3EYYA

Structural basis for the specialization of nur, a nickel-specific fur homologue, in metal sensing and dna recognition
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
133
structure length
133
Chain Sequence
STDWKSDLRQRGYRLTPQRQLVLEAVDTLEHATPDDILGEVRKTASGINISTVYRTLELLEELGLVSHAHLGHGAPTYHLADRHHHIHLVCRDCTNVIEADLSVAADFTAKLREQFGFDTDMKHFAIFGRCES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative iron uptake regulatory protein
publication title Structural basis for the specialization of Nur, a nickel-specific Fur homolog, in metal sensing and DNA recognition
pubmed doi rcsb
source organism Streptomyces coelicolor
molecule tags Transport
total genus 35
structure length 133
sequence length 133
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01475 FUR Ferric uptake regulator family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3eyyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3eyyA02
3ZN0A 2M30A 4KN7X 3BPVA 2D1HA 1RUOA 3KEOA 1BIAA 3QOPA 1WWXA 4IJAA 4G94A 3HOSA 2K86A 4MQ9F 2DK5A 1P2FA 3K9TA 4WCGA 4BQAA 2PI0A 4HDUA 2Z5UA 3WODF 2RKHA 3IHUA 2ZBKA 2CO5A 1G3SA 1YW8A 1HSTA 4KA4A 1V4RA 2E7XA 3TDZC 1E2XA 4G7HF 4BHPA 5HDKA 1XSDA 3J7AO 4WF2A 3RKWA 2CGPA 2BBYA 2O03A 3BOQA 2DO7A 4R79A 5D5UB 2V9VA 1FYMA 2A3SA 2ETHA 2DBBA 1T98A 1IUYA 1Z1DA 5F64A 4JBAA 1SD7A 3DPLC 1MDMA 2IPQX 1KU3A 2ZFWA 2VT2A 2ESHA 2KKOA 3ROUA 2PJPA 3LFKA 1U8RA 4WX9A 1J75A 4OIQF 4L9NA 3F6OA 3R0JA 2DQRA 1USSA 1T6SA 3C7JA 2OAZA 2D1VA 2A61A 1R58A 1STZA 5HS8A 1LDKB 5L3FA 2VC1A 2LNBA 1SMYF 3WTYC 2FBIA 3FXQA 1LDJA 2L01A 5DUKA 3FMQA 5ICFA 1IW7F 2G7HA 3CUQC 1FZPB 3T8TA 2R7FA 2DLLA 3GYHX 2EA2A 3HRMA 3C1DA 2LDUA 2QQBA 2QZ8A 5FFZA 3MWMA 4M6YA 4ON0A 1W7PA 5JI6A 4HF1A 3N97A 2Q2EA 4FHTA 4KIGA 5KK1A 2JPCA 2V79A 2Y48A 3GFJA 4P5OA 4HQMA 2JSCA 3CUQA 3HHHA 1KYWA 3RPUA 5D5WB 3TOAA 3KLNA 3JAMZ 2YU3A 2Q0OA 4IRGA 3HIFA 4GCVA 4OOIA 1U2WA 1YFHA 2IVMA 3NQOA 4NQWA 1DPRA 3GFLA 1NHAA 3RYRA 1LDDA 1B9NA 1ZG1A 1I27A 1FYKA 1OKRA 2ZNZA 2YPRA 1BN5A 2WTEA 3MAJA 4L0ZB 4EMSA 3I53A 3TKYA 3GFIA 4ZYGA 3ERED 2IW5A 4G7OF 3VODA 3I59A 1V3FA 3CJNA 1JHHA 1USTA 2DAOA 2BE5F 3RPQA 1UB9A 4KNYA 1EH7A 4YFNF 1IRGA 1IXSB 2ELHA 1WI9A 1ZHFA 3QPHA 1G3YA 4HV6A 2UZKA 2ACJA 5L3GA 3GX4X 2P8TA 4TV7A 5JFRA 1LB2A 1R22A 1IXRC 1KGSA 3FX3A 5A2QK 3B02A 2FBHA 4IHTA 1B4AA 5JR3A 1HSJA 1FP2A 1MJ9A 4WXHA 1TW2A 3F21A 2XKPA 1BI2A 5CLSA 1FSEA 4NB5A 5E1XA 3MEXA 3DPTA 1VTNC 4GXOA 5D4RA 3HTUA 2PMUA 2P5KA 1OYWA 2QYOA 4BAYA 2MH9A 2QBYB 3VOEA 4D0PA 3COAC 2H6BA 5TRDA 2HKOA 2HWVA 2L02A 3ULQB 2FOKA 1KU7A 5DD8A 3KP5A 5DCMA 3FM3A 3PFIA 2W84A 1MGTA 3LA7A 2QWWA 4PGGA 3R6SA 3JSOA 4KUMA 3HYIA 2B0LA 3RKXA 2KIFA 3PQJA 1FLIA 4JQFA 1YS7A 1D8KA 2BV6A 3SXYA 3H3ZA 4BHCA 4S05A 3S2WA 4UVAA 4EJOA 3GZ6A 1REPC 4AIHA 2XROA 3G73A 3IC7A 1YLFA 4AVPA 1S6LA 3WTWC 1ZAOA 1LEAA 3DQVC 4LK1F 2EFPA 1GVJA 1W4MA 2ZCWA 2MA3A 3ABTA 2Y0MA 3IWFA 1HXDA 3KP6A 1I1GA 3DFGA 3BPXA 4GO1A 2W24A 2EK5A 2Z99A 2GWRA 1ZYRF 2VE8A 2O61A 4HLYA 3QP5A 3F23A 1P4XA 2OU2A 1FBQA 3LAJA 1GXPA 2RDPA 4WK8F 3P7NA 2VE9A 5FFXA 2FMYA 3CO6C 3ZMTA 3K1NA 3BDDA 1D8JA 2OBPA 3DF8A 1DUXC 5E20A 1MD0A 5H6QA 2E7WA 4HV5A 5ICGA 1K78A 2AXLA 3FMSA 5D5VB 2MH2A 2JRTA 1YO5C 3KE2A 3ZMUA 5KVRA 3MFKA 4LLNA 2H6CA 4HYEA 1B59A 2HOEA 2E1CA 1MJBA 4OINF 3E5UA 3U1DA 3CTAA 3MZYA 3BJ6A 5D4SA 1LEBA 2PEXA 3RDIA 2AS5F 1DP7P 2A69F 4U0YA 4A0XA 3EUHA 2XAJA 1RNLA 2BGCA 5L3CA 3FMRA 5E1WA 4KMUX 2BEOA 2DI3A 4G9YA 2YR2A 4UNOA 1OPCA 3HSEA 4LB6B 2WC2A 1TNSA 1O7FA 2F5EA 3J81K 3BY6A 1O3QA 4GGGA 2CW0F 1SD6A 3JTGA 3BZ6A 1IRFA 3FXUA 3R60A 3V8JA 2V1UA 4KICA 4A0YA 5IT9K 2L54A 1R36A 1U6GA 3TOBA 5BMZA 4M72A 4KYWA 4L9VA 5ERIA 4EM1A 1HKSA 3ZPLA 1Q1HA 4KIBA 4O5VA 4YFKF 1TBXA 1K7AA 2P5LC 2OQRA 3BJAA 3I58A 3TGNA 1RZ4A 2LF8A 3ZMZA 3F8MA 1TW3A 1BOAA 1ZLJA 2HS5A 5D5XB 5LEKA 3D5LA 2DQLA 4Q48A 1K6OA 5LEJA 4O3MA 2X4HA 5J6XA 2ZO4A 2LF7A 3NRVA 2FNAA 4G6DA 1HBXG 1FX7A 3V8LA 3AAFA 1OYIA 2H09A 2QQ9A 2DPDA 2XRNA 4OIOF 4Y15A 2K27A 3ZN1A 3M8FA 1F5TA 3WTZA 2GQQA 2CYYA 5DUIA 4U88A 2GXBA 4A5MA 2EFNA 1HW1A 4YIIA 5LHIA 1ZRFA 4LG0B 4M74A 5CYVA 2JT1A 2FNPA 1PP8F 3KP3A 3WGHA 2HEOA 5HS9A 3T0YA 5BOXA 3BJOA 5HLGA 1UCRA 4A6DA 5F1RA 2Z9OA 4L5IA 2M8EA 2VN2A 4UV8A 5CVVA 5ED4A 1W5SA 5BPIA 1T39A 5TJJA 4HOBA 4EVIA 4WXCA 3MQ0A 1C0WA 4P9UA 3WU0A 4HF0A 1SFEA 1WKMA 1EH8A 1JXSA 2ESNA 3ABUA 1AWCA 1SD4A 5LBQA 2KIMA 4EQQA 4XSXF 5DDGA 2CFXA 3FHZA 3J80K 2W25A 1H0MA 4L5JA 2EWNA 4I2OA 1BM9A 3LA2A 4UVBA 3GW2A 3R4KA 4YG2F 5CVUA 5HDGA 1Z6RA 5K5OA 4N0BA 3WGGA 5A2QZ 3BWGA 1IAWA 1XCBA 5AIPA 4RB2C 3SHFA 4LB5A 3RTRA 1HQCA 3KEQA 4HX4A 3IRQA 4OU0A 3MZHA 2J5OA 2VXZA 4CYDA 4HF2A 1FPQA 3FWEA 4UUVA 4RGUA 1T0FA 2VBYA 1ULYA 4I0AA 5LLQA 3VB2A 1XMKA 4KFCA 2HKXA 2W57A 4HX7A 2EJRA 1ZN2A 5LGUA 3DEUA 4XLPF 1J5YA 1FP1D 1BBYA 3HRUA 5EEHA 1ZRDA 4I7HA 4IRIA 3RJPA 5DCFA 1YTYA 3SFZA 1JE8A 4AIKA 1PDNC 1MKMA 5LHGA 4ZYHA 3IRRA 4I02A 2HR3A 2XAHA 1QNTA 3P9KA 4CZZA 1ZARA 3LAPA 2WWYA 4OIPF 1FBUA 2FXAA 2LSOA 1QZYA 2RNJA 3TQNA 4IPAA 1T2KA 4P55A 3L2CA 1FBSA 1ZGAA 3QU6A 3JSPA 1R7JA 5E8GA 1R5GA 3R0AA 3GVAA 1YQAA 2YX4A 4EGYA 3WTUC 1BI3A 2K4BA 4L9JA 4Z2YA 3HUGA 4MEYF 1U5TB 1R1VA 1QZZA 3RKYA 