYQA 2W9CA 2ZXWH 4EGZA 2V1UA 3Q8PB 4WXHA 5E8IA 2DTRA 4AM3A 2QM3A 3W2AA 4G12A 3GTOJ 2IP2A 1KQ9A 4XL9A 5J8FA 1UC8A 1MSEC 4UCVA 4KICA 4IAJA 3F23A 2MH9A 4BE2A 3OUZA 2DYRH 3BQZA 3ABLH 2KRHA 3F21A 3H4BA 3QPTA 4XLPF 2B9SA 2MC4A 1R5HA 3KP7A 4UUTA 4ZOLF 5JVLA 3MKYB 5DS9A 1TQPA 2DQLA 1I50J 1ULZA 5FPRA 3FF5A 2FLLA 2LK2A 2W24A 2Z5UA 2FQ4A 2X6OA 5JHUA 4IOCF 1FIPA 1S8NA 2K3PA 4DJAA 1PUFA 2JA8J 1RK5A 2XB0X 2XAFA 3BCBA 1HNZH 1KJ8A 1APLC 3J7YJ 2M9HA 1ZN2A 3BZCA 2C35B 2QEXI 2HQNA 1FYKA 2NRAC 3GILA 2RGRA 1RJPA 3ZQHA 3WU0A 2YCHA 3BPVA 1Z6RA 4NC6A 3T5KA 2XSDC 2CUEA 2VJ4A 1NH3A 1UJ8A 2X1CA 3IAM2 2R6FA 1FOYA 4A3MG 1T0FA 3BG3A 1A31A 3RSNA 2D5VA 2EZHA 3DBHB 3CCEI 2QQAA 2IS1A 2QSGX 2OUMA 4FE7A 4YY3H 2WAQE 3I58A 5GTIC 1N48A 5HLGA 3WE3A 2UXDH 1BM9A 1T56A 2EV6A 4D7MA 2GZWA 3Q5FA 3S8PA 1LVKA 3FISA 3NQOA 2LC2A 3LNQA 3KYDB 1T6SA 4KNYA 2M4KA 1G59A 2VQDA 5KFGA 1KGSA 4XKCA 4M9XA 3VOEA 3RCOA 2HU9A 3K1PA 2Y30A 3PFIA 5GP9A 2E2IJ 1OWTA 2R87A 4C3JJ 3JRDA 4S04A 3AKZA 1OPCA 2ZSHB 4IO9F 4ZYAA 2IAIA 2QVOA 5KK1A 2UXNA 1W5CC 2JA6A 5DCMB 2EV5A 4XIDA 1GSHA 3K3VA 2HPIA 4GXOA 2IPQX 3I55I 2ZC2A 2MCTA 2V59A 3ZMVA 2EFQA 5J47A 3OIPA 4A3MJ 5C4JJ 3MZYA 2LD5A 1SAXA 1VQ9I 3TDZC 1B6RA 3M4OJ 1BIBA 1Z9CA 4BS9A 3MR5A 4Q48A 1Y39A 3K70D 5BPDA 1FLIA 2V4QA 4G3IA 2IGNA 2BQUA 4UCTA 1SD7A 5DEQA 4BL0B 4UCRA 1BJZA 3KETA 4PJ0C 4HW0A 3DQVC 3KXYT 4FQGA 3TO7A 2ZDQA 2F5VA 1I3QA 3M9MB 4CO8A 4CZCA 3GXOA 2LF7A 1Z2PX 3GIIA 4DV2H 1PX2A 2DK8A 1TWAJ 1TT5B 5CKTA 5K5RA 3OYEA 1EZ1A 1PUFB 2NS0A 2CMPA 3UR3C 2ZSIB 3R23A 2JPCA 2LDUA 2XGCA 4NUBA 4LH6A 3T8RA 3KP2A 1CE8A 2ELHA 4HV5A 1JE8A 3K7AJ 4QWBA 1GLVA 3PNVA 3RGXA 2CO5A 3U2RA 1H89C 1IG7A 2PN1A 1ORKA 4G7HF 4TV8F 5FJ8G 2LY9A 4DR2H 5D1OA 2CJJA 2ZFWA 1LFUP 2LOOA 1B72A 1YX5A 1YW7A 3W2WA 4BWSC 4RZQA 3BG7A 4BXFA 2VJIA 1OR7C 2GIZA 1U9NA 3C7JA 4FBUA 2HEOA 2GA2A 4AIDA 1J9IA 5CJ9A 