3EYYA

Structural basis for the specialization of nur, a nickel-specific fur homologue, in metal sensing and dna recognition
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
STDWKSDLRQRGYRLTPQRQLVLEAVDTLEHATPDDILGEVRKTASGINISTVYRTLELLEELGLVSHAHLGHGAPTYHLADRHHHIHLVCRDCTNVIEADLSVAADFTAKLREQFGFDTDMKHFAIFGRCES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for the specialization of Nur, a nickel-specific Fur homolog, in metal sensing and DNA recognition
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport
molecule keywords Putative iron uptake regulatory protein
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eyyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3eyyA02
1R58A 1BOAA 5FGMA 5J8FA 2PG4A 2Q2EA 2E1NA 1MD0A 4EJOA 2EV0A 2O3FA 1QQIA 3RPQA 2EV5A 3HHGA 4EGYA 2EJRA 4KIGA 1RI7A 1IN8A 3D5LA 4LJZF 1SD6A 2J5OA 1ULYA 5ICCA 4O6JA 4G6DA 4A12A 2LF8A 2ZXJA 3ZMSA 4L0YB 1ZGAA 4HF2A 4HBLA 3KCCA 2PI0A 5FO5A 1G6NA 1IXRC 2PMUA 2XASA 4XSXF 1U3EM 5BMZA 1DPUA 1O7LA 3M8EA 4ON0A 4HX8A 4YFXF 5ICEA 4GXOA 1U78A 1USSA 4EJVA 1B9MA 1D3YA 1FOKA 3TO9A 4WF2A 4A6DA 1IW7F 2HS5A 2MH2A 2PLYA 2DPDA 4P5OA 1ZH5A 3L9FA 5BOXA 2DQRA 3BOQA 3LA2A 1WSUA 4RGRA 2DTRA 2JRTA 5HVQC 1KQ9A 3QP6A 1T0FA 2X0LA 2FMYA 2Y48A 4HX4A 5HS7A 3MZHA 1FBQA 1W5TA 3F22A 5BPDA 1FC3A 4L9JA 4KN4X 5EEGA 1RUOA 3F23A 1UHMA 3FXQA 3TQNA 4N9HA 2AXLA 2NAZA 5J6XA 3DPTA 2G7UA 2A69F 2DFIA 4B09A 1RNLA 1KU3A 2QQ9A 3KEQA 1XGMA 3HIFA 3AAFA 1TW3A 1HQCA 1OMIA 2NNYA 4EM1A 3L09A 3IC7A 1QGPA 5LGUA 3I71A 3I64A 4OIRF 3K0LA 5E8GA 5D6FA 1ZLJA 2TDXA 2FRHA 5BQTA 1R1VA 1FP1D 4KIBA 5JHUA 1BI1A 4GYIA 1MZBA 3CDHA 3GUDA 1W4MA 4G8XA 1USTA 3BY6A 2HQRA 2HYFA 3ZPLA 4PCQA 4BQAA 1ZN2A 1HSJA 3WU0A 1BC8C 1J59A 3RYRA 4XSZF 4P9UA 4AIKA 1XMKA 3ERED 4LGWA 5ICFA 4EQQA 3KP5A 5CVRA 1S3JA 2ESNA 1YFHA 3LA3A 4L9VA 1YTYA 1LQ1A 1YW7A 2HDCA 1K6OA 4Y13A 4OINF 3CUQC 5JR3A 2CFXA 2PMHA 3E97A 4K2EA 2MA3A 2QVOA 1AOYA 2QLZA 2P5VA 1FNNA 1GVJA 1J2XA 2W57A 1ZRDA 3M1EA 3WTSC 1NHAA 1U2WA 1S6LA 4M9XA 4IRGA 1R1UA 2RN7A 1LJ9A 3GYHX 3Q9VA 5F1RA 1MKMA 2P4WA 2R3SA 3LQQA 2W25A 3D0SA 3RI4A 4JK1X 3F8CA 2HWVA 1Z7UA 2NRAC 3I54A 3CTAA 1E2XA 3M9AA 5LRRA 2VBYA 4M73A 1HW5A 4S05A 2VONA 4M72A 2COMA 2XAQA 2K27A 1ZG1A 2B0LA 1X3UA 2L54A 4KMFA 4Z2YA 1FBUA 2XV4S 4EVIA 1FLIA 2R7DA 3QAHA 2GXBA 1KA8A 1YW8A 1IF1A 3BZ6A 1HKSA 2QZ8A 2ZFWA 5L3EA 2VC1A 5JFRA 1F9NA 2ZKZA 2L02A 3BP8A 3RKXA 1HKTA 5E18F 2Q0OA 1YLFA 4ASNA 3RYPA 1E17A 1YS7A 3BPVA 1ZHFA 3PFIA 4FX0A 1OR7A 4A0YA 4WCGA 1B6AA 3E6MA 1W7PB 4KFCA 2GQQA 2ZO4A 3KP3A 2XRNA 1IXSB 5E1ZB 3GWZA 1YYVA 3R0JA 2RVCA 5ERIA 2OBPA 4AWXB 1KYZA 4HAMA 1F5TA 2A61A 1FYKA 4MEYF 1XSXA 4U0WA 1DDNA 2ZNYA 2MH9A 4IXAA 2OQRA 1GXPA 3VB2A 2VBWA 3P9IA 2MBFA 2DT5A 2DLLA 4ZZLA 3WGHA 2EWNA 3ABUA 4I0BA 4NQWA 3IRQA 2HQNA 1Z9CA 1F4KA 4LB6B 4YIFA 3VODA 1EH7A 1VTNC 4Q47A 4ETSA 4OIOF 1S7OA 4P55A 5L3GA 4UHTA 3ZMVA 2PQ8A 2HEOA 1R7JA 2EA2A 4HV5A 5BS6A 1XCBA 1T39A 1EH8A 1SD7A 1FYMA 2GWRA 4ZYHA 1LDDA 2DW4A 1FX7A 4R79A 4EGZA 2P5LC 1S8NA 1ZYRF 3WE3A 1UHWA 3REOA 1BM9A 2XAFA 2IA0A 2BV6A 2BBYA 4WXDA 1G3SA 2E7XA 3WGIA 4IRIA 1G3TA 3HUGA 1W5SA 3HRMA 5LRSA 5H6RA 2CQKA 1XD7A 3WE2A 2V1DA 3MWMA 2GAUA 2CGPA 2NS0A 1O3RA 3V8JA 1TTYA 2M8EA 1KU7A 1GXQA 3BJOA 1XGSA 4UXNA 5ILUA 3R60A 2FEZA 1FPQA 1YS6A 5FLXK 3V7CA 1TQMA 3V8LA 1XGOA 2CW0F 4D0PA 2CG4A 2OAZA 5IT3A 4QLCU 5E1XA 4HOBA 5E17F 1WRJA 2Q8KA 4KUMA 1BI2A 4CO8A 2DPUA 1DP7P 1I5ZA 1IN4A 4G7OF 2JT1A 3W6KB 4U0YA 4YIIA 2DQLA 1ZLKA 3HTUA 4LLGF 4HZFA 1ZARA 4M9ZA 1T98A 4RS8A 3ELKA 2O0YA 4TV7A 2FMLA 2BYVE 2DAOA 4BAYA 1WKMA 1IN6A 3O2PE 3E5QA 3DV8A 3F8FA 2VBXA 4HDVA 1P4WA 2UXXA 5E1WA 3CJNA 4KT5C 2LNBA 2MD5A 1RUNA 2EA4A 4BXUA 5L3BA 1MDMA 3DF8A 5HS9A 3N97A 4EJTA 1OPCA 4R8HA 1H0MA 1I1SA 3T8TA 1I6XA 4PGHA 3QRFF 3JAMZ 2E7WA 5CVJA 4RB1A 1TQPA 3RDIA 5K5QA 2H94A 2D1HA 4B8XA 2YX7A 4HA8A 4ENJA 3HSEA 5HOOA 4MEXF 3TOAA 3J81K 4A0XA 3GFLA 5JVTA 2FBKA 2DK8A 1TNTA 3LSTA 3SZPA 3RKYA 3MAJA 1G3YA 1B9NA 4I2OA 5DD4A 3GXOA 1K78B 4LD5A 4XLNF 2VXZA 4AIJA 1W7PA 5IT9Z 1FY7A 4LFUA 2FBHA 3K2ZA 2D1VA 4P9FA 2O8XA 2XAJA 3F8BA 4JBAA 4N0BA 4U88A 3U2RA 3IWFA 1XGNA 1DUXC 4AIHA 4KA4A 3E6CC 3OOPA 4EMSA 1K79A 2M1BA 1SFUA 4ZYEA 1IN7A 2LF7A 3ZMTA 4EJUA 4GYGA 3LFKA 1U6GA 2QWWA 4ESJA 4WX9A 3P9CA 3RIRA 5DCMB 2A3SA 2YSRA 3S2WA 3ABTA 2HTJA 1ZG5A 5DUIA 1O7FA 4DNCA 2FNAA 1D8JA 3NRVA 3T1BA 3TO6A 5KVRA 3VOEA 2GXGA 3H3ZA 2W84A 5BPIA 2VE9A 2F5EA 4MGRA 3GF2A 3J80K 5H6QA 5FFXA 4IPAA 2IA2A 2ZNZA 2ZMEB 3RTRA 1Z91A 3IWZA 3TDUC 4UNOA 1J75A 2QBYB 1R22A 2F5FA 2JPBA 2FA5A 3WTWC 2LKPA 5E20A 1LVAA 1B59A 1U8RA 2FU4A 2IT0A 2M45A 1SD5A 2OQGA 4BHPA 1ZAOA 4MQ9F 4BYYA 1JXSA 3GO5A 2L4AA 3E6DA 3F3XA 3I5UA 3IHUA 1F1ZA 4PZJA 1I1GA 1J7KA 1V4RA 3R0AA 2V79A 1MJBA 2QUFA 2VT2A 1UB9A 4YFNF 4HLXA 2NYXA 2P7CB 3ZMUA 4LK1F 4RB2C 4S04A 1D5VA 2XAHA 3Q5FA 1HW1A 1LB2A 4BNCA 1WI9A 1TBXA 4OU0A 1R00A 4L9TA 2E1CA 3JSPA 3FMQA 2EFQA 3JSOA 4PGGA 4FX4A 4A2UA 5K5RA 3DPLC 3SQNA 4L5IA 2ZBKA 4U7DA 4HDUA 1IRFA 1HBXG 3TDZC 3WTYC 3EQLF 1XDSA 4EV0A 1J9IA 2K7LA 3KFWX 3C18A 3I58A 5LHGA 3DKWA 3EYIA 1R5HA 2D45A 1LDJA 4XBFA 4CYDA 3MQ0A 1SMYF 1PDNC 2Y0MA 