3EYYA

Structural basis for the specialization of nur, a nickel-specific fur homologue, in metal sensing and dna recognition
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
b'STDWKSDLRQRGYRLTPQRQLVLEAVDTLEHATPDDILGEVRKTASGINISTVYRTLELLEELGLVSHAHLGHGAPTYHLADRHHHIHLVCRDCTNVIEADLSVAADFTAKLREQFGFDTDMKHFAIFGRCES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative iron uptake regulatory protein
publication title Structural basis for the specialization of Nur, a nickel-specific Fur homolog, in metal sensing and DNA recognition
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eyyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3eyyA02
3U2RA 1XSDA 5IT9Z 4I0BA 4HF2A 3ELKA 3GZ6A 4IXAA 3AAFA 4KN7X 5DUKA 1Z6RA 5LGNA 2KJBA 2DK8A 3HOTA 1RUOA 3WGHA 3D0SA 4I0AA 3KEQA 4HLXA 1S7AA 3BY6A 1IN7A 2HS5A 2IW5A 4IRGA 2QBYB 5ERIA 2FBKA 1BJAA 2IRFG 1W7PA 1HKTA 2P5VA 1MZBA 1C0WA 1FP1D 3GLXA 3FHZA 5CVVA 1HBXG 5L3DA 3MQ0A 1CF7B 4S04A 4A5MA 1K79A 2YR2A 2J5PA 4M74A 2Y48A 4YIIA 5FLXZ 1TNSA 2IA2A 2P8TA 4HX8A 1FNNA 4A0YA 2ZMEB 4WXHA 2HR3A 4EJWA 2L01A 4XBFA 4KIFA 1OYIA 5DUIA 3GVAA 5TJJA 5KVRA 2FF4A 1H9TA 2QZ8A 2EFQA 3HOSA 1D8KA 3F23A 4IJAA 3OOPA 3B73A 4RAZA 4WWCA 2A07F 3WTXC 4G7HF 1V4RA 2DBBA 4OOIA 1D8JA 2OA4A 2PLYA 1NHAA 5D5UB 2M30A 4M9XA 4HW0A 2MC3A 4LLLA 3O2PE 3E6DA 3P9KA 1I5ZA 4OIOF 2EJRA 4L9NA 1G3TA 1UHMA 4UV8A 1P92A 2P6SA 2FBIA 1DPRA 4PCQA 4RB0A 2EWNA 2JZYA 4WK8F 1HKQA 3ZPLA 3WTYC 5L3EA 1KQ9A 1HW5A 2DK5A 2JRTA 3EDPA 5L3BA 1K6OA 3RI4A 1CF7A 4LK0F 3BPXA 4DQ2A 3QU6A 5E1ZB 2NNYA 2VODA 1IW7F 2NRAC 2NS0A 1PDNC 5K5OA 2ZBKA 2LSOA 3EUHA 3ZN0A 2HDCA 1FX7A 3ECOA 1JHFA 4KMFA 3K69A 3V7CA 1BI2A 3N4MA 1KYWA 1XD7A 3HRUA 3HRSA 5DCMA 1FOKA 2FU4A 4AIKA 4KIBA 3KETA 2ZXJA 4GYIA 4PDKA 2KJCA 2YX4A 1XCVA 5HVQC 2VBZA 5DEQA 4BXUA 4ZYGA 3B02A 4IVNA 3FXUA 4L9TA 4M6YA 4L0ZB 2CG4A 3WTUC 3FXQA 2O6GE 3KCCA 4PGGA 4MGRA 5J6XA 1O7LA 2ZFWA 5HS8A 2ADUA 3BJOA 2FOKA 2A68F 2Q8KA 2HFHA 2FSWA 1KYZA 1XN7A 3FM5A 5BOXA 1J5YA 3GWZA 2IPQX 5BPIA 4KFCA 2W24A 5E1WA 5BMZA 4MHGA 2BGCA 1R22A 3IKVA 1USSA 2FXAA 2CGPA 1S7OA 2DLLA 5ICGA 4ZZDA 3IL2A 4U7DA 1PP7U 1F5TA 4Y17A 3DPTA 3F8BA 3GFMA 4BQAA 3DQVC 1DP7P 2XV4S 3FXRA 1PP8F 2L4AA 5DD8A 1WI9A 4LGWA 3GUDA 3DPLC 4ENNA 1USTA 2DPUA 1FYKA 5D8LB 2LNBA 3CUQA 5ILSA 1JE8A 4EJVA 2VBXA 3ABUA 1FBUA 3SFZA 3T0YA 1G3WA 4Q48A 1ON2A 4XRFA 3CDHA 4ON0A 4U88A 1K78A 3FX3A 1FY7A 3U9GA 1B59A 5HS9A 2VE9A 2Y0MA 1ZLKA 4ETSA 4QWQA 2OU2A 1UFMA 2BBYA 3PFIA 4ZH4F 5HDNA 2F2EA 1BN5A 2MLKA 3GYHX 2XHKA 3BOQA 3HIFA 1QZZA 4G7OF 1IZ1A 1LDJA 4E70A 1W5TA 3J81K 1U5TA 4NHJA 1UHWA 3K9TA 1R00A 2K4BA 5LHGA 4P9UA 4ENKA 3R0AA 1FYMA 5JR3A 1FT9A 3WTVC 4ZZLA 1YQAA 3E6CC 1YIOA 4EQQA 3R6SA 1FWZA 3NQOA 1O3RA 4KT5C 1G3YA 4RB2C 2PQ8A 4YFXF 4O5VA 2W84A 3P9IA 2FMLA 1LVAA 3F22A 2XROA 2Y75A 3JTGA 1Z6TA 1TTYA 3Q9VA 2UZKA 3HTUA 3ZMTA 4RB1A 2CQKA 3HHHA 3ISPA 3NRVA 4KN4X 4M9SA 3KP5A 3LAPA 4ASNA 2A69F 2IA0A 3C18A 4MNUA 1ZRFA 4LG0A 5JVTA 3KZZA 3T1BA 3SQNA 1PUEE 2GXGA 1P4AA 3V7SA 1HW2A 1BIBA 4PZJA 5F6FA 4HZFA 3SXYA 5D6FA 2Z33A 1J59A 1B9NA 4LLGF 2L54A 1QBJA 1IN4A 4UXNA 4MEYF 3ZMZA 5H6RA 2OBPA 4LLNA 1FSHA 4EV0A 5E8IA 2M1BA 5BS6A 3RDIA 3LAJA 1G4DA 2RGVA 3O6BB 4Y15A 1J0RA 2VOPA 5AONA 2QLZA 2NNNA 3FMRA 1ODDA 4HBLA 2WV0A 4M72A 2LF8A 3GW2A 4LMYA 1I1SA 5DYMA 3H3UA 4CHUA 3I0TA 1AOYA 4KYWA 1LQ1A 4WXCA 2DU9A 3G3ZA 2VOOA 5ICFA 4EJTA 3U1DA 2V1UA 4FX0A 1UB9A 1B6AA 2O8XA 2QYOA 2VBYA 2EK5A 4IHTA 3WTZA 1QGPA 3F6OA 3T8RA 2H27A 2P4WA 3DEUA 1FC3A 1R23A 3I4PA 1E2XA 1BC8C 3GX4X 5BQTA 2PEXA 2HKOA 1O7FA 2B0LA 3P7NA 3ML6A 3M1EA 5CLSA 4R79A 3TDZC 3BROA 4K2EA 4WX9A 2YPRA 3HTSB 4ZYHA 3L2CA 1LB2A 1Z91A 4AD9A 2P7CB 3I59A 3REOA 2HOEA 3WG9A 1BBYA 1ZLJA 4KIGA 5L3FA 1TW3A 1HSJA 4I02A 1RI7A 3WU1B 2HWVA 2W25A 1J2XA 3OV8A 4OIQF 1MJBA 3I53A 3RKYA 3V8LA 2V9VA 3QPHA 1H0MA 4KMUX 5HLGA 3EYIA 2GA2A 2NYXA 3WE2A 2HTJA 5ICCA 4L9JA 4P55A 4HQEA 3VEPA 2GZWA 1T6SA 2RKHA 1R58A 4WF2A 4KUMA 5K1YA 1P6RA 3MWMA 4BAYA 2P5LC 1KA8A 4JBAA 4CYDA 2VXZA 4BHPA 3K0LA 3V8KA 5D6EA 5E20A 5CVUA 2UWMA 1GHCA 2IP2A 3Q5FA 3FF5A 2D2WA 1V3FA 2EFNA 4JQFA 1MJAA 3ZMUA 4U0VA 5DDGA 5K5RA 2RN7A 2EFPA 3K1MA 1QPMA 4YG2F 4M9ZA 2V1XA 4KA4A 4XSZF 1Q1HA 4UV9A 1YG2A 3TO6A 2ZNZA 1MDMB 5CVJA 2EV5A 3KP3A 4O3MA 4O6JA 2YSRA 5HLHA 1YW8A 2QQBA 4ESJA 2EA4A 2PBIA 4L18B 1UCRA 2R3SA 4U7BA 3SZPA 1D3YA 3S2WA 4I98B 1XGSA 1IN8A 4EVIA 3JAMK 3GZ5A 3BJ6A 2KRFA 1REPC 2QQ9A 1R1VA 3F72A 2AS5F 4L9VA 2R7DA 4MTEA 2O0YA 2XVCA 4CDGA 5F64A 2QM3A 2V1DA 2QBYA 4MEXF 2QENA 2MH2A 2A61A 3L00A 1E17A 3LA3A 4HQMA 1Z1DA 2FRHA 1HSTA 3K2ZA 1IUYA 4EJUA 4F7ZA 3TQNA 4OU0A 2GWRA 1B1BA 5LRRA 3PQKA 1SMTA 4A12A 4MQVA 2HZTA 5FB2A 2ZMEA 2PG4A 5LLQA 1LNWA 1R5GA 1Z9CA 3IC7A 3K1NA 2IT0A 4AVPA 3H92A 4N0BA 1L3LA 5J8FA 2RNJA 3RYPA 2HYFA 3RIRA 5LEKA 4ENMA 2PJPA 5JI6A 4A5NA 4LK1F 3LA2A 4LB6B 2ZJ2A 3V8JA 4CO8A 3WODF 3T5XA 3DP7A 1ONVA 1ZGAA 2MA3A 1ZG3A 3NEUA 5ICEA 2XAGA 3M8EA 5IT9K 1SD7A 5A2QZ 1FBQA 2DW4A 3WTTC 1IN6A 2M8EA 3TKYA 1CGPA 2ISYA 3ZMDA 2RVCA 4G94A 4B09A 1DDNA 1IRFA 4IRIA 1RZ4A 3ERED 3I58A 5H20A 3W6JB 4R8HA 2X0LA 1OR7A 1G6NA 2XIGA 4A0ZA 2ZO4A 1GXQA 3MZHA 1ULYA 