2EBIA 2E1CA 5IOZA 3M8EA 1E3PA 5GAGJ 4FBTA 1M1EB 5H6RA 3HUGA 4EGYA 3A0BC 5CLSA 3Q0UA 5DG8A 3AG2H 1ONVA 2VBWA 2VBYA 2SCUB 2BGCA 2GOMA 4R1HA 1P9QC 5E3NA 2ISYA 2HTJA 5GPCA 1OR7A 1CF7A 1S10A 3TBIA 4DBQA 5AONA 2CQNA 2W70A 4RNNA 4KHPH 4HF0A 3QOPA 2QUFA 4J01A 2HOSA 5DLGA 3A4CA 4GO1A 3D5RC 1EH7A 4YAJB 4MV6A 3ZQGA 3R5FA 1T38A 3U21A 1W5SA 2R7DA 2FP4B 3RPUA 4JX4A 3BY6A 3A01A 4Y7NJ 3CC2I 3GO5A 1STZA 4U0VA 4A2AA 3MKLA 1K61A 2JA2A 1LE8A 3H3VK 4AVPA 3B73A 4MHGA 2M30A 3CMAI 3BDDA 1XGOA 3L4JA 1IBMH 4EJVA 5H80A 4O2AF 5F1JA 2ASLA 3CF5F 2HGSA 2O5RA 2GLOA 3H20A 3CO6C 3RTXA 1B6AA 1BOBA 1GV2A 3ABMH 1JLLB 1FSEA 4Q47A 2EV0A 1ETQA 4MQ9F 3GTPJ 5KG5A 3RZDJ 2XRLA 1W96A 4J9MA 2DJNA 3T8TA 4MV7A 5D5XB 2HYFA 1ETXA 2NXNB 1ZETA 2L9NA 3GF2A 1MDMA 4S0HB 5L3GA 5TJJA 2X85A 1FBQA 5D1OB 4FISA 4X64H 2W6NA 2P5LC 1P6RA 2M0MA 1I1SA 2DA6A 1B72B 2ZNZA 1UFMA 5EEAA 2WB1A 2I87A 2KSWA 3MN2A 4XSXF 3BA8A 2DFHA 1IRGA 1KQ8A 3DTEA 4CC6A 4JI8H 4YR2A 2A6EF 3HOUJ 3CC7I 4Q44A 2UUBH 4JQFA 2MD5A 3O3KA 2VT2A 1F43A 4QLCU 5IP7G 2E34A 5IP9J 2XAJA 1IC8A 2O0YA 3GV5B 4A12A 3HUGB 2WBMA 1XC5A 3LSPA 4I55F 2RKHA 2P0WA 4HNVA 1V5EA 3RKQA 4KISA 1TWCA 3RF2A 1D0YA 2V9PA 4XKVA 2W48A 1SFOJ 2JUGA 3VWBA 1OISA 3RQ4A 1CF7B 5KFBA 2LLKA 3HOVG 2X6XA 4DIQA 5J6XA 2O6GE 2Z99A 2STWA 5AIPA 3K4JA 2V4RA 4LK1F 3ZCOA 1W7PA 2LKSA 4BHCA 4ZJZA 1YRNA 3I12A 1H0MA 1T36A 2E1NA 3REOA 2EK5A 5M5WJ 1XCBA 2RGVA 5IYZF 3H0GJ 3DP7A 1Y0NA 2ECCA 3A01B 1UG2A 2DFEA 4QIWA 4O3MA 3DWLE 1WJFA 3OYNA 4D7NA 1GDTA 3PSIA 4X62H 4JV1A 1LE8B 4LF4H 3KALA 1I5ZA 1V4YA 3MR3A 2DOFA 4ECYA 2HWVA 3RGZA 5KX5F 2Y48A 2R84A 1XNQH 3CO7C 5KFUA 2AQFA 2KJBA 4E4TA 1VTNC 3IH4A 2K4BA 5E3MA 5J1UA 1ZELA 1R58A 2HGCA 3ZQCA 3M7GA 1WH2A 1MDMB 5KFVA 4BE1A 1Z6TA 1IBKH 5DGBA 2R92A 3R5XA 2DPIA 3TW6A 1MKMA 2LY1A 4MNUA 4HAMA 2ZMEA 3M9OB 2WB1N 4UFZA 1MH4A 2FU4A 3CUQC 1I6XA 1S68A 1JTXA 