5H20A 2PEXA 3FF5A 2P7VB 5TRDA 4ZZDA 4Q4ZF 2O03A 1G3WA 3P9KA 3GZ6A 2WC2A 3GVAA 2UXNA 4A6EA 1ZGJA 2UWMA 1IUYA 4LMYA 1OYIA 4M6YA 2EFOA 5ILSA 2H6BA 4I7HA 3KLOA 5DDGA 1WWXA 2ACJA 2G9WA 3HTSB 5A2QZ 2J5PA 3LAPA 3VEPA 1YO5C 1HW2A 3GW2A 4GGGA 2A5YB 4EM2A 2P8TA 4OIPF 5DCFA 2JPCA 1REPC 3I4PA 1XN7A 2V9VA 4MTEA 4UV8A 1YG2A 4ESBA 2RKHA 3NEUA 4FHTA 1BBYA 3JTHA 5CYVA 1L0OC 4HQMA 2VOPA 2EB7A 2DBBA 2HFHA 4I0AA 3E5XA 4NHJA 2XVCA 5FLXZ 4G7HF 2HYGD 2ISZA 3F6OA 4L0ZB 4HF1A 1RIOH 3F8MA 5HDNA 1PP7U 3FWEA 2VE8A 4LG0A 5LLQA 4KICA 2XIGA 3KE2A 2XHKA 3KP6A 3GFIA 3PQKA 3RJPA 2H09A 2GIVA 5CJ9A 1RZ4A 5ICGA 4HX7A 3IL2A 3GZ5A 4G94A 5CVIA 1S7AA 3WODF 2O6GE 2DK5A 4KMUX 4IF4A 5HLGA 4RGXA 2OA4A 3QPHA 4RGSA 5AIQA 1O3SA 2EV6A 1IN5A 2JSCA 3L00A 3MCZA 1EH6A 2VC0A 2YPRA 4HQEA 2WV0A 4OIQF 2EFPA 1KU2A 2BE5F 2ISYA 2VODA 2KJCA 3LQRA 1YIOA 3F21A 3T5XA 3BPXA 4HYEA 3K1NA 2RDPA 4UVCA 3DFGA 5HLIA 3SFZA 2FE3A 1KGSA 3WTZA 5LEJA 3BWGA 2A6EF 4A5NA 3ROUA 1D8KA 1FZPB 3HSFA 3WG9A 5HDKA 2DO7A 5LGNA 1KYWA 1ZRCA 4IHSA 3V8KA 3R61A 3BDDA 4E70A 2HOEA 5LEKA 2IPQX 1P4AA 4L9NA 5F64A 3TOBA 2PJPA 2QM3A 4DQ2A 3HYIA 2L4MA 2G7HA 1BI0A 2H6CA 4OMZA 3EYYA 3EETA 5D5XB 3F6VA 1P92A 4U7BA 2OD5A 1G4DA 2X4HA 5AONA 1P6RA 2V6CA 2QYOA 1ONVA 3JW4A 4JQFA 2QBYA 1BIAA 2QQBA 1P4XA 2YR2A 3BROA 3SXYA 4EM0B 2STWA 1ON1A 5FB2A 4WXHA 3FMRA 2OU2A 3U9GA 3M7GA 1OYYA 4Y15A 5L3DA 3WTUC 2D2WA 2HR3A 3I53A 2F5DA 3VFZA 4ENNA 5DD8A 1TLHB 2VN2A 1YQAA 3FMSA 1MGTA 1Q1HA 1LNWA 1FBSA 3CO7C 2YU3A 2QQAA 3I0TA 3TKYA 2Z99A 2FOKA 3E5UA 5KK1A 1H9TA 1PUEE 3TGNA 2IRFG 2OZUA 2P6TA 2XUBA 2HKOA 1FP2A 3DEUA 4WXCA 1XSVA 4RAYA 4FT8A 4CDGA 1OKRA 2RGVA 4U0VA 4M71A 3I59B 2GZWA 2F2EA 2ELHA 1JE8A 3GLXA 1A04A 1BI3A 4I02A 1KU9A 4LB5A 1IRGA 2C6YA 3C7JA 3FX3A 3QOPA 4HV6A 3ZN1A 4GO1A 2KIUA 2KKOA 2FF4A 4OMYA 3FHZA 1J5YA 1TNSA 4QWQA 3WU1B 1XB4A 1OYWA 3DXJF 2AS5F 3C1DA 5LHHA 3KETA 3V4GA 3HHHA 1R23A 4O5VA 2ZMEA 1BIBA 2XKPA 2PFBA 1P2FA 2ZJ2A 2L3DA 2KJBA 1MDMB 3QPTA 3EDPA 4ZH4F 1W7PD 3BJ6A 1B4AA 1SFEA 2KIFA 2KRFA 5CLSA 3LAJA 4UV9A 1R5GA 1QNTA 3RPUA 1TW2A 1MJAA 3O6BB 1LEAA 2OZ6A 3CUQB 4G9YA 2A6HF 4MNUA 5D8LB 3GEZA 2STTA 5D5VB 1C0WA 1O3TA 2FNPA 1UFMA 2HTSA 5DYMA 1FYLA 2GA1A 3K1MA 2L01A 2BEOA 3CLOA 2R7FA 2JTVA 2RV8A 4HF0A 3ML6A 4G6QA 5CVVA 3T0YA 2MLGA 4O3MA 2K4BA 5FD6A 2VT3A 1S29A 3M8FA 5AIPA 2K4JA 3HSRA 1R36A 2FBIA 4YFKF 4UVAA 2K86A 5LHIA 4KNYA 1SFXA 5D5UB 3KZZA 3ZP5A 1H9GA 3N4MA 1STZA 3KEOA 2VOOA 1T38A 6PAXA 4M74A 3O3KA 3IRRA 1ON2A 2W24A 3OV8A 1V3FA 1FSHA 3WTTC 4UVBA 3J7AO 2Z9OA 1JGSA 4ZYGA 3Q9SA 1HSTA 2CO5A 5LGTA 2HZTA 4NB5A 2WWYA 2JZYA 5A2QK 2CSOA 3SHFA 4WWCA 1GHCA 2EK5A 3ZMZA 1HXDA 1IAWA 2ESHA 2M30A 5ILVA 4CXFA 2KIMA 2XGXA 1DPRA 3E6BA 5D6EA 5K1YA 5D8KB 1CF7A 4LLLA 3J80Z 2IW5A 3R4KA 4H0EA 2K02A 3H3UA 1FSEA 4IRHA 2V1UA 1K78A 4RGUA 4M6XA 1Z1DA 4BH9A 3F8NA 3FM5A 3L7WA 2FXAA 3COAC 2DI3A 2O61A 3R6SA 3DP7A 4RB3C 1FT9A 4KIFA 4MHGA 1KQ0A 2P6SA 4RB0A 2XROA 4XRFA 3MZYA 4PDKA 3B02A 3ECHA 4BHBA 5D5WB 1QO0D 5L3CA 1U5TC 1AWCA 1XSDA 2RNJA 4CGZA 4Q48A 4EJWA 2ZCWA 4HW0A 2XKOA 2DU9A 4I09A 2CYYA 4ENKA 2RQPA 3K69A 5IT9K 1XCVA 4OOIA 5DV5A 5ED4A 5EEHA 3KP4A 3NQOA 3FXUA 3FZVA 1K7AA 3U1DA 3G73A 4BHCA 2IP2A 2Y75A 3ISPA 1MJ9A 5JI6A 2WTEA 5HS8A 5DUKA 3K1PA 1Z6TA 1BN5A 2FSWA 3J81Z 3V7RA 4IHTA 1Z05A 1XDUA 4AVPA 3ZN0A 4L5JA 1CF7B 2CWEA 3LWFA 3JAMK 1PP8F 4WK8F 1LDKB 3QU3A 1Y0UA 3HOSA 4M9SA 1QPMA 2IA1A 3CUQA 4HLYA 3WTXC 1QZZA 1ZREA 2IJLA 4A5MA 3CO6C 3EUHA 2BGCA 3WTVC 4UUVA 4I01A 2GA2A 3V7SA 2Z3YA 2XAGA 4LK0F 1QBJA 1R1TA 5E8IA 1I27A 2V1XA 2NNNA 3ULQB 2PBIA 3FM3A 3ECOA 3H92A 2F5CA 5TJJA 1O57A 4XLPF 2UZKA 3WGGA 2HKXA 3ZQ7A 3MFKA 2MLKA 4P96A 3QP5A 5CVUA 3BJAA 2MC3A 3RKWA 3W6JB 1B1BA 5FFZA 2RC4A 1T6SA 3LA7A 4IVNA 1SAXA 2M87A 3CUOA 3JTGA 4G7ZF 2Z33A 2A68F 1FWZA 2LSOA 3PQJA 1SD4A 1JHFA 1QZYA 1U5TA 1O3QA 1BC7C 3IKVA 1UCRA 4Q5SF 5D4RA 4MQVA 3SZTA 2W85A 4CICA 3KP2A 2PN6A 1ZRFA 3GFJA 1L3LA 1J0RA 1WQ2A 1EV7A 4LLNA 3HRTA 2ADUA 3IKTA 2M5WA 1Z6RA 3F72A 4GCVA 3C3WA 4ENMA 3HRUA 4N9IA 5F6FA 5K5OA 1ODDA 3TO7A 1T2KA 4MTDA 2A07F 4KN7X 4KDPA 1IZ1A 5LBQA 4ESFA 2P5KA 1TQIA 3HOTA 1JHHA 2IVMA 3MEXA 4AD9A 4KYWA 3GFMA 5HLHA 1YW9A 2FQ3A 4F7ZA 1KQ8A 4CZZA 2LDUA 1BJAA 3KZYA 4IJAA 4CHUA 1HKQA 3G3ZA 3ZMDA 2VBZA 1CGPA 3K9TA 3I59A 3HRSA 4YG2F 1SMTA 3T8RA 4Y17A 1LEBA 2EFNA 3L2CA 4R1HA 5L3FA 5FD5A 3FXRA 3GX4X 3B73A 5D4SA 2EFWA 1ZG3A 3QU6A 2YX4A 3P7NA 4L18B 4ZYDA 2H27A 2ETHA 3KP7A 4RAZA 3E3VA 3KLNA 1U5TB 2Z5UA 5HDGA 2QENA 5J8CA 4I98B 2HGCA 5DCMA 4A0ZA 5DEQA 4LG0B 1XMAA 3DQVC 1IXCA
chains in the Genus database with same CATH superfamily