3IRQA 3Q9SA 4UVAA 5HS7A 1U2WA 1O3QA 4KDPA 3BJAA 2IVMA 3HYIA 1XGNA 4AIJA 4GO1A 3ZQ7A 1IXCA 2KIUA 3I64A 1U8RA 1J75A 2W57A 3IWZA 2CYYA 1G3SA 1SFXA 4L5IA 1XDUA 3R4KA 3KE2A 3KP7A 4EMSA 5TRDA 4OIRF 3L09A 3K1PA 4HV6A 1AWCA 5EEGA 1ZG5A 3TGNA 1XMKA 4H0EA 1P2FA 5BPDA 3M9AA 4Z2YA 2DO7A 4EM1A 3FMSA 2WTEA 2BE5F 3ZMSA 2EA2A 5AIPA 5E18F 1TW2A 3F8FA 1EH7A 1YS6A 3HHGA 4Q5SF 4WXDA 1TLHB 4HLYA 1ZAOA 2O03A 2FBHA 5LGUA 5L3GA 2D1VA 3CO7C 1SFUA 5D4RA 3QPTA 4BH9A 5JFRA 2Q2EA 3HUGA 1TQPA 3J80K 1YW7A 1WRJA 1R1UA 1ZN2A 1ON1A 3W6KB 5ED4A 5HLIA 1KU3A 2Z5UA 2DAOA 1T98A 1F4KA 1FYLA 4P9FA 1U5TC 1ZREA 2BYVE 3M7GA 3LQRA 4HX7A 1TBXA 1A04A 2H6BA 5D5XB 4LFUA 4MQ9F 3H3ZA 2L4MA 2GQQA 1ZARA 2XAHA 4NQWA 4P96A 1I1GA 3F21A 2DQLA 4CICA 1YTYA 1GVJA 2KKOA 1KU7A 1W4MA 2KIFA 1FPQA 3CO6C 2Q0OA 1O3TA 1BC7C 1ZG1A 4G8XA 4HF0A 1OYWA 2UXNA 4HAMA 3WTWC 1OKRA 2COMA 3MFKA 3BWGA 3MCZA 3G73A 2E1NA 1T0FA 3RPUA 2O3FA 1SFEA 2PI0A 1EH8A 2G9WA 3BZ6A 4IHSA 2HTSA 1DPUA 3DXJF 2PMHA 1KU2A 4D0PA 2K27A 5CVRA 2A5YB 4G7ZF 4RS8A 3QOPA 2PFBA 2DT5A 1Z7UA 1P4XA 4HOBA 4Q47A 2IJLA 1B4AA 2HYGD 1RNLA 3E6BA 4UNOA 2VT3A 1GXPA 4UVCA 5D5WB 1KGSA 1W7PB 1SMYF 1S6LA 3F6VA 3VOEA 1KU9A 1FP2A 3CTAA 1BI3A 2GXBA 3ZN1A 3MAJA 5E8GA 2EV6A 1HXDA 5LEJA 1L0OC 5D8KB 2DQRA 1JXSA 2DI3A 1OYYA 4EJOA 3C7JA 3JW4A 3N97A 4A2UA 5ILVA 3BDDA 5HDKA 3KLNA 1LDKB 4AIHA 1IF1A 2E7WA 1EV7A 2A6HF 1JHHA 3IRRA 2EV0A 1U3EM 5J8CA 2F5CA 3PQJA 2K7LA 4OMYA 5LHIA 2XAFA 2XAQA 2H6CA 5E1XA 2DPDA 4MTDA 2HQNA 3HSFA 1YYVA 2HGCA 2F5DA 4IRHA 1ZYRF 1I6XA 1XDSA 1B9MA 5LGTA 3J7AO 2OQRA 4RGRA 3KEOA 4GGGA 2G7UA 3D5LA 4EGZA 2CFXA 1F1ZA 3ZP5A 3I54A 2L02A 3ULQB 4YFKF 2MLGA 4CGZA 4I01A 2ELHA 2JPBA 1H9GA 2VBWA 1FLIA 5AIQA 2VC1A 2Z9OA 3TOAA 4RB3C 3WU0A 1RIOH 6PAXA 3LFKA 2K4JA 1Y0UA 1LEBA 4GYGA 1LDDA 1FBSA 1XCBA 4HYEA 4ZYDA 2BV6A 4IF4A 1J7KA 2R7FA 2YU3A 4EGYA 3FMQA 3E3VA 3QP6A 1XGOA 2UXXA 3E5XA 3FZVA 4PGHA 1R5HA 2MD5A 2DFIA 2NAZA 4EM2A 1O57A 1KQ8A 3DFGA 1W7PD 1WKMA 2QWWA 1XGMA 2GIVA 3E97A 1W5SA 2XRNA 4HA8A 1S29A 3C3WA 1ZGJA 5DCMB 3R0JA 2HEOA 5H6QA 2JTVA 3MEXA 2FE3A 1SD5A 2JT1A 2JPCA 4RGSA 4N9HA 4XLPF 2CSOA 1U78A 1HKSA 4UHTA 5F1RA 2RV8A 3I71A 4G6QA 2ESNA 1FZPB 3GEZA 2TDXA 3SZTA 2CO5A 3EYYA 5EEHA 2OZUA 3J81Z 2H09A 3RKXA 2BEOA 2CW0F 2EFWA 3FWEA 4P5OA 2ISZA 3RTRA 1R1TA 5CYVA 5CVIA 3J80Z 4I2OA 2ZKZA 3TDUC 4OIPF 2LF7A 4UVBA 3QP5A 1IXRC 1BI1A 1YLFA 3M8FA 3ROUA 1TQMA 5DV5A 1XMAA 3ECHA 4RAYA 3GFIA 2LKPA 2ESHA 1T38A 4GXOA 1BIAA 3F3XA 4HDUA 4L0YB 2ACJA 4FX4A 3RKWA 4DNCA 1BM9A 4B8XA 3IHUA 5K5QA 1TQIA 3F8MA 3L7WA 4Y13A 3FM3A 4BHBA 2X4HA 3HRTA 5DD4A 1MDMA 1R7JA 3CUQB 4BHCA 2D1HA 4IPAA 1OPCA 3TO7A 4M73A 3I5UA 1ZRCA 2G7HA 2H94A 2RC4A 5LBQA 2O61A 1K78B 2Z3YA 3V7RA 4UUVA 1T39A 4U0WA 3GO5A 5D5VB 3EQLF 2CWEA 4M71A 1QO0D 5HDGA 1EH6A 3F8NA 2XAJA 2VC0A 3L9FA 1XB4A 2KIMA 3JTHA 4HF1A 2OZ6A 3GFJA 1DUXC 5LHHA 3BP8A 5ILUA 1ZRDA 2FNAA 1U5TB 2D45A 4U0YA 3RJPA 1U6GA 3P9CA 1LEAA 2QVOA 2VONA 1MGTA 3EETA 4EM0B 2HQRA 3T8TA 4YFNF 1IAWA 1O3SA 1IN5A 4ZYEA 2ETHA 2WWYA 5FLXK 2HKXA 2MH9A 3ABTA 4HDVA 4R1HA 1LJ9A 3JSOA 1WWXA 3WE3A 3LSTA 2FA5A 4RGXA 1ZHFA 1KQ0A 1WSUA 2DTRA 4QLCU 1MJ9A 1X3UA 2V6CA 2C6YA 2L3DA 5FFZA 4AWXB 4OMZA 3WTSC 1VTNC 4ESBA 1YO5C 5CJ9A 3QU3A 4LG0B 3KFWX 2ZCWA 3LQQA 4LD5A 3CLOA 2WC2A 3TO9A 1F9NA 2AXLA 1YFHA 2XGXA 3CUQC 3VB2A 2VE8A 1HQCA 3CUOA 1S3JA 2P6TA 3LA7A 4CZZA 2RDPA 2FQ3A 2J5OA 2RQPA 3HRMA 1OMIA 3CJNA 4I7HA 5FO5A 2OD5A 4JK1X 2VN2A 3DKWA 2FNPA 2XUBA 2YX7A 4I09A 1R36A 1XSVA 4ENJA 4BNCA 3O3KA 4KICA 1T2KA 1FSEA 3QAHA 4KNYA 3SHFA 4XLNF 2MBFA 1XSXA 2XASA 4YIFA 3F8CA 3TOBA 2EB7A 4BYYA 3LWFA 2W85A 1BI0A 2A3SA 4L5JA 2V79A 3WGGA 2VT2A 3RPQA 1IRGA 4LJZF 3WGIA 1D5VA 4A6DA 3GF2A 3DF8A 1SAXA 2E7XA 2JSCA 1WQ2A 4FT8A 1SD6A 3BPVA 3JSPA 1TNTA 3VODA 1IXSB 1I27A 1J9IA 1STZA 3HSEA 1K7AA 3COAC 1QQIA 3QRFF 1HW1A 3KP4A 3RYRA 4GCVA 1S8NA 2PN6A 2XKOA 3I59B 3IWFA 1YW9A 1JGSA 4XSXF 4LB5A 4G9YA 4OINF 2K02A 4ESFA 3V4GA 2STWA 1ZH5A 3E5UA 3GFLA 5A2QK 2P7VB 2STTA 2IA1A 4TV7A 2ZNYA 4G6DA 2F5EA 4M6XA 2E1CA 1QNTA 3JAMZ 4RGUA 2F5FA 2OAZA 5KK1A 2XKPA 3DV8A 1Z05A 3KP6A 5IT3A 2FEZA 1QZYA 3E6MA 2OQGA 5FD5A 3KP2A 4A6EA 4A0XA 5D4SA 3VFZA 4WCGA 2M87A 2A6EF 2PMUA 2EFOA 5LRSA 5JHUA 2QUFA 4HV5A 3IKTA 5DCFA 2Z99A 4FHTA 2LDUA 3C1DA 1MKMA 3KZYA 1RUNA 5FGMA 3E5QA 5FD6A 1MD0A 4CXFA 1P4WA 3R61A 1SD4A 1YS7A 3R60A 2GA1A 2K86A 2FMYA 5HOOA 4NB5A 2QQAA 4S05A 5FFXA 2GAUA 2M45A 4N9IA 4Q4ZF 3ZMVA 5L3CA 4HX4A 5E17F 3MZYA 3GXOA 3KLOA 2M5WA 2P5KA 3HSRA 1BOAA
chains in the Genus database with same CATH superfamily