3DLLF 4DR3H 1WRJA 2KIUA 4RUCA 3VPDA 2DDAA 4M74A 3FMRA 1XSDA 1O75A 1XDSA 2AXTC 3LWFA 1YW9A 2LREA 3EDPA 3H92A 2YZGA 2PN6A 1ZKGA 3PW0A 2F48A 4XX0B 3TP3A 2VUMG 1MNEA 3HBLA 3OUUA 3BCAA 2W7NA 2YRXA 3FMSA 4FX0A 2JMWA 3CQZJ 5D6FA 1TWAA 4PDBA 3FXUA 4J00A 1XG1A 2DA3A 5LHHA 3CUQA 9ANTA 3HOZJ 1JJ8C 2P5KA 4EV0A 2M8GX 2ZXJA 2VPLA 4XR6A 4I6ZA 3IG0A 5L1KA 2F4OB 2OV7A 2GOXB 2Q0OA 4JI2H 4J9QA 4O3PA 4D9JA 1ITYA 1WHUA 2JWTA 2E1MC 2R8GA 3GTQJ 1W7PB 4XONA 2K4JA 1YRNB 3HYIA 3WTYC 2P7VB 3CZ6A 3VFZA 1YIJI 2BY1A 2LFBA 4QIWN 2Q8KA 1NTCA 1FEXA 4OX9H 5LMNH 4RMNA 3JSNA 4EBEA 4MO7A 4B3MH 4DZPA 3EYYA 4LIUA 4HX8A 4EBDA 2VUMJ 2PMZA 3F22A 4ENJA 1E3HA 4ZDOA 4J9RA 2BVLA 4U0WA 2IGMA 5HNFA 5A2QW 1U0JA 2GXGA 3BAAA 4EYIB 5CA1F 2W6QA 2ALZA 3T1BA 1R36A 5H2FC 1G3TA 3L2UA 2ZJTA 5DUIA 2NOGA 3I59A 1S9HA 2FLNA 2F2EA 1MMSA 5KFEA 3G2BA 2W7OA 2JA7G 1IV8A 1U2WA 5D8KB 2WADA 2K3FA 4V2GA 3CCUI 4YAKB 2ZMEB 3TQNA 2JUCA 2HVRA 3NWTA 2ZXIA 4L18B 2LKPA 3BOQA 4XRFA 4JUZA 1GSAA 4YR3A 2V9KA 2P81A 4U0YA 4A3DG 2KRCA 2L7ZA 1ZR2A 3GIDA 5KFRA 2GM4A 4LLNA 5FKNA 5KFJA 1B04A 2Y0SA 5KFIA 1IBLH 4Q4ZF 1RRJA 5M3MJ 1K83A 5LOVF 5FKLA 3KLOA 1RUOA 2ETHA 2FBKA 4E7KA 4BBRG 1WFXA 2CFXA 2J6TA 1JHFA 4F4ZA 1AUXA 2QQ8A 3JSOA
chains in the Genus database with same CATH topology
1J7KA 3CUQB 2A07F 1ZGJA 1Z2OX 5TRDA 1P8LA 2M87A 4G8XA 4HX7A 2RQPA 1HKQA 5FO5A 4WXCA 2OU2A 3ABTA 1BC8C 3O6BB 4IRGA 1DUXC 4IHSA 4JI7H 1Z7UA 3IC7A 3TGNA 4A0ZA 2PMUA 1XMQH 2IRFG 1IXCA 1LB2A 4AQYH 3I59B 4FM9A 1HXDA 3GYHX 4HA8A 1O57A 4EM2A 3IL2A 3LSTA 3TO6A 2OQGA 4I98B 1XSVA 4LFBH 4KN4X 4ZZDA 2VODA 4OOIA 3KCCA 2HYGD 4KA4A 4G6DA 2O61A 4LF6H 1R1TA 4X66H 1BI3A 4LLLA 1L0OC 4IXAA 4WX9A 3DV8A 2V79A 1SMTA 2L02A 1LEBA 1GVJA 4RGUA 4A0XA 3F6VA 4HLYA 2R3SA 2D45A 1SD6A 3DKWA 4LH7A 4LK0F 2UZKA 4WK8F 1R1UA 2D1HA 3W6JB 3CUOA 1DDNA 1LDDA 3KFWX 1DPRA 5FB2A 5D5UB 2OBPA 