4RB3C 5FGMA 5LHHA 2V6CA 2Q8KA 5L3EA 4A12A 4UHTA 4N9IA 4ESFA 1B9MA 1WSUA 4ZYEA 2V1DA 3V7SA 4CHUA 1BI1A 2FSWA 1R1UA 5D6FA 1SFXA 3I64A 5HLIA 1IN5A 1JHFA 3O6BB 3WE3A 2PLYA 1FOKA 5F6FA 5H20A 4I98B 2EV5A 5AIQA 2M5WA 3CUOA 2CG4A 3WE2A 3HTSB 3ISPA 2OZ6A 1KQ0A 4ENNA 3JW4A 3V7RA 1QBJA 2RVCA 3W6KB 1G4DA 2HZTA 4EGZA 4EV0A 5ICEA 2DT5A 2HTJA 3OV8A 1A04A 5ICCA 2Z3YA 4MTDA 1YIOA 4DQ2A 5ILSA 1S29A 4K2EA 1BJAA 2HYGD 5FD5A 3WTVC 3J81Z 3C18A 3KP2A 3LQQA 2P6SA 2Y75A 3GUDA 2RGVA 3IKVA 2FU4A 2EFWA 2HQRA 1AOYA 3U2RA 5IT9Z 3CO7C 4EM2A 2ADUA 2CQKA 4B8XA 5CVIA 4NHJA 3F3XA 5LRRA 5DYMA 1S3JA 5HS7A 3QAHA 4H0EA 1FC3A 1O57A 3K0LA 1ZG3A 2P6TA 2F5CA 3F6VA 2VT3A 2P4WA 3HHGA 2GIVA 1CF7B 2RV8A 3BP8A 2PFBA 2ZMEB 1BC8C 1DDNA 1XMAA 1QPMA 1U78A 5K5RA 2YSRA 4F7ZA 2STWA 4EJTA 3KETA 3DXJF 1ZRCA 3RYPA 2M1BA 2GA2A 4M9ZA 2H94A 4QWQA 2IA2A 2UXNA 1TNTA 2K7LA 5DD4A 4G6QA 4KT5C 4LFUA 1KA8A 4MGRA 5HDNA 3K69A 3LWFA 3L00A 5JHUA 4KDPA 4XLNF 2J5PA 2M87A 4LK0F 1XB4A 2LKPA 5HOOA 2QQAA 3LSTA 3Q9VA 4ASNA 4ENMA 3W6JB 3K2ZA 4MEXF 3GXOA 4RAZA 1W7PD 1DPUA 2NYXA 4OIRF 3Q9SA 4A0ZA 2V1XA 3K1MA 1YW9A 4HA8A 4ENJA 4PCQA 4HLXA 1ZGJA 2KRFA 1I6XA 5CVJA 1HW5A 3EETA 4Q5SF 3I0TA 2OD5A 1K79A 4EJWA 1RI7A 4U7DA 1G6NA 1KYZA 1QGPA 2CSOA 2MD5A 5H6RA 3J80Z 5BQTA 3E5XA 3L9FA 2GZWA 3KCCA 1D3YA 4Y13A 2STTA 3ZP5A 4HZFA 1TLHB 2FE3A 3K1PA 1OMIA 4MTEA 2CWEA 2M45A 4G7ZF 3U9GA 4L0YB 1EH6A 1OYYA 4ZZLA 4ESBA 2R3SA 4I01A 3T5XA 1QQIA 4IVNA 1W5TA 1J9IA 4M6XA 1RUNA 4Y17A 4P96A 3E5QA 4PGHA 2NRAC 2G7UA 2P7VB 4CXFA 2PN6A 3IKTA 2MLGA 3GO5A 1F4KA 2XAFA 1IN6A 1B1BA 3KP7A 1J7KA 3M9AA 1MJAA 3KLOA 4OMZA 3Q5FA 4ETSA 1S7AA 1WRJA 4HX8A 2XASA 4LG0A 4OMYA 1O3TA 1XDUA 3ZMVA 4M9XA 3QPTA 4LGWA 3RIRA 1FT9A 2D2WA 2DPUA 5D8KB 5BS6A 3GLXA 2W85A 1LNWA 1ON1A 2PQ8A 2P7CB 1L0OC 2MBFA 4UVCA 4CDGA 3O3KA 4WXDA 4LD5A 3REOA 5JVTA 2DU9A 3V4GA 1IF1A 3DV8A 2DFIA 3KFWX 1I5ZA 2IRFG 4A2UA 4JK1X 3CLOA 5E17F 5LRSA 1O3SA 5FD6A 2PG4A 4GYIA 1YS6A 1XGMA 3ECOA 2OA4A 3KP4A 1MZBA 3D0SA 3VFZA 2FEZA 5J8CA 2VOOA 2EV6A 2VBZA 5K5QA 1IXCA 2K4JA 2FQ3A 2ZNYA 3LQRA 3F22A 3O2PE 4LLGF 4B09A 4HW0A 1YW7A 5FB2A 2MLKA 4QLCU 2NAZA 2D45A 3P9IA 2XUBA 2K02A 2XAQA 3L09A 5AONA 3LA3A 2H27A 2TDXA 3WGIA 4BXUA 5E1ZB 1ONVA 1TQIA 2VBWA 3F8FA 3M1EA 5FO5A 3EQLF 1RIOH 4XBFA 1FY7A 1Z9CA 1MDMB 2DW4A 4KIFA 2FBKA 2X0LA 3KZYA 4EJVA 4BYYA 2HDCA 3GWZA 3ZMSA 2A6HF 1R5HA 2HTSA 1P6RA 3HRSA 1XSVA 3E6CC 4CGZA 2VODA 4A5NA 2BYVE 1QO0D 3I54A 3F8CA 5IT3A 2XIGA 4PZJA 1D5VA 2QVOA 2XAGA 3CDHA 3FF5A 4RGXA 3E6DA 3HOTA 3FZVA 4G8XA 3N4MA 1P4AA 4E70A 4MNUA 2HGCA 1WQ2A 1UHWA 3ECHA 3V8KA 4ZH4F 3WTTC 3TO6A 5EEGA 1KU2A 4IRHA 5ILVA 4P9FA 4R1HA 4M71A 1FNNA 3V7CA 4RAYA 4M9SA 1H9GA 2NNYA 3KZZA 1U5TC 1J59A 1W7PB 4HDVA 4U0WA 1L3LA 1E17A 3TDUC 1PUEE 3EYYA 3GEZA 2COMA 1S8NA 1KU9A 3CUQB 2NNNA 2VC0A 1IZ1A 2FA5A 1LVAA 4IF4A 5FLXZ 1O7LA 3T8RA 2O3FA 4L9TA 3WTSC 3C3WA 4BNCA 2O6GE 3H92A 1U5TA 3I5UA 4A6EA 4IHSA 4S04A 1LQ1A 2VONA 4ESJA 2EFQA 2O8XA 5D6EA 3WU1B 1XDSA 4RGRA 1CGPA 1BC7C 1YYVA 3DKWA 4DNCA 3I59B 3M8EA 2HQNA 3BROA 2XHKA 3G3ZA 4CICA 1YG2A 1G3WA 5E18F 3QP6A 1GHCA 1SFUA 2QBYA 1F1ZA 1TTYA 2E1NA 4UV9A 3OOPA 2F2EA 2IA0A 4O6JA 4WWCA 2EFOA 4ZYDA 4BHBA 2QM3A 3P9CA 2DTRA 4FX4A 3E97A 4U0VA 1S7OA 1XGSA 2YX7A 5D8LB 1ZLKA 3NEUA 2QUFA 3MCZA 1Z6TA 2UXXA 4AD9A 2A6EF 3I71A 2JTVA 2FRHA 5DEQA 2FF4A 4EM0B 1FSHA 2EA4A 2ZJ2A 1ZG5A 1T38A 4MHGA 2R7DA 3T1BA 4LLLA 2XGXA 2WV0A 2MC3A 1HKTA 5DCMB 3PQKA 3JAMK 1FYLA 5CVRA 1R23A 2QENA 2XV4S 5FLXK 4XRFA 1SAXA 2L3DA 1G3TA 5L3DA 2IA1A 3EYIA 1KQ9A 4Q47A 5K1YA 2UWMA 2L4MA 4UXNA 5BPDA 4N9HA 2NS0A 4GYGA 4I0BA 2PMHA 2RC4A 1XGNA 5HLHA 4EJUA 1JGSA 1CF7A 4KN4X 3HSFA 2ZMEA 2C6YA 4MQVA 2GAUA 3R61A 1TQMA 3EDPA 2IP2A 1XN7A 5CJ9A 4FT8A 3E6BA 4AIJA 2IJLA 4R8HA 3IL2A 4LJZF 4RB0A 5E8IA 1ZH5A 2ZKZA 3GFMA 1R1TA 1XCVA 4FX0A 5J8FA 2A07F 3IWZA 1B6AA 4U7BA 3ELKA 4PDKA 5L3BA 3E3VA 4ENKA 3GF2A 1H9TA 4AWXB 4L18B 1K78B 1Z91A 3FXRA 1XD7A 1P92A 2VBXA 2G9WA 3SZTA 3SQNA 2P5VA 4HBLA 3QU3A 4YFXF 4RGSA 4IXAA 1BI0A 2PBIA 4HQEA 5LGTA 4RS8A 5ILUA 1KQ8A 1O3RA 1TQPA 1Z7UA 1PP7U 4LMYA 5HVQC 1EV7A 3M7GA 4BH9A 1R00A 1J0RA 3TO7A 3I4PA 1Y0UA 2Z33A 5DV5A 2ZXJA 3B73A 1ON2A 3JTHA 2JZYA 2KIUA 1HKQA 4KMFA 2KJCA 2ISYA 1SMTA 4I09A 2KJBA 1BIBA 2A68F 2F5FA 3SZPA 4CO8A 3HRTA 3F8BA 3FM5A 1ODDA 1HW2A 3E6MA 3ZMDA 2XVCA 2RQPA 1F9NA 1Z05A 1IN4A 1LJ9A 1SD5A 3ZQ7A 1U3EM 3H3UA 1UHMA 2JPBA 1ZREA 3WTXC 2L4AA 4M73A 2HYFA 1P4WA 1UFMA 2OZUA 3DP7A 2ISZA 2F5DA 4XSZF 6PAXA 2FMLA 5LGNA 3HSRA 1IN7A 2GXGA 2IT0A 4HAMA 1J2XA 2HFHA 1GXQA 3L7WA 3RI4A 3QRFF 2VOPA 2GA1A 3WG9A 2EB7A 1X3UA 2EV0A 1FWZA 1OR7A 2XKOA 3GZ5A 2OQGA 2QLZA 1I1SA 1XGOA 1XSXA 3ML6A 2RN7A 4YIFA 1IN8A 2DK8A 3F72A 3TO9A 4Q4ZF 4RB1A 2A5YB 3F8NA 3VEPA 2O0YA 4ZZDA
chains in the Genus database with same CATH superfamily