2DJNA 2VKEA 4N4NB 4GKJH 3G1MA 3OSPA 1R58A 3OYNA 4P1WA 3OYMA 1BOAA 1AKHA 4XNFA 2DCEA 1I94H 2DLNA 1FKAH 5FGMA 5J8FA 2DT6A 2PG4A 1ETKA 3ZXSA 3RTXA 2K9NA 4IEJA 3BC8A 2CUJA 2Q2EA 1IGNA 2JA8G 1X4PA 2A6TA 2FKLA 4MV6A 2PBZA 2E1NA 4DIQA 4LF6H 4IHYA 1Y1WJ 2SCUB 5DTDA 3TQ1A 2NVTJ 5M5XJ 4BJ6C 3OS2A 1MD0A 3MKYB 3SEZA 4EJOA 2EV0A 4BDZA 3W6VA 4BEHA 2O3FA 1NG6A 4RZQA 1QQIA 3RPQA 2EILH 2EV5A 3HHGA 3RZOJ 3OIOA 4EGYA 2WV1A 4W1UA 2EJRA 4HNUA 4KIGA 1RI7A 1IN8A 1D0XA 3D5LA 4LJZF 3JRGA 2E5ZA 1SD6A 5GONF 3MN2A 4DL7A 2J5OA 1ULYA 4BKXA 3VPDA 5ICCA 4B3XA 4O6JA 5KFAA 5KFLA 3VYSB 2K40A 4G6DA 4A12A 1JKQC 3M9MB 1WJBA 2LF8A 2ZXJA 3ZMSA 4L0YB 1ZGAA 4HF2A 1WJEA 1NG7A 4IO9F 3GLKA 3ZRGA 2B63G 4HBLA 3I4NJ 3SEQA 3IV5A 3KCCA 4MV4A 2PI0A 5FO5A 2E2IA 3OYLA 4B47A 4BXFA 4HYKA 3S3NA 1TWHA 1G6NA 1FVIA 3MMYB 2V9PA 2BOLA 2JA7A 1IXRC 2PMUA 2XASA 4XSXF 1U3EM 4DZJA 2J6TA 1RYSA 2V4RA 3RZDJ 5BMZA 1DPUA 3M07A 3OSFA 2JVHA 1MBJA 1FOYA 5J2UF 1O7LA 3M8EA 1S0NA 4ON0A 2L7ZA 3C2BA 1JJ6C 3HPGA 5EZYF 3PO2G 3HEFA 4O3OA 2HXIA 4HX8A 3OYJA 2PJRB 2I8CA 4YFXF 4J00A 2VQEH 2KZVA 5ICEA 2PMZN 4GXOA 1U78A 1USSA 3KYCB 4EJVA 3GTQJ 1B9MA 1D3YA 1FOKA 3TO9A 1VNDA 4YBZB 2CFOA 4WF2A 2VUGA 3FBIB 3OOUA 4A6DA 3OSNA 3OYIA 2R7UA 1IW7F 2DA2A 5BPHA 2FMAA 2HS5A 2MH2A 3PUBA 4A3CJ 2PLYA 3LWBA 3T5LA 2DPDA 1ZR2A 4DL6A 2Z1DA 4P5OA 1ZH5A 2W9CB 3L9FA 1W0UA 5BOXA 2DQRA 3BOQA 3LA2A 1D0YA 3A4CA 1WSUA 2W6ZA 4RGRA 2DTRA 2JRTA 1T0FC 4BBSG 5HVQC 1KQ9A 3QP6A 1JUPA 2G0EA 1T0FA 4O3QA 5JVDF 2X0LA 3ZR8X 3C2GA 4B3RH 1GLVA 3EUAA 2FMYA 2Y48A 4HX4A 5HS7A 5HODA 1Y1WG 4NLGA 4XX0B 4C2UA 5L1KA 3MZHA 5KFIA 3DEEA 2CKZB 1E3HA 1FBQA 1W5TA 4XRSG 5KFEA 3PSIA 4PJMA 3F22A 2A05A 3ZQQA 1BW6A 1FC3A 5BPDA 4L9JA 4KN4X 2VUMG 4QJFA 4R8UB 5EEGA 1RUOA 5DQGA 3Q8QB 2JA2A 2CH0A 1Y8QB 2JSPA 1IC8A 1NK2P 4JV5H 3F23A 3BAAA 1UHMA 3FXQA 4IWXA 3WNZA 1CE8A 3T5JA 2LBFB 4XM3A 3TQNA 2YRXA 4NUBA 3TIIA 4UUSA 4N9HA 1MBHA 4XYMB 2AXLA 2NAZA 4F55A 5KFPA 3GTJA 3K4KA 4UB8C 5J6XA 3DPTA 3QQAA 2A69F 2G7UA 2DFIA 1I39A 4B09A 1RNLA 4C5AA 5DQIA 1KU3A 2QQ9A 3KEQA 3BG7A 1XMXA 2LKSA 1XGMA 5J47A 2OTLI 4UFZA 2GOXB 3HIFA 5K7HA 3N40P 3B6AA 4C3HJ 3AAFA 2YCHA 1TW3A 1WHUA 3Q2OA 4LG3A 4JI2H 3OYEA 3V6JA 4LFCH 1HQCA 2I10A 4QTRA 1OMIA 1UZCA 2NNYA 4RU9A 1P7JA 4EM1A 2CV2A 4LF7H 3JRWA 3L09A 2JA6A 2JK3A 4ZI7F 3IC7A 1QGPA 5LGUA 3DF7A 2OH2A 3S1RJ 3LSGA 2TCTA 3I71A 3I64A 1WFXA 4PFOA 1HNXH 1WPKA 4OIRF 2DA3A 1WZ2A 2FPGB 4D1QA 4U6PA 2BY0A 4X62H 3TMOA 2X1CA 3I12A 3K0LA 1EF4A 3J7YJ 1NH3A 5E8GA 2GLOA 1Z3XA 3T5HA 5D6FA 5C44G 2R92J 1ZLJA 4DV6H 4EEQA 1HNWH 2IGNA 1OR7C 2TDXA 2FRHA 2FQ4A 5HLTA 1KJQA 4F52A 5BQTA 4R7RA 2BZTA 4E7ZA 4DW6A 3GTKJ 1R1VA 4A69C 1FP1D 4KIBA 5JHUA 1A9XA 1BI1A 1JIHA 1VQ9I 4GYIA 4V2GA 1MZBA 3CDHA 3GUDA 1W4MA 4G8XA 1USTA 2W6PA 3U9TA 5JQWA 3BY6A 2HQRA 4A3IG 1G2HA 2HYFA 4Q44A 4PUSA 2DA4A 3ZPLA 3BQZA 4PCQA 3G6XA 5M3MJ 4BQAA 1ZN2A 2LD5A 1HSJA 2UVVA 3WU0A 1I3QA 1BC8C 1J59A 4EFBA 3RYRA 4YR2A 4IHWA 2BW3B 4XSZF 4P9UA 5I47A 4AIKA 1XMKA 2LR8A 2QKLB 4A93J 4RNMA 1PUFB 4EYIB 5HNHA 1XMOH 3RCOA 2JUGA 3ERED 1DU0A 1FMWA 2EIKH 4CCOA 4LGWA 5ICFA 4EQQA 3KP5A 5CVRA 1S3JA 2ESNA 1YFHA 3OHBA 3LA3A 4L9VA 3CQZJ 4M3DA 5C4JJ 1YTYA 5L1IA 1ACIA 3SE7A 5KFJA 1LQ1A 4NXNH 2BVLA 1H8AC 1YW7A 3CP2A 1RJQA 4Q0YA 1PJRA 5IYCJ 3BA9A 5KCMA 1RESA 2HDCA 1K6OA 1XPXA 1TWFJ 5F0FA 4Y13A 4OINF 4BY1G 3CUQC 2QSHX 2CFXA 2PMHA 5JR3A 3E97A 4K2EA 4I55F 2MA3A 3LSJA 1VBHA 1Y1VA 4JX4A 4F50A 2VL8A 4PK4A 2WTFA 3HOXG 2GBYA 2QVOA 3F0CA 4BE1A 3EUHC 1AOYA 2QLZA 5KNLA 4QWDA 2P5VA 1IBKH 1FNNA 5KG2A 4A3BJ 1GVJA 4EBDA 1J2XA 2MABA 2W57A 1OFCX 1ZRDA 4A3DG 3H0GA 2CQ7A 2IAIA 3DU6A 2IEKA 3M1EA 3PNVA 4Y3OA 3WTSC 5LOVF 1NHAA 1V5GA 2FK3A 2WB1E 1TA8A 5D8DA 1FIAA 3O8GA 2HQAA 1U2WA 1S6LA 3JRIA 3PUFA 4M9XA 3LFUA 4IRGA 4JP0A 1R1UA 2NVUB 2W6NA 2RN7A 5KFUA 2BVMA 5DGAA 1N48A 1FOXA 4Q43A 1LJ9A 3GYHX 3Q9VA 5F1RA 4XYLB 5JLWA 4X6AJ 2HDDA 1MKMA 2P4WA 3DEWA 2R3SA 3LQQA 2NVXA 2W25A 1VQNI 3D0SA 1DV2A 3RI4A 4JK1X 3F8CA 2HWVA 1T33A 3K4CA 2ASLA 1WH5A 2M4KA 1Z7UA 2NRAC 3I54A 3CTAA 2W71A 5KFOA 5KT4A 3L2UA 3CJQB 1E2XA 4F3QA 3M9AA 3M8JA 4D9JA 5LRRA 2VBYA 2HOTA 2F6CA 1HW5A 1TWAJ 4M73A 1UC9A 4S05A 3IG0A 1B33N 4EGJA 2VONA 1S03G 1X1BA 4M72A 2ME6A 4OWRB 5IOZA 2COMA 2QF7A 3BTIA 4E7LA 2KIQA 3K4LA 2XSDC 1M1EB 2XAQA 2K27A 3TP0A 1TWCA 2CUFA 1ZG1A 2XGPA 2R8HA 4Q45A 2B0LA 2E71A 2VQLA 1WR2A 1X3UA 3H35A 2LK2A 2GXAA 3GLLA 1WJAA 2UVUA 2NUAB 1IO2A 1Y39A 3FK6A 2R7LA 2L54A 4KMFA 1SVLA 1SVMA 1I3AA 4Z2YA 1FBUA 4QWAA 2XV4S 4EVIA 2EZIA 1LFUP 3OR1C 4I50F 1VFCA 1FLIA 1KJ8A 2R7DA 5EGOA 2YYAA 1KEEA 3IP4B 3QAHA 4A3LJ 2X9DA 4HEA2 2GXBA 1KA8A 3DKYA 1YW8A 3JCUC 1IF1A 4C9YA 2C2RA 1E4GT 3SZGA 3BZ6A 1HKSA 4XN3A 2W7NA 2QZ8A 5EWEA 2ZFWA 2R7MA 5L3EA 1AA7A 2VC1A 4PJ0C 1VI0A 1F9NA 2K3FA 4XLCA 5JFRA 2VQDA 4RZRA 2LLKA 4XKBA 4DR3H 2FK2A 3T5KA 3PW0A 2ZKZA 2RAEA 2L02A 1DGRM 1U8BA 3BP8A 3H9JA 3RKXA 1HKTA 2VR1A 2DT7B 1B6RA 2CJJA 5E18F 4A2AA 2Q0OA 5IP7G 2R82A 2HOAA 1YLFA 4ASNA 3RYPA 2ECCA 1E17A 4HPQA 1YS7A 3BPVA 1M0TA 1OCCH 1ZHFA 3PFIA 4FX0A 5IOYA 1OR7A 4MAMA 4A0YA 3L2RA 4X0GA 4IWYA 4WCGA 1B6AA 3R5XA 3E6MA 1W7PB 4KFCA 4BE2A 4YJ3F 2EINH 1RJPA 2GQQA 3GMEA 2ZO4A 3KP3A 2XRNA 1IXSB 2W6QA 3QZ8A 2OUMA 5E1ZB 3GWZA 1YYVA 2DWCA 3JSNA 3IH3A 4XRMA 2W82A 3R0JA 2RDJA 2RVCA 1MIJA 4ITVA 1IBMH 4RUCA 2CW8A 2X51A 1RETA 2XAUA 3CDIA 3H9QA 5ERIA 2OBPA 2QA4I 4QW9A 3BQ1A 4AWXB 1KYZA 3JRAA 4HAMA 3K4JA 1F5TA 4ZDLA 1EZ1A 4BXXG 2A61A 3DLAA 2FD5A 2NXNB 4MEYF 1FYKA 3KHRA 1XSXA 4U0WA 1DDNA 4ED0A 1U9OA 5LP6F 2ZNYA 2MH9A 1E0EA 4IXAA 2OQRA 1WJ5A 1GXPA 4X65H 1ETVA 3VB2A 2VBWA 3P9IA 3JR9A 4XOTA 2V5AA 2ZC2A 2MBFA 2DT5A 3K7AJ 4MV3A 5IYDG 3BA8A 2CV1A 2PN1A 3J7ZI 1E4FT 4AQYH 2DLLA 4D7MA 5KG0A 4ZZLA 5KG5A 3WGHA 2EWNA 3ABUA 