3U2RA 3LMMA 1EYZA 1XSDA 5IT9Z 1AA7A 4I0BA 2F48A 4HF2A 3WHBA 1WSCA 3ELKA 3TINA 3GZ6A 1LE8B 4IXAA 1Y14B 2DFEA 4KJZA 4XORA 3AAFA 4KN7X 4ZTFA 4DV1H 5DUKA 1Z6RA 5LGNA 1A36A 2KJBA 3PO3J 3ZOBA 3FXLA 3L2VA 5DS9A 1MNMC 1QVTA 3SE7A 2DK8A 4LITA 1I3QJ 5KFUA 3HOTA 5KFCA 1RUOA 3WGHA 3H4BA 4BE0A 1HDPA 2GPSA 4XNFA 1IRZA 2IXSA 3RQ4A 3D0SA 4A3MJ 4I0AA 3RCOA 3TW6A 3KEQA 2V59A 3RKQA 4HLXA 3JZIA 2ASDA 3S93A 1J5EH 3LFUA 4A3EG 2DJIA 1S7AA 3BY6A 1IN7A 2HS5A 2IW5A 4ZDPA 2KDZA 2GLOA 2FPIB 2WADA 4IRGA 3VPBA 1D0ZA 2KDOA 4F4ZA 2QBYB 4B43A 5ERIA 2E34A 2FBKA 2F5VA 1CS0A 1BJAA 1BL0A 2IRFG 1KJ8A 2FLNA 1W7PA 1HKTA 2P5VA 1MZBA 5FKOA 1C0WA 1Y1VA 1FP1D 3VPRA 3GLXA 1ZETA 2XPWA 4F93B 3FHZA 5CVVA 1ENHA 4F4WA 1HNXH 3Q8QB 4UCTA 2BW3B 1HBXG 1B8IB 3RFCA 5L3DA 3MQ0A 2HXIA 1CF7B 4BXXJ 3K4CA 4S04A 4A5MA 1UZCA 1K79A 1M7JA 2YR2A 5F0HA 2J5PA 3CC7I 1SEIA 4M74A 1SVMA 2Y48A 4YIIA 5FLXZ 4RNNA 1TNSA 1UMQA 2IA2A 5F08A 2P8TA 4HX8A 1U8BA 1KJQA 3OR2C 1ETQA 1FNNA 4XQFA 4A0YA 1V51A 2ZMEB 3PIPF 1Y1VG 4WXHA 4O3NA 4LF4H 2XGDA 3CQZJ 4Y7NJ 3EPZA 2DWCA 4AC0A 1DV2A 1Y8QB 4H4KC 2HR3A 4EJWA 3KEYA 1QHHD 2QF7A 2L01A 4RZQA 4XBFA 5GAEJ 4J9SA 1UG2A 4KIFA 3PIOF 1OYIA 2HGSA 1S7EA 2NU6B 1WGXA 4BQQA 5DUIA 4OX9H 2NU7B 3GVAA 2P0AA 5TJJA 1HC8A 3ETJA 1N36H 2E2IA 2HVRA 5KVRA 2UXDH 2FF4A 4DJAA 1H9TA 1X2NA 2QZ8A 1TWCJ 4UCOA 2EFQA 3HOSA 2W6ZA 1D8KA 5GP9A 3F23A 2DTZA 1GVDA 4IJAA 3Q0UA 3OOPA 2X48A 3B73A 3PN1A 4RAZA 4WWCA 2R8KA 4IOAF 5M3FJ 3ABLH 3D5RC 2A07F 3WTXC 3MKZA 2ID6A 4G7HF 1S9FA 2R92G 1ETKA 2L9NA 1V4RA 3ASNH 5KFSA 2RDJA 2DBBA 5E3MA 4OOIA 2P0WA 4NC7A 2I87A 3BR2A 4G6TB 1KJJA 5CA1F 3BR6A 2V9KA 1WJEA 1D8JA 1MH4A 1M1EB 4IZZA 4RLQA 2OA4A 5C3EJ 2PLYA 1NHAA 4NC6A 5D5UB 2M30A 4Y3OA 1UAAA 4BKXA 4ECUA 3J81W 3E7LA 3TBIA 1WHUA 4M9XA 2O8KA 5KFZA 4HW0A 4RLFA 1S68A 1V5GA 1QHGA 3H0GG 3TP3A 4TQRA 1LE8A 1Y6IA 1JLLB 3VDXA 2MC3A 4LLLA 2W9AA 3O2PE 3ONQA 4GKJH 4IHWA 2XPUA 3S14J 4YEJA 2KRCA 2ME0A 3E6DA 3P9KA 4CUGA 2JA5A 1AUVA 1I5ZA 5IP9G 5KFMA 4OIOF 3GV8B 1T08B 2EJRA 2NS8A 3J80W 4A3GG 1VBHA 5DLGA 1D1AA 3MD2A 3LSIA 4BEHB 4L9NA 3K6GA 5F0FA 1G3TA 3HOUG 4FQGA 3A1YA 3HB9A 1UHMA 4F91B 3GV5B 3A0BC 4UV8A 1P92A 2DA3A 4Y8VB 2P6SA 2FBIA 1DPRA 2XRLA 3L2QA 2KZVA 1ZTRA 4PCQA 4RB0A 2EWNA 1MBGA 4XN3A 2JZYA 4JYKA 2BQUA 3OYKA 2V6EA 3QYFA 4OAYA 1R6RA 4ME6A 5EGOA 4WK8F 4J9KA 1ULZA 2YRXA 3S32A 4D5FA 2DMUA 1HKQA 3DCFA 1JUMA 3ZPLA 4YIRX 1W5CC 1YHQI 2M0CA 3BQ1A 3WTYC 5L3EA 3RTXA 2PX9A 3K7AJ 2RGRA 4DGWB 1KQ9A 3NGDA 3CMYA 1YIJI 5EDNA 1HW5A 2IBKA 2DK5A 2JRTA 4YB8B 1MNDA 3EDPA 5L3BA 1K6OA 2BW3A 4LH6A 4XYLB 4RNMA 3RI4A 1CF7A 2KT0A 4LK0F 1IV6A 2V7FA 2JUGA 4DZPA 1VFCA 3BPXA 4DQ2A 2ZXWH 1VF9A 1K83A 3IN5A 3QU6A 3U9TA 1S03G 5E1ZB 2NNYA 2VODA 3BR1A 2EQRA 4BY1J 4JI3H 1IW7F 2A5WA 1ZR4A 2XCPA 2NRAC 3KALA 2R8IA 2VJ5A 1ETXA 5KNLA 2NS0A 1PDNC 4CC5A 2BR0A 2E2HA 2JEGA 5K5OA 2ZBKA 2LSOA 2VQLA 3EUHA 3ZN0A 4WD3A 4A3FG 2HDCA 1FX7A 3ECOA 1JHFA 3IAM2 3NAUA 5JVGF 2W48A 1IC8A 5GPAA 4KMFA 1T33A 1MBEA 4RM3A 1BGWA 3K69A 3V7CA 4JV1A 2HPMA 2VL8A 1JTYA 3KYCB 1BI2A 3N4MA 5KT3A 4DR4H 1QA6A 1KYWA 1XD7A 1FTTA 2BXZA 4QWDA 4ZDLA 2R4GA 2CZGA 3BR5A 4II2A 3HRUA 5GPCA 2VQGA 3HRSA 5DCMA 4XRSA 1FOKA 2FU4A 4AIKA 4JI0H 3ORQA 4KIBA 3OUZA 4B3RH 4DIQA 3KETA 2ZXJA 3MVPA 2RNGA 1WPKA 3H35A 4GYIA 5KT2A 4PDKA 2KJCA 3R23A 4AU7A 2YX4A 3SZGA 3CCSI 1XCVA 1EF4A 2R7ZG 4O2AF 4ITVA 5HVQC 2VBZA 3ZQIA 5DEQA 5EG0B 4RBOA 4BXUA 4ZYGA 2ECBA 1T36A 3B02A 2PMZE 4ABZA 3FIWA 2LYCA 3E0JB 3FXUA 4IVNA 4L9TA 2VA3A 3OMYA 1XX5A 3CJRB 4M6YA 1FIPA 4L0ZB 1A35A 4XRSG 2CG4A 5FKLA 4MV6A 4HQ6A 1MSFC 4X62H 2CUZA 3WTUC 2VR1A 3MR6A 3SJMA 3FXQA 4LSAA 2O6GE 3KCCA 4S0HB 4CCMA 4PGGA 2LY2A 4MGRA 5J6XA 4LIVA 1FIAA 4APMA 1O7LA 1GV2A 4XLCA 4AYBE 5KCMA 2ZFWA 5HS8A 2ADUA 3JRCA 3BJOA 1JKRC 2F6CA 2FOKA 2BOLA 2MD0A 4PSXA 2A68F 1MBHA 2HFHA 2Q8KA 3CD6I 3BA9A 4HYKA 4B3XA 2V4QA 2FSWA 3BTIA 1FJGH 1KYZA 3DWLE 3DBLB 3FHNA 3ESWB 1XN7A 3FM5A 2XCLA 5BOXA 5EJCA 1NK3P 2E71A 2Y0SN 2E1MC 4E7JA 1CE8A 1JDBB 1J5YA 2YZGA 1JX4A 2IGKA 4EBEA 2Q2EB 3GWZA 3HUGB 1AKHB 1T3NA 1BJTA 3K5IA 1Z2PX 4IZOA 2IPQX 5BPIA 5HNHA 4G12A 4KFCA 5LMNH 3GIJA 2W24A 5DQIA 1PYVA 2BY2A 1JKPC 3RZOJ 4DV7H 1RJRA 3U9SA 5E1WA 4DR1H 4MV8A 4LF6H 5BMZA 3HOXG 4MHGA 2BGCA 1R22A 1X1BA 3IKVA 1USSA 5CKTA 4IHYA 4HRIA 1VKZA 1LFPA 3LSHA 2FXAA 2JN6A 2CGPA 1S7OA 2DLLA 5ICGA 2EIJH 5KFFA 2AQEA 2XSJC 1JIHA 3ASOH 2YZMA 4ZZDA 3I3LA 3SFIA 3IL2A 2CQNA 3Q8RB 2AQFA 4A3JJ 3RB3A 2UV1A 1N75A 2EIMH 4U7DA 1PP7U 2NVXJ 3T1HH 1F5TA 4JI8H 4Y17A 2W9CB 3DPTA 3K70C 2SCUB 3F8BA 3GFMA 4NQWB 2B63G 4BQAA 4XOPA 3DQVC 1TT0A 2JEFA 1DP7P 2DA1A 3E5NA 2XV4S 2UUBH 3FXRA 1PP8F 2L4AA 5DD8A 4A3KG 1WI9A 1E3PA 4LGWA 1YJNI 3GUDA 3DPLC 3JRGA 1MMAA 1USTA 3BG5A 4ENNA 2DPUA 1FYKA 2BQ3A 3UR3C 2V9PA 5D8LB 2LNBA 3CUQA 2Z16A 5ILSA 3W3CA 4C3HJ 1G59A 5KFEA 1JE8A 3CP2A 2HOSA 2QSGX 3GIKA 4XM3A 1PK8A 1JGGA 1JDEA 4EJVA 2ZJPF 5JLXA 2VBXA 3ABUA 1FBUA 2IGMA 3SFZA 3T0YA 3W2WA 2LH9A 9ANTA 1G3WA 4XLFA 4DV0H 4Q48A 3FKIA 2W9BB 1RK5A 1ON2A 4XRFA 5KG6A 3CDHA 1XNQH 4IKFA 5DGBA 4IX7A 3FBNB 4ON0A 4DR7H 4U88A 1K78A 4RUAA 3OSPA 3FX3A 4QSHA 1IGNA 4ANJA 2IS1A 2YW2A 1FY7A 3U9GA 5EG0A 1B59A 5HS9A 1OCZH 2VE9A 3K5HA 1LFBA 2Y0MA 2WE6A 1ZLKA 3BJYA 1R9TA 4ETSA 4QWQA 1ZKGA 4LIUA 1TC3C 3S17J 1FOYA 3JRXA 3KAKA 2OU2A 5KFXA 1UFMA 4MIMA 1JTXA 2BBYA 3PFIA 1GDTA 5F1JA 4ZH4F 4IWYA 3CC2I 4AQYH 1N56A 5HDNA 1TL8A 1N48A 4JV5H 4ZTJA 2F2EA 1BN5A 4ECXA 4DL4A 2MLKA 4M3EA 3GYHX 2XHKA 3BOQA 3HIFA 1QZZA 4G7OF 2LY9A 1IZ1A 2NXNB 1LDJA 4E70A 4J9LA 5DTDA 4TV9F 1W5TA 3J81K 2WBMA 4CCNA 3K3PA 1U5TA 4NHJA 1UHWA 2O7OA 1VQ8I 3K9TA 1R00A 2K4BA 4X0GA 5LHGA 1SEUA 4P9UA 3CZ6A 4B3AA 4ENKA 3OSFA 3R0AA 1KJIA 4DV6H 3GTQA 2YS9A 1FYMA 2DMPA 5JR3A 1FT9A 3WTVC 4ZZLA 4MV9A 3K4LA 2ATLA 1AKHA 5CA0F 3A2KA 1YQAA 