1VAJA 3ZN0A 2M30A 4CCMA 4QIWN 3DU5A 2K3FA 4KN7X 3BPVA 2D1HA 1RUOA 4DL6A 3KEOA 3S16J 5LFAA 1N32H 5IT9W 1BIAA 2JMWA 1WWXA 3QOPA 3VPBA 5C5JA 2BQUA 4IJAA 4NLGA 3G1OA 4G94A 3CP2A 5E79C 3I4MJ 2QEXI 1O4XA 2DMTA 5KG5A 3HOSA 5EEAA 2W9BB 2K86A 4MQ9F 3RB6A 2DXIA 2XGCA 2PVPA 2DK5A 1D5YA 1D0YA 1P2FA 3K9TA 3PJRA 1X19A 2YZMA 2TRTA 2KSWA 1VQPI 4WCGA 3HGGA 1Y1WA 2WDTA 4BQAA 3CP8A 3HJEA 2ID3A 3S3OA 2PI0A 4IQJA 2W8KA 3OMYA 2Q2TA 4HDUA 1GLVA 5LMNH 2Z5UA 3BG9A 3G1LA 2XC7A 3QODA 1JKQC 4EEFG 1RK5A 3WODF 5FPRA 1TP4A 4LIUA 2RKHA 4FS1A 3IHUA 2FUG2 2ZBKA 4A3IG 2CO5A 5GADJ 4Z6YA 4JUZA 3LSKA 4DL4A 1G3SA 4C2MA 1YW8A 1HSTA 2JA5J 4KA4A 4O3RA 1IBKH 1V4RA 4FETA 3BZCA 2E7XA 2X6XA 1XTAA 4D7MA 1W0UA 1K1SA 3TDZC 3AYHB 1E2XA 4G7HF 5IYZF 1IC8A 4BHPA 5HDKA 1XSDA 3J7AO 4WF2A 3RKWA 4XNFA 2K9MA 3ZCOA 5JHFA 2RGRA 2CGPA 2DOEA 4BY7G 2BBYA 1YX3A 2KRCA 1RK6A 3BR3A 2O03A 3DEEA 4EFBA 3BOQA 3AG1H 2DO7A 4R79A 5D5UB 4HSTA 1PK8A 4LF8H 2V9VA 2XF5A 2LKXA 2F4OB 3I4MG 1FYMA 2EZHA 1V9PA 4Y4RA 2A3SA 5KG1A 2ETHA 5C4XJ 2DBBA 1T98A 3BG5A 3GTQJ 1IUYA 5E3NA 5FRMA 3K5IA 3CCLI 1B33N 4ZQIA 1Z1DA 2F48A 3WNZA 3E1SA 5F64A 2KDZA 2ZJPF 4CZCA 4JBAA 1SD7A 3DPLC 3K70D 4E7KA 5KT6A 4F4YA 1MDMA 3PW4A 2HOAA 2WA0A 2IPQX 1KU3A 3CD6I 4O3NA 2Q2UA 4PFPA 2L7KA 1SYXB 3H4BA 2ZFWA 2VT2A 2DA1A 2W7PA 2YU9J 1ULZA 4A2BA 3UFXB 2ESHA 2KKOA 1E4EB 4IHJF 2V4RA 3ROUA 2PJPA 3LFKA 1U8RA 3V6HA 1XMQH 1X3ZB 4C3JJ 3TEDA 1UC9A 4WX9A 2JQ7A 2JA5G 1J75A 4OIQF 1VBGA 1B8IB 4L9NA 2AQFA 3F6OA 3R0JA 1IBLH 1DP3A 2DQRA 4YR0A 1USSA 1X58A 1G2HA 5JQWA 4IZZA 1T6SA 3C7JA 3UNGC 4JI6H 2OAZA 5KT3A 3OYNA 2D1VA 3K4JA 1GT0C 2A61A 1R58A 1MIJA 4FASD 2ALZA 2R5YA 4RMNA 1STZA 5HS8A 2W8LA 1LDKB 2ASJA 5L3FA 2VC1A 1HC8A 1ZR2A 2RAEA 2LNBA 1BNCA 1SMYF 3WTYC 2FBIA 3SI8A 2DA5A 2AU0A 2O9LA 1RPWA 1LDJA 3FXQA 1VQ7I 4BUPA 2L01A 5DUKA 1MMDA 3FMQA 2AGPA 2R7MA 3LSPA 5ICFA 1I39A 1IW7F 2HOSA 2G7HA 2V4QA 2R7NA 3CUQC 1FZPB 3T8TA 1FMWA 2CQ7A 5J47A 2BHYA 2BW3A 2R7FA 4X66H 1S0OA 2DLLA 1BA5A 3GYHX 2EA2A 3HRMA 1Z21A 1OCRH 2XC9A 4JI8H 3H5RA 2M4KA 4Y33A 5F08A 1ETKA 1Z67A 3C1DA 3Q0VA 1QVTA 4BL0B 5K7ZA 2LDUA 1AU7A 1S97A 2VKVA 2QQBA 2QZ8A 5FFZA 2PBZA 4Y8VB 1YRNA 1OCPA 3MWMA 4M6YA 4ON0A 4FS2A 3IUOA 1JKOC 1Y8RB 2HVQA 1W7PA 2JN6A 3WO1A 5JI6A 4J9KA 4HF1A 3N97A 2VPSA 3BQZA 2Q2EA 4FHTA 5GTHC 4KIGA 2J6SA 3W2WA 1MBFA 5KK1A 2JPCA 1DGRM 2V79A 1RJQA 3V6JA 2Y48A 3GFJA 4P5OA 2DMUA 5KFPA 1YX5A 3MKWB 4HQMA 1YI2I 2NVYA 2YRXA 4ED8A 1X2MA 3S1NJ 3O8HA 2JSCA 3JRCA 3CUQA 3HHHA 3HKZE 3S14J 3S1MJ 4Y3OA 1KYWA 3RPUA 5EZGA 2KFDA 3W3CA 2LBFB 5D5WB 1WSCA 3TOAA 2F5VA 5KG2A 3KLNA 4M3BA 4BJ6C 3JAMZ 4UCOA 2YU3A 5H80A 2Q0OA 4IRGA 3M9NB 3HIFA 2GPSA 4GCVA 5JLWA 4OOIA 5KFDA 1D1AA 1U2WA 4CUGA 2IVMA 1YFHA 4PJNA 9ANTA 1CQTA 3NQOA 4NQWA 1R4MB 4CCJA 3L2WA 1DPRA 1LFUP 3GFLA 1XNQH 1NHAA 4G6TB 3GTPA 4M7EA 3RYRA 4XN3A 1LDDA 1P9QC 1B9NA 2H1LA 2JEJA 4S0HB 4X1EA 3JRBA 1ZG1A 1I27A 3H36A 1FYKA 2RQQA 2R7OA 5TISC 3Q2OA 1OKRA 3PZPA 2K9SA 4IRDA 2ZNZA 4XLFA 2YPRA 3FXLA 2M7AA 3SE7A 4O4IF 1BN5A 2ZSIB 2WTEA 3FKIG 5EWFA 3W6VA 3MAJA 3EPIA 1VQ6I 4B3MH 3ABKH 1ETYA 3HG9A 4EMSA 4C2TA 4L0ZB 2L7FP 3I53A 3TKYA 3GFIA 4ZYGA 1DV2A 1UAAA 1I3AA 3ERED 2E2IJ 1WHUA 2IW5A 2JVGA 2IBDA 4PJMA 4G7OF 3VODA 5BNGA 4EATA 2XCPA 4EYIB 4ECRA 1TWAA 3I59A 1V3FA 3CJNA 1JHHA 1USTA 2DAOA 4X62H 4HG2A 2BE5F 5FRNA 3RPQA 2FPIB 4A3FG 4JI0H 5F0FA 1UB9A 4KNYA 3PSIA 2JA6J 1WR2A 1EH7A 3MKLA 4YFNF 1IOVA 2J9GA 4MV9A 1IRGA 1IXSB 1VQLI 5K7FA 2ELHA 1WI9A 4KHPH 1ZHFA 3MR6A 3QPHA 1G3YA 2R86A 4Q0YA 1D1BA 4JI2H 4HV6A 2UZKA 2ACJA 5L3GA 4O4LF 5KG0A 2LH9A 2VR1A 3GX4X 2P8TA 1XMOH 1SCUB 4TV7A 5JFRA 1LB2A 1S0NA 1U9NA 1R22A 3HUGB 1IXRC 4M3GA 1E3HA 1KGSA 3FX3A 5A2QK 3B02A 2KZGA 2VQHA 2FBHA 2WADA 1N56A 1CQIB 5C8YF 4IHTA 1B4AA 5JR3A 1OCCH 3GCMA 1YIJI 3M9OB 1HSJA 1FP2A 1MJ9A 4MFEA 4J9OA 4WXHA 1TW2A 4JI1H 2DA3A 4A3MJ 2IA6A 4XK4A 4BE2A 1Z3YA 3F21A 4A3JJ 2XRLA 3O8GA 3K7AJ 3VYRB 2ID6A 2XKPA 1BI2A 5CLSA 3RKQA 1VBHA 4YRVA 1BR2A 1FSEA 2OC6A 4NB5A 5E1XA 4BGDA 5IY5H 5GAGJ 3MEXA 1YE9A 2OTJI 2L7MP 1EHIA 3DPTA 1VTNC 1PJRA 2XGDA 4GXOA 1I7LA 1XDNA 1W36C 4FTHA 2R6FA 3DLLF 4J9RA 5D4RA 3HTUA 2PMUA 3LSJA 4BU2A 2UVRA 2VUMA 2P5KA 3KAJA 1OYWA 2MSYA 5CAEB 2EINH 1UHSA 5DQIA 1VQ9I 3JZIA 3CF2A 2QYOA 4BAYA 2ZJQF 3S17J 3WG7H 2MH9A 5FLMJ 2QBYB 4RUCA 2JA6G 3VOEA 1ERDA 3Q8RB 1QVUA 1Z77A 2EH3A 4D0PA 4BACA 3CC7I 2EZKA 4AQYH 4LF4H 3COAC 4G3IA 2UXBH 2A5WA 2ICWG 2ZC2A 2JEIA 5HBRB 2H6BA 5TRDA 2HKOA 1HCRA 3Q8PB 3CCSI 1XMXA 2MABA 2HWVA 2F4IA 4B44A 1ZHQA 2L02A 5GPAA 4YR3A 3ULQB 1S72I 2FOKA 2HZDA 1WCMJ 1KU7A 5DD8A 4NXMH 1QHHD 3BR1A 3KP5A 5DCMA 3JRIA 3FM3A 3PFIA 3K3PA 2W84A 5GTIC 4KITB 4BEHB 1MGTA 1BR1A 3LA7A 2QWWA 4PGGA 4II3A 1N77A 2JA7G 4BBSJ 4UCUA 2VKDA 2HQ5A 3R6SA 3JSOA 5FKMA 4M3FA 4A3MG 4KUMA 3HYIA 1PVEA 2B0LA 3KEYA 3RKXA 4A3JG 2JA7A 2YCHA 1H88C 2R4GA 1W96A 4ECVA 2ME6A 2KIFA 3MR5A 3PQJA 1FLIA 4CYCB 4JQFA 2WAFA 1YS7A 1K4TA 3MMYB 1V5GA 4ECUA 1D8KA 2IAIA 2BV6A 3SXYA 1E0EA 3CLQA 3H3ZA 3U21A 1KEEA 4BHCA 4S05A 2EZIA 3A01B 3DF7A 3AG3H 3S2WA 2YS6A 4UVAA 4EJOA 3GZ6A 3Q8QB 4DV5H 4UCVA 3DTKA 1REPC 3T5LA 2KHMA 4AIHA 2XROA 5KG7A 3G73A 3G2BA 1JUMA 1L2ZA 4FBUA 3IC7A 1YLFA 4AVPA 3SEQA 2ECCA 1S6LA 4XIDA 3WTWC 1V54H 1ZAOA 1LEAA 3DQVC 2M3AA 3FBIB 2EFPA 4LK1F 3H20A 5KFSA 4ZDPA 1GVJA 1W4MA 2ZCWA 5C4JJ 1YJNI 2MA3A 3ABTA 2Y0MA 2WB1E 3IWFA 3RZDJ 1HXDA 3H3VH 2VQLA 3KP6A 3M4IA 1I1GA 3DFGA 4CC6A 3BPXA 1WVRA 4GO1A 5KFQA 3VYTB 2W24A 2AGQA 4DV1H 2EK5A 3T5KA 2Z99A 3CCQI 4A3CJ 1GV5A 2WAQA 1WCMG 2GWRA 1ZYRF 2VE8A 4MAMA 2DOFA 1YJWI 2HJWA 2O61A 2CV1A 1X4OA 3GTGJ 4HLYA 5KKNB 3BZKA 