4I0BA 3KTMA 4NQWA 1QHHD 2VA2A 3PSFA 3MR2A 4IR9A 3G2BA 2M7AA 2L9VA 3P5JA 2F5VA 1IRZA 2NVYA 3H0GG 3IRQA 2R5YA 3GV8B 2HQNA 1Z9CA 1F4KA 1UG0A 1HOMA 4LB6B 4FASD 2FLLA 4YIFA 2Q2EB 2E1OA 1QRYA 3VODA 4UCVA 4DUYH 3QFFA 1EH7A 1VTNC 1XTAA 4Q47A 1S7OA 4P55A 4ETSA 1G59A 5L3GA 4UHTA 3ZMVA 3KEYA 4OIOF 4ZOLF 2PQ8A 4XIDA 1K83A 2HEOA 1R7JA 3KAKA 2EA2A 4HV5A 1Z77A 2WY7Q 5EZGA 5J4YA 5C8YF 3KHGA 5BS6A 4EEYA 1XCBA 1T39A 1EH8A 3QYBA 1SD7A 3ETJA 3VSKA 4FETA 1FYMA 2GWRA 1GSOA 3V6KA 1LDDA 4ZYHA 2DW4A 1FX7A 4AIDA 2X6YA 1ZQ7A 1R6RA 4II3A 4R79A 5K7FA 3LP8A 5JHFA 2BR0A 4DR5H 4EGZA 1APLC 2R4GA 2P5LC 2JA7G 1S8NA 1ZYRF 3WE3A 5EOYA 1UHWA 4FQGA 4IQ4A 1LKXA 3REOA 4DBQA 1BM9A 2XAFA 2R7XA 2IA0A 2QQ8A 3UNGC 3DPUA 3MKZA 2QEXI 1T56A 3H4DA 2BV6A 2H8RA 2BBYA 4WXDA 1I6HJ 1G3SA 2E7XA 4XRSA 3WGIA 1BR4A 3VDXA 4CYCB 3CF2A 1UG2A 1YJ9I 2OTJI 3HM5A 4IRIA 3SYTA 3QZ7A 1G3TA 2LKXA 2LC2A 3HUGA 1W5SA 3HRMA 4XN0A 2LREA 3K70C 5LRSA 5H6RA 4BXXJ 4ED2A 3CCRI 2CQKA 2C28A 1XD7A 3BZKA 3WE2A 2V1DA 3MWMA 4FCYA 2GAUA 5C1PA 4O4LF 4Y52J 2CGPA 1MMGA 4MV9A 2IGOA 2BXYA 2NS0A 1O3RA 2KRCA 5B1AH 1S5LC 4ECVA 3E1SA 1JDEA 3V8JA 1TTYA 3GBGA 2M8EA 1KU7A 1GXQA 3HOUJ 3BJOA 1XGSA 1S9HA 3HBLA 1MNDA 1Z3YA 4UXNA 4CCKA 1ZKGA 2Y69H 5ILUA 3G71I 2ZJRF 4J9RA 1YX3A 4PWQA 3BLYA 3R60A 4YQWA 2Y0SN 2FEZA 1FPQA 4BBRJ 4JI4H 3GTJJ 1YS6A 3AG4H 5FLXK 3V7CA 1TQMA 1W0TA 3RB0A 3V8LA 1QA6A 3CMMA 2NOJB 1XGOA 4MFDA 2IBDA 1DIKA 2CW0F 5IP6A 2V4JC 4D0PA 1LUJB 2CG4A 5IP9G 3H3VH 2OAZA 4LF9H 4PSXA 3SDGA 3IAS2 4CSWA 4QLCU 5IT3A 2RDIA 3DBRB 5E1XA 1P8LA 3R23A 4QW8A 4HOBA 5E17F 2C2EA 1WRJA 2Q8KA 2GPWA 2DFFA 5C4XG 4KUMA 3JRHA 2Y0SA 2LVSA 1Z0XA 1BI2A 4FE4A 3PW2A 4CO8A 3CCQI 2DPUA 1DP7P 1IN4A 1I5ZA 4G7OF 4DL2A 2DODA 2JT1A 3W6KB 2UUAH 2FOWA 4U0YA 2OPTA 4YIIA 3FDSA 2DQLA 1ZLKA 3HTUA 4LLGF 1Y14B 4MV7A 4HZFA 3EPIA 1CQJB 1C3OA 1ZARA 1SVOA 1T98A 4M9ZA 4RS8A 5FPOA 3ELKA 1VBGA 3HDDA 1Y1WA 2O0YA 4TV7A 2FMLA 2BYVE 3BCAA 1JT6A 1QU3A 2ZDQA 2DAOA 1F36A 4BAYA 5M5WJ 4JI8H 2V7FA 2NU7B 1OCRH 1WKMA 1IN6A 2Y9ZA 4B3MH 3O2PE 3E5QA 3DV8A 2CRGA 2ME0A 3HOVJ 2L9NA 5J1RA 3F8FA 1WH2A 5D1OB 4BL0B 2VBXA 3BCBA 3CCVI 4A3BG 5EG0A 4HDVA 3FBNB 3CC2I 1P4WA 1FOWA 1TWGJ 5BMVF 2UXXA 4F4YA 1X4OA 2FPIB 5CA0F 5E1WA 3CJNA 4KT5C 1FTZA 2K9QA 2LNBA 2MD5A 1GGOA 1RUNA 1H89C 4GDFA 2EA4A 4BXUA 5L3BA 1MDMA 4ZYAA 1A36A 3L2VA 3ZQLA 3H20A 3N6XA 2IMWP 3DF8A 3HUGB 5HS9A 4BGDA 3N97A 4MA5A 5EDWA 4HSRA 4EJTA 1OPCA 2KHMA 4R8HA 1H0MA 1I1SA 3T8TA 5FJ8J 2F4IA 2E2IJ 1I6XA 4PGHA 3QRFF 2J9GA 3RPUD 1TWHJ 3JAMZ 4CZCA 2XC7A 3CQZA 3QYFA 2E7WA 2QKMB 5CVJA 4RB1A 1AKHB 1X1AA 1Z21A 2EH3A 1S68A 2XGDA 1TQPA 3WHBA 3H1CA 3RDIA 5LA6F 4BBRG 2VIXA 5K5QA 3U21A 4IZOA 2H94A 2D1HA 4B8XA 2DOAA 1BR1A 2HYJA 1RK6A 2YX7A 4HA8A 5KFXA 4ENJA 3HSEA 3LNQA 4TQRA 5HOOA 5C3EG 4MEXF 5FRMA 1KC7A 2NU8B 5EEAA 2GPSA 3TOAA 5DS9A 5LD2C 4JI7H 3LSMA 3J81K 4DV2H 1IDZA 4A0XA 3GFLA 2ECBA 4OAYA 3AL0C 5JVTA 5FLXW 2FBKA 1UHSA 1Y1VJ 2DK8A 1O75A 1WH7A 1TNTA 2ALZA 1PYVA 3LSTA 1PX2A 4NBQA 3SZPA 4IL6C 2R87A 3RKYA 1UELB 3MAJA 1SEUA 5C5JA 3GTQA 1B9NA 1G3YA 4I2OA 3K6GA 2NVQJ 5DD4A 3A2KA 3CCJI 2O5RA 4EGQA 4AVZA 3GXOA 1K78B 3S17J 2R7ZJ 4LD5A 5KG3A 4BACA 3QODA 4XLNF 4RAFA 3CD6I 2VXZA 4LSAA 4AIJA 1W7PA 3FXJA 5CPRB 5J3LA 4YRVA 4BE0A 2NVXJ 3R5HA 1MMAA 2W7PA 5IT9Z 1FY7A 2COBA 2VB6A 4CCNA 4LFUA 2FBHA 3K2ZA 2D1VA 5F08A 2HVSA 4P9FA 2O8XA 4BQQA 2RREA 2XRLA 1E3PA 2K85A 1ETOA 2XAJA 3F8BA 4JBAA 4A3GG 4N0BA 4U88A 3U2RA 2VPSA 4LSXA 2CQXA 2E1MC 1X1PA 3OUZA 3IWFA 3A01B 5JVGF 1MSFC 2YU9J 1XGNA 4LFBH 4II2A 1DUXC 1GUUA 4AIHA 3CESA 5JLXA 4KA4A 3GCMA 3E6CC 3S32A 3C0FB 3OOPA 2WAFA 4EMSA 1K79A 2M1BA 3IAM2 2P0WA 2V58A 3HJEA 1TT5B 1SFUA 2DA5A 1VQOI 3JRFA 2ATLA 4J9QA 4ZYEA 3K5IA 2PMZA 4MFEA 3VMMA 5M5YJ 3SJMA 1IN7A 2LF7A 4UCTA 4MV8A 1JTXA 3ZMTA 2YZMA 4XL9A 4EJUA 4GYGA 3LFKA 1U6GA 3DU5A 3LMMA 2L0KA 2UUCH 1MW7A 2XF6A 1HF0A 2QWWA 4ESJA 2FJZA 4XK4A 4WX9A 3P9CA 2EPFA 2Y9YA 3DTIA 3RIRA 4O3RA 1IUFA 5DCMB 2A3SA 2YSRA 1RR7A 2JEFA 1P9QC 3S2WA 2EIJH 4KISA 3ABTA 2HTJA 3JRCA 1ZG5A 1R9TJ 5DUIA 4YR3A 1O7FA 5IYBJ 4DNCA 2FNAA 2M4GA 1GV2A 2VLAA 2OC6A 3NRVA 3T1BA 1YIJI 2B9SA 1D8JA 3RIZA 3TO6A 5KVRA 2XB0X 2J6SA 3TBIA 3VOEA 4DYQA 1DV1A 4EYHB 4M3EA 4ANJA 2AQEA 5IWAH 2B7EA 3FXKA 2GXGA 2YL2A 3H3ZA 1B8IA 3HZJA 2DA1A 3GIMA 3CC7I 1BR2A 2W84A 1KONA 1JDBB 3S15J 1SFOA 5BPIA 3H40A 4H4KC 2VE9A 3ORQA 1GYFA 1MMSA 2WAQE 3HC7A 1YX5A 1POGA 4AYBN 4A3FJ 2KFDA 2F5EA 5IYBG 4MGRA 2MC4A 5KHDA 5E3OA 2MGQA 3GF2A 3RSNA 5H6QA 3J80K 3ESWB 5FFXA 4IPAA 2IA2A 4G12A 1OJLA 4JI6H 2ZNZA 2ZMEB 4M6VA 3ABLH 3RTRA 4A3MG 1Z91A 1D1BA 3RGZA 4ZDPA 2JEJA 3IWZA 3TDUC 4JX5A 4L1KA 2KQRA 1AHDP 2KDZA 3G8CA 4JOMA 3DTEA 1QPIA 4UNOA 2R86A 1J75A 2N8GA 5EZHA 2R7NA 3OS0A 1MNEA 2QBYB 1R22A 3D5RC 4XONA 2F5FA 1ZGWA 2JPBA 3OWTA 2O9LA 3FKIG 4JI0H 4A3IJ 2FA5A 4ZHQF 3WTWC 2LKPA 4PDBA 3JRXA 5E20A 5LYJF 3HKZE 1R5ID 4XMYA 5J1YA 2H8WA 1LVAA 3ZCOA 1B59A 3Q0WA 1U8RA 3RB4A 2FU4A 2M45A 2IT0A 2I80A 1SD5A 2OQGA 2ZXHA 4BHPA 3S2DJ 5T14A 4K0KH 5JUMA 1ZAOA 5GPCA 4ECRA 5DG9A 4ZJZA 3W3CA 4A3EJ 4MQ9F 5KT3A 4FS2A 4BYYA 1WJDA 3HGYA 3X2QH 3KHHA 1JXSA 3GO5A 2L4AA 1O4XA 3E6DA 2FK1A 2R84A 3F3XA 2HHHH 2R6FA 3DBLB 3I5UA 