2K9MA 2VQHA 5IYBJ 5EF6A 3E6CC 1YIOA 3V6JA 1WH5A 3T1YH 1U9NA 4EQQA 3R6SA 1FWZA 3NQOA 1O3RA 1X3ZB 1HNWH 2ZDGA 4ZHQF 2JA6G 4KT5C 1K4TA 5HLTA 1G3YA 4FU0A 4RB2C 2PQ8A 4YFXF 4O5VA 1O75A 1TWAJ 2QSFX 2W84A 1POGA 4DR3H 2VJJA 3P9IA 2Q2TA 1ETVA 2FMLA 2R7RA 2ASJA 1LVAA 2X6OA 5KAFC 3F22A 3GILA 1OISA 2XROA 1UC8A 2Y75A 4FTHA 3JTGA 1TWGA 1Z6TA 1TTYA 4R8UB 3RB6A 3Q9VA 4BGDA 3HTUA 2UZKA 1QPIA 2H1KA 3ZMTA 4RB1A 2CQKA 4LF8H 2NVYA 1BR4A 3HHHA 3ISPA 5KFNA 4RAGA 1X1DA 3NRVA 4KN4X 4M9SA 3KP5A 2EZLA 4JX6A 3BG3A 2F4VH 3LAPA 2E1OA 2A69F 4ASNA 5KG0A 2IA0A 2KFDA 2R7OA 1YI2I 4A3DJ 4MV7A 3QPSA 3C18A 3P5JA 3OYIA 2O5RA 5IP7J 2E5ZA 3OHBA 4MNUA 5B5EC 4LG3A 3BTLA 1ZRFA 4LG0A 2VQEH 1LVKA 1IG7A 1FOWA 5JVTA 4C30A 3S2HJ 3KZZA 3OS0A 4BDZA 2R82A 4Q44A 4XLHA 3T1BA 3SQNA 2HOAA 1PUEE 2R93J 2GXGA 2EZKA 2Q1ZB 4BJTA 2OWOA 2A6TA 1P4AA 2P81A 1KEEA 1G2HA 2PBZA 2RDIA 3V7SA 1HW2A 1BIBA 4PZJA 4X64H 2XD4A 2CUEA 5F6FA 2W00A 4E7IA 2YL2A 2ELKA 5J47A 4HZFA 3SXYA 4CCKA 2R7QA 2CW7A 4JI1H 5D6FA 3N44B 2Z33A 1XMXA 3LSKA 1J59A 1JJ6C 1B72A 1B9NA 2BHZA 1CQIB 5KG7A 3GTMA 2DFFA 2CV0A 3CLQA 4LLGF 1A31A 2BY0A 3K3VA 2YCHA 2DOAA 1V5FA 2L54A 3H9JA 1QBJA 2XF5A 3JAMW 3GV7B 1IN4A 4JV0A 4UXNA 2FX0A 4MEYF 3ZMZA 5H6RA 3L2WA 1ZQ3P 3MWEA 4M9UA 2OBPA 1DIKA 4LLNA 5IYZF 1FSHA 2XB5A 1RJQA 4EV0A 3KYLA 1I7LA 4YR3A 5E8IA 4UUSA 5D1OA 3I4MG 2M1BA 2CKZB 3OWTA 4DZJA 1T0FC 3RDIA 5BS6A 3RB0A 3GTKA 1WJ5A 2L0KA 3VYTB 3LAJA 4DUZH 3QYBA 1G4DA 2WB1N 4DYRA 3A01A 2RGVA 1EUCB 4IEJA 3O6BB 4Y15A 1J0RA 2VOPA 5AONA 2QLZA 2DA6A 2NNNA 1ODDA 3FMRA 2WV0A 4HBLA 4JOMA 2LVSA 4M72A 2DA7A 2LF8A 3GW2A 2DT7B 3G71I 1IOWA 1KONA 2K9LA 1Z77A 3HGYA 3IH2A 2R86A 3BT9A 1ORKA 1E3HA 4LMYA 3RPUD 3HZJA 1I1SA 5DYMA 1AU7A 2JA7J 3H3UA 3VSKA 2CFOA 3CCMI 3FK7A 4PJMA 4UB6C 4CHUA 2JA8J 3I0TA 1AOYA 4KYWA 1LQ1A 2M0MA 4B47A 4WXCA 3S15J 2DU9A 4IHXA 3G3ZA 2YU9J 2OV7A 2VOOA 5ICFA 5FPOA 4EJTA 3HKZN 4MV1A 1H88C 3RJ0A 3U1DA 2V1UA 2UUZA 4FX0A 2R7UA 1S0OA 1KJ9A 5FJ8J 5IOZA 1UB9A 1B6AA 2O8XA 2QYOA 1I50J 2X1DA 4QWBA 3K4KA 2VBYA 2EK5A 1X58A 3V42A 2WYOA 2QEXI 4HPQA 5GTHC 4IHTA 3PUBA 3WTZA 1QGPA 3F6OA 3T8RA 2H27A 3FK6A 2P4WA 1RJPA 3DEUA 3KAJA 5BR8H 1GLNA 2WY8Q 3OIQA 3JRIA 1FC3A 3QZ7A 1R23A 4O3OA 3A02A 3TIGA 2R5ZB 4DL2A 1ERDA 4NC8A 4ZOLF 3I4PA 1E2XA 3R5XA 2FMAA 4MAMA 4R8UA 2C28A 1BC8C 3GX4X 5BQTA 4D7MA 3LSRA 1SFOA 2PEXA 1A5JA 5T14A 1GSOA 5J40A 3ZXSA 2HKOA 2KQRA 1HA8A 3HOZJ 1O7FA 2B0LA 2Y2ZA 3P7NA 5DG7A 2KSWA 5IYDJ 3ML6A 3FMAA 1I94H 4E4HA 2MGQA 3M1EA 5CLSA 4R79A 2XGPA 3V6HA 3RBDA 3TDZC 4DYQA 2ZXIA 3BROA 3DLAA 5FKNA 3W6VA 1GO3E 2W6PA 4YBZB 1I3QA 4K2EA 4WX9A 4DL7A 2YPRA 4E7KA 3HTSB 4C5CA 2GOXB 2DOEA 2WAFA 2UVRA 1WJBA 3ZRGA 2RREA 3OYNA 4ZYHA 4FE7A 2RAEA 2JVGA 3L2CA 4IL6C 1X1CA 1LB2A 1Z91A 4AD9A 3C0FB 2P7CB 3I59A 3REOA 3TP0A 2HOEA 3LWBA 4A3IG 3WG9A 5IT9W 1BBYA 2QYZA 1ZLJA 1WJDA 2R5YA 5BPFA 3EPIA 3V4ZA 4KIGA 3MFHA 1IJWC 5KG2A 5L3FA 4JI2H 1TW3A 1HSJA 4I02A 1RI7A 3CC4I 2V58A 4U87A 3WU1B 3RQIA 5J2TF 2HWVA 2FPPB 2C22A 3OHAA 2W25A 4RUCA 1J2XA 3OV8A 4QIWN 3K2AA 4OIQF 4A3CJ 1IDYA 2FB9A 2COBA 1AHDP 1MJBA 5CB4F 3I53A 3RKYA 2HNHA 4LF9H 3MKYB 4YJ3F 4A3LJ 3GIMA 3V8LA 2V9VA 4ZDOA 3QPHA 3HJEA 1H0MA 5EWEA 4KMUX 5HODA 2F4MB 5HLGA 3EYIA 2VJ4A 2GA2A 2NYXA 3WE2A 2HTJA 3CQZA 5ICCA 3A0HC 3DKXA 4L9JA 4P55A 4HQEA 3VEPA 2GZWA 2LG4A 1DGRM 1T6SA 2RKHA 1R58A 4WF2A 5DLFA 1Z0XA 4KUMA 5K1YA 1MBJA 2KISA 3PR5B 4LF5H 4LH7A 1P6RA 2H1LA 1BR1A 1WH7A 3MWMA 2R87A 3TL4X 1N25A 1V4YA 5M5WJ 2L9VA 3QOEA 5FLXW 1XNRH 1I3AA 4BAYA 2WV1A 2DN0A 2P5LC 3C2HA 3SYTA 5M5XJ 1KA8A 2XSDC 3JRFA 5L1LA 4JBAA 3I4NG 1WH2A 3CCYA 2C00A 4CYDA 1Y0NA 4QTRA 2HHHH 4J9MA 3MN2A 4IOCF 3HOVG 2L2OA 4C9YA 2VXZA 5H80A 3HDDA 3W2VA 4BHPA 3K0LA 3V8KA 2OCCH 5D6EA 5E20A 1WJCA 5CVUA 2TRTA 3D1NI 5EEAA 1SCUB 4IQJA 2UWMA 2E19A 2IP2A 3VYRB 1GHCA 4EEQA 3Q5FA 3FF5A 2D2WA 1V3FA 3FISA 1B33N 5DQGA 4A3EJ 4DLKA 1BW6A 4ECSA 3H3VH 1S0NA 2EFNA 4AM3A 4JQFA 5LOVF 2HVSA 1OCOH 3HL2A 4ECWA 1MJAA 4NUBA 3ZMUA 2DXIA 2M34A 4ED1A 4U0VA 5DDGA 5EYRA 1VBGA 5JH7F 1Y39A 4FBTA 4P1WA 5K5RA 1LUJB 2RN7A 3S1MJ 2EFPA 4BJ6C 2H8WA 1JT6A 3LP8A 3K1MA 1QPMA 3SEQA 2V1NA 2JA2A 4M9ZA 2V1XA 4YG2F 5DM7F 5C3EG 1Z7LA 3PUFA 4KA4A 3S3NA 2JRMA 4XSZF 1Q1HA 4UV9A 3PO2G 2FK1A 3AKZA 2HXOA 2WAQA 3CMAI 2ZSHB 1J09A 4AVZA 1VZ0A 4IWXA 1YG2A 1RKWA 4A69C 3PW5A 3TO6A 3AYHB 2ZNZA 1MDMB 3JR9A 1OQYA 5LD2C 2VOBA 2Y9ZA 5CVJA 2EV5A 1I6HJ 3KP3A 2LOOA 4O3MA 4Q45A 1PVEA 4O6JA 3BCAA 3DBRB 1EZ1A 5KFRA 3N05A 1Y1VJ 2YSRA 4JV2A 5HLHA 1YRNB 1YW8A 2QQBA 4E7SA 4ESJA 4EGQA 2EA4A 2FJ1A 4YR0A 1WFXA 3F0CA 2PBIA 4L18B 1UCRA 2H8RA 2R3SA 5FKKA 3ZQFA 3C2GA 2HQAA 4U7BA 3J7AY 3SZPA 1L2ZA 1D3YA 3NWSA 3S2WA 2M4GA 4I98B 2BY1A 1XGSA 1IN8A 1A9XA 3PW0A 3MR3A 4EVIA 2E1MB 1WCMA 2FK2A 1CQJB 3ETHA 3JAMK 3GZ5A 3BJ6A 2KRFA 1REPC 1GYFA 1DU0A 2QQ9A 5CAEB 1R1VA 2VASA 4K0KH 3IH4A 3F72A 1HOMA 1DP3A 2R92J 4O4HF 3GMEA 2AS5F 1Y1WA 4L9VA 3LSJA 3B6AA 5JVDF 2R7DA 4MTEA 4TQSA 2O0YA 2XVCA 4CDGA 5F64A 2QM3A 2V1DA 2I80A 2QBYA 4MEXF 2QENA 2CRGA 4IO9F 4RMNA 2JA5G 2MH2A 2A61A 2IGOA 3L00A 5JVLA 1Y56A 2C2EA 1E17A 2JQ7A 2VUMA 3LA3A 1WCMG 4HQMA 3PSIA 1Z1DA 1U9OA 2FRHA 1FEXA 3H0GJ 4CSWA 1UNNC 1HSTA 3K2ZA 