1M0WA 3PR4A 3QP5A 2M4GA 1IG7A 3ZQQA 1KJ9A 3F23A 1WFXA 1RR8C 2W6QA 2JEGA 5KCMA 4BBSG 5HNHA 1FTTA 2GLTA 1P4XA 4AUXA 5B1AH 5JUMA 2OU2A 1FBQA 3LAJA 1GXPA 2RDPA 3S1RJ 2HVSA 4WK8F 4FM9A 1TWFA 2VIXA 3P7NA 2VE9A 2B63A 5FFXA 4J0MA 2FMYA 2NVXA 3CO6C 3ZMTA 1FIPA 3IH3A 3K1NA 3BDDA 1TWHJ 1D8JA 2OBPA 1JX4A 2NS7A 3DF8A 3GILA 1WGXA 1F36A 1ZELA 1DUXC 1H8AC 5E20A 1MD0A 5M3FJ 5H6QA 2VASA 4A3GJ 3ETJA 3OYMA 2E7WA 4HV5A 2EIMH 5ICGA 3AKZA 1K78A 1AUXA 1SANA 2AXLA 4XORA 3FMSA 3VPDA 5D5VB 3QPSA 2Y31A 1UZCA 2MH2A 2JRTA 4RM2A 1FJGH 3WHCA 1YO5C 3EUHC 3BR5A 3KE2A 3ZMUA 5KFMA 5KVRA 3MFKA 4C30A 3K4CA 4O3QA 4LLNA 2H6CA 1NH3A 3CMMA 3FK7A 2LY1A 4HYEA 3L1PA 1B59A 3G1MA 2HOEA 4ZJZA 1R71A 2E1CA 1MJBA 1ZKGA 4ED2A 3PW5A 2FMAA 4OINF 3CCRI 3E5UA 4E6KG 3GQCA 4A3DJ 4F55A 3HEFA 3U1DA 3BR0A 3CTAA 3MZYA 1I50A 2IGMA 3PW2A 1AKHA 3A2KA 4A3CG 3BJ6A 3OUUA 1S0MA 5D4SA 1LEBA 2PEXA 3CC2I 2O7OA 1T94A 4A3EJ 2QA4I 2C2EA 1Z0XA 5EWGA 4DR6H 3PNYA 1V55H 2AQEA 4G12A 2W7NA 4NC6A 1T33A 4IQ4A 3Q0UA 5LL6b 3RDIA 1GUUA 2AS5F 2R7WA 4R8UA 3OR2C 4CCLA 1DP7P 2WAQN 4IHYA 2BY0A 4PJ0C 4O3OA 2DPJA 2ZXWH 2A69F 4U0YA 4A0XA 2AHQA 3EUHA 2XAJA 1U8BA 1RNLA 1BW5A 2BGCA 2FP4B 1RC9A 2DFHA 3C2GA 1GSHA 4DL7A 1E4FT 5L3CA 1S03G 2RDIA 1N48A 3FMRA 5E1WA 4KMUX 4A3GG 4KJZA 4IWYA 4PK4A 2BEOA 2DI3A 4G9YA 2YR2A 3J7ZI 4UNOA 4LF6H 3JRWA 1OPCA 3HSEA 4LB6B 2UVWA 1I3QJ 1X4PA 4B3SH 2WC2A 2Z2SB 4OWRB 2RREA 4CCKA 2W82A 1TNSA 5C1PA 3MWEA 1O7FA 2F5EA 3SJMA 2Y9ZA 1LFPA 3J81K 2XSDC 3BAAA 1IDZA 3CQZJ 3BY6A 1O3QA 1QPIA 3P5JA 3TQTA 5M3MJ 4GGGA 3L2UA 2QCOA 4J9LA 4EBCA 3KHLA 1S9FA 2DJNA 2CW0F 1SD6A 3JTGA 3HOZG 2CW7A 3GIQA 1X1CA 3BZ6A 4ZC3A 2LR8A 1MBJA 3LNQA 3S1QJ 3NWTA 5EWEA 1IRFA 4A3DG 3FXUA 4C3HJ 3R60A 3V8JA 1JLLB 5KFRA 2V1UA 3BA8A 4KICA 4A0YA 5L1IA 1BOBA 1B04A 5IT9K 2L54A 1R36A 2M9HA 4A3EG 1U6GA 4N4NB 3TOBA 1MH3A 5BMZA 3AL0B 4GC6A 4M72A 2CV0A 4O4HF 4KYWA 5KFAA 4L9VA 4J9PA 1HNWH 3G6VA 5ERIA 2UVVA 4EM1A 1HKSA 2L9SA 2ZXIA 2LKSA 3CF5F 4FE4A 3M4OJ 5J4YA 3ZPLA 4KT6A 1Q1HA 5EGOA 3VMMA 2DODA 4KIBA 5JVGF 4UUSB 1ETQA 2JUGA 4X64H 3CMAI 2R85A 4M9UA 4O5VA 5KFOA 4MV7A 3A4CA 4YFKF 3GTLA 1TBXA 2NU9B 1FOWA 4XLHA 1ZETA 4RAFA 3GTJJ 3NAUA 1K7AA 2M34A 2P5LC 3FBNB 3K10A 4LFCH 2OQRA 3BJAA 2GXAA 3JSLA 4B3TH 1V5FA 1EJ9A 3I58A 4ECXA 3TGNA 4YP3A 5C3EJ 1JKPC 2R87A 1RZ4A 2SCUB 3CCVI 4DL2A 3OYFA 1LKXA 1WH7A 3GIKA 2LF8A 3ZMZA 3JREA 4ANJA 3F8MA 1TW3A 1BOAA 3GLLA 4LFBH 1I6UA 5GONF 2R7SA 1ZLJA 2HS5A 2L7ZA 5D5XB 1IDYA 2W71A 5KT4A 5LEKA 4A93J 2HHHH 3D5LA 3U1KA 2DQLA 2R7ZA 1K83A 4D9JA 2X6WA 4Q48A 3OR1C 4DOZA 2KMUA 1K6OA 5LEJA 1A9XA 4O3MA 1S9HA 2X4HA 4IEJA 5J6XA 2ASDA 4ECTA 2ZO4A 4LH7A 1XG1A 2LG4A 1Y39A 1QRYA 2LF7A 3BG6A 3NRVA 4JP0A 2I8DA 1IRZA 3L4JA 4MIMA 2BY3A 2V26A 2OJED 4AYBE 3RBEA 5B3SH 3RZOJ 4OAZA 2VUMG 4JV5H 2FNAA 2Q1ZB 4G6DA 4ECSA 1HBXG 1FX7A 4JOMA 3V8LA 4I76A 5KFEA 1GSOA 2R0QC 5M5WJ 2L9VA 2QSFX 2K9LA 3RAXA 1X9NA 2N8GA 3OL3A 3QWLA 4BY7J 3AAFA 3PO2J 1JJ8C 3PN1A 1MBHA 1NG7A 4ECWA 2W9BA 1IV6A 1OYIA 2H09A 2R92A 2QQ9A 2DPDA 3UQ8A 2XRNA 2PN1A 2QYZA 2LK2A 4WD3A 4OIOF 2V6EA 4Y15A 1N25A 4PSWA 2E2HJ 2W70A 2K27A 2YS9A 1S10A 3ZN1A 3M8FA 3PNTA 4MFDA 1F5TA 4A3BJ 2CQYA 3TW6A 1TWCA 3WTZA 2GQQA 2CYYA 5DUIA 4U88A 1GYFA 3SEZA 2GXBA 4A5MA 5C3EG 2Y2ZA 2EFNA 2X1DA 5J4VA 3OYIA 3PVXA 1HW1A 4F4ZA 2CQNA 4YIIA 5LHIA 3X2QH 1MNMC 1ZRFA 4LG0B 1WZ2A 4BS9A 1KC7A 3OIQA 4YEJA 1J5EH 4M74A 5FROA 3G8CA 1X2NA 4U87A 5CYVA 4JX5A 2JT1A 2FNPA 4A93G 3RIZA 5KAIC 1PP8F 3V4SA 2LYCA 3KP3A 3WGHA 2VLAA 1U0JA 2HEOA 2K85A 2O5RA 4RBOA 3GTKJ 3ABLH 5FKLA 5HS9A 4HRIA 4OX9H 1PUFB 3T0YA 5BOXA 4TUYF 1W1WE 1NG6A 3BJOA 1MH4A 3CJTB 5HLGA 1UCRA 4A6DA 5F1RA 3UKGA 4L5IA 2M8EA 2VN2A 4UV8A 4UUTA 2Z9OA 4WBNF 3N8DA 4ECYA 2HPMA 5CVVA 1Q1VA 5ED4A 5J1UA 2BZTA 4RLQA 1W5SA 1O75A 5BPIA 1T39A 4UCTA 2H8RA 2EPFA 4NC7A 5TJJA 3LSRA 4JI5H 4HOBA 4QPOA 4DUYH 2DA4A 4DZPA 4EVIA 3KYDB 4WXCA 3MQ0A 2MFZA 1C0WA 1YOVB 3PO2G 3GTOA 4P9UA 1EA3A 3WU0A 2LY9A 5J1RA 1RKTA 1TWGA 3GTMA 4CSWA 4HF0A 2E19A 4DL5A 1SFEA 1WKMA 1EH8A 1JXSA 4JV1A 2ESNA 3ABUA 1AWCA 4A3BG 1C3OA 1JXLA 2L0KA 1SD4A 4LG3A 5LBQA 2KIMA 2R8GA 2GLOA 3NWSA 4EQQA 1ACIA 4XSXF 5DDGA 3LWBA 2CFXA 4HR7A 1E4EA 3A0BC 2R8IA 2HXOA 4DJAA 3FHZA 3J80K 2W25A 2XGEA 4MO7A 1H0MA 4C2UA 3DTEA 2DJIA 2K5CA 4L5JA 2EWNA 4I2OA 2R93J 4C9YA 1BM9A 3T1YH 3KYCB 3LA2A 4UVBA 1B8IA 3GW2A 3R4KA 1Y56A 3BCBA 1MNDA 3ETHA 4YG2F 1T0FC 2HDWA 2E1MB 3ZOBA 2QK4A 5CVUA 5HDGA 3TP0A 2UUCH 3FXMA 4YHHH 1Z6RA 5EOYA 5K5OA 2R5ZB 1SEIA 5KFCA 1A31A 2BR0A 4BXXG 3LSIA 4N0BA 1RRJA 2YRWA 1JGGA 1VS0A 4LF5H 4YJ2F 3WGGA 5A2QZ 2L9NA 3BWGA 4RZQA 3S93A 1IAWA 1XCBA 2PJRB 2C35B 5AIPA 2MCTA 4RB2C 3NARA 5HLTA 1G59A 3SHFA 4LB5A 2NVTJ 3RTRA 1Z7LA 4DR4H 1RJPA 2DLNA 3HPGA 3ZQGA 4B48A 2HQAA 1HQCA 1APLC 3KEQA 1OCOH 3H0GA 4HX4A 2WE6A 4FBTA 1I94H 1MBKA 4MA5A 3IRQA 4OU0A 5CA1F 5IYDJ 3MZHA 2J5OA 2VXZA 4CYDA 4HF2A 1FPQA 2RNGA 1VQ5I 3FWEA 2MG4A 2KQRA 4UUVA 4RGUA 3N05A 1HOMA 1T0FA 2VBYA 3PIOF 1ULYA 4I0AA 5LLQA 3VB2A 5DM7F 1WH5A 1XMKA 3TBIA 2R7LA 3TW7A 1P8LA 2VJ4A 4DGWB 3ZR8X 2NVQJ 5KHDA 4KFCA 2HKXA 1R49A 2JRMA 2Z16A 5IP7J 2R93G 2W57A 2QSHX 3VWBA 3DCFA 3FKIJ 2A6TA 4EGQA 3I55I 4F93B 2DDBA 4HX7A 2EJRA 1M7JA 1ZN2A 2DYRH 2ELJA 