3EYZA

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna (open form)
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
molecule keywords DNA polymerase I
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3eyzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3eyzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3eyzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3eyzA01
2AGOA 1XSPA 9ICWA 3DOLA 1Y97A 4O5CA 2RDJA 3QZ8A 8ICVA 4F2RA 9ICEA 3M9NB 3A2FA 1SL0A 5KI6A 4DO9A 3SI8A 3VQ6A 4F5RA 4DQQA 3KHLA 9ICVA 3N4MB 2W9CA 1TV9A 2ZJAA 9ICXA 9ICJA 3AVBA 4QZFA 4I2PA 3Q8QB 1S9EA 4F4ZA 2VA8A 1N56A 2HHWA 3B0YA 4P4PA 4M3XA 1N6QA 3BDPA 1BPXA 2IDOA 1KTQA 1ZQFA 4Z4FA 2E4LA 3MXJA 3KHGA 4DF4A 5CR0A 2ZE2A 4RUCA 2W9MA 7ICJA 3G6YA 2PFNA 5BOMA 3ZDBA 5J29A 3C1YA 2PZSA 3RR8A 4KHWA 4M47A 5HRPA 2C2RA 2HNDA 3CFPA 3F73A 3AVJA 4HHTA 3AO5A 1VRTA 1XHZA 3KLIA 4BACA 4CHOA 1A5XA 2F1HA 1MC8A 8ICCA 4QZAA 3MGIA 3V9ZA 4J9OA 4DLEA 4UB5A 1N48A 4E7KA 4FS2A 2YKNA 1D9FA 3MBYA 2HNYA 3QERA 3V9XA 2OPQA 5DMRA 3JYTA 3OYMA 4J9QA 4F8RA 1WAJA 4ECUA 4N76A 4R66A 4CERA 3RAXA 2XY7A 3O3GA 1RBTA 3ISBA 4HTUA 3CQ8A 2DY4A 3GFKB 3K58A 2AU0A 1S0OA 5DDMA 2FPKA 3RB0A 5FRMA 5KG2A 5KG0A 4MFCA 4KB0A 3LAMA 5IIOA 2RDIA 9ICGA 4DS5A 5J2IA 1S1TA 4CJVA 3DLRA 2AGQA 3GV5B 2R8IA 7ICGA 3EYZA 3MR2A 4KLLA 4KRFA 5CYMA 1NKBA 5C5JA 4B9UA 4M41A 3JPPA 4GVMA 8ICQA 3Q8RB 4Z6FA 3OY9A 1IXRA 3V1QA 4QWAA 3VQ5A 4L8RB 3O4QA 5DG7A 4DU1A 2DTUA 3VQEA 2P6UA 4NLKA 2XGPA 3GQCA 4I9QA 1IH7A 3RTVA 2GWSA 1L5UA 1ZQVA 3C21A 3H4DA 8ICGA 4CGGA 2VA3A 5KFAA 2O4IA 5HROA 2XY5A 4CCHA 4O5KA 2RF2A 3NAEA 4KV8A 4M6WA 3AVIA 3Q8PB 4FJXA 4DL3A 3M8RA 3FDSA 2D5RA 5KFUA 4KKOA 2KZZA 1MQ2A 1F21A 3DRPA 3UXOA 3MDAA 3ZSVA 4GXIA 4IRCA 4I2JA 4Q45A 4YXJA 2B6AA 9ICMA 2B5JA 8ICSA 1FK9A 3H08A 1ASWA 2M9NA 2GBZA 2EX3A 2VWKA 5L1JA 3LALA 1HQEA 8ICOA 3HJFA 4AHSA 2NRZA 4R65A 2MAXA 4TUPA 4Z6EA 1VSLA 4PY5A 1TKDA 1Z00A 1QHTA 4J9SA 4CGFA 4RW6A 1JN3A 4CECA 4OJRA 3K5OA 4JV1A 2QXFA 3KKRA 2ZUBA 1ZQLA 1KRPA 1A76A 5JUMA 2I9GA 3RMBA 3NTUA 1T7PA 4JWNA 5HP1A 3WNHA 9ICQA 5D3GA 4NCGA 2HVHA 4B8CA 1KVBA 3G10A 3L2QA 3I0SA 5KFXA 3PX4A 4RQ2A 4QZBA 5KFGA 1BHLA 5HP4A 2BQ3A 3SZ2A 