2OCCH 4DBRA 3IHUA 3H4BA 2ZFUA 3I55I 4I6ZA 3UQ8A 1F1ZA 1OCOH 3F9KA 3A0BC 1I1GA 1J7KA 3H5RA 4PZJA 2R7TA 1GVDA 1V4RA 3BR2A 3R0AA 4F93B 3GV7B 2V79A 3RB6A 2CUEA 1MJBA 4C5CA 4DV5H 3L4KA 4IHVA 3Q8SB 3PM1A 2E5LH 2AGQA 4HRIA 2RF4A 3S2HJ 2QUFA 4ZC3A 3GTLA 1WJFA 2VT2A 1V55H 2BQ3A 1UB9A 3BT9A 1I50J 2LOOA 4YFNF 3GIIA 2W9BB 3LSRA 4JV1A 1D1AA 4Y4RA 5KFFA 2JRMA 1SEIA 4IQJA 3H0GJ 2R85A 4MA0A 3BG3A 4HLXA 1N25A 2NYXA 2P7CB 2KL4A 2ZB9A 3ZMUA 4LK1F 4RB2C 4S04A 1D5VA 4ECXA 2XAHA 3Q5FA 3RB3A 2FPPB 4I99C 3HPHA 1K4TA 1HW1A 2HDWA 2B63A 2H1KA 1LB2A 4BNCA 4IOAF 3V4ZA 5KAIC 2JEIA 1UJ8A 1WI9A 1TBXA 5JVLA 2RNGA 3OYHA 3FKIA 4A3JJ 5E3NA 1GV5A 2AGOA 4OU0A 1R00A 4L9TA 1N78A 2E1CA 3RV3A 3Q8PB 3JSPA 5KFBA 3FMQA 3M4IA 4A93G 1W96A 1Z2OX 2EFQA 4KHPH 2ZDHA 3HOZJ 3S1MJ 1FEXA 3JSOA 1YRNA 5A2QW 1FJLA 3ZGKA 5KX5F 4IRDA 4PGGA 4F4XA 4BBSJ 1XNRH 3PFYA 4FX4A 4A3KG 4A2UA 1W36D 3FXOA 1WVRA 1RC9A 5KFGA 5K5RA 2UVWA 3BTCA 3DPLC 3SQNA 3DCFA 3OIPA 4M3GA 4L5IA 2ZBKA 3ZQCA 5KT2A 3KAJA 4U7DA 1RJRA 3CCSI 4IZZA 4OX9H 4ABZA 3KXYT 4RM2A 4HDUA 1IRFA 1V9PA 2DPIA 1I7LA 3VWBA 2R7VA 3A03A 5C44J 1HBXG 3TDZC 1JXLA 1TAEA 3WTYC 2GLTA 3EQLF 1UMQA 5J1UA 1XDSA 3EUKL 4ME6A 4EV0A 1J9IA 2XCLA 4XOPA 2YZGA 1AN7A 2K7LA 3GIQA 2BY3A 3KFWX 4DV7H 4E7IA 2P81A 3C18A 3I58A 5LHGA 3DKWA 2FP4B 4HQ6A 2XPWA 2X85A 4LIVA 5FJ8G 1JTYA 1OCTC 3EYIA 2DOFA 1R5HA 4AYBA 1LPQA 4EBCA 2D45A 1T08B 4XKVA 1S10A 5DG8A 5KFHA 5F0HA 1LDJA 4XBFA 4NC7A 2M0MA 4DR2H 4CYDA 4BU2A 3OY9A 4AUXA 3MQ0A 1OWTA 2UVRA 1L2ZA 1SMYF 1PDNC 1ORKA 2Y0MA 5H20A 1ZELA 5FLVA 2NS7A 2C22A 2PEXA 3FF5A 4RLFA 5KFWA 3PNYA 2P7VB 3H5AA 5TRDA 4ECQA 2L5QA 2DPJA 1FTTA 1Y1VG 4ZZDA 1N75A 4Q4ZF 2O03A 1SFKA 5KFTA 2XSJC 2ASDA 1ZETA 1G3WA 3P9KA 3GZ6A 2WC2A 3GVAA 4IHJF 3JAMW 2UXNA 4A6EA 2WAEA 5KAFC 3S93A 1ZGJA 3DLLF 3HOWJ 4LH7A 2C00A 3MJFA 4PFPA 5KG7A 2R92G 2WE6A 5KT7A 3J7AK 2CZGA 2LG4A 2VQCA 4ZDOA 4X66H 1SAUA 2UWMA 3GIPA 4QIWE 2ID6A 1IUYA 1ETXA 2A5WA 3PO2J 4LMYA 1OYIA 1J09A 4M6YA 4PJJA 3HG9A 2EFOA 5C4XJ 5ILSA 2W9CA 2H6BA 2C35B 5KFQA 5DG7A 2CQNA 4I7HA 1YJWI 3GIKA 5L1JA 2R8JA 3BTLA 2DMNA 3KLOA 3LSHA 1LE8B 5DDGA 1XMQH 3SFIA 1WWXA 2ACJA 2G9WA 4CC5A 4XLAA 1EJ9A 3HTSB 5A2QZ 2J5PA 2OLSA 3LAPA 3VEPA 4FBTA 3A02A 2XCAA 4ECWA 1YO5C 1HW2A 3G6VA 3GW2A 4GGGA 2A5YB 2DA6A 4EM2A 2P8TA 4DR7H 4OIPF 2ELKA 1JJ8C 5DCFA 5FPRA 2JPCA 1GSHA 1REPC 4C5BA 3I4PA 1XN7A 3D5SC 2V9VA 4MTEA 3AL0B 5K7ZA 1YRNB 1BA5A 4UV8A 5GADJ 3IN5A 1YG2A 4XKCA 2VQFH 4ESBA 3HKZA 4XQFA 3JREA 4J9NA 4TV8F 2NVYJ 4LF8H 2HPIA 4EBEA 2RKHA 3NEUA 4FHTA 2GOMA 4C2TA 1BBYA 1VQKI 3JTHA 5CYVA 4RNOA 2LFBA 1L0OC 3PNTA 2W8KA 4HQMA 4UCSA 4O3SA 1ERDA 2VOPA 2EB7A 1K83J 2W9AA 2DBBA 4O4IF 2HFHA 1EA3A 3S14J 3A1YA 3S3MA 3A0HC 3RUPA 3CCMI 3N44B 4I0AA 3E5XA 2L9SA 2VI6A 4NHJA 2XVCA 5FLXZ 4G7HF 2HGSA 2HYGD 2R7KA 1JUSA 2PMZE 2ISZA 2W70A 3G4SI 2JUCA 4E4TA 3OIQA 3F6OA 4L0ZB 4HF1A 5CQEA 1K61A 1X3ZB 4QPQA 4ZQIA 3ABMH 1A6IA 2W7OA 4N4OB 1RIOH 3BQ0A 3F8MA 3MD2A 3OL4A 4JX6A 3OL3A 4J9PA 5HDNA 2DYSH 1PP7U 3FWEA 1VQ6I 2VE8A 4LG0A 5LLQA 2JA5G 3GIDA 4G3IA 4KICA 2V9WA 2XIGA 3KE2A 2XHKA 2MCTA 5KT6A 3KP6A 4E7SA 3GFIA 1N77A 3PQKA 3GV5B 2EIMH 1RRJA 2XB5A 3RJPA 4D5CA 3FKJA 2H09A 4CYCA 2GIVA 5CJ9A 1RZ4A 5ICGA 2L2OA 4HX7A 3PW5A 3TIGA 3RAQA 3IL2A 2VUMA 3GZ5A 2WB1A 4G94A 1WJCA 5CVIA 4YEJA 2QSGX 1S7AA 5KG4A 2E19A 1IOWA 1SANA 3WODF 2O6GE 5IP7J 1MBEA 4E7HA 2DK5A 1VQ7I 2QSFX 5K2MA 4KMUX 1KBLA 4IF4A 5HLGA 5DLFA 2IA6A 1W36C 1M6VA 3H9GA 1XDNA 2JA8J 4RGXA 4MIMA 1VQ4I 2IGMA 2OA4A 3QPHA 4RGSA 5EYRA 5AIQA 2VJIA 3JRBA 2DYRH 1O3SA 2BW3A 2JA6G 2EV6A 1IN5A 2JSCA 3L00A 2DIKA 3MCZA 4PJNA 4O3PA 2YS6A 2IS1A 3CC4I 1Z7LA 2VC0A 2YPRA 1EH6A 1OCZH 4HQEA 3K3PA 2WV0A 5F9LA 4OIQF 2EFPA 4XR6A 3PL8A 3CMYA 4DL4A 1JKRC 4Y7NJ 4Y8VB 1R4NB 4YAKB 1KU2A 2BE5F 3S3OA 4GKKH 1D0ZA 1EHIA 2ISYA 2VODA 2KJCA 3LQRA 3GTPA 1YIOA 2WAQN 3F21A 4OAZA 3T5XA 5KFKA 5KFZA 3BPXA 3MZ8A 1MNMC 4EFEA 4HYEA 3K1NA 3RGXA 4JI5H 2RDPA 1DP3A 4UVCA 5CAEB 2EBIA 4ED7A 3DFGA 2HU9A 5F04A 2AO9A 5HLIA 3L2WA 3SFZA 2FE3A 1KGSA 3G1OA 3WTZA 5LEJA 1A35A 4LIUA 4R8UA 3OYGA 4RAGA 2DOEA 3BWGA 2A6EF 4ZTJA 4A5NA 3MR6A 1ITYA 4J9SA 3ROUA 1D8KA 1FZPB 3L4JA 1RYRA 3HSFA 1GDTA 5IYZF 3WG9A 2WY8Q 2LBFA 1T3NA 5HDKA 2DO7A 4QSHA 5LGNA 2M9HA 1HDDC 5FKKA 4DOZA 1KYWA 1SFOJ 3OS1A 3HOXJ 1ZRCA 2JEGA 3W2VA 4Z6YA 3HKZN 4YHHH 1BL0A 3MVPA 4IHSA 4V2FA 3V8KA 2F48A 2E2HA 1W1WE 4CCLA 1EKEA 2JJ7A 3R61A 4BJ5C 5KG1A 1IDYA 4B3TH 3UR3C 3AKZA 2VPQA 2W8LA 4BUPA 3BDDA 2VA3A 4U7CA 3GTGJ 5HBRB 1VZ0A 2L7FP 4E70A 3QPLA 2R5YB 5KFYA 4C2MA 5KFCA 2HOEA 3OYAA 5LEKA 4FISA 2DXIA 3U1KA 3V4SA 2IPQX 1TWGA 5CA1F 1P4AA 2BQUA 4L9NA 3GTMJ 2LMDA 2W48A 4KITB 3HL2A 1WCMA 4NQWB 5F64A 3K3VA 5KKNB 4C30A 3TOBA 4J9MA 4PSWA 2PJPA 3GILA 3I4MG 2WA0A 4DZPA 1AUXA 2MD0A 3NWSA 3LL7A 2R5ZA 2QM3A 4Y33A 5F0CA 3OSGA 1A5JA 5LMUH 2XPUA 1GLNA 3ZQHA 4DQ2A 2VKVA 3HYIA 2M0CA 1XX5A 2JN6A 2L4MA 2G7HA 2CW7A 1YI2I 1BI0A 2H6CA 3FIWA 4MV1A 4OMZA 3ZQIA 2L7MP 3EYYA 3EETA 5D5XB 3F6VA 1P92A 1XG1A 2NOGA 2UUBH 2HQ5A 4F92B 4BJTA 3RFCA 3AG2H 4U7BA 2OD5A 1G4DA 2X4HA 5AONA 2LY1A 1W93A 1P6RA 2ELJA 2LH9A 2V6CA 2QYOA 1ONVA 2UUZA 5J4VA 5M3FJ 3JW4A 4JQFA 1R49A 2QBYA 3VYRB 4A3FG 4JI1H 