2Y0SE 1VKZA 5LGUA 2VOBA 3DEUA 4DR5H 5B5EC 4YR2A 3J80W 4XLPF 1J5YA 4MV8A 4A3FJ 1FP1D 1BBYA 3OSPA 4O3SA 2ZJTA 1IRXA 3HRUA 3JRGA 2LBFA 2BW3B 4X65H 1Y1VJ 4JI7H 2E5LH 5EEHA 3K4LA 1ZRDA 4I7HA 1UMQA 1HLVA 4IRIA 3CC4I 4QSHA 3OIOA 3RJPA 4BJ5C 3OYLA 3JRHA 1FVIA 5DCFA 1YTYA 3SFZA 1RJRA 1JE8A 3HKZA 4ME6A 2PMZE 4AIKA 1PDNC 2D5VA 1ZHSA 3DLAA 2BXYA 1MKMA 5LHGA 4ZYHA 2X0SA 2R7TA 3BABA 5IYDG 3H9GA 4W1UA 3GIDA 3IRRA 2PMZA 1MBEA 2HR3A 4I02A 2XAHA 1QNTA 3P9KA 4CZZA 1ZARA 4XRSA 3LAPA 2WWYA 1ITYA 1JDEA 2UUAH 1S7EA 1JIHA 3AG4H 1NK2P 4OIPF 1FBUA 3JRFA 2FXAA 2LSOA 3N42B 4MLOA 4L1KA 2IS6A 3N44B 1QZYA 2RNJA 2CFOA 4IPAA 3TQNA 3C2HA 1T2KA 4XICA 2DN0A 2ZB9A 4P55A 3L2CA 5IP7G 2ATLA 1FBSA 5KNLA 1ZGAA 2NS8A 2CV2A 3QU6A 3E0JB 1ENHA 3OY9A 2W9CB 1V5EA 2XD4A 3BQ1A 4QWDA 3GIIA 4XOTA 4IWXA 5F27A 4IL6C 4U7CA 4K0KH 2FB9A 1E3PA 5BPFA 2BQ3A 4BQNA 5E8GA 1R7JA 3JSPA 3VPCA 1R5GA 4YQWA 1IO2A 3GVAA 3R0AA 1Y1VG 1YQAA 1X1PA 1P7IA 2LMDA 2YX4A 4E7ZA 4EGYA 3M8JA 4Y52J 1JDBB 3LMLA 3RV4A 2QF7A 4CCNA 1BI3A 2K4BA 4L9JA 3WTUC 2M0CA 3HXLA 5IOYA 1FIAA 2UUZA 4QWBA 2LREA 4Z2YA 3GV5B 4J01A 1JTXA 2M2EA 3HUGA 3QPLA 2LVSA 1DGWY 4MEYF 1U5TB 3OWTA 3JRAA 1R1VA 1QZZA 3OYHA 1KJIA 3ABMH 1Y1WJ 5J40A 2E71A 2OWOA 4A3LG 4GDFA 1SEUA 3R5XA 4CC5A 3RKYA 4RB3C 5J3LA 4RAGA 5IYCG 5FGMA 3OYCA 5LHHA 4QWAA 4UFZA 2V6CA 2RF4A 2Q8KA 5L3EA 3KYLA 4A12A 2CRGA 1IUFA 4UHTA 1T08B 4AU7A 3OYBA 3TP3A 4N9IA 4ESFA 3BTJA 1B9MA 1GSAA 4C2MJ 5E3OA 1WSUA 3HKZN 4ZYEA 5D1OB 5KFUA 2V1DA 4NBQA 3V7SA 4CHUA 2WYOA 1NK3P 1K1QA 1BI1A 2FSWA 3TIIA 1R1UA 5D6FA 2G0EA 1SFXA 2PMZN 3I64A 5HLIA 4F4XA 3N43B 1IN5A 1JHFA 1R9TA 2GOXB 3O6BB 3WE3A 2PLYA 4F4WA 4M3EA 3L2QA 4HQ6A 1FOKA 5F6FA 5H20A 3G71I 4I98B 3CMEI 2EV5A 2VUGA 4MV3A 5AIQA 3G4SI 2M5WA 2X1EA 3Q3SA 4DYRA 3Q0WA 4RDUA 3CUOA 2FD5A 5GAHJ 2CG4A 5LA6F 1B72B 2E35A 3WE2A 3HTSB 3B6AA 5IWAH 1FMVA 1NTCA 3ISPA 1XX5A 2OZ6A 1WJAA 3OUZA 1TA8A 3V42A 5FJ8J 3MKYB 1KQ0A 1UG0A 3FXJA 2AQ4A 4ENNA 3JW4A 4XLAA 3V7RA 1X3WB 2GOMA 1QBJA 2RVCA 3BA9A 2CZGA 3W6KB 3RQIA 4QW9A 1D1CA 3LSGA 4I99C 4P1WA 2HZTA 3VYUB 4EV0A 5F0HA 5IP6A 4EGZA 2LD5A 1G4DA 3RJ0A 1Z2PX 1Y1WG 3OL4A 5ICEA 2DT5A 3ZQFA 4B3XA 5KT2A 2HTJA 2NVUB 3OV8A 1A04A 4BKXA 5ICCA 2Z3YA 3VDXA 4BXFA 4MTDA 3MFIA 1YIOA 3HGYA 5F9NA 4DQ2A 4BWSC 2XB0X 2DT6A 5ILSA 4AVZA 1S29A 3K70C 4CYCA 1EZ1A 2UXCH 2R7XA 4UCSA 4K2EA 1SFOA 3DU6A 4DV7H 1BJAA 1K6YA 1MMAA 2VQCA 2HYGD 4A2AA 5FD5A 4LH6A 2E36A 4DR2H 2OCCH 3WTVC 3A01A 3J81Z 3C18A 3KP2A 4Y7NJ 5F1JA 3G6EI 3HOXJ 2FKLA 2W4SA 3W2VA 3QZ8A 4LOCA 5J2TF 3HBLA 1RETA 3LQQA 2P6SA 1A36A 3BLYA 2Y75A 3GUDA 2RGVA 4DLKA 3IKVA 4D5CA 2FU4A 4QWCA 2EIJH 2EFWA 2HQRA 5DM6F 1AOYA 3U2RA 2DPIA 3LMMA 3D1NI 3H9JA 4U6PA 5IT9Z 4LSAA 3CO7C 2DFFA 4EM2A 3DBRB 3I56I 4AM3A 2ADUA 3D5SC 5FJ8G 2CQKA 4B1RA 1CS0A 3ZQLA 1A6IA 3HM5A 4DV6H 4B8XA 5CVIA 4E7HA 2WB1A 4XX0B 4NHJA 3F3XA 3M1CA 3MZ8A 3OSFA 2X6OA 5LRRA 5DYMA 4EEQA 4R7RA 1S3JA 5HS7A 3V6KA 3QAHA 2V7FA 5KFZA 5DLFA 1Z2OX 3WU2C 2BOLA 4DZJA 4IOCF 3R23A 1TC3C 4DV2H 4H0EA 1FC3A 1O57A 5KT7A 4B43A 1E3OC 3K0LA 1ZG3A 2P6TA 2F5CA 3RQ4A 4JYKA 2IS1A 3F6VA 4ED0A 3QFFA 2UUBH 4EFEA 3HOXG 2VT3A 2P4WA 3OSGA 2NVYJ 3HHGA 5FLVA 4BQOA 2GIVA 4ITVA 4XMYA 5C1OA 1CF7B 2RV8A 5DGBA 2PX9A 2LOOA 3BP8A 2PFBA 2M0MA 2QGUA 3AG2H 2ZMEB 4UCRA 1BC8C 1DDNA 1SVLA 3HOUJ 4IRKA 3J7YJ 3HZJA 1XMAA 2JA5A 1QPMA 2JJ7A 3MFHA 1V51A 4I4TF 1PYVA 1GV2A 2HNHA 4F3QA 4J00A 1U78A 4I6ZA 5EZHA 2C00A 1TT5B 5K5RA 1LE8B 2YSRA 4F7ZA 2P81A 2R7QA 4JX4A 2ME0A 1VFCA 3KHGA 2UV1A 3M07A 2VKEA 3GTPJ 3PUBA 3OOUA 2OPTA 3HOZJ 3PNVA 3OS1A 3DBHB 2JWTA 1KZHA 5LD2C 4HNVA 2STWA 4EJTA 3JAMW 2FJZA 4DV3H 3KETA 1JUPA 3DXJF 2FK3A 5F9LA 1ZRCA 3RYPA 1UELB 3MWDA 4LSXA 1FKAH 2M1BA 2R7RA 3RGXA 2GA2A 4BQQA 4ECQA 4M9ZA 2H94A 4QWQA 2IA2A 3UR3C 5EG0B 1CQJB 3B6CA 1IGNA 1K61A 2UXNA 4ED1A 1FOXA 1TNTA 4HNTA 1WJDA 2K7LA 3QQAA 5F04A 3FDSA 5FLXW 1B6SA 1Y14B 4CA0A 5DD4A 2X85A 3AL0C 3GTQA 2HI3A 1TWAJ 2WB1N 4G6QA 4KT5C 4LFUA 1Y8QB 5JLXA 1KA8A 4MGRA 4X0GA 5CB4F 2R8HA 5HDNA 2IS2A 4UY8I 2XF7A 3AFHA 3V4ZA 2KPMA 3K69A 3LWFA 3BTLA 3L00A 5JHUA 4KDPA 4XLNF 2J5PA 2OH2A 2M87A 1RR7A 4LK0F 2YU9A 1BR4A 1XB4A 2K9NA 2LFBA 2LKPA 2VB6A 5HOOA 1FOYA 4C5BA 3SZGA 2QQAA 4GFBA 4Q43A 3HL2A 1ETVA 2FX0A 2LLKA 4BBRJ 3HPHA 3LSTA 1UJ8A 4Q44A 3HOUG 3Q9VA 4ASNA 4ENMA 2DA2A 4XL9A 3W6JB 3K2ZA 2NU8B 4HEA2 4MEXF 3GXOA 4RAZA 4IOAF 1W7PD 1DPUA 2NYXA 3BTIA 3NGDA 1QZEA 1R6RA 4OIRF 2YW2A 3H1CA 1OLTA 2CUFA 2DT7B 3Q9SA 4A0ZA 2V59A 1ZQ3P 2V1XA 2R8JA 4H4KC 2ZDGA 5KFVA 4QW8A 3K1MA 5DLGA 1YW9A 3OTOH 2E60A 3ZGKA 3OYAA 2CUZA 3RPUD 4HA8A 4BJTA 4ENJA 4B3AA 3L2PA 1VQKI 5BMVF 2E34A 2H1KA 2X51A 4PCQA 4HLXA 1N78A 5CQEA 5LOVF 1ZGJA 2KRFA 3JRDA 1ZTRA 1I6XA 5CVJA 1HW5A 3EETA 3OS0A 5KFTA 4YB8B 4FU0A 4TQRA 4UUSA 3I0TA 4Q5SF 2OD5A 1K79A 1AA7A 2VUMJ 4V2GA 4EJWA 4D1QA 1X1DA 1RI7A 1QHGA 3RB0A 4U7DA 2EQRA 5TGTA 1G6NA 1KYZA 1QGPA 2K3PA 2CSOA 1BJZA 2MD5A 5H6RA 1LUJB 3KPHA 1GGOA 3DEWA 5EDNA 3J80Z 4IHVA 5BQTA 3CCYA 2VPRA 3E5XA 1BGWA 5T14A 5LMUH 3L9FA 4QTRA 1DGSA 5B66C 3TINA 1M6VA 2GZWA 2OCEA 3A1YA 1T95A 3F9KA 4RUAA 5C44J 3KCCA 1D3YA 2R7UA 2ZDHA 2EBIA 4Y13A 2STTA 2B9SA 3ZP5A 4BBRG 4HZFA 1TLHB 5CQGA 2WY7Q 2CH0A 2FE3A 4E7LA 3K1PA 1OMIA 3BQYA 