4Z4HA 1U49A 4B9MA 4FLVA 3GIKA 4MEXA 1RCHA 4B9NA 3ZDDA 3UQ2A 7ICTA 1B92A 4DTXA 4QZGA 1NOYA 3AVGA 3NF6A 2W9CB 3OYKA 2BPFA 2OYQA 4QZHA 5KFHA 1EX4A 5L1KA 1NK6A 4CF0A 3OYHA 3ZSYA 4O3NA 4JV2A 1S97A 5T7BA 5J0UA 1Q9YA 3RB4A 1U04A 3WNGA 4ECVA 3ZSZA 1U47A 1LV5A 4I2BA 1X2IA 4NCBA 3NDKA 1JLGA 4Z4GA 1IKYA 5JS1A 1NK4A 1NK8A 4NLZA 4RQ4A 3OVNA 2F1JA 2XRIA 3H8WA 3QO9A 4UAZA 4NLGA 1BPBA 2R8GA 1YT3A 5KG5A 2BCQA 4CJSA 1RDAA 4KHSA 1U9LA 2ISOA 4I7FA 4O0JA 2VG5A 3QEWA 1FKOA 4YXMA 4BWMA 4DMNA 1UT5A 3SPZA 4M0AA 4M3RA 2FC0A 3AA2A 4MF2A 2BPGA 4J2AA 4EP4A 3AA4A 2FBTA 4W5QA 2BE2A 8ICIA 1NKEA 3JPSA 4I29A 1JMSA 2BANA 5FDLA 2VANA 4E7JA 1UOCA 2NRWA 5J0QA 1LAWA 3K59A 1TKZA 4ZHRA 4FM1A 4IRKA 2F1IA 1RTHA 1C0TA 3ISNC 3QLHA 5KTQA 4B9TA 4FLYA 4PHDA 4FJHA 3HP9A 5IIIA 2YNHA 2D0CA 2DPJA 5KRTA 3V1RA 3K5MA 4KHQA 4M9NA 1ZBLA 3TAFA 4PHPA 1IO2A 3OHAA 2V4QA 1RT1A 2LSNA 5HRSA 4XQ8A 3AVNA 1QS4A 1GOBA 5BOLA 1C7YA 5CA7A 3SUNA 1U4BA 4OLBA 7ICQA 4O5BA 3QEIA 5DGBA 2OWOA 1EXQA 3HO1A 5DB7A 3TFSA 3AA5X 3KLHA 2UVUA 3DLGA 1TFRA 4ECZA 1UT8A 3UPQA 3ORYA 3ZT0A 3DLEA 2XY8A 1NJWA 3KK2A 3OYCA 2KFNA 5J0XA 9ICPA 3KHHA 4J9KA 2JEJA 4CJWA 4EBEA 2A1JA 3OYLA 5DB9A 2YKMA 3LP1A 4FJMA 3K75D 3VQ4A 1YVUA 2JZBB 4FK0A 5KFBA 3T5KA 3QEVA 3TAPA 3L3VA 2PFOA 3CFRA 3DI6A 4CJPA 2PYJA 1S77D 1IG9A 3D45A 3FFIA 5J2QA 3ETLA 1D8LA 3PW0A 1VSDA 3T1AA 5EU7A 1S9FA 3HWTA 1BPYA 2G8IA 1WCNA 1RZTA 3DRSA 2BPCA 3O3FA 7ICUA 3C1ZA 3QNNA 4BXOB 2HHXA 3AA3A 1S5JA 1TL1A 1RBUA 4PWDA 4F5PA 1RDBA 3DM2A 5J0WA 1DTQA 4XRHA 4I2AA 4K4GA 3S3NA 1T05A 1WSEA 3LDSA 1JLEA 3D0PA 5DBBA 2GUIA 4O3SA 3DOKA 4F5OA 1NK9A 1BIUA 5DBAA 3PUFA 4CJKA 1IKVA 3AVAA 4KLHA 2R8KA 2DFEA 4M9HA 4FJ5A 4PQUA 4KREA 8ICLA 3AO4A 4CJQA 4RW4A 1W0HA 4IDKA 2FBXA 5CY4A 1XWLA 4RT2A 5CZ1A 4QWEA 3K57A 4FYDA 3QEAZ 4NM2A 5KFRA 2ASLA 1WN7A 2VG7A 4KLGA 4XIUA 1S1WA 2OA8A 3B0XA 3UQ0A 1ZQNA 1BIZA 1NJYA 4DOCA 3VQAA 2JEFA 1SUQA 3P5JA 2W42A 3V9UA 5HMLA 3AVKA 2Q0ZX 4K4HA 2RPIA 4RQ8A 5C42A 4NM1A 2IAJA 4UQGA 3RJHA 3EPIA 4FXDA 4KFBA 2G8VA 3HL8A 4DEZA 2J6SA 2X6SA 4YD1A 3EZ5A 4KB1A 3AU2A 4M04A 3SQ2A 2HHUA 3LWMA 1HRHA 1T03A 3OJSA 3C94A 4O4GA 3TI0A 3JSMA 4ED1A 3TAGA 5J0RA 5J2KA 2A1SA 4CHYA 4Q44A 3RH4A 7ICEA 4Q0BA 