4G7OF 5IWAH 5E18F 1SD4A 3S2WA 3WTWC 3L9FA 4IRIA 3KP3A 2Y0MA 3WTZA 2HZTA 3R4KA 3L7WA 2HR3A 2M8EA 4U7DA 3I64A 2F4VH 2UUCH 4R79A 3C1DA 4G9YA 2JRTA 2XHKA 1ZHFA 4BHBA 1KYWA 4DV4H 3BZ6A 4A6DA 3GX4X 2QYOA 4U88A 3HSRA 2KKOA 2QZ8A 3P7NA 4DUYH 3DF7A 4KIFA 3RTRA 3BJAA 1I27A 5ERIA 4I2OA 5LBQA 5AIQA 4UVAA 1RIOH 1ZHQA 4PCQA 2AXLA 4PGGA 4ENMA 4LSXA 4HDVA 4UCSA 3I71A 2KRFA 2QWWA 1T39A 1V3FA 4LF7H 2K27A 4HDUA 1D8KA 1GYFA 3SQNA 4GKKH 3E5QA 3HHHA 5A2QZ 4YHHH 1HW2A 4YFXF 4YFNF 4P55A 4A5MA 3N42B 4O5VA 2OZ6A 3K1MA 1XGNA 2VT3A 4HV6A 4UHTA 4DR6H 3HRTA 1PP8F 2F5FA 1N34H 3KAJA 1CGPA 3R60A 4OU0A 1DP7P 1D8JA 4UXNA 2FNPA 1E4GT 3RDIA 4ZH4F 2FMLA 2ZO4A 1F9NA 3SZTA 4BNCA 5BMZA 4ON0A 4GKJH 3HHGA 1PUEE 3N4MA 1B9MA 2D2WA 5HLHA 4LFUA 1U5TA 2JPBA 3WGIA 1O3RA 3T1YH 5CVJA 4ENKA 2XASA 2RNJA 5DYMA 2XAGA 4M9ZA 1D3YA 3DEUA 2HHHH 4D0PA 5K5QA 3L00A 5JI6A 1XB4A 4E70A 3N41B 2YR2A 3HRUA 1J2XA 3BWGA 3RKWA 3CDHA 2LNBA 4UNOA 1XNRH 1ZAOA 4RGXA 4Y15A 4KMUX 5EEGA 3KZZA 3OV8A 2XAHA 1U3EM 1T98A 3G3ZA 1H9GA 2EA4A 5L3DA 1IN4A 5BPIA 3F72A 1OKRA 1ZLKA 1ZLJA 2RDPA 1U5TB 2NNYA 2COMA 2ZM6H 3LA3A 4CGZA 1HR0H 3SXYA 4YG2F 1XSXA 2O03A 5J8CA 1Z91A 1HQCA 5H20A 5DV5A 3IKTA 4N0BA 5LGUA 5LHIA 4A6EA 2XVCA 2Z9OA 3QU3A 4HF1A 1USSA 1BN5A 1Y0UA 4G94A 5HOOA 3FHZA 3WTSC 1K6OA 1J75A 3P9IA 3J81K 2E7XA 4NXNH 4Z2YA 2PG4A 2HKXA 3ISPA 2LSOA 4M73A 5CYVA 3JSPA 1XN7A 3AAFA 2JT1A 3N97A 3KLNA 1QO0D 1TNSA 4AD9A 3M1EA 3FMQA 4B3SH 1LNWA 2FSWA 4CZZA 4MTDA 4UCUA 5A2QK 1AOYA 4B3TH 3RYPA 2VC1A 2JTVA 2Q2EA 2KJCA 5HDNA 4PDKA 1DGSA 4BQAA 4LF9H 1V4RA 2YSRA 2P5VA 4YFKF 1FOKA 2FBHA 5DD4A 4CDGA 1BBYA 3SHFA 4XBFA 1VS0A 4I02A 2FNAA 1TBXA 4B3RH 1NHAA 3JTGA 2J5PA 5FGMA 3TDUC 2UWMA 3FM3A 4L9JA 1UB9A 3RKXA 4UV9A 4P9FA 4LB6B 3MWMA 4IPAA 4ZYDA 5ICGA 1PDNC 5D5VB 2VXZA 4JI0H 1Z1DA 1EH8A 2XIGA 1BOAA 1P2FA 3IHUA 3I54A 4FX4A 2UXBH 4LJZF 1R22A 