1UNNC 4MTEA 2CWEA 2IMWP 2M45A 3RB3A 1EUCB 3WO0A 4G7ZF 3U9GA 4E7JA 1MBGA 3OHAA 4L0YB 1EH6A 1OYYA 3S2HJ 4ZZLA 4J19A 3E7LA 5GAEJ 2JA7J 4ESBA 2R3SA 4I01A 3T5XA 3JRXA 1QQIA 2VA2A 1W93A 5DGAA 5DG8A 2IS4A 1SC7A 4IVNA 4PDBA 2DCEA 1W5TA 1J9IA 3PO3J 4M6XA 1FTZA 4PJLA 1RUNA 4Y17A 4P96A 1LVKA 3C2BA 3E5QA 4ZDOA 4XN0A 5JH7F 2X48A 4FQGA 4D7NA 2CQQA 4PGHA 1ZQ7A 2NRAC 2G7UA 2P7VB 2GIZA 2PN6A 1TZLA 4CXFA 4IKFA 2FLLA 4JV2A 3IKTA 2MLGA 4EBDA 3GO5A 3SFIA 1F4KA 2XAFA 5CA0F 1M1EB 1IN6A 4AYBA 3TQ1A 2NU6B 4AC0A 1CE8A 1B1BA 3KP7A 1J7KA 2BVMA 3M9AA 1MJAA 3K4KA 1VQNI 3KLOA 4FE7A 4OMZA 1HF0A 3Q5FA 4ETSA 1S7AA 1SAUA 1WRJA 5C44G 4F50A 2WBMA 3GIPA 1I6HJ 4ZDLA 3CDLA 4HX8A 2XASA 2XGQA 1KONA 1W0TA 4XYLB 4LG0A 2I80A 2IGKA 2R7KA 5L9XA 2E2IA 2XF6A 4DYCA 4OMYA 1O3TA 1LFBA 2K9QA 3CCJI 1XDUA 5HNFA 4YJ3F 1KBLA 4XKCA 3ZMVA 3SDGA 2ZDQA 4M9XA 3QPTA 4LGWA 3HOYJ 2JA6A 3RIRA 1FT9A 2D2WA 2DPUA 3A03A 5D8KB 2DA7A 1DQUA 5BS6A 1PUFA 3GLXA 2W85A 1S5LC 1LNWA 4DW6A 1ON1A 2PQ8A 4DR1H 2E2JJ 3K4MA 2P7CB 2VL8A 1L0OC 2MBFA 3BG3A 4UVCA 4CDGA 3R5FA 4ZOLF 2EZLA 2GBYA 2ZJRF 2FPPB 3ZXSA 3O3KA 1TWFJ 3KXYT 4MV6A 4WXDA 1YITI 2B63J 4LD5A 1GLNA 3REOA 3GIMA 4UB6C 2NVXJ 3QYEA 4BXXJ 1U9OA 3M9MB 3BTCA 2E1MC 5JVTA 2DU9A 3CJRB 3V4GA 1IF1A 3OIPA 1UC8A 3DV8A 4YAJB 2DFIA 4J9NA 1OISA 3PO3G 3KFWX 1I5ZA 2IRFG 2R84A 4A2UA 1AUVA 4JK1X 5J2UF 2KISA 3GV7B 3CLOA 5E17F 5LRSA 2HXIA 4ZTFA 3MR3A 1O3SA 5FD6A 3C0FB 2PG4A 4GYIA 1W36D 1YS6A 2V5AA 1XGMA 2DMPA 3TIGA 3DTIA 3ECOA 3U9SA 2OA4A 2VXDA 3KP4A 1MZBA 3RGZA 2FQ4A 3D0SA 3PW7A 4ZHQF 1A5JA 3IN5A 3VFZA 2FEZA 3H5AA 5J8CA 2VOOA 2EV6A 2VBZA 1LPQA 1GO3E 5DTDA 5K5QA 3PW0A 1IXCA 2K4JA 3PFYA 5EJCA 2FQ3A 2CW8A 2KZVA 2ZNYA 4AYBN 2XSJC 1I50J 2W6PA 5HODA 3LQRA 3F22A 1HA8A 3O2PE 1T56A 4XQFA 5KFYA 4O2BF 3W2AA 2NU7B 4JYAH 4LLGF 1W5CC 2V4JC 2KL4A 4B09A 3HOYG 5L1JA 4HW0A 1YW7A 1SFKA 4UB8C 2R5ZA 5FB2A 2MLKA 2V9KA 2VJJA 3CESA 3DKXA 4QLCU 2NAZA 2W7OA 4PJJA 2D45A 2H8WA 3P9IA 4RNMA 2XUBA 4XKBA 2K02A 2XAQA 3L09A 3CDIA 5AONA 2B63G 3LA3A 2PJRA 5DG7A 1VNDA 2H27A 5KFBA 1DV1A 2TDXA 4C3IJ 1WCMA 2L2OA 3K6GA 2DYSH 3I9V2 3WGIA 4BXUA 3PR5B 5E1ZB 3ZRGA 4HNUA 4NXNH 2VI6A 1ONVA 3EPZA 1TQIA 4ZTJA 2VBWA 3F8FA 2NUAB 3M1EA 5FO5A 3EQLF 1RIOH 4XBFA 1FY7A 3FK6A 1Z9CA 1MNEA 1MDMB 2JK3A 3GIJA 2EIKH 2DW4A 1UG2A 4KIFA 2FBKA 3MD2A 2ASLA 2X0LA 3KZYA 1D0XA 3HDDA 4EJVA 3RBDA 3QZ7A 4ZYAA 4BYYA 1N33H 1EUDB 2HDCA 2MGQA 4TV8F 4DV4H 3GWZA 3ZMSA 2XPVA 2OTLI 2A6HF 1VQMI 1R5HA 1JUSA 2HTSA 1P6RA 2QKMB 3QYFA 4XRMA 3HRSA 5FKOA 5D8DA 5D1PA 1XSVA 3E6CC 3N41B 4CGZA 2VODA 3PM1A 2HOTA 2M05A 4HSRA 4Q8FA 2DOAA 3T5HA 1B6RA 2VPLA 4A5NA 2BYVE 1QO0D 3FXOA 3I54A 4NUBA 3F8CA 2W00A 3LL7A 2CS3A 5IT3A 2W6MA 1HNZH 2XIGA 1MMGA 2JVHA 4PZJA 2R5YB 2X1CA 4BDZA 3KHHA 2J6TA 5KFIA 4E7SA 1D5VA 5L1LA 2QVOA 2XAGA 5H2FC 3BQ0A 5DS9A 2L9RA 1XNRH 4GKKH 1M0TA 1VQ8I 2JSPA 3CDHA 3FF5A 4RGXA 3E6DA 4ED7A 3L4KA 2DDAA 3HOTA 1IV8A 4JV0A 3FZVA 4B47A 5C4XG 2AO9A 3N6XA 3BC8A 3M3YJ 4G8XA 3N4MA 4J9QA 1X1BA 1P4AA 1WJ5A 2KP6A 1IJWC 5FPOA 2IBKA 1ETOA 2KDOA 1MSEC 4E70A 1IBMH 2Y0SA 1RYSA 2MD0A 4MNUA 2HGCA 3GTLJ 2MC4A 1WQ2A 1UHWA 5LYJF 3ECHA 3GTGA 2V1NA 3RSNA 3V8KA 4ZH4F 2BHZA 3WTTC 3JR9A 3TO6A 5EEGA 1EKEA 2P0AA 1KU2A 3FHNA 2VQFH 4IRHA 5ILVA 3J7AK 4P9FA 4R1HA 4ED3A 3GBGA 4DBQA 3FMAA 2WY8Q 4M71A 4C5CA 4A3LJ 1FNNA 3V7CA 1TT0A 5IP9J 4RAYA 4E4HA 2BQRA 3HOWJ 3GMEA 3ORRA 5IYCJ 4M9SA 1YRNB 3S32A 2FPGB 1H9GA 2NNYA 5K2MA 3KZZA 1U5TC 3OSNA 1TWHA 3I3LA 4NC8A 1J59A 4B4CA 1W7PB 3BR2A 2KLOA 2Y30A 4GRIA 4HDVA 4U0WA 1L3LA 2R7ZJ 1K83J 3QOEA 2CMPA 1E17A 2Q2EB 3TDUC 1PUEE 1WJCA 3EYYA 3GEZA 2COMA 3K4NA 3PIPF 1S8NA 4I50F 4DL3A 1ETXA 5CPRB 1MW7A 3ORQA 3BQ2A 3TL4X 1KU9A 1BL0A 4XLCA 3CUQB 2I8CA 3KTMA 2W9CA 2NNNA 2W9AA 3RFCA 4CH7A 2VC0A 3CCEI 4MV4A 5LP6F 3FISA 4DYQA 3EUAA 2XDVA 3K4BA 1IZ1A 2FA5A 2Y69H 5GPCA 4QJFA 2J6UA 1SVMA 1GVDA 1MSFC 4F91B 4XKVA 1TAEA 1LVAA 3PSFA 4IF4A 2OV7A 1BXRA 2XGPA 5FLXZ 1OCTC 1O7LA 3T8RA 5KX5F 2CJJA 1T36A 2O3FA 3IAM2 4L9TA 4NQWB 1BJTA 3WTSC 3C3WA 3JCUC 2R92J 2AXTC 2BY1A 3S3NA 2O6GE 4BNCA 4TV9F 2DA6A 4F52A 3J7AY 2WV1A 1EF4A 2DTZA 1V4YA 3H92A 1U5TA 4V2FA 3I5UA 4A6EA 2IP4A 4IRCA 3Q1KA 5EF6A 4IHSA 1TWCJ 4S04A 2JUCA 3ONQA 1KJ8A 1LQ1A 2YL2A 1WI3A 1JJ6C 2VONA 4B3RH 3GLKA 4ESJA 2EFQA 2Y0SN 3LOCA 3E5NA 4IHWA 3KHRA 2O8XA 1WJEA 5D6EA 3WU1B 5IP9G 2M7BA 1XDSA 3BG7A 3HOWG 3I4NJ 2F4VH 4RGRA 3IAS2 1CGPA 1BC7C 1AHDP 5BR8H 2V58A 5D1OA 1YYVA 1RYRA 2BXZA 3DKWA 2I10A 4DNCA 5EDWA 3I59B 4JI4H 4ED6A 2R7ZG 3HB9A 3ESWB 3M8EA 2HQNA 4M3DA 4BY1J 3BROA 2JA8J 4MV1A 3WHBA 3H40A 2FJ1A 2XHKA 3VSKA 3G3ZA 2ECBA 4PFOA 1OFCX 2F6CA 4CICA 1JKJB 1I3QA 1YG2A 2W6OA 1G3WA 5E18F 4YELA 4YIRX 2NOGA 1IOWA 2CKZB 5DQGA 2LC2A 3CQZA 3QP6A 3S3MA 1AN7A 3OYJA 1GHCA 2V9WA 2GPWA 1B72A 2V9PA 3I12A 1SFUA 2QBYA 1RESA 5KFJA 2BY2A 1F1ZA 2YYAA 1TTYA 3TMOA 2E1NA 4UV9A 3OOPA 1QU3A 3BJYA 2LTPA 1GDTA 2FLNA 2F2EA 3GTOJ 4GKJH 2L5QA 2IA0A 2C28A 2R92G 1TWGJ 4O6JA 4WWCA 2C2DA 2OLSA 2EFOA 4ZYDA 3GTMJ 5DG9A 4F92B 4O3PA 2HPIA 2UXDH 2XB5A 5J1YA 2WTFA 4DR3H 4BHBA 4D5FA 2MYSA 2QM3A 2ZFUA 3P9CA 3ZQHA 2DWCA 2DTRA 4FX4A 1VF9A 3E97A 3IH4A 4PUSA 4U0VA 4IR9A 3IP4B 4BEHA 4XR6A 1S7OA 1XGSA 2YX7A 1HDPA 3LP8A 4GLXA 