1IUYA 3KHLA 2NS7A 4EJUA 4F7ZA 2AGPA 1B8IA 2K9SA 4RA2A 3TQNA 5E3LA 1NG7A 2EIKH 4ED2A 5FLMG 1Y1WG 4OU0A 2GWRA 3CJQB 5IP9J 2ZB9A 3HEFA 4A3GJ 5J2UF 1B1BA 3HOWG 3E1SA 1X1PA 5B1BH 2WA0A 4ECVA 5LRRA 3PQKA 3OYCA 1Z67A 1B6RA 1SMTA 3JRWA 3HOUJ 4A12A 1WR2A 2M7BA 2VUMG 1X4PA 4MQVA 5K7FA 3OS1A 5JUMA 1GLVA 2HZTA 2X9DA 5FB2A 5F0CA 1MMNA 2ZMEA 1YJWI 2PG4A 5LLQA 1LNWA 1R5GA 1Z9CA 4RDUA 5B3SH 3IC7A 1E4EB 2HI3A 3K1NA 1K1SA 2L7MP 2IT0A 4AVPA 4G3IA 1JUPA 3H92A 4N0BA 3ZQHA 4C2MJ 1L3LA 4CCJA 5J8FA 4RAFA 3BZKA 3ERMA 4C2TA 2RNJA 3CF2A 3RYPA 2G0EA 4CH7A 2HYFA 3RIRA 5LEKA 4ENMA 3NWTA 2IMWP 2R7TA 4Q43A 1O4XA 1PUFB 2PJPA 2MSYA 2O9LA 2HPIA 5JI6A 1G8XA 4J0MA 1GSHA 4J9OA 4A5NA 4NXNH 1IBLH 4LK1F 1V5EA 2LLKA 3LA2A 4LB6B 4IR9A 5FKMA 2ZJ2A 4V2GA 4W1UA 2MC4A 4EEFG 4YAJB 3EUHC 2E5LH 3V8JA 4CO8A 3OL4A 3MR5A 3WODF 4O3PA 2C35B 2UVVA 2D5VA 3T5XA 3IUOA 1APLC 4HNUA 1QU3A 4UUTA 2B9SA 3WO0A 3DP7A 3H40A 1ONVA 3GIQA 2CV1A 1ZGAA 4DUYH 3J7AK 4A3FJ 2MA3A 2L9RA 1ZG3A 1YRNA 2Y0SA 3NEUA 2LK2A 3PZPA 5KFLA 4DL3A 5KFBA 3QODA 2W4SA 5ICEA 2Y9YA 2XAGA 3M8EA 4DR5H 2LFBA 1D1CA 1R49A 5IT9K 1SD7A 3BQ2A 1T94A 5C44G 5A2QZ 2AGOA 1FBQA 1E3OC 2AO9A 3G2BA 2OUMA 2DW4A 1E0EA 3WTTC 4BEHA 1D5YA 1R4NB 2NVXA 3BZCA 2OTJI 3ZQLA 1UG0A 4MA5A 1IN6A 3N41B 2UVUA 2DFHA 4ECZA 2M8EA 3IH3A 2FJZA 2OJED 3TKYA 2FP4B 2W7OA 1CGPA 2ISYA 3ZMDA 2R7ZJ 2DMTA 2RVCA 4G94A 4B09A 3RB4A 1DDNA 1IRFA 4IRIA 1RZ4A 2EH3A 2DYSH 3ERED 2M8GX 3L2UA 3I58A 5CPRB 1EJ9A 2NOJB 5H20A 3W6JB 4C5BA 3FBIB 4A3BG 4R8HA 3PL8A 2X0LA 3JREA 3I56I 1OR7A 3HGGA 3AL0C 1ACIA 2Y30A 2VPLA 4BBRG 1G6NA 4J01A 2XIGA 3IG0A 2PMZN 4I50F 4O3QA 2XC9A 2XB0X 4DW6A 1V9PA 5EZGA 1XC5A 4A0ZA 4DV2H 3S16J 3LL7A 3H5NA 4Y52J 1TWFJ 1WJFA 3PVXA 2ZO4A 2PN1A 1GXQA 3MZHA 2DDBA 4FETA 1ULYA 3CCEI 2ZJTA 2VIXA 3IRQA 5C1PA 3Q9SA 4UVAA 3K4MA 5HS7A 3TW7A 4XKWA 1U2WA 1O3QA 1H8AC 4KDPA 4O2BF 3BJAA 2IVMA 4JX5A 3HYIA 4AYBN 1XGNA 4AIJA 4GO1A 5BMVF 2KLOA 3ZQ7A 1A6QA 1IXCA 4UCRA 3VWBA 2Z2SB 4XOTA 2KIUA 3I64A 1U8RA 1J75A 2W57A 1IDZA 5LFAA 3IWZA 2CYYA 1G3SA 3BG6A 1SFXA 3GIDA 5KFGA 4L5IA 5J1RA 2TCTA 3LOCA 1XDUA 3EUKL 3R4KA 5D1PA 3KE2A 2ZDQA 4O4LF 3K70D 2HDDA 3LSMA 3KP7A 3VSLA 4EMSA 5TRDA 1RYSA 3OYFA 4OIRF 3L09A 1AUXA 5EZYF 2QKMB 3HOXJ 3K1PA 4HV6A 1K6YA 4XKCA 1AWCA 1N78A 3JRBA 4UCUA 5D8DA 4J19A 5EEGA 3KYDB 4RZRA 4I76A 4ECTA 1FJLA 1ZG5A 3TGNA 1XMKA 4H0EA 1P2FA 2R8HA 5BPDA 1MMDA 3OSNA 3M9AA 4CCLA 5KG3A 4BDYA 4Z2YA 3R5HA 2DO7A 4FS1A 4EM1A 2IAIA 1JKQC 1VQ5I 3BABA 2X0SA 3EPGA 3FMSA 1B6SA 2WTEA 4B3SH 1P7JA 3WNZA 2BE5F 2MFZA 4PWQA 2B63J 5IWAH 3ZMSA 2CW8A 2EA2A 2DODA 1TWAA 2K5CA 5AIPA 5E18F 4MV3A 3RGZA 4A3KJ 5IYCG 2E35A 3FKIG 1TW2A 3F8FA 1EHIA 5EOYA 1EH7A 2OC6A 1YS6A 4DBRA 3HHGA 4Q5SF 4WXDA 1T95A 3J7ZI 4GC6A 4XMYA 4MFEA 5F04A 1TLHB 4XYMB 2XF6A 4FASD 4XLAA 2K85A 4HLYA 3Q0WA 1ZAOA 4MV4A 3MZ8A 3GTGA 2O03A 2FBHA 1OCPA 4DL6A 1X1AA 5LGUA 5L3GA 5FROA 4XL9A 4BY7G 2D1VA 3CO7C 4C3JJ 1SFUA 3VYUB 5D4RA 5LP6F 3QPTA 4BH9A 3A03A 5JFRA 4GC7A 2Q2EA 3HUGA 4ZJZA 2OTLI 1JI8A 4AIDA 1S5LC 1TQPA 3J80K 5F27A 4BE1A 1YW7A 4Q8FA 3GTJJ 1WRJA 3ZGKA 1R1UA 4FE4A 1RR8C 3GTOA 1ZN2A 3CDLA 1SC7A 2DPJA 3WHCA 1ON1A 2X1EA 3W6KB 3ABKH 5ED4A 3B6CA 5HLIA 1KU3A 5IOYA 1PJRA 2Z5UA 2QGUA 2ZJQF 1RR7A 4EBDA 2DAOA 2M7AA 1F36A 1T98A 5KFIA 3GTLA 3S1RJ 2BY3A 2DA4A 4PJNA 1RRJA 1RETA 1F4KA 3PNTA 2IBDA 4P9FA 1U5TC 1FYLA 1ZREA 2EINH 2BYVE 3DU5A 3M7GA 5KFQA 3LQRA 4HX7A 1TBXA 4GLXA 2JSPA 2I10A 2QSHX 1A04A 2H6BA 5FRNA 5D5XB 4LFUA 4MQ9F 1R9TJ 3Q8SB 3H3ZA 4Q0YA 2L4MA 5E79C 2W9CA 2GQQA 1ZARA 4BBSG 2XAHA 4BQNA 3HPGA 4NQWA 2NVQJ 4ED8A 2M2EA 4P96A 1JKOC 4JYAH 1HF0A 1ZHQA 1C30A 1I1GA 3F21A 2GXAA 4EFEA 4CCOA 3VPDA 3R5FA 3BG9A 3G1OA 3H9GA 2W8LA 3DEWA 2DQLA 1W36C 1MNEA 4CICA 1YTYA 1GVJA 2KKOA 2DDAA 3HBLA 2MW8A 5KT4A 2GIZA 4CC6A 1KU7A 4EEYA 1FMWA 4M3GA 1W4MA 2KIFA 3WU2C 2JA6J 1FPQA 2X1CA 3K10A 3CO6C 3BR3A 1CQTA 2Q0OA 3OSGA 1O3TA 1BC7C 1ZG1A 1V55H 4G8XA 3KZIC 3MMYB 4HF0A 2VUGA 4U6PA 3S3OA 5F9NA 2W9BA 1OYWA 2CUFA 2EBIA 4W97A 4B4CA 4I6ZA 1M0TA 3RV4A 1K1QA 2BHYA 1TZLA 1OCTC 1OCCH 2YU9A 2UXNA 4HAMA 3WTWC 2VKVA 3HOYG 2WB1A 1OKRA 5DM6F 2COMA 3U1KA 3Q1KA 2NU9B 3MFKA 2YS6A 3DTKA 1BNCA 3BWGA 3MCZA 3G73A 3K4JA 1PX2A 1I50A 2E1NA 5LA6F 1IV8A 1T0FA 3RPUA 3G4SI 1YOVB 2O3FA 4L5EA 3BR0A 1SFEA 4ECRA 2PI0A 1EH8A 2G9WA 4MA0A 3BZ6A 4IHSA 2DMQA 2HTSA 1DPUA 2JA8G 3DXJF 3HKZA 2PJRB 4M3BA 3OR1C 2PMHA 1KU2A 2GPWA 4B44A 4QPQA 1TWGJ 4D0PA 3T5HA 2M9HA 3RF2A 2FPGB 4IQ4A 3RIZA 2K27A 5CVRA 2NVYJ 2E2JJ 2DYRH 2VI6A 1W0UA 4YQWA 2A5YB 3OYGA 5B1AH 2VB6A 5I47A 4G7ZF 4RS8A 2CV2A 4F3QA 2WDTA 4XIDA 4QJFA 3I55I 2IS6A 2K3FA 4NDLA 2AHQA 3BAAA 3QOPA 4CZCA 2YZNA 2PFBA 1IOVA 3MFIA 4F4XA 2DT5A 2YUSA 3GTPJ 1Z7UA 1ZQ7A 2CQXA 1P4XA 3IP4B 2R7KA 1TWHJ 3NARA 1I6UA 1FTZA 4HSRA 5L9XA 3CCRI 4HOBA 3OS2A 4Q47A 4JX4A 2IJLA 5EWFA 3PW7A 1B4AA 2HYGD 1RNLA 3E6BA 1DU6A 4UCSA 4PJLA 3N42B 4L1KA 4YP3A 1S10A 4UNOA 2VQFH 4QWCA 3PSFA 3G6YA 4EFBA 2R7XA 5KFKA 4DL5A 3I4MJ 4II3A 2VT3A 1GXPA 4UVCA 2VA2A 4WBNF 5D5WB 3FXKA 3G6XA 4E7LA 4A93G 4IAJA 2CQYA 3ORRA 3QFFA 1GUUA 3L1PA 1KGSA 4RU9A 5L1IA 1W7PB 1P9QC 1SMYF 2KPMA 3GLLA 1S6LA 3F6VA 3KXYT 2DPIA 5C4XG 3VOEA 3PW2A 