3C3WA 3ZMSA 3KEQA 3M4IA 1KA8A 2OD5A 3I4PA 4HLXA 2J5OA 1ZRDA 2OZUA 3WGGA 3BJ6A 2GQQA 5D8LB 1SD5A 3TOBA 1O3TA 1J5YA 2HTSA 5JVTA 4LD5A 2XRNA 4J0MA 2HS5A 3HOTA 2NNNA 2QQBA 2Q2UA 1R00A 2V1XA 3GFMA 5ICCA 3HRSA 1USTA 2MA3A 5HDKA 4MEXF 3WE2A 4OMZA 2ACJA 2IVMA 1ODDA 1J0RA 1XMOH 2EFNA 1XD7A 2FQ3A 3UQ8A 5LLQA 3LFKA 4MTEA 3M9AA 4M9SA 1HW5A 3ZN1A 4YIFA 2XROA 1P4XA 4IF4A 5IT9K 4L0YB 3C0FB 1ZG5A 3ULQB 3F3XA 3KZYA 3MEXA 4Q5SF 1XMAA 2OA4A 3J81W 4U7BA 3EETA 4AIHA 2XGXA 2A61A 2AS5F 2EWNA 3F6OA 2H94A 2QQ9A 5EEHA 4S05A 1ZG3A 4L9NA 2P8TA 5K5OA 4HBLA 4ZYEA 2PI0A 2GIVA 2ZCWA 3MAJA 3B02A 2OAZA 1ZYRF 3N43B 4M71A 4BXUA 1C0WA 5L3CA 3RPQA 3OTOH 3PQJA 5BS6A 4ZYGA 2F5DA 2M5WA 1HNXH 4WCGA 3WTVC 1KYZA 2FXAA 1XGSA 3V7SA 2VUGA 5ILSA 1KU3A 3H3ZA 2FEZA 1FBSA 3J80W 2BV6A 3JAMW 2H27A 4F7ZA 1KU9A 4ESBA 3V8LA 5CVUA 1S6LA 4JK1X 5CVRA 3K1NA 5LHGA 3K2ZA 5ICFA 1TQIA 1HW1A 4OMYA 3ECOA 1LEAA 2DBBA 5ED4A 3F8FA 1FY7A 4EVIA 2L4AA 4WWCA 2PBIA 3TO9A 1ZH5A 3KE2A 3I0TA 4FHTA 1YYVA 4YIIA 2E5LH 3LMLA 4GCVA 3JSLA 2QBYA 3ZMTA 4DQ2A 3EYIA 2GXBA 2FOKA 1MJAA 4EJWA 4KT5C 1FX7A 3R6SA 1QZZA 4DV5H 2G7UA 4A2UA 1LDJA 3K0LA 5E1WA 5L3BA 5FLXK 3SFZA 1B9NA 2EJRA 4UCOA 1MZBA 1IZ1A 2IA0A 1BC7C 4OIPF 3KP4A 1TNTA 4KUMA 1J5EH 1IW7F 2HKOA 5FD6A 5ILUA 2L4MA 2JZYA 1B4AA 4AIJA 1EH6A 4UUVA 1E4FT 4R8HA 1TW3A 4CYDA 2HVSA 3F8BA 1O3SA 2HOEA 5DD8A 2G7HA 5IT9W 1UHWA 3QPHA 5HS9A 2QBYB 3ELKA 3F8CA 4DNCA 4IHTA 1TW2A 3WTTC 3DF8A 4RB3C 2WWYA 3VODA 4DV3H 3QRFF 3NRVA 2P4WA 1BI2A 2A5YB 1XMKA 3ERED 2Z3YA 2GA1A 2UUAH 3E97A 1ON2A 2EB7A 1QZYA 4EFBA 1I6UA 1BJAA 1YG2A 2PFBA 3U1DA 5LEKA 4KDPA 1TQMA 4ESFA 1ZRCA 4DV6H 1P92A 3GLXA 1WQ2A 2P6SA 2XAQA 4AIKA 3Q9VA 1YQAA 1HNWH 3LQRA 3RJ0A 3N6XA 3GZ6A 2K7LA 2P7CB 2XV4S 5HVQC 2FA5A 4I7HA 1W7PD 2MC3A 4DR5H 1R23A 5LL6b 1QGPA 3J81Z 4N9HA 4OINF 3ZQ7A 4DUZH 4P96A 2L54A 4GLXA 4I01A 2VPSA 5KVRA 