5D8LB 1ZLKA 3NEUA 5EYRA 3DPUA 3BR6A 1OCZH 3I4NG 2QUFA 4LFAH 3MCZA 4JX6A 4CCOA 5B1BH 1ZGWA 1DU6A 3G6XA 1J09A 4A69C 4Q8EA 1Z6TA 4BY1G 3GTJA 2JA8G 3K5HA 2UXXA 1D0ZA 1DIKA 4AD9A 3GZNB 1QA6A 2A6EF 3I71A 2JTVA 2FRHA 5DEQA 4DBRA 4OAYA 3ZQIA 2FF4A 3HOVJ 4MA0A 3RCOA 4EM0B 2R8KA 1K4SA 1G8XA 2EA4A 1FSHA 2ZJ2A 3RV3A 4GC7A 1VQ4I 1ZG5A 2HYJA 1T38A 4RNNA 2ZSHB 2CU7A 3ASOH 2R7DA 4MHGA 5KFLA 3QYBA 3CCMI 3T1BA 4LLLA 2XGXA 1KJQA 2DIKA 2WV0A 2MC3A 3K2AA 2Y9YA 1HKTA 4EGJA 5DCMB 3T1HH 3PQKA 1P7JA 1BW6A 3DWLE 4EBEA 5LXTF 1Z3XA 3H0GJ 3JAMK 2M8GX 3L2VA 4DR7H 2ZMEC 5A2QW 1FYLA 2OF7A 2R7VA 4EG0A 3ASNH 5CVRA 3L2RA 2DMNA 1R23A 4RM3A 2QENA 2XV4S 3D5RC 4W97A 5FKNA 1VQOI 4XZ3B 2VJIA 1XS9A 5FLXK 4XRFA 1SAXA 4X6AJ 3RUPA 2L3DA 4HPQA 1G3TA 3MR2A 3H4DA 5L3DA 2IA1A 3EYIA 1KQ9A 4RA2A 3U9TA 4Q47A 2IGOA 5K1YA 2YS7A 1FJLA 2YZGA 2IGNA 4ECZA 4RLFA 3SYTA 2UWMA 1C30A 5FLMG 2L4MA 4UXNA 5JVDF 1SVOA 5BPDA 1VI0A 1X1AA 4N9HA 4DV0H 2E2HA 3IV5A 2NS0A 4GYGA 4I0BA 2VQEH 2PMHA 4J9MA 2RC4A 2WAQE 1XGNA 2EILH 2VQDA 5HLHA 4EJUA 3GV8B 3IG0A 4YAKB 2B7EA 1JGSA 2DZDA 1CF7A 4KN4X 2CUJA 5GP9A 1N34H 3OYDA 2JEFA 3HSFA 3HOVG 2AGOA 2ZMEA 2C6YA 4MQVA 1JT6A 2GAUA 3R61A 3KALA 1TQMA 1WH2A 2DFEA 2GM4A 1XPXA 2KT0A 3H5NA 3EDPA 2IP2A 1XN7A 1ETWA 4NDLA 4FT8A 3E6BA 5CJ9A 4AIJA 2FK2A 4RU9A 2VA3A 2IJLA 2QSGX 4R8HA 3IL2A 4LJZF 3DBLB 4RB0A 5E8IA 1LE8A 1ZH5A 2ZKZA 3GFMA 3H0GG 5JVLA 2VKHA 4ZI7F 3GTKA 4IZOA 1R1TA 2E5NA 1I7NA 1XCVA 2E1OA 2VJ5A 4FX0A 2Z1DA 5J8FA 2KIQA 2A07F 3IWZA 1B6AA 4C5AA 2KRHA 4EYHB 4U7BA 3H0DA 2CUEA 3FKJA 1YJ9I 4EEYA 1POGA 3OS2A 3ELKA 4PDKA 3MVPA 1MMSA 1R4NB 1OWTA 3SDBA 1JTYA 4DIQA 3OYEA 1JT0A 1WPKA 5L3BA 5EG0A 2F4MB 3E3VA 3H9QA 3MKZA 4ENKA 2VPQA 3JSNA 3GF2A 3KZIC 1H9TA 4Q45A 1A6QA 1S68A 4AIDA 4AWXB 4L18B 3BCAA 5IOZA 3PUFA 3IH2A 4IR1A 1A35A 4LF9H 1K78B 1Z91A 3FXRA 1XD7A 1ZR4A 1P92A 2VBXA 2ZXHA 2G9WA 4PWQA 5CKTA 2MW8A 3SZTA 5KFHA 4XKWA 2UVUA 2TCTA 3SQNA 4I55F 4APMA 2HU9A 1ZK8A 2P5VA 2YZNA 2RDJA 3LSMA 4HBLA 3QU3A 4IHXA 3KX2A 5KAFC 2C22A 3MJFA 4YFXF 3H3VK 2QKLB 1R5ID 4RGSA 5FKKA 4N4OB 4IXAA 1BI0A 3CZ6A 3FIWA 2PBIA 4HQEA 1N36H 5LGTA 4RS8A 2R93A 5ILUA 1AKHB 4BDYA 1O3RA 1KQ8A 1TQPA 1Z7UA 3ZQCA 1JKRC 1DU0A 3CMYA 3A0HC 1T8IA 1PP7U 3K3VA 4LMYA 5HVQC 3FXKA 5E3LA 1EV7A 1HR0H 3M7GA 4BH9A 2OUMA 1HDDC 1F43A 1R00A 2XPWA 3MN2A 2R82A 3HC7A 3VYSB 1J0RA 3TO7A 4KISA 2FK1A 2I5UA 3I4PA 1A0IA 3F0CA 3CJQB 1Y0UA 2Z33A 4QWEA 1T3NA 4YY3H 4R8UB 5DV5A 3BT9A 3OHBA 2LP0A 2ZXJA 3B73A 5BPHA 2COBA 1ON2A 1TL8A 3JTHA 4LF7H 1XC5A 2JZYA 4XRSG 1E4GT 1PX2A 5KFKA 1RKWA 5DQHA 2QQ8A 5KFFA 1HNXH 2LY2A 2KIUA 2HDDA 1HKQA 3S2DJ 4IO9F 4KMFA 2KJCA 5KG3A 2ISYA 1SMTA 2P0WA 4QPQA 3N40P 5KG6A 2C2RA 2W48A 4I09A 5M5XJ 2KJBA 1BIBA 3RTXA 2A68F 1OJLA 3OYGA 5EZYF 2F5FA 3SZPA 4CO8A 3HRTA 1R9TJ 1H89C 3F8BA 4A3KJ 5E3MA 3FM5A 4FISA 1ODDA 1HW2A 3E6MA 2NOJB 3ZMDA 4HYKA 2X6YA 2XVCA 4QIWE 4E4TA 2RQPA 3S15J 1F9NA 1Z05A 5K7HA 2WAEA 2W6NA 2FLPA 1WJBA 4J9SA 4V19K 1MMNA 1IN4A 1LJ9A 1SD5A 2BVLA 3LSHA 3LFUA 4LITA 3ZQ7A 4FCYA 1U3EM 3H3UA 4BE1A 3KAKA 2ELKA 1UHMA 2XCLA 4QIWA 2JPBA 1ZREA 3WTXC 2L4AA 4M73A 3DKYA 3G6YA 1N75A 2E5ZA 5IYBJ 1OR7C 3A02A 5I47A 1ORKA 3FKIA 2W6ZA 2HYFA 4ABZA 3VPRA 1P4WA 1UFMA 5M5YJ 2HVRA 2XCAA 1KJJA 2X9DA 3EUKL 2OZUA 3DP7A 2ISZA 4RZRA 2F5DA 4JI3H 2XAUA 4L5EA 2IXSA 4E7IA 3H35A 4PSXA 3RF2A 5KT5A 3CCUI 3S8PA 1FEXA 4O2AF 3T5JA 1Y1VA 4XSZF 2ZM6H 6PAXA 2FMLA 4RNOA 5EGOB 5LGNA 1VZ0A 4XYMB 3HSRA 1IN7A 4II2A 2GXGA 2NXNB 5KFGA 2XPUA 1SFOJ 2YUSA 1EYZA 3RAQA 2FOWA 3FDYA 1OQYA 2IT0A 4HAMA 1J2XA 2HFHA 1GXQA 3L7WA 3RI4A 3QRFF 2VOPA 3KIOA 2GA1A 5F0CA 5KFXA 4TQSA 3WG9A 2I87A 1JI8A 2UU9H 2DMQA 1X3UA 2EB7A 2IEKA 2EV0A 3EPGA 4A3KG 1FWZA 1OR7A 3Q8SB 2XKOA 3GZ5A 4XLEA 3VSLA 2OQGA 2QLZA 4IAJA 4A3IJ 1I1SA 1Y0NA 4XM3A 4IX7A 1XGOA 4YBZB 1XSXA 4XOPA 4DUZH 3RB4A 3ERMA 4BE0A 2W1OA 3ML6A 4NNJA 3J81W 2RN7A 1Y6IA 2A05A 2HGSA 4LIVA 2K40A 4YIFA 5L1KA 3PL8A 1IN8A 2O8KA 2DK8A 3F72A 3TO9A 1WJFA 5KG4A 4Q4ZF 5IYBG 2CQXA 1YHQI 4RB1A 3OYKA 2LRDA 2A5YB 5KFNA 5KFWA 4M6VA 5IPAA 3F8NA 3VEPA 2O0YA 1Z2NX 3R5HA 2VQGA 4XONA 4ZZDA 5HV6A 3CVZA 2JA2A
chains in the Genus database with same CATH topology
3ZN0A 2M30A 4KN7X 3BPVA 2D1HA 1RUOA 1N32H 3KEOA 5IT9W 1BIAA 3QOPA 1WWXA 4IJAA 4G94A 3HOSA 2K86A 4MQ9F 2DK5A 1P2FA 3K9TA 2KSWA 4WCGA 2WDTA 4BQAA 2PI0A 2Q2TA 4HDUA 5LMNH 2Z5UA 3WODF 5FPRA 2RKHA 3IHUA 2ZBKA 2CO5A 1G3SA 1YW8A 1HSTA 4KA4A 1IBKH 1V4RA 2E7XA 3TDZC 1E2XA 4G7HF 4BHPA 5HDKA 1XSDA 3J7AO 4WF2A 3RKWA 2RGRA 2CGPA 2BBYA 2O03A 4EFBA 3BOQA 2DO7A 4R79A 5D5UB 4LF8H 2V9VA 1FYMA 1V9PA 2A3SA 2ETHA 2DBBA 1T98A 1IUYA 1Z1DA 5F64A 4JBAA 1SD7A 3DPLC 1MDMA 2IPQX 1KU3A 2Q2UA 1SYXB 2ZFWA 2VT2A 4A2BA 2ESHA 2KKOA 3ROUA 2PJPA 3LFKA 1U8RA 1XMQH 4WX9A 1J75A 4OIQF 1IBLH 4L9NA 3F6OA 3R0JA 2DQRA 1USSA 1T6SA 3C7JA 4JI6H 2OAZA 2D1VA 2A61A 1R58A 1STZA 5HS8A 1LDKB 5L3FA 2VC1A 2LNBA 1SMYF 3WTYC 2FBIA 3FXQA 1LDJA 2L01A 5DUKA 3FMQA 5ICFA 1IW7F 2G7HA 3CUQC 1FZPB 3T8TA 2R7FA 4X66H 2DLLA 3GYHX 2EA2A 3HRMA 4JI8H 3C1DA 2LDUA 2QQBA 2QZ8A 5FFZA 3MWMA 4M6YA 4ON0A 2HVQA 1W7PA 5JI6A 4HF1A 3N97A 2VPSA 2Q2EA 4FHTA 4KIGA 5KK1A 2JPCA 2V79A 2Y48A 3GFJA 4P5OA 4HQMA 2JSCA 3CUQA 3HHHA 1KYWA 