1BIAA 2QQBA 3NAUA 2EZKA 4NXMH 3OYDA 1P4XA 2WB1N 1ZHQA 2X1EA 2YR2A 3GQCA 1HNZH 2ZSHB 2ZXIA 3BROA 1TP4A 3SXYA 4EM0B 2VKDA 3WHCA 1OISA 1B72B 2STWA 3HOUG 3MWEA 2LRDA 1ON1A 1E3OC 4YR0A 5FB2A 3VYUB 1S72I 2R7ZA 4WXHA 3FMRA 3ZQGA 2QYZA 2W6MA 3BR0A 1RK5A 3HOVG 2OU2A 3HOWG 3OYKA 3CCYA 4UUTA 3L2PA 3QPSA 3CCLI 3FXLA 3U9GA 5C1OA 2B63J 3M7GA 1OYYA 1Y56A 2HPMA 3MFIA 4Y15A 3M1CA 4PJLA 5L3DA 2XF7A 3WTUC 2D2WA 2HR3A 3I53A 2F5DA 1FJGH 5HNFA 1N32H 4XKWA 5E3LA 4WD3A 1X58A 2F4MB 3VFZA 1QZEA 5DD8A 4ENNA 1LVKA 4UB6C 1TLHB 2ASJA 2VN2A 2VQGA 1AUVA 4XLHA 1YQAA 3FMSA 1MGTA 1Q1HA 3ZQFA 1LNWA 1FBSA 3BQYA 3CO7C 3TW6A 2I8DA 3S1QJ 5FKOA 2YU3A 2QQAA 3A01A 3I0TA 3BABA 2YU9A 3TKYA 2Z99A 2FOKA 2M3AA 3SDBA 3SI8A 1U0JA 3E5UA 5KK1A 4I4TF 1IV8A 1H9TA 1PUEE 3TGNA 5IYCG 2W9BA 4IRCA 2IRFG 4DV0H 2OZUA 1UC8A 4F4WA 1S7EA 3KHLA 3PO3J 4RDUA 2P6TA 2XUBA 2AQ4A 2HKOA 3Q8RB 2HOSA 1FP2A 5IPAA 2IXSA 3DEUA 1W5CC 5IY5H 4YJ2F 3RKQA 2UV1A 4WXCA 2PX9A 3BR3A 1XSVA 4RAYA 4FT8A 3BTJA 4CDGA 1OKRA 2BY2A 2ID3A 2RGVA 4HNVA 4U0VA 1K4SA 1GO3E 1KJ9A 1M0WA 2FLPA 1MSEC 4DR4H 4M71A 3I59B 4FE7A 4XZ3B 2XGQA 2GZWA 2F2EA 1FIPA 4DV4H 1RKWA 2ELHA 4GLXA 4IAJA 1JE8A 1VAJA 2LY2A 3GLXA 1A04A 1BI3A 1N34H 4I02A 4A2BA 3BQ2A 3JSLA 1R9TA 4M7EA 1KU9A 2K9SA 4LB5A 1DU6A 2AHQA 1M7JA 1IRGA 2C6YA 4YAJB 1YITI 2DDAA 3C7JA 2ZDGA 3FX3A 3QOPA 4HV6A 3ZN1A 3DBHB 2R7SA 4GO1A 4ECTA 2KIUA 2UU9H 2ICWG 4GFBA 2KKOA 3K5HA 1B8IB 2FF4A 1QVUA 1Z2PX 4FTHA 3E5NA 3DTKA 4OMYA 2R8IA 3FHZA 1JLLB 1J5YA 1TNSA 4QWQA 3ASNH 4UCRA 1SCUB 3WU1B 1XB4A 1OYWA 3ABKH 1HDPA 4CCMA 2AU0A 1B04A 4DUZH 3DXJF 3UKGA 2Z16A 3C1DA 2RQQA 2MFZA 2AS5F 3Q0UA 4U87A 4YB8B 1ZHSA 2QGUA 2AQFA 5LHHA 3KETA 4DL5A 2ZMEC 3CDLA 3TINA 3V4GA 3HHHA 1R23A 2Q2TA 4O5VA 4XICA 4AC0A 1VQ8I 2ZMEA 4DYRA 1BIBA 2XKPA 2PFBA 5FROA 2UXCH 1P2FA 2ZJ2A 1Y0NA 3S8PA 2L3DA 1KJJA 2KJBA 2VASA 4X64H 1MDMB 3QPTA 1B72A 5EG0B 3JZIA 3EDPA 2L9RA 1ETQA 3Q1KA 4ED1A 3L2QA 5J2TF 4ZH4F 4YY3H 1W7PD 1BGWA 3BJ6A 1B4AA 1SFEA 2KIFA 2KRFA 1YE9A 1V5EA 1AU7A 2ZSIB 5DM6F 4DL3A 5CLSA 4CUGA 2QCOA 2C2DA 3LAJA 3OR2C 3J80W 2MG4A 5F27A 1VQPI 3V6HA 4NNJA 4BDYA 4UV9A 4J9OA 1R5GA 5EGOB 1QNTA 3S1NJ 3AFHA 2FUG2 2IS6A 4NDLA 3RPUA 2IGKA 1VF9A 2JA5J 4A3EG 3ZOBA 1TW2A 1MJAA 3O6BB 1LEAA 2OZ6A 5EWFA 2XC9A 2CV0A 2LYCA 3CUQB 3BR1A 4G9YA 5EWGA 5KFDA 2A6HF 4MNUA 3K4MA 5D8LB 3GTLJ 2WYOA 5FKLA 4O2AF 3M9OB 5BNGA 4FBUA 3GEZA 1I50A 2STTA 5D5VB 1SC7A 1CQTA 1C0WA 1RPWA 4DJAA 1PK8A 4FS1A 1X2NA 2Z2SB 1O3TA 2FNPA 4QWEA 1UFMA 1WI3A 2HTSA 2M7BA 5DYMA 2UXDH 2K9LA 1FYLA 2GA1A 3K1MA 4A3GJ 2L01A 1SYXB 2BEOA 3RQ4A 4DR6H 4V19K 3CLOA 2R7FA 4A3MJ 2X0SA 1Z67A 2JTVA 2RV8A 4HF0A 4A3CG 4LOCA 4O4HF 1A6QA 3ML6A 2VJ4A 4G6QA 1V4YA 1IBLH 2E35A 2PJRA 1VS0A 5CVVA 3T0YA 1X2MA 2P0AA 2MLGA 3LSPA 1PVEA 3FKIJ 4O3MA 2K4BA 4CA0A 3LMLA 3CMEI 4E6KG 5FD6A 2VT3A 5IP9J 3FK7A 4AU7A 1S29A 3M8FA 5AIPA 2K4JA 2F4VH 3B6CA 3HSRA 5GPAA 2FB9A 1R36A 2FBIA 3KIOA 4YFKF 4BS9A 4ZTFA 4ECZA 3PO3G 2YRWA 4UVAA 3OHAA 3LOCA 2IS2A 4BY1J 2CQQA 3CJTB 2K86A 2Q1ZB 2WAQA 5LHIA 2XPVA 4UUSB 4YP3A 5TGTA 1MH3A 4J19A 4KNYA 1H88C 1QVTA 1ZR4A 1SFXA 5D5UB 3KZZA 3ZP5A 1N56A 4BQNA 4J01A 1H9GA 5LXTF 1OCPA 3N4MA 1STZA 4E7JA 3KALA 3EPZA 3KEOA 2VOOA 3DWLE 4RNNA 4ED3A 1T38A 6PAXA 4M74A 2YS9A 1LFPA 3O3KA 1JGGA 2D5VA 5FKMA 2HVRA 1BXRA 1JKOC 3IRRA 2R8GA 1V5FA 1S9FA 1ON2A 1U9NA 3KYDB 2W24A 3OV8A 5KFNA 2PVPA 2WDTA 1S97A 2J6UA 1V3FA 3W2WA 3RBEA 3IUOA 5DM7F 2V9KA 2XGCA 3PW7A 4IX7A 2DFHA 1X19A 5GAGJ 2IBKA 1FSHA 5C3EJ 3WTTC 4UVBA 3J7AO 2QK4A 3MR5A 2R5ZB 2Z9OA 1K1SA 1JGSA 4ZYGA 3BR6A 1T94A 3Q9SA 1HSTA 1MBKA 2CO5A 2I87A 2OF7A 5B66C 5L9XA 1KJIA 3HXLA 5LGTA 3TQTA 4ECSA 2HZTA 2KZGA 4NB5A 2WWYA 1EUDB 2V6EA 2DMQA 2JZYA 3AYHB 3WO0A 5A2QK 1X1CA 2CSOA 4A3JG 3NARA 3ERMA 3SHFA 4WWCA 1UNNC 3GTPJ 1GHCA 2EK5A 3ZMZA 1HXDA 1D5YA 1IAWA 1D1CA 5EJCA 2ESHA 2M30A 2X6WA 4LF4H 3BR5A 4JI3H 3GTOA 5GTIC 5ILVA 2E36A 4CXFA 2KIMA 5KG6A 3G6EI 2W1OA 2XGXA 3HOYG 5E3MA 5KFRA 4A3KJ 4FM9A 2DMTA 4YELA 3LSIA 3K10A 1A0IA 1DPRA 4DV1H 4F91B 3GIJA 3E6BA 2XF5A 1PUFA 2ZXWH 2R93A 5D6EA 4UY8I 5K1YA 5D8KB 1V54H 1CF7A 4JUZA 4LLLA 3J80Z 4KT6A 4O2BF 2IW5A 2XDVA 3AG1H 3R4KA 4H0EA 2K02A 3C2HA 3H3UA 1FSEA 4IRHA 1T8IA 5IT9W 3CF5F 2V1UA 1N33H 1K78A 2RGRA 3OMYA 4E7KA 4A3LG 3QWLA 1JUMA 4Q8FA 4RGUA 4JYKA 4M6XA 3HOYJ 1S0OA 2O7OA 1Z1DA 1XNQH 4BH9A 2AXTC 5GTHC 3F8NA 2E2HJ 1TC3C 3S16J 3BG6A 1WGXA 2JMWA 3Q0VA 2Y31A 5J40A 3FM5A 2HJWA 2MYSA 3IH2A 4RLQA 1DGSA 4GC7A 3RAXA 3L7WA 3GTOJ 4B48A 2FXAA 3N05A 3COAC 2DI3A 2ZJQF 5GAEJ 2O61A 2IS4A 1EUCB 2E60A 3GTMA 3R6SA 2M8GX 1WCMJ 2KMUA 2NS8A 3DP7A 4RB3C 2DA7A 1I3QJ 5DLGA 1JKPC 1FT9A 3K70D 3PJRA 1EYZA 3FMAA 4KIFA 5B1BH 1KQ0A 4MHGA 4GC6A 3WG7H 3PVXA 2DJIA 2P6SA 2VQHA 4NC8A 4HG2A 4RB0A 3PIPF 3G6YA 3CCUI 2X1DA 1LE8A 2XROA 2VPRA 4XRFA 2R7OA 3BG9A 3MZYA 3M3YJ 4PDKA 3N43B 3NGDA 4ED8A 3B02A 2HI3A 3ECHA 1VKZA 2EQRA 4BHBA 5D5WB 4J9LA 4A3DJ 3FXMA 1BOBA 2DN0A 5JH7F 3N8DA 4RM3A 1QO0D 5L3CA 2CMPA 1U5TC 2K5CA 1AWCA 4EG0A 3RJ0A 3EPGA 1TWFA 2YW2A 2KLOA 5EDNA 3OYBA 2CQYA 4S0HB 2XD4A 3RF2A 2BQRA 1XSDA 2RNJA 1IRXA 4DYCA 4M3BA 4CGZA 4Q48A 4EJWA 2WBMA 4RA2A 3PZPA 4BQOA 3QYEA 2W00A 3CLQA 4TUYF 4IKFA 