3AO1A 3LP3A 3OJUA 3PX0A 3PW5A 2HHVA 4TQSA 3PW7A 4CEBA 3ZSXA 1HNIA 4M3UA 5KFFA 4ICLA 3IHQB 2ITGA 4CESA 3K4GA 1KEJA 5J0TA 3MDCA 4Z6CA 1RBRA 3M8QA 2AJQA 5IIMA 1CLQA 4CGJA 5DDYA 4DL2A 5FRNA 3VQ8A 1RTIA 4QZ8A 3V6DA 3JPRA 1RT6A 3ZDEA 1HUZA 3NGDA 5KFCA 4EZ9A 5EWGA 2IMWP 3RAQA 4BXOA 4K8XA 1VSIA 1CXUA 1ZQPA 1S76D 1VSJA 3ZT3A 1S0VA 3EY1A 3CM5A 1JIHA 5CYQA 1HQUA 1JLFA 4R64A 4CHNA 4KLOA 7ICVA 5CJ7A 5IIJA 5KFTA 4XUSA 4I2HA 5HLFA 4EBDA 2JGUA 3ZSOA 2G8WA 4FJLA 2JZBA 3RB6A 5SWMA 3OYBA 3TFRA 1TAUA 1JXLA 3ZCMA 2IS3A 1ZQJA 1S1VA 1S10A 4PGYA 9ICAA 2AGPA 2X78A 2MUTB 4IQTA 1Q9XA 1ZQOA 4YNQA 3GV7B 4CEAA 5DB6A 4NLNA 2JEIA 4CEFA 4NY8A 1EXNA 3T5JA 4CJUA 3QEPA 3T5HA 3KK1A 4KI6A 4YP3A 4QW8A 2YHBA 2UVVA 4FJ7A 3N97B 2DFHA 2W9AA 2E6LA 1PZNA 1C6VA 5KFMA 3KHRA 1H38A 5DLGA 2F8SA 3K2PA 2XCAA 3CFOA 4CJ3A 1RXWA 4E3SA 5KG6A 4KLEA 4CGIA 4QCLA 4M9LA 2VWJA 3IM1A 3HPGA 1BCMA 2ZTCA 4QAGA 4FZZA 3V6KA 3ISDA 4O44A 4OKEA 1ZQGA 1WSJA 1SL2A 4N5SA 1TAQA 3E2EA 2NUBA 1CEZA 5C24A 1BQNA 4FW1A 1UWBA 4IFVA 3Q8SB 3GV8B 1REVA 5J2JA 1QE1A 4M3TA 4NCAA 2Y1JA 2W8LA 4ECWA 2VG6A 5J2DA 1ZQZA 9ICKA 2MUTA 1S1UA 4IG0A 3RRHA 3G6XA 4YMMA 1L3VA 1ZQMA 3QETA 1L3SA 4M9JA 1CUKA 2W8KA 1VSFA 8ICFA 2ISPA 3TQ1A 4RQ3A 1KFDA 4M3ZA 4DTSA 3V4IA 1VSEA 3SQ1A 4I9LA 4ED8A 2RN2A 8ICEA 4IQVA 4BE1A 4I2DA 5KFPA 1SKSA 1VSKA 4BDZA 3SQ0A 3WNFA 3IG1A 3NF9A 1BL3A 4PPXA 2HHTA 1TGOA 1ZQYA 1NOMA 2HNZA 5IINA 3RMAA 4C8NA 4QZCA 4P4MA 1RT4A 3C6UA 4KTZA 4ZTFA 1KSPA 3NCIA 2Q3SA 4CEQA 4GXJA 3MEEA 5KFZA 5KFYA 3HW8A 2C22A 1U48A 2V4RA 1K1SA 5DG9A 3VA0A 4CEEA 4LZGA 4UB1A 4DSKA 1JLCA 4KLSA 1T8EA 1X9WA 2RKIA 4PGXA 1A5WA 5HRNA 8ICAA 5E41A 3KTQA 2ALZA 4O3RA 3NH1A 3I8DA 3KLEA 3ZT1A 1ZBHA 4Q5VA 3JPQA 1IKWA 2FBVA 1XC9A 3GIJA 3SUPA 4OPKA 2QKKA 3QZ7A 4CFBA 4BWJA 1S9GA 5EOZA 4MFFA 3ZSWA 1S0NA 2XGQA 4DTMA 2HVIA 3LZIA 1ITGA 3PR4A 1WLJA 1NK0A 4LSNA 1B43A 3PO5A 4UB4A 4KN7A 4OVLA 2EHGA 4F2SA 3DLBA 4KLFA 3MFHA 4W5NA 2XO7A 5KT4A 3V7LA 1KFSA 5SZTA 4AHCA 4H8KA 3C6TA 4J2DA 5J2BA 4B9SA 2A1JB 9ICCA 4I2GA 1QSLA 3AVMA 4QW9A 5J2HA 2R7YA 2C2DA 1CZBA 3TWHA 1TK0A 4I2EA 1G15A 5HNKA 3RRGA 4E89A 1S6PA 3RBDA 3RMDA 4CEZA 4PUOA 5J2PA 4J2BA 1X9MA 1TK5A 2B21A 4YMOA 3GDXA 1HYSA 2XC9A 4FM0