3RPUA 5D5WB 3TOAA 3KLNA 3JAMZ 4UCOA 2YU3A 2Q0OA 4IRGA 3HIFA 4GCVA 4OOIA 1U2WA 1YFHA 2IVMA 3NQOA 4NQWA 1DPRA 3GFLA 1XNQH 1NHAA 4M7EA 3RYRA 1LDDA 1B9NA 1ZG1A 1I27A 1FYKA 1OKRA 2ZNZA 2YPRA 1BN5A 2WTEA 4B3MH 3MAJA 4L0ZB 4EMSA 3I53A 3TKYA 3GFIA 4ZYGA 3ERED 2IW5A 4G7OF 3VODA 3I59A 1V3FA 3CJNA 1JHHA 1USTA 2DAOA 4X62H 2BE5F 3RPQA 4JI0H 1UB9A 4KNYA 1EH7A 4YFNF 4MV9A 1IRGA 1IXSB 2ELHA 1WI9A 4KHPH 1ZHFA 3QPHA 1G3YA 4Q0YA 4JI2H 4HV6A 2UZKA 2ACJA 5L3GA 1XMOH 3GX4X 2P8TA 4TV7A 5JFRA 1LB2A 1R22A 1IXRC 1KGSA 3FX3A 5A2QK 3B02A 2FBHA 4IHTA 1B4AA 5JR3A 1HSJA 1FP2A 1MJ9A 4JI1H 4WXHA 1TW2A 3F21A 2XKPA 1BI2A 5CLSA 1FSEA 4NB5A 5E1XA 3MEXA 3DPTA 1VTNC 4GXOA 1XDNA 5D4RA 3HTUA 2PMUA 2P5KA 3KAJA 1OYWA 2QYOA 4BAYA 2MH9A 2QBYB 3VOEA 4D0PA 4AQYH 4LF4H 3COAC 2UXBH 2H6BA 5TRDA 2HKOA 2HWVA 1ZHQA 2L02A 3ULQB 2FOKA 1KU7A 5DD8A 4NXMH 3KP5A 5DCMA 3FM3A 3PFIA 2W84A 1MGTA 3LA7A 2QWWA 4PGGA 4UCUA 3R6SA 3JSOA 4KUMA 3HYIA 2B0LA 3RKXA 2YCHA 2KIFA 3PQJA 1FLIA 4JQFA 1YS7A 1D8KA 2BV6A 3SXYA 3H3ZA 4BHCA 4S05A 3DF7A 3S2WA 4DV5H 4UVAA 4EJOA 3GZ6A 4UCVA 1REPC 4AIHA 2XROA 3G73A 1L2ZA 3IC7A 1YLFA 4AVPA 1S6LA 3WTWC 1ZAOA 1LEAA 3DQVC 4LK1F 2EFPA 3H20A 1GVJA 1W4MA 2ZCWA 2MA3A 3ABTA 2Y0MA 3IWFA 1HXDA 3KP6A 3M4IA 1I1GA 3DFGA 4CC6A 3BPXA 4GO1A 2W24A 4DV1H 2EK5A 2Z99A 2GWRA 1ZYRF 2VE8A 2O61A 4HLYA 1M0WA 3QP5A 3F23A 1P4XA 2OU2A 1FBQA 3LAJA 1GXPA 2RDPA 2HVSA 4WK8F 4FM9A 3P7NA 2VE9A 5FFXA 4J0MA 2FMYA 3CO6C 3ZMTA 3K1NA 3BDDA 1D8JA 2OBPA 3DF8A 1DUXC 5E20A 1MD0A 5H6QA 2E7WA 4HV5A 5ICGA 1K78A 2AXLA 3FMSA 5D5VB 2MH2A 1FJGH 2JRTA 1YO5C 3KE2A 3ZMUA 5KVRA 3MFKA 4LLNA 2H6CA 4HYEA 1B59A 2HOEA 2E1CA 1MJBA 4OINF 3E5UA 3U1DA 3CTAA 3MZYA 3BJ6A 5D4SA 1LEBA 2PEXA 4DR6H 5LL6b 3RDIA 2AS5F 1DP7P 2A69F 4U0YA 4A0XA 3EUHA 2XAJA 1RNLA 2BGCA 1E4FT 5L3CA 1S03G 3FMRA 5E1WA 4KMUX 2BEOA 2DI3A 4G9YA 2YR2A 4UNOA 4LF6H 1OPCA 3HSEA 4LB6B 4B3SH 2WC2A 1TNSA 1O7FA 2F5EA 3J81K 3BAAA 3BY6A 1O3QA 4GGGA 2CW0F 1SD6A 3JTGA 2CW7A 3BZ6A 1IRFA 3FXUA 3R60A 3V8JA 2V1UA 3BA8A 4KICA 4A0YA 1B04A 5IT9K 2L54A 1R36A 1U6GA 3TOBA 5BMZA 4M72A 4KYWA 4L9VA 1HNWH 5ERIA 4EM1A 1HKSA 3ZPLA 1Q1HA 4KIBA 4X64H 4O5VA 4MV7A 4YFKF 1TBXA 1K7AA 2P5LC 4LFCH 2OQRA 3BJAA 3JSLA 4B3TH 3I58A 3TGNA 1RZ4A 2LF8A 3ZMZA 4LFBH 3F8MA 1TW3A 1BOAA 1I6UA 1ZLJA 2HS5A 5D5XB 5LEKA 2HHHH 3D5LA 2DQLA 4Q48A 1K6OA 5LEJA 4O3MA 2X4HA 5J6XA 2ZO4A 4LH7A 2LF7A 3L4JA 3NRVA 4JV5H 2FNAA 4G6DA 1HBXG 1FX7A 3V8LA 1X9NA 3AAFA 3PN1A 1OYIA 2H09A 2QQ9A 2DPDA 3UQ8A 2XRNA 4OIOF 4Y15A 2K27A 3ZN1A 3M8FA 1F5TA 3WTZA 2GQQA 2CYYA 5DUIA 4U88A 1GYFA 2GXBA 4A5MA 2EFNA 1HW1A 4YIIA 5LHIA 1ZRFA 4LG0B 1J5EH 4M74A 5CYVA 2JT1A 2FNPA 3RIZA 1PP8F 3KP3A 3WGHA 2HEOA 5HS9A 4OX9H 3T0YA 5BOXA 3BJOA 5HLGA 1UCRA 4A6DA 5F1RA 2Z9OA 4L5IA 2M8EA 2VN2A 4UV8A 5CVVA 5ED4A 4UCTA 1W5SA 1O75A 5BPIA 1T39A 5TJJA 4JI5H 4HOBA 4DUYH 4EVIA 4WXCA 3MQ0A 1C0WA 4P9UA 3WU0A 4HF0A 1SFEA 1WKMA 1EH8A 1JXSA 2ESNA 3ABUA 1AWCA 1SD4A 5LBQA 2KIMA 4EQQA 4XSXF 5DDGA 2CFXA 3FHZA 3J80K 2W25A 1H0MA 4L5JA 2EWNA 4I2OA 3T1YH 1BM9A 3LA2A 4UVBA 3GW2A 3R4KA 4YG2F 5CVUA 5HDGA 2UUCH 4YHHH 1Z6RA 5EOYA 5K5OA 1SEIA 4N0BA 1VS0A 4LF5H 3WGGA 5A2QZ 3BWGA 4RZQA 1IAWA 1XCBA 5AIPA 2MCTA 4RB2C 3SHFA 4LB5A 3RTRA 4DR4H 1HQCA 3KEQA 4HX4A 2WE6A 1I94H 3IRQA 4OU0A 3MZHA 2J5OA 2VXZA 4CYDA 4HF2A 1FPQA 3FWEA 4UUVA 4RGUA 1T0FA 2VBYA 1ULYA 4I0AA 5LLQA 3VB2A 1XMKA 1P8LA 4KFCA 2HKXA 2W57A 4HX7A 2EJRA 1ZN2A 5LGUA 2VOBA 3DEUA 4DR5H 3J80W 4XLPF 1J5YA 1FP1D 1BBYA 2ZJTA 3HRUA 4X65H 4JI7H 2E5LH 5EEHA 1ZRDA 4I7HA 4IRIA 3RJPA 1FVIA 5DCFA 1YTYA 3SFZA 1JE8A 4AIKA 1PDNC 1ZHSA 1MKMA 5LHGA 4ZYHA 3BABA 3IRRA 4I02A 2HR3A 2XAHA 1QNTA 3P9KA 4CZZA 1ZARA 3LAPA 2WWYA 2UUAH 4OIPF 1FBUA 2FXAA 2LSOA 3N42B 3N44B 1QZYA 2RNJA 3TQNA 4IPAA 1T2KA 4P55A 3L2CA 1FBSA 1ZGAA 3QU6A 4K0KH 3JSPA 1R7JA 5E8GA 1R5GA 3R0AA 3GVAA 1YQAA 3LMLA 2YX4A 4EGYA 3WTUC 1BI3A 2K4BA 4L9JA 3HXLA 4Z2YA 3HUGA 4MEYF 1U5TB 1R1VA 1QZZA 2OWOA 4CC5A 3RKYA 4RB3C 5FGMA 5LHHA 4UFZA 2V6CA 2Q8KA 5L3EA 4A12A 4UHTA 4N9IA 4ESFA 1B9MA 1WSUA 4ZYEA 5D1OB 2V1DA 3V7SA 4CHUA 2WYOA 1BI1A 2FSWA 1R1UA 5D6FA 1SFXA 3I64A 5HLIA 3N43B 1IN5A 1JHFA 3O6BB 3WE3A 2PLYA 1FOKA 5F6FA 5H20A 2VUGA 4I98B 2EV5A 5AIQA 2M5WA 3CUOA 2CG4A 3WE2A 3HTSB 5IWAH 3ISPA 2OZ6A 1TA8A 1KQ0A 4ENNA 3JW4A 3V7RA 1QBJA 2RVCA 3BA9A 3W6KB 1G4DA 3RJ0A 2HZTA 4EGZA 4EV0A 1Z2PX 5ICEA 2DT5A 2HTJA 3OV8A 1A04A 5ICCA 2Z3YA 4MTDA 1YIOA 4DQ2A 4BWSC 5ILSA 1S29A 2UXCH 4UCSA 4K2EA 4DV7H 1BJAA 2HYGD 4A2AA 5FD5A 4LH6A 4DR2H 3WTVC 3J81Z 3C18A 3KP2A 3LQQA 2P6SA 2Y75A 3GUDA 2RGVA 3IKVA 2FU4A 2EFWA 2HQRA 1AOYA 3U2RA 5IT9Z 4LSAA 3CO7C 4EM2A 2ADUA 2CQKA 4DV6H 4B8XA 5CVIA 4NHJA 3F3XA 4EEQA 5LRRA 5DYMA 4R7RA 1S3JA 5HS7A 3QAHA 1Z2OX 4DV2H 4H0EA 1FC3A 1O57A 3K0LA 1ZG3A 2P6TA 2F5CA 3F6VA 2UUBH 4EFEA 2VT3A 2P4WA 3HHGA 2GIVA 1CF7B 2RV8A 3BP8A 2PFBA 2ZMEB 4UCRA 1BC8C 1DDNA 1XMAA 1QPMA 1U78A 5K5RA 2YSRA 4F7ZA 2STWA 4EJTA 3JAMW 4DV3H 3KETA 3DXJF 1ZRCA 3RYPA 4LSXA 1FKAH 2M1BA 3RGXA 2GA2A 4M9ZA 2H94A 4QWQA 2IA2A 2UXNA 1TNTA 2K7LA 5FLXW 5DD4A 4G6QA 4KT5C 4LFUA 1KA8A 4MGRA 5HDNA 3K69A 3LWFA 3L00A 5JHUA 4KDPA 4XLNF 2J5PA 2M87A 4LK0F 1XB4A 2LKPA 5HOOA 2QQAA 3LSTA 3Q9VA 4ASNA 4ENMA 3W6JB