2ZCWA 3MR3A 1ZTRA 4HW0A 2E1MB 2XKOA 4BY7G 2DU9A 4I09A 1ULZA 1TT0A 1Y6IA 2CYYA 4D5FA 3H36A 4ENKA 3V42A 2RQPA 3K69A 4EATA 5B5EC 3AG3H 1ETWA 5IT9K 5FKNA 1X9NA 3ASOH 3I56I 1HLVA 2JA7J 5BR8H 3KX2A 1XCVA 2WADA 4OOIA 5DV5A 1CS0A 2Q2UA 4Q8EA 1IV6A 1DGWY 5ED4A 5EEHA 3KP4A 3NQOA 3FXUA 3FZVA 2BXZA 3OTOH 2K3PA 1K7AA 3U1DA 3CMAI 4X1EA 5FLMG 3QOEA 3G73A 2DTZA 3I4NG 4BHCA 3KYLA 2IP2A 2KDOA 4G6TB 1VQ5I 3I4MJ 3MWDA 1CQIB 2Y75A 4ED6A 2VUMJ 3ISPA 2HNHA 1UAAA 1MJ9A 5JI6A 3J81W 4F4ZA 1X1DA 3TP3A 3VPRA 2M05A 4LF5H 2WTEA 5KT5A 5HS8A 3FISA 2JVGA 3NWTA 4MO7A 2HVQA 3E7LA 5DUKA 4JV0A 2R8KA 2LY9A 3K1PA 1Z6TA 1IJWC 4DR1H 1BN5A 2FSWA 3PIOF 1N36H 1C30A 3J81Z 1MMNA 1R4MB 1TWAA 3V7RA 4IHTA 1Z05A 3PW4A 1XDUA 5FLMJ 4AVPA 3ZN0A 4L5JA 4HR7A 2CU7A 2DDBA 1LFBA 1CF7B 2BY1A 5HV6A 2LTPA 2LP0A 2JQ7A 2GIZA 1TWCJ 2K9MA 1E4EA 3VPCA 4IHXA 2CWEA 3LWFA 3PR5B 2M2EA 3JAMK 1Q1VA 4C3IJ 1PP8F 3H3VK 4WK8F 1XC5A 2E2JJ 1X3WB 1LDKB 3QU3A 1R71A 1E4EB 5D1PA 5DQHA 1ETYA 1RKTA 4C3JJ 1TL8A 1Y0UA 3HOSA 4M9SA 4QWBA 3CJRB 1TZLA 1IG7A 5H80A 1QPMA 2IA1A 3CUQA 3MKWB 4HLYA 3FHNA 3E0JB 3WTXC 5L1LA 4YIRX 4TQSA 2KISA 2JA6J 1QZZA 4B1RA 2V59A 1G8XA 5H2FC 4KJZA 3J7AY 3CVZA 1BJTA 4J0MA 2FX0A 1ZREA 2IJLA 2DZDA 3OUUA 3K2AA 1T95A 4A5MA 2OCEA 3EUHA 2BGCA 3CO6C 2YZNA 1DQUA 3RQIA 3WTVC 4APMA 3Q3SA 4UUVA 4B3SH 4LH6A 4I01A 4O3NA 4AYBE 4RBOA 2GA2A 3KZIC 3V7SA 2Z3YA 2XAGA 4CH7A 3M4OJ 1HA8A 1WCMG 1Y8RB 2X48A 3CZ6A 2R92A 3ONQA 4LK0F 4W97A 1QBJA 3WO1A 1R1TA 5E8IA 5GAHJ 3H5NA 3HOZG 3T1HH 1I27A 1P7IA 2NNNA 2V1XA 2MSYA 1FMVA 2PBIA 3HB9A 3ULQB 3FM3A 1NK3P 4QPOA 2KP6A 1GSAA 2OJED 3ECOA 5B3SH 2IP4A 4J9KA 3PN1A 4LFAH 1QHGA 1IOVA 3GTKA 3H92A 2KRHA 4TV9F 2O8KA 1WSCA 2F5CA 5EF6A 2VJ5A 1K1QA 1BJZA 2FLNA 1I6UA 3VYTB 5TJJA 1O57A 4XLPF 2OWOA 4GRIA 1F43A 3GTGA 2UZKA 1RR8C 2E34A 5CKTA 4XLEA 3VSLA 2HKXA 3WGGA 4C2MJ 3K4NA 4NC6A 3ZQ7A 4XLFA 3MFKA 4XORA 2MLKA 2VOBA 4CC6A 4P96A 5LFAA 3QP5A 2R7QA 5CVUA 4D7NA 3BJAA 1YJNI 4HSTA 3ETHA 2MC3A 3RKWA 4QIWA 2EZLA 3W6JB 1B1BA 1OQYA 5IYDJ 4JYAH 2BHZA 5FFZA 2RC4A 2M34A 1T6SA 4DGWB 3LA7A 2CS3A 3M9NB 4IVNA 1MBFA 3I9V2 4B43A 1MBGA 4LITA 1SAXA 2L7KA 2M87A 3CUOA 3JTGA 5DGBA 2KPMA 2VKHA 4BEHB 1BNCA 4G7ZF 2Z33A 4ECUA 2EZHA 4CCJA 2CUZA 2A68F 3PR4A 4IOCF 3I3LA 4MLOA 1FWZA 2LSOA 4M3FA 4BWSC 2JA5A 3BG5A 3CCEI 3PQJA 2R7WA 1SD4A 1JHFA 2DFEA 3TW7A 2E5NA 1QZYA 1JI8A 1B6SA 4M9UA 1U5TA 5KFSA 3L1PA 1O3QA 1BC7C 3MKLA 3IKVA 2ZJPF 1UCRA 4Q5SF 2XCPA 2ZM6H 5D4RA 1HC8A 9ANTA 1HCRA 3U9SA 3BZCA 4RMNA 1JX4A 4MQVA 3SZTA 2NU9B 2W85A 3H0DA 1JKJB 4IRKA 4CICA 3KP2A 2PN6A 4L5EA 4B44A 1ZRFA 3GFJA 1L3LA 2MW8A 2W4SA 1NTCA 1J0RA 1MH4A 4IR1A 4QWCA 1YOVB 1WQ2A 3ORRA 1EV7A 2FJ1A 3HRTA 5E79C 2ADUA 3IKTA 2BHYA 2M5WA 4LLNA 5BPFA 1Z6RA 2I5UA 3F72A 4GCVA 2KT0A 5CQGA 2Y2ZA 2GM4A 3KPHA 2TRTA 3C3WA 3HRUA 4ENMA 4N9IA 2KSWA 5F6FA 5FRNA 2V1NA 2R93G 1K6YA 2R7ZG 5K5OA 1ODDA 3TO7A 1T2KA 4MTDA 2HZDA 2A07F 3D1NI 3N41B 5F9NA 3MFHA 1OLTA 2HXOA 3DKXA 1BW5A 4KN7X 1IZ1A 4KDPA 5LBQA 4ESFA 2V4QA 2P5KA 5F1JA 2W6OA 1TQIA 4DLKA 3HOTA 1JHHA 5KFVA 1HR0H 3N42B 2IVMA 3MEXA 2Y0SE 4RUAA 4AD9A 4FU0A 2Y30A 3GFMA 4KYWA 3RBDA 5HLHA 5LL6b 1MMDA 1YW9A 4WBNF 1J5EH 3CP8A 2FQ3A 3JRDA 2X6XA 4F7ZA 1I7NA 4B3AA 5CB4F 1KQ8A 4CZZA 2LDUA 3VPBA 3W2AA 1BJAA 2VJJA 5TISC 3KZYA 4IJAA 3UFXB 3WU2C 4CHUA 1HKQA 2X6OA 3OYFA 1V51A 3T1YH 3G3ZA 3ZMDA 5LMNH 1ZK8A 3TL4X 2ZJTA 2DMPA 2VBZA 1CGPA 3K9TA 5KFMA 3I59A 3FDYA 3HRSA 4YG2F 4I76A 2JWTA 2VPLA 4UCOA 1SMTA 3T8RA 4Y17A 3GZNB 4E4HA 3G1LA 1A31A 3BJYA 4EEFG 1LEBA 1S0MA 2EFNA 2VXDA 3L2CA 1T36A 4R1HA 2NU6B 5L3FA 1YHQI 1GT0C 5FD5A 3FXRA 3GX4X 3B73A 3HGGA 5GP9A 3R5FA 4DV3H 5D4SA 4UCUA 2EFWA 1ZG3A 3QU6A 2YX4A 2XGEA 1ENHA 3P7NA 4B4CA 1KZHA 1XS9A 1JT0A 2YS7A 4ECYA 4L18B 4AM3A 4ZYDA 2H27A 1VQLI 2ETHA 3TEDA 2H1LA 3KP7A 4HNTA 3LSKA 4RAZA 3E3VA 3KLNA 2F4OB 1U5TB 2Z5UA 2AGPA 5HDGA 3K4BA 2QENA 3RV4A 4JV2A 4QIWN 4BY7J 5J8CA 1VQMI 2YUSA 2HGCA 4I98B 5DCMA 3OYCA 2DMUA 3O8HA 2UXBH 3IH4A 4A0ZA 2R0QC 5DEQA 5D1OA 2OV7A 4LG0B 1XMAA 1Z2NX 3DQVC 2R93J 2V26A 1ZQ3P 1IXCA 2R7RA
chains in the Genus database with same CATH topology
4GKJH 1R58A 1BOAA 1I94H 1FKAH 5FGMA 5J8FA 2PG4A 3RTXA 2Q2EA 2E1NA 4LF6H 1MD0A 4EJOA 2EV0A 2O3FA 4RZQA 1QQIA 3RPQA 2EV5A 3HHGA 4EGYA 2EJRA 4KIGA 1RI7A 1IN8A 3D5LA 4LJZF 1SD6A 2J5OA 1ULYA 5ICCA 4O6JA 4G6DA 4A12A 2LF8A 2ZXJA 3ZMSA 4L0YB 1ZGAA 4HF2A 4HBLA 3KCCA 2PI0A 5FO5A 1G6NA 1FVIA 1IXRC 2PMUA 2XASA 4XSXF 1U3EM 5BMZA 1DPUA 1O7LA 3M8EA 4ON0A 4HX8A 4YFXF 2VQEH 5ICEA 4GXOA 1U78A 1USSA 4EJVA 1B9MA 1D3YA 1FOKA 3TO9A 4WF2A 2VUGA 4A6DA 1IW7F 2HS5A 2MH2A 2PLYA 2DPDA 4P5OA 1ZH5A 3L9FA 5BOXA 2DQRA 3BOQA 3LA2A 1WSUA 4RGRA 2DTRA 2JRTA 5HVQC 1KQ9A 3QP6A 1T0FA 2X0LA 4B3RH 2FMYA 2Y48A 4HX4A 5HS7A 3MZHA 1FBQA 1W5TA 3F22A 5BPDA 1FC3A 4L9JA 4KN4X 5EEGA 1RUOA 4JV5H 3F23A 3BAAA 1UHMA 3FXQA 3TQNA 4N9HA 2AXLA 2NAZA 5J6XA 3DPTA 2G7UA 2A69F 2DFIA 4B09A 1RNLA 1KU3A 2QQ9A 3KEQA 1XGMA 4UFZA 3HIFA 3N40P 3AAFA 2YCHA 1TW3A 4JI2H 4LFCH 1HQCA 1OMIA 2NNYA 4EM1A 4LF7H 3L09A 3IC7A 1QGPA 5LGUA 3DF7A 3I71A 3I64A 1HNXH 4OIRF 4X62H 3K0LA 5E8GA 5D6FA 1ZLJA 4DV6H 4EEQA 1HNWH 2TDXA 2FRHA 5BQTA 4R7RA 1R1VA 1FP1D 4KIBA 