5KHDA 1KU9A 2I8CA 2E5NA 3SDBA 4DYCA 1FP2A 3DPUA 3JCUC 3CTAA 2XPVA 4B3MH 1BI3A 1GT0C 2GXBA 2J6SA 3ZN1A 5E3OA 3V6KA 3MAJA 5E8GA 3GTKJ 2EV6A 1HXDA 2OLSA 1VQ6I 2IGNA 5LEJA 3ZCOA 2HOTA 4XKVA 1RYRA 1L0OC 5D8KB 2DQRA 5F9LA 1N32H 1ZGWA 4Y33A 2DI3A 1JXSA 1OYYA 4EJOA 3C7JA 3JSNA 3Q8PB 3JW4A 3ZR8X 2OH2A 1DGSA 3N97A 2IP4A 4A2UA 5ILVA 1BJZA 2I5UA 3BDDA 3BLYA 4B1RA 2KRHA 2K9QA 5HDKA 3KLNA 3DLLF 2MABA 2ID3A 1LDKB 4AIHA 2E60A 1VNDA 1IF1A 3TEDA 3MWDA 4QIWA 3M3YJ 1HNZH 2LRDA 2AU0A 2E7WA 1ZR2A 2R7NA 1EV7A 2A6HF 2LC2A 3BA8A 2JWTA 3RAXA 1JHHA 3H5AA 3IRRA 2ZFUA 3BTJA 2W8KA 3PO3G 4TUYF 2EV0A 3ZQQA 3OYLA 1U3EM 1H89C 2AXTC 3I12A 5J8CA 5IY5H 2F5CA 1MW7A 3PQJA 1XMQH 2K7LA 2ASLA 4OMYA 5LHIA 2XAFA 5KG1A 2XAQA 1Y8RB 2H6CA 3CCVI 4A3MG 5E1XA 2DPDA 4C5AA 4MTDA 2HQNA 3HSFA 5CQGA 3QPLA 1HDDC 1YYVA 4JUZA 3G6EI 2HGCA 4EYHB 3F9KA 2F5DA 1VQ9I 3FDYA 4IRHA 1XTAA 5IPAA 3V4SA 1ZYRF 1SAUA 1I6XA 3VYSB 1XDSA 1B9MA 4BQOA 1C3OA 5LGTA 3J7AO 2OQRA 4RGRA 3KEOA 5JLWA 4KITB 3MKWB 4GGGA 3JRAA 4A2BA 1X2MA 2G7UA 3D5LA 4EGZA 2CFXA 1K61A 1WZ2A 4R7RA 4LF7H 1VI0A 2DOFA 4UY8I 1F1ZA 5KFYA 3ZP5A 3I54A 2L02A 3ULQB 4YFKF 2MLGA 2KL4A 4CGZA 4A3IJ 4XZ3B 2LKSA 2ELHA 4I01A 2JPBA 4XR6A 2R85A 4BXXG 1H9GA 2VBWA 1FLIA 3DKYA 5AIQA 2VC1A 2Z9OA 2X6XA 4J00A 5KG5A 3TOAA 4RB3C 1HR0H 2R6FA 2DT6A 3WU0A 1EA3A 2KMUA 4C3IJ 4F55A 1RIOH 6PAXA 3LFKA 2K4JA 1TWCA 1WJAA 3K4BA 4ED0A 1Y0UA 1LEBA 4GYGA 2MG4A 5LMUH 1LDDA 1FBSA 2YYAA 1LPQA 5KFHA 1XCBA 4HYEA 4DV5H 4O3RA 4ZYDA 4PFOA 2BV6A 5HNFA 2GOMA 4IF4A 1J7KA 2R7FA 2YU3A 3KX2A 4EGYA 2RF4A 2W6NA 1E4GT 2LREA 5EGOB 5FPRA 2R5ZA 3FMQA 1FOXA 5KFDA 3E3VA 4V19K 1IBKH 4HNVA 2R84A 3QP6A 2FLPA 1XGOA 5KFVA 3RGXA 4DR2H 2UXXA 3E5XA 2W6QA 3FZVA 4PGHA 2VQDA 2LR8A 5H2FC 4ZC3A 1SVOA 2M4KA 4HNTA 4E6KG 1P7IA 1R5HA 3CP8A 3ZQCA 2X6YA 4MFDA 1U0JA 2MD5A 3S2DJ 2K9NA 2DFIA 2NAZA 3BG7A 5TISC 4EM2A 3RSNA 2WAQE 1O57A 2XGQA 1KQ8A 3DFGA 1W7PD 3H20A 1WKMA 2CH0A 2EZIA 2QWWA 5J1YA 4ED3A 2DLNA 3IV5A 4M3FA 4JI6H 1XGMA 2GIVA 2K3PA 1RC9A 3E97A 1W5SA 4EYIB 2UVWA 3I4NJ 3PW4A 5IP6A 1KBLA 2R92A 2XRNA 1JT0A 4X6AJ 4HA8A 4FM9A 1S29A 3DU6A 3OYMA 3PNYA 3C3WA 3DTEA 3HOVJ 1MBKA 2UU9H 1ZGJA 3S3MA 5LL6b 4LOCA 1W1WE 2LMDA 5DCMB 3OYJA 3DBHB 3R0JA 2HEOA 4XN0A 5H6QA 2ME6A 2KP6A 1VQMI 2FOWA 1ZHSA 1TP4A 3EUAA 1RK6A 3H0GA 2JTVA 1P8LA 3MEXA 1JKJB 3WG7H 4CYCB 3CESA 2FE3A 4ZI7F 4DV3H 5M3MJ 1ITYA 1SD5A 4JI7H 2JT1A 2JPCA 4RGSA 3M07A 4N9HA 3CF5F 2VPQA 3FXOA 4BACA 4YJ2F 5KT7A 1K4SA 1MSEC 4D9JA 2ZM6H 4NBQA 5BNGA 2CSOA 4XLPF 4EBCA 3CCUI 3N8DA 3CDIA 1U78A 1HKSA 4UHTA 5F1RA 2R7LA 2ZC2A 1D0YA 2RV8A 3PO2J 4LSXA 4HEA2 2Q2UA 2L7ZA 3H1CA 3I71A 2EILH 4G6QA 2R7MA 2ESNA 5GONF 1FZPB 2OF7A 3GEZA 2TDXA 3SZTA 1NTCA 2CO5A 2WAQN 2JK3A 3EYYA 3G1MA 4HSTA 4XONA 5FLVA 2LBFB 4B48A 1X3WB 2WTFA 2DIKA 5E3NA 5EEHA 1V54H 4C2MA 2OZUA 3AL0B 2ZJRF 3J81Z 1I7NA 5KT6A 4FBUA 2H09A 2ZXHA 4V2FA 3RKXA 2E2IJ 4DR6H 1ETWA 2BEOA 4BY1G 1NG6A 2CW0F 4A2AA 2CQQA 2VLAA 2EFWA 1DGWY 3FWEA 4P5OA 2ISZA 4IHJF 2ALZA 4QPOA 3RTRA 2MYSA 1R1TA 5CYVA 2GBYA 5KX5F 2BQRA 5CVIA 3DTIA 3J80Z 4I2OA 2ZKZA 2V5AA 5FRMA 1FMVA 5DG9A 1Z3XA 3TDUC 2CJJA 2XAUA 4I99C 4BL0B 2LF7A 4OIPF 4UVBA 1R4MB 1MBFA 4X65H 4YHHH 4XX0B 3LSPA 3QP5A 1IXRC 2W82A 1S0MA 4IRDA 3G8CA 2F4IA 1BI1A 1YLFA 2A05A 3M8FA 1SVLA 1X4OA 5TGTA 3ROUA 1TQMA 2LKXA 5DV5A 1XMAA 5LXTF 3ECHA 4RAYA 2N8GA 5KAIC 3GFIA 2LKPA 3M4IA 2ESHA 2W7PA 1WVRA 3LMLA 1T38A 1OWTA 4ECQA 2ICWG 4GXOA 1BIAA 1D1BA 1JJ8C 3CMMA 3F3XA 3KTMA 3H4DA 4BS9A 3TIIA 2CUJA 4GKKH 3VMMA 4HDUA 4L0YB 2M3AA 2ACJA 3D5SC 1S72I 4FX4A 2JA5J 2OPTA 3RKWA 5L1KA 2I8DA 2UUAH 1UELB 2QKLB 3BCBA 4X66H 2L7FP 4DNCA 3SI8A 1BM9A 2BVMA 1WCMJ 4B8XA 1IBMH 3IHUA 5K5QA 3OUUA 2HDWA 2FD5A 2V4RA 1TQIA 2B7EA 1JXLA 3F8MA 3L7WA 3L4KA 2ZSIB 3OTOH 5KT5A 2R7ZA 5FLMJ 1Y1WJ 4BU2A 1XS9A 4QW8A 4Y13A 3HOWJ 3FM3A 4BHBA 1TAEA 4NLGA 2X4HA 3ZQGA 1NH3A 2L9SA 3HRTA 2ZMEC 5DD4A 1MDMA 1IRXA 1R7JA 3CUQB 4BHCA 2D1HA 2LD5A 2Y0SE 1FVIA 4IPAA 5HV6A 4N4OB 4QW9A 4IRKA 1OPCA 3KPHA 3TO7A 3HXLA 3OYBA 2VUMJ 4M73A 3I5UA 3KHHA 1ZRCA 1N34H 2JEIA 2G7HA 4FS2A 1E4FT 5A2QW 3L4JA 4HR7A 1MMGA 2H94A 3M9MB 2RC4A 3LNQA 5LBQA 2XF7A 2O61A 4CYCA 1BW5A 4JI5H 1K78B 2Z3YA 1K83J 2JVHA 3M8JA 3V7RA 1TWFA 1XG1A 4UUVA 2KHMA 4XKBA 1QRYA 1T39A 5M5YJ 4U0WA 3GO5A 5D5VB 3EQLF 2IA6A 2CWEA 4M71A 1QO0D 2VPRA 5HDGA 1EH6A 1YJ9I 1YX5A 1B04A 2WAEA 3F8NA 2XAJA 2E2HJ 1GSAA 1Z2OX 2VC0A 2PMZA 5K7HA 3L9FA 2DCEA 1HLVA 3Q2OA 4UB8C 1XB4A 2KIMA 2QCOA 4NNJA 4RM2A 3KHGA 3JTHA 2R8GA 2LBFA 3M9OB 3MKLA 3OOUA 4HF1A 2OZ6A 3GFJA 4KISA 3RBEA 2W70A 2Z1DA 5C4JJ 4LFBH 3VPCA 4UCVA 1DUXC 5LHHA 1RKTA 3BP8A 2R7VA 3GLKA 4A3JG 4X1EA 5ILUA 1ZRDA 2FNAA 4AYBA 4BE2A 1U5TB 4D7NA 1VQKI 2HU9A 3LSGA 4PUSA 2D45A 4U0YA 1MIJA 3RJPA 4YAKB 1A0IA 1EKEA 2W6OA 1W0TA 4Q8EA 1U6GA 4GDFA 3P9CA 1LEAA 2QVOA 4BUPA 2VONA 4E4TA 2KZGA 2BZTA 2JEJA 1MGTA 4E7ZA 4MO7A 3EETA 5C44J 2VPSA 3SDGA 3QZ8A 1AN7A 4EM0B 2HQRA 4D1QA 3CCLI 2R8JA 3T8TA 4YFNF 4ZQIA 4TV8F 3C2BA 3A4CA 1VS0A 2NOGA 3J7YJ 3RAQA 1IAWA 2F4OB 1NK2P 1O3SA 1IN5A 2V26A 4ZYEA 2ETHA 2WWYA 5FLXK 2B63A 2HKXA 4ZYAA 2MH9A 2NVTJ 1X19A 3MJFA 4RNOA 3UQ8A 3ABTA 4HDVA 4R1HA 1LJ9A 4MLOA 1E4EA 3MR2A 1DV1A 