1WI9A 2CGPA 3OOPA 2X4HA 2MBFA 2DPDA 1H9TA 2DW4A 2EFPA 1RUNA 2WTEA 2BYVE 3FX3A 1HSTA 5E20A 1IAWA 3TOAA 4MQVA 1UHMA 3J7AK 2VE9A 2A69F 4QWQA 1ZREA 2VQFH 1W5TA 2HFHA 4EFEA 3WG9A 1G3WA 3ZMDA 2DU9A 3J7AO 1U6GA 1U5TC 1YFHA 5FLXW 2RV8A 2FF4A 2MH2A 4KYWA 3E3VA 1T2KA 3J80Z 2DFIA 4MGRA 1JGSA 1MD0A 4RB1A 5FD5A 3MCZA 3GEZA 4JI1H 4LG0A 1I1GA 2WV0A 2K02A 5LGTA 1TAEA 1F4KA 2VOOA 2CW0F 1O7LA 3O2PE 1OMIA 3JW4A 4EJOA 5E1XA 5D6EA 3Q9SA 4WF2A 3VB2A 2V1DA 3WGHA 1SEIA 2EA2A 4EJUA 4RGRA 2W57A 2L01A 3BA9A 1MGTA 4EJTA 1IN7A 2Z33A 4JI3H 4AWXB 1REPC 3GUDA 3E6CC 1X9NA 4JYAH 3E5UA 5LEJA 3RIRA 4LF8H 1K7AA 2L3DA 2H09A 1BI1A 5D5WB 1TLHB 4GGGA 2DPUA 2WYOA 1K78A 4EM1A 3BPXA 3BABA 2X0LA 3R0AA 2FRHA 4RB0A 1R1VA 3L09A 1YS7A 5FPOA 3MQ0A 3FXRA 4BH9A 2STTA 4LG0B 2QENA 2R7FA 2KIMA 2A68F 4NB5A 3BJOA 3ZN0A 2BBYA 2VONA 3N40P 2XUBA 3GW2A 5E17F 4M6YA 5D1PA 3IWFA 5ILVA 2B0LA 1IUYA 3QU6A 5IT9Z 4M7EA 2PMHA 1QQIA 3D0SA 1X3UA 4LMYA 1FYLA 5LMUH 3HSEA 4APMA 4LGWA 3H3UA 2VBZA 4EMSA 3JTHA 4I0AA 1LJ9A 3ZMZA 4L9VA 1JXSA 1S3JA 4L9TA 2WDTA 1EV7A 5H6QA 3GVAA 4CC5A 1K78B 3QAHA 4RGSA 5LRSA 2BE5F 3BROA 2VQEH 1DPUA 3ZP5A 3ECHA 4N9IA 4OIQF 1ON1A 1ZHSA 1KQ0A 2YPRA 1F1ZA 4O6JA 2F5EA 1SFXA 5D4SA 5HS8A 3RJPA 1FPQA 2DK5A 5JR3A 1G3SA 4A5NA 4ASNA 5JFRA 1G4DA 1FJGH 3R61A 3LAPA 2MLGA 4OIOF 3J80K 3HRMA 1WSUA 3JAMK 1YIOA 3KAKA 4L5JA 1V9PA 2K86A 4A0YA 2QLZA 4RS8A 2EFOA 4IJAA 1U78A 4LLGF 3LA7A 3K69A 3ML6A 3V8JA 3ABUA 3T0YA 4L5IA 5L3FA 3GFLA 2ZJ2A 2IJLA 5HLIA 5FFZA 5HDGA 1KU2A 4LB5A 1N36H 3KP5A 4GYGA 1LDKB 1GXPA 1FP1D 4HF2A 2DO7A 3T1HH 4UVCA 3D5LA 4DV1H 4IRHA 1BJTA 4DR7H 3P9KA 1IRFA 5DUKA 1ZGAA 4UV8A 3W6KB 1O7FA 3MFKA 2GAUA 4CXFA 4H0EA 3C18A 3IWZA 4OIRF 4M72A 2VOPA 3F8MA 4G7ZF 1Z2NX 5FLXZ 1WKMA 3FWEA 1LVAA 1HKTA 1Q1HA 3I5UA 1GHCA 2BEOA 1PP7U 2RC4A 3WODF 4JI5H 1IN6A 3CJNA 3FZVA 5DCFA 1F5TA 1YS6A 1W4MA 3RKYA 3FMAA