5JHUA 1BI1A 4GYIA 1MZBA 3CDHA 3GUDA 1W4MA 4G8XA 1USTA 3BY6A 2HQRA 2HYFA 3ZPLA 4PCQA 4BQAA 1ZN2A 1HSJA 3WU0A 1BC8C 1J59A 4EFBA 3RYRA 4XSZF 4P9UA 4AIKA 1XMKA 1XMOH 3ERED 4LGWA 5ICFA 4EQQA 3KP5A 5CVRA 1S3JA 2ESNA 1YFHA 3LA3A 4L9VA 1YTYA 1LQ1A 4NXNH 1YW7A 4Q0YA 3BA9A 2HDCA 1K6OA 4Y13A 4OINF 3CUQC 5JR3A 2CFXA 2PMHA 3E97A 4K2EA 2MA3A 2QVOA 1AOYA 2QLZA 2P5VA 1IBKH 1FNNA 1GVJA 1J2XA 2W57A 1ZRDA 3M1EA 3WTSC 1NHAA 1TA8A 1U2WA 1S6LA 4M9XA 4IRGA 1R1UA 2RN7A 1LJ9A 3GYHX 3Q9VA 5F1RA 1MKMA 2P4WA 2R3SA 3LQQA 2W25A 3D0SA 3RI4A 4JK1X 3F8CA 2HWVA 1Z7UA 2NRAC 3I54A 3CTAA 1E2XA 3M9AA 5LRRA 2VBYA 4M73A 1HW5A 4S05A 3IG0A 2VONA 1S03G 4M72A 2COMA 2XAQA 2K27A 1ZG1A 2B0LA 1X3UA 2L54A 4KMFA 4Z2YA 1FBUA 2XV4S 4EVIA 1FLIA 2R7DA 3QAHA 2GXBA 1KA8A 1YW8A 1IF1A 1E4GT 3BZ6A 1HKSA 2QZ8A 2ZFWA 5L3EA 2VC1A 5JFRA 1F9NA 4DR3H 2ZKZA 2L02A 3BP8A 3RKXA 1HKTA 5E18F 4A2AA 2Q0OA 1YLFA 4ASNA 3RYPA 1E17A 1YS7A 3BPVA 1M0TA 1ZHFA 3PFIA 4FX0A 1OR7A 4A0YA 4WCGA 1B6AA 3E6MA 1W7PB 4KFCA 2GQQA 2ZO4A 3KP3A 2XRNA 1IXSB 5E1ZB 3GWZA 1YYVA 3JSNA 3R0JA 2RVCA 1IBMH 2CW8A 5ERIA 2OBPA 4AWXB 1KYZA 4HAMA 1F5TA 2A61A 1FYKA 4MEYF 1XSXA 4U0WA 1DDNA 2ZNYA 2MH9A 4IXAA 2OQRA 1GXPA 4X65H 3VB2A 2VBWA 3P9IA 2MBFA 2DT5A 3BA8A 1E4FT 4AQYH 2DLLA 4ZZLA 3WGHA 2EWNA 3ABUA 4I0BA 4NQWA 3IRQA 2HQNA 1Z9CA 1F4KA 4LB6B 4YIFA 3VODA 4UCVA 4DUYH 1EH7A 1VTNC 4Q47A 4ETSA 4OIOF 1S7OA 4P55A 5L3GA 4UHTA 3ZMVA 2PQ8A 2HEOA 1R7JA 3KAKA 2EA2A 4HV5A 5BS6A 1XCBA 1T39A 1EH8A 1SD7A 1FYMA 2GWRA 4ZYHA 1LDDA 2DW4A 1FX7A 4R79A 4DR5H 4EGZA 2P5LC 1S8NA 1ZYRF 3WE3A 5EOYA 1UHWA 3REOA 1BM9A 2XAFA 2IA0A 2BV6A 2BBYA 4WXDA 1G3SA 2E7XA 3WGIA 4IRIA 1G3TA 3HUGA 1W5SA 3HRMA 5LRSA 5H6RA 2CQKA 1XD7A 3WE2A 2V1DA 3MWMA 2GAUA 2CGPA 4MV9A 2NS0A 1O3RA 3V8JA 1TTYA 2M8EA 1KU7A 1GXQA 3BJOA 1XGSA 4UXNA 5ILUA 3R60A 2FEZA 1FPQA 4JI4H 1YS6A 5FLXK 3V7CA 1TQMA 3V8LA 1XGOA 2CW0F 4D0PA 2CG4A 2OAZA 4LF9H 5IT3A 4QLCU 5E1XA 1P8LA 4HOBA 5E17F 1WRJA 2Q8KA 4KUMA 1BI2A 4CO8A 2DPUA 1DP7P 1I5ZA 1IN4A 4G7OF 2JT1A 3W6KB 2UUAH 4U0YA 4YIIA 2DQLA 1ZLKA 3HTUA 4LLGF 4MV7A 4HZFA 1ZARA 4M9ZA 1T98A 4RS8A 5FPOA 3ELKA 2O0YA 4TV7A 2FMLA 2BYVE 4JI8H 2DAOA 4BAYA 1WKMA 1IN6A 4B3MH 3O2PE 3E5QA 3DV8A 3F8FA 1WH2A 5D1OB 2VBXA 4HDVA 1P4WA 2UXXA 5E1WA 3CJNA 4KT5C 2LNBA 2MD5A 1RUNA 2EA4A 4BXUA 5L3BA 1MDMA 3H20A 3N6XA 3DF8A 5HS9A 3N97A 4EJTA 1OPCA 4R8HA 1H0MA 1I1SA 3T8TA 1I6XA 4PGHA 3QRFF 3JAMZ 2E7WA 5CVJA 4RB1A 1S68A 1TQPA 3RDIA 5K5QA 2H94A 2D1HA 4B8XA 2YX7A 4HA8A 4ENJA 3HSEA 5HOOA 4MEXF 3TOAA 4JI7H 3J81K 4DV2H 4A0XA 3GFLA 5JVTA 5FLXW 2FBKA 2DK8A 1O75A 1TNTA 3LSTA 3SZPA 3RKYA 3MAJA 1G3YA 1B9NA 4I2OA 5DD4A 3GXOA 1K78B 4LD5A 4XLNF 2VXZA 4LSAA 4AIJA 1W7PA 5IT9Z 1FY7A 4LFUA 2FBHA 3K2ZA 2D1VA 2HVSA 4P9FA 2O8XA 2XAJA 3F8BA 4JBAA 4N0BA 4U88A 3U2RA 2VPSA 4LSXA 3IWFA 1XGNA 4LFBH 1DUXC 4AIHA 4KA4A 3E6CC 3C0FB 3OOPA 4EMSA 1K79A 2M1BA 1SFUA 4ZYEA 1IN7A 2LF7A 4UCTA 3ZMTA 4EJUA 4GYGA 3LFKA 1U6GA 2UUCH 2QWWA 4ESJA 4WX9A 3P9CA 3RIRA 5DCMB 2A3SA 2YSRA 3S2WA 3ABTA 2HTJA 1ZG5A 5DUIA 1O7FA 4DNCA 2FNAA 1D8JA 3NRVA 3T1BA 3RIZA 3TO6A 5KVRA 3VOEA 5IWAH 2GXGA 3H3ZA 2W84A 5BPIA 2VE9A 1GYFA 2F5EA 4MGRA 3GF2A 3J80K 5H6QA 5FFXA 4IPAA 2IA2A 4JI6H 2ZNZA 2ZMEB 3RTRA 1Z91A 3RGZA 3IWZA 3TDUC 4UNOA 1J75A 2QBYB 1R22A 2F5FA 2JPBA 4JI0H 2FA5A 3WTWC 2LKPA 4PDBA 5E20A 1LVAA 1B59A 1U8RA 2FU4A 2IT0A 2M45A 1SD5A 2OQGA 4BHPA 4K0KH 1ZAOA 4MQ9F 4BYYA 1JXSA 3GO5A 2L4AA 3E6DA 3F3XA 2HHHH 3I5UA 3IHUA 3UQ8A 1F1ZA 4PZJA 1I1GA 1J7KA 1V4RA 3R0AA 2V79A 1MJBA 4DV5H 3L4KA 2E5LH 2QUFA 2VT2A 1UB9A 4YFNF 1SEIA 4HLXA 2NYXA 2P7CB 3ZMUA 4LK1F 4RB2C 4S04A 1D5VA 2XAHA 3Q5FA 1HW1A 1LB2A 4BNCA 1WI9A 1TBXA 4OU0A 1R00A 4L9TA 2E1CA 3JSPA 3FMQA 3M4IA 1Z2OX 2EFQA 4KHPH 3JSOA 5A2QW 4PGGA 1XNRH 4FX4A 4A2UA 5K5RA 3DPLC 3SQNA 4L5IA 2ZBKA 3KAJA 4U7DA 4OX9H 3KXYT 4HDUA 1IRFA 1V9PA 1HBXG 3TDZC 1TAEA 3WTYC 3EQLF 1XDSA 4EV0A 1J9IA 1AN7A 2K7LA 3KFWX 4DV7H 3C18A 3I58A 5LHGA 3DKWA 3EYIA 1R5HA 2D45A 1LDJA 4XBFA 4DR2H 4CYDA 3MQ0A 1L2ZA 1SMYF 1PDNC 2Y0MA 5H20A 2PEXA 3FF5A 2P7VB 5TRDA 4ZZDA 4Q4ZF 2O03A 1G3WA 3P9KA 3GZ6A 2WC2A 3GVAA 3JAMW 2UXNA 4A6EA 4LH7A 1ZGJA 2WE6A 3J7AK 4X66H 2UWMA 1IUYA 4LMYA 1OYIA 4M6YA 2EFOA 5ILSA 2H6BA 4I7HA 3KLOA 1XMQH 5DDGA 1WWXA 2ACJA 2G9WA 4CC5A 3HTSB 5A2QZ 2J5PA 3LAPA 3VEPA 1YO5C 1HW2A 3GW2A 4GGGA 2A5YB 4EM2A 2P8TA 4DR7H 4OIPF 5DCFA 5FPRA 2JPCA 1REPC 3I4PA 1XN7A 2V9VA 4MTEA 4UV8A 1YG2A 2VQFH 4ESBA 4LF8H 2RKHA 3NEUA 4FHTA 1BBYA 3JTHA 5CYVA 1L0OC 4HQMA 4UCSA 2VOPA 2EB7A 2DBBA 2HFHA 3N44B 4I0AA 3E5XA 4NHJA 2HGSA 2XVCA 5FLXZ 4G7HF 2HYGD 2ISZA 3F6OA 4L0ZB 4HF1A 1RIOH 3F8MA 5HDNA 1PP7U 3FWEA 2VE8A 4LG0A 5LLQA 4KICA 2XIGA 3KE2A 2XHKA 2MCTA 3KP6A 3GFIA 3PQKA 3RJPA 2H09A 2GIVA 5CJ9A 1RZ4A 5ICGA 4HX7A 3IL2A 3GZ5A 4G94A 5CVIA 1S7AA 3WODF 2O6GE 2DK5A 4KMUX 4IF4A 5HLGA 1XDNA 4RGXA 2OA4A 3QPHA 4RGSA 5AIQA 1O3SA 2EV6A 1IN5A 2JSCA 3L00A 3MCZA 1EH6A 2VC0A 2YPRA 4HQEA 2WV0A 4OIQF 2EFPA 1KU2A 2BE5F 4GKKH 2ISYA 2VODA 2KJCA 3LQRA 1YIOA 3F21A 3T5XA 3RGXA 3BPXA 4JI5H 4EFEA 4HYEA 3K1NA 2RDPA 4UVCA 3DFGA 5HLIA 3SFZA 2FE3A 1KGSA 3WTZA 5LEJA 3BWGA 2A6EF 4A5NA 3ROUA 1D8KA 1FZPB 3L4JA 3HSFA 3WG9A 5HDKA