1OR7C 2W7NA 3JSOA 2QQ8A 1BR2A 1WWXA 3WE3A 3I9V2 3LSTA 2ZDHA 2FA5A 2AQ4A 4RGXA 3PNVA 1ZHFA 4UFZA 1KQ0A 4FCYA 1MMSA 1WSUA 1TT5B 4A3BJ 2DTRA 4QLCU 1MJ9A 1WI3A 4M7EA 1X3UA 2V6CA 3OY9A 2C6YA 4BBRJ 2L3DA 1PUFA 5FFZA 4YRVA 4AWXB 3QWLA 3OIOA 4OMZA 2NUAB 4QWAA 5JQWA 1VQOI 4PJJA 3WTSC 3M4OJ 1VTNC 4ESBA 4ED6A 1YO5C 5CJ9A 3AG2H 3QU3A 3KFWX 2ZCWA 4LG0B 5KG4A 3LQQA 2HVQA 1KC7A 4LD5A 3KHRA 3CLOA 1IUFA 1OLTA 2VXDA 4NXMH 2WC2A 3GTJA 3FDSA 2FK3A 5DQHA 3TO9A 3AG3H 1F9NA 2AXLA 1YFHA 2XCAA 3BQYA 4XICA 2XGXA 1ETOA 2CQ7A 3CUQC 3VB2A 3JRDA 3S1NJ 5K7ZA 2IS4A 2VE8A 1HQCA 3CUOA 3CMEI 1S3JA 5KFJA 1F43A 1YX3A 2LP0A 2E36A 3U21A 4Y4RA 3H0DA 1B72B 4IR1A 4PJ0C 2P6TA 3GBGA 1VQ7I 2EPFA 3LA7A 2Y69H 2RDPA 4CZZA 2FQ3A 2J5OA 5GAGJ 1VQNI 2RQPA 4FISA 5IYBG 3ABMH 3HRMA 1OMIA 3CJNA 4I7HA 3G1LA 4YY3H 5FO5A 2OD5A 3L2PA 1UHSA 3OIPA 1JUSA 5J4YA 1KZHA 2C2DA 2RQQA 4JK1X 2VN2A 4D5CA 3DKWA 5EDWA 2FNPA 4UUSB 2HJWA 2W6MA 2XUBA 4DOZA 5D1OB 2X85A 2YX7A 1T56A 4I09A 2UXBH 5KFPA 1R36A 1SFKA 5K2MA 3M9NB 2IS2A 1XSVA 4ENJA 1BXRA 4C2UA 2J9GA 4BNCA 3O3KA 4KICA 3HM5A 1D0XA 1T2KA 1DQUA 1QVUA 5CQEA 3A01B 3TQ1A 2VJIA 1FSEA 2KIQA 3H36A 1OJLA 3QAHA 3PM1A 1QZEA 4N4NB 3GIIA 4KNYA 4IHVA 2YRWA 3SHFA 2R93A 2JA6A 1UJ8A 4XLNF 2MBFA 3RUPA 1XSXA 2HQ5A 5IYCJ 1A6IA 3FKIJ 3GCMA 3T5KA 5JHFA 2XASA 4A3DG 1Z2NX 3G6VA 4BWSC 4YIFA 4BXFA 2DZDA 5IP7G 3F8CA 3OL3A 4J9NA 1YITI 3KIOA 4CA0A 2K40A 1EUDB 2DA2A 1LFUP 1SYXB 4PSWA 3TOBA 3DF7A 5GTIC 2EB7A 4BYYA 3LWFA 2W85A 1XMOH 2R93G 1BI0A 3Q0VA 4BJ5C 2A3SA 1M0WA 4L5JA 4F52A 4BY7J 5KFWA 3RZDJ 3CVZA 3HC7A 4ED7A 2V79A 2FLLA 2QK4A 3WGGA 2VT2A 3RPQA 1IRGA 1S97A 4LJZF 3WGIA 1R5ID 2R7SA 5C1OA 3S1QJ 1D5VA 1VQ4I 4A6DA 4J9PA 1LKXA 5BPHA 3GF2A 3DF8A 1SAXA 2E7XA 3OYEA 3PFYA 4GFBA 2JSCA 4EATA 3GTGJ 3FKJA 4F92B 3AG1H 2WB1E 1WQ2A 4FT8A 1SD6A 2JA7A 1SANA 3BPVA 3BTCA 4QWEA 1W36D 2L5QA 5KFAA 3JSPA 4E7HA 4DBQA 3GTPA 1TNTA 1X9NA 3VODA 1IXSB 2C2RA 3GTQJ 4OWRB 1I27A 1J9IA 3TQTA 1TWHA 4J9RA 2UUCH 4B3TH 1STZA 3HSEA 1BA5A 3QQAA 2CMPA 3FXJA 1K7AA 5B66C 2V4JC 1ZK8A 2NU8B 3COAC 4M3DA 3GTOJ 1QQIA 2MCTA 3HKZE 5GAHJ 1HW1A 3KP4A 3UKGA 3QRFF 4BBSJ 2FKLA 3RYRA 3SEZA 4GCVA 1S8NA 1RPWA 1RESA 4PK4A 2QA4I 3N43B 2HZDA 4PDBA 2PN6A 2XKOA 4LFCH 3I59B 3IWFA 2JA7G 1YW9A 1JGSA 4XSXF 4XRMA 3GTLJ 3BQZA 4LB5A 4JP0A 3S8PA 1GV5A 4G9YA 3N6XA 4OINF 2K02A 4PFPA 4F50A 4ESFA 3V4GA 2R5YB 1UC9A 2STWA 4DV4H 1XPXA 2FQ4A 3HPHA 4KHPH 3X2QH 4U7CA 2JJ7A 3QYEA 1ZH5A 3OYHA 5FJ8G 3E5UA 4EG0A 3GFLA 2VKHA 5A2QK 5L1JA 2P7VB 4ECYA 2VKEA 2Y31A 2STTA 2IA1A 3UNGC 4TV7A 2ZNYA 3GIPA 4G6DA 3JSLA 2F5EA 3HOYJ 4M6XA 2VKDA 2W1OA 1S9HA 2E1CA 3T5LA 1QNTA 3JAMZ 3H9QA 1M6VA 4RGUA 1BOBA 2GLTA 5EZHA 2LTPA 5KFTA 4XK4A 2F5FA 2OAZA 1Q1VA 3O8GA 3BQ0A 2UXCH 2J6TA 5KK1A 2XKPA 2DA5A 2XDVA 3PR4A 3DV8A 3W2AA 4O3SA 3IAS2 4AUXA 1Z05A 1Z3YA 3KP6A 5IT3A 3HOZG 2R0QC 2AGQA 5IYDG 2FEZA 3M1CA 1QZYA 3E6MA 1W93A 3AG4H 1OFCX 4GRIA 3PJRA 2OQGA 3UFXB 5FD5A 3O8HA 5DG8A 3KP2A 3H5RA 4A6EA 3GTMJ 4A0XA 5D4SA 3VFZA 1W96A 3GZNB 3CCJI 5KKNB 4WCGA 3T5JA 5C8YF 2M87A 2XGEA 4EGJA 2A6EF 3H3VK 5J1UA 4OAZA 2X6WA 2ECCA 5HBRB 1OCRH 2CU7A 2PMUA 2EFOA 5KFOA 5LRSA 5JHUA 2HYJA 4M6VA 3RV3A 2LY1A 2QUFA 4HV5A 3IKTA 2R7WA 4I4TF 5DCFA 2ELJA 4O4IF 2L7KA 1I39A 2Z99A 2IEKA 1MH3A 2LDUA 4FHTA 4Z6YA 1Z21A 2M05A 4HG2A 1R71A 2EZHA 3C1DA 4QIWE 1N77A 4J9QA 2JUCA 2DMNA 3CJTB 4YR2A 3HG9A 1MKMA 2JMWA 1ETYA 3KZYA 3BC8A 2FUG2 2NVUB 1RUNA 2XC7A 4IRCA 5J4VA 5J3LA 5LYJF 3K4NA 5FGMA 3E5QA 3AFHA 2W71A 4LFAH 2VQCA 5FD6A 2WY7Q 4A93J 1MD0A 4CXFA 4A3CG 1P4WA 3R61A 1SD4A 3TMOA 1T8IA 3JRHA 5C4XJ 1IO2A 3FXMA 1YS7A 3OYDA 1FKAH 3R60A 2GA1A 2PVPA 2K86A 2FMYA 4A3LG 5HOOA 4NB5A 2QQAA 4S05A 2YS7A 5GADJ 1HCRA 3WO1A 5FFXA 2BXYA 1VQPI 3L2RA 2GAUA 4XLEA 4JI4H 5EWGA 3N40P 2CS3A 2DJNA 4KT6A 2M45A 3CCQI 2GM4A 3DEEA 4N9IA 1VAJA 2XGCA 4Q4ZF 3Q3SA 3OYAA 3ZMVA 5L3CA 1N33H 4HX4A 5E17F 2V9WA 2X51A 2PJRA 1YE9A 3MZYA 3GXOA 1XDNA 4I55F 5DGAA 2J6UA 1GGOA 4F4YA 3GQCA 1ZELA 4YELA 1VQLI 3KLOA 5C5JA 2OCEA 1TA8A 2M5WA 2P5KA 1SFOJ 3HSRA 2BVLA 1BOAA
chains in the Genus database with same CATH topology
3U2RA 1XSDA 5IT9Z 4I0BA 4HF2A 3ELKA 3GZ6A 4IXAA 3AAFA 4KN7X 4DV1H 5DUKA 1Z6RA 5LGNA 2KJBA 2DK8A 3HOTA 1RUOA 3WGHA 3D0SA 4I0AA 3KEQA 1J5EH 4HLXA 1S7AA 3BY6A 1IN7A 2HS5A 2IW5A 4IRGA 2QBYB 5ERIA 2FBKA 1BJAA 2IRFG 1W7PA 1HKTA 2P5VA 1MZBA 1C0WA 1FP1D 3GLXA 3FHZA 5CVVA 1HNXH 4UCTA 1HBXG 5L3DA 3MQ0A 1CF7B 4S04A 4A5MA 1K79A 2YR2A 1SEIA 2J5PA 4M74A 2Y48A 4YIIA 5FLXZ 1TNSA 2IA2A 2P8TA 4HX8A 1FNNA 4A0YA 2ZMEB 4WXHA 4LF4H 2HR3A 4EJWA 4RZQA 2L01A 4XBFA 4KIFA 1OYIA 2HGSA 5DUIA 4OX9H 3GVAA 5TJJA 1N36H 2HVRA 5KVRA 2UXDH 2FF4A 1H9TA 2QZ8A 4UCOA 2EFQA 3HOSA 1D8KA 3F23A 4IJAA 3OOPA 3B73A 3PN1A 4RAZA 4WWCA 2A07F 3WTXC 4G7HF 1V4RA 2DBBA 4OOIA 1D8JA 2OA4A 2PLYA 1NHAA 5D5UB 2M30A 3J81W 4M9XA 4HW0A 1S68A 2MC3A 4LLLA 4GKJH 3O2PE 3E6DA 3P9KA 1I5ZA 4OIOF 2EJRA 3J80W 4L9NA 1G3TA 1UHMA 4UV8A 1P92A 2P6SA 2FBIA 1DPRA 4PCQA 4RB0A 2EWNA 2JZYA 4WK8F 1HKQA 3ZPLA 3WTYC 5L3EA 3RTXA 2RGRA 1KQ9A 1HW5A 2DK5A 2JRTA 3EDPA 5L3BA 1K6OA 4LH6A 3RI4A 1CF7A 4LK0F 3BPXA 4DQ2A 3QU6A 1S03G 5E1ZB 2NNYA 2VODA 4JI3H 1IW7F 2NRAC 3KALA 2NS0A 1PDNC 4CC5A 5K5OA 2ZBKA 2LSOA 3EUHA 3ZN0A 2HDCA 1FX7A 3ECOA 1JHFA 4KMFA 1BGWA 3K69A 3V7CA 4DR4H 1BI2A 3N4MA 1KYWA 1XD7A 3HRUA 3HRSA 5DCMA 1FOKA 4JI0H 2FU4A 4AIKA 4KIBA 4B3RH 3KETA 2ZXJA 4GYIA 4PDKA 2KJCA 2YX4A 1XCVA 5HVQC 2VBZA 5DEQA 4BXUA 4ZYGA 3B02A 4IVNA 3FXUA 4L9TA 4M6YA 4L0ZB 2CG4A 4X62H 3WTUC 3FXQA 4LSAA 2O6GE 3KCCA 4PGGA 4MGRA 5J6XA 4APMA 1O7LA 2ZFWA 5HS8A 2ADUA 3BJOA 2FOKA 2A68F 2Q8KA 2HFHA 3BA9A 2FSWA 1FJGH 1KYZA 1XN7A 3FM5A 5BOXA 1J5YA 3GWZA 1BJTA 1Z2PX 2IPQX 5BPIA 4KFCA 5LMNH 2W24A 4DV7H 5E1WA 4DR1H 4LF6H 5BMZA 4MHGA 2BGCA 1R22A 3IKVA 1USSA 2FXAA 2CGPA 1S7OA 2DLLA 5ICGA 4ZZDA 3IL2A 4U7DA 3T1HH 1PP7U 1F5TA 4Y17A 3DPTA 3F8BA 3GFMA 4BQAA 2UUBH 3DQVC 1DP7P 2XV4S 3FXRA 1PP8F 2L4AA 5DD8A 1WI9A 4LGWA 3GUDA 3DPLC 4ENNA 1USTA 2DPUA 1FYKA 5D8LB 2LNBA 3CUQA 5ILSA 1JE8A 4EJVA 2VBXA 3ABUA 1FBUA 3SFZA 3T0YA 1G3WA 4Q48A 1ON2A 4XRFA 3CDHA 1XNQH 4ON0A 4DR7H 4U88A 1K78A 3FX3A 1FY7A 3U9GA 1B59A 5HS9A 2VE9A 2Y0MA 2WE6A 1ZLKA 4ETSA 4QWQA 3KAKA 2OU2A 1UFMA 2BBYA 3PFIA 4ZH4F 4AQYH 5HDNA 4JV5H 2F2EA 1BN5A 2MLKA 3GYHX 2XHKA 3BOQA 3HIFA 1QZZA 4G7OF 1IZ1A 1LDJA 4E70A 1W5TA 3J81K 1U5TA 4NHJA 1UHWA 3K9TA 1R00A 2K4BA 5LHGA 4P9UA 4ENKA 3R0AA 4DV6H 1FYMA 5JR3A 1FT9A 3WTVC 4ZZLA 4MV9A 1YQAA 3T1YH 3E6CC 1YIOA 4EQQA 3R6SA 1FWZA 3NQOA 1O3RA 1HNWH 4KT5C 1G3YA 4RB2C 2PQ8A 4YFXF 4O5VA 1O75A 2W84A 4DR3H 3P9IA 2Q2TA 2FMLA 1LVAA 3F22A 2XROA 2Y75A 3JTGA 1Z6TA 1TTYA 3Q9VA 2UZKA 3HTUA 3ZMTA 4RB1A 2CQKA 4LF8H 3HHHA 3ISPA 3NRVA 4KN4X 4M9SA 3KP5A 2F4VH 3LAPA 4ASNA 2A69F 2IA0A 4MV7A 3C18A 4MNUA 1ZRFA 4LG0A 2VQEH 5JVTA 3KZZA 3T1BA 3SQNA 1PUEE 2GXGA 2OWOA 1P4AA 3V7SA 1HW2A 1BIBA 4PZJA 4X64H 5F6FA 4HZFA 3SXYA 2CW7A 4JI1H 5D6FA 3N44B 2Z33A 1J59A 1B9NA 3K3VA 4LLGF 2YCHA 2L54A 1QBJA 3JAMW 1IN4A 4UXNA 4MEYF 3ZMZA 5H6RA 2OBPA 4LLNA 1FSHA 4EV0A 5E8IA 5D1OA 2M1BA 5BS6A 3RDIA 3LAJA 4DUZH 1G4DA 2RGVA 3O6BB 4Y15A 1J0RA 2VOPA 5AONA 2QLZA 2NNNA 3FMRA 1ODDA 4HBLA 2WV0A 4M72A 2LF8A 3GW2A 4LMYA 1I1SA 5DYMA 3H3UA 4CHUA 3I0TA 1AOYA 4KYWA 1LQ1A 4WXCA 2DU9A 3G3ZA 2VOOA 5FPOA 5ICFA 4EJTA 3RJ0A 3U1DA 2V1UA 4FX0A 1UB9A 1B6AA 2O8XA 2QYOA 2VBYA 2EK5A 2WYOA 4IHTA 3WTZA 1QGPA 3F6OA 3T8RA 2H27A 2P4WA 3KAJA 3DEUA 5BR8H 1FC3A 1R23A 3I4PA 1E2XA 1BC8C 3GX4X 5BQTA 2PEXA 2HKOA 1O7FA 2B0LA 3P7NA 2KSWA 3ML6A 3FMAA 1I94H 3M1EA 5CLSA 4R79A 3TDZC 3BROA 4K2EA 4WX9A 2YPRA 3HTSB 4ZYHA 3L2CA 1LB2A 1Z91A 4AD9A 3C0FB 2P7CB 3I59A 3REOA 2HOEA 3WG9A 5IT9W 1BBYA 1ZLJA 4KIGA 5L3FA 4JI2H 1TW3A 1HSJA 4I02A 1RI7A 3WU1B 2HWVA 2W25A 1J2XA 3OV8A 4OIQF 1MJBA 3I53A 3RKYA 4LF9H 3V8LA 2V9VA 3QPHA 1H0MA 4KMUX 5HLGA 3EYIA 2GA2A 2NYXA 3WE2A 2HTJA 5ICCA 4L9JA 4P55A 4HQEA 3VEPA 2GZWA 1T6SA 2RKHA 1R58A 4WF2A 4KUMA 5K1YA 4LF5H 4LH7A 1P6RA 3MWMA 5FLXW 1XNRH 4BAYA 2P5LC 1KA8A 4JBAA 1WH2A 4CYDA 2HHHH 2VXZA 4BHPA 3K0LA 3V8KA 5D6EA 5E20A 5CVUA 2UWMA 1GHCA 2IP2A 4EEQA 3Q5FA 3FF5A 2D2WA 1V3FA 2EFNA 4JQFA 2HVSA 1MJAA 3ZMUA 4U0VA 5DDGA 5K5RA 2RN7A 2EFPA 3K1MA 1QPMA 4YG2F 4M9ZA 2V1XA 4KA4A 4XSZF 1Q1HA 4UV9A 1YG2A 3TO6A 2ZNZA 1MDMB 2VOBA 5CVJA 2EV5A 3KP3A 4O3MA 4O6JA 2YSRA 5HLHA 1YW8A 2QQBA 4ESJA 2EA4A 2PBIA 4L18B 1UCRA 2R3SA 4U7BA 3SZPA 1L2ZA 1D3YA 3S2WA 4I98B 1XGSA 1IN8A 4EVIA 3JAMK 3GZ5A 3BJ6A 2KRFA 1REPC 1GYFA 2QQ9A 1R1VA 4K0KH 3F72A 2AS5F 4L9VA 2R7DA 4MTEA 2O0YA 2XVCA 4CDGA 5F64A 2QM3A 2V1DA 2QBYA 4MEXF 2QENA 2MH2A 2A61A 3L00A 1E17A 3LA3A 4HQMA 1Z1DA 2FRHA 1HSTA 3K2ZA 1IUYA 4EJUA 4F7ZA 3TQNA 4OU0A 2GWRA 1B1BA 5LRRA 3PQKA 1SMTA 4A12A 4MQVA 2HZTA 5FB2A 2ZMEA 2PG4A 5LLQA 1LNWA 1R5GA 1Z9CA 3IC7A 3K1NA 2IT0A 4AVPA 3H92A 4N0BA 1L3LA 5J8FA 2RNJA 3RYPA 2HYFA 3RIRA 5LEKA 4ENMA 2PJPA 5JI6A 4J0MA 4A5NA 4NXNH 1IBLH 4LK1F 3LA2A 4LB6B 2ZJ2A 2E5LH 3V8JA 4CO8A 3WODF 3T5XA 3DP7A 1ONVA 4DUYH 1ZGAA 3J7AK 2MA3A 1ZG3A 3NEUA 5ICEA 2XAGA 3M8EA 4DR5H 5IT9K 1SD7A 5A2QZ 1FBQA 2DW4A 3WTTC 1IN6A 3N41B 2M8EA 3TKYA 1CGPA 2ISYA 3ZMDA 2RVCA 4G94A 4B09A 1DDNA 1IRFA 4IRIA 1RZ4A 3ERED 3I58A 5H20A 3W6JB 4R8HA 2X0LA 1OR7A 1G6NA 2XIGA 3IG0A 1V9PA 4A0ZA 4DV2H 2ZO4A 1GXQA 3MZHA 1ULYA 2ZJTA 3IRQA 3Q9SA 4UVAA 5HS7A 1U2WA 1O3QA 4KDPA 3BJAA 2IVMA 3HYIA 1XGNA 4AIJA 4GO1A 3ZQ7A 1IXCA 4UCRA 2KIUA 3I64A 1U8RA 1J75A 2W57A 3IWZA 2CYYA 1G3SA 1SFXA 4L5IA 1XDUA 3R4KA 5D1PA 3KE2A 3KP7A 4EMSA 5TRDA 4OIRF 3L09A 3K1PA 4HV6A 1AWCA 4UCUA 5EEGA 1ZG5A 3TGNA 1XMKA 4H0EA 1P2FA 5BPDA 3M9AA 4Z2YA 2DO7A 4EM1A 3BABA 3FMSA 2WTEA 4B3SH 2BE5F 5IWAH 3ZMSA 2EA2A 2CW8A 5AIPA 5E18F 3RGZA 1TW2A 3F8FA 5EOYA 1EH7A 1YS6A 3HHGA 4Q5SF 4WXDA 1TLHB 4HLYA 1ZAOA 2O03A 2FBHA 5LGUA 5L3GA 2D1VA 3CO7C 1SFUA 5D4RA 3QPTA 4BH9A 5JFRA 2Q2EA 3HUGA 1TQPA 3J80K 1YW7A 1WRJA 1R1UA 1ZN2A 1ON1A 3W6KB 5ED4A 5HLIA 1KU3A 2Z5UA 2DAOA 1T98A 1F4KA 1FYLA 4P9FA 1U5TC 1ZREA 2BYVE 3M7GA 4GLXA 3LQRA 4HX7A 1TBXA 1A04A 2H6BA 5D5XB 4LFUA 4MQ9F 3H3ZA 4Q0YA 2L4MA 2GQQA 1ZARA 2XAHA 4NQWA 4P96A 4JYAH 1ZHQA 1I1GA 3F21A 4EFEA 2DQLA 4CICA 1YTYA 1GVJA 2KKOA 4CC6A 1KU7A 1W4MA 2KIFA 1FPQA 3CO6C 2Q0OA 1O3TA 1BC7C 1ZG1A 4G8XA 4HF0A 2VUGA 1OYWA 1M0TA 2UXNA 4HAMA 3WTWC 1OKRA 2COMA 3MFKA 3BWGA 3MCZA 3G73A 2E1NA 1T0FA 3RPUA 2O3FA 1SFEA 2PI0A 1EH8A 2G9WA 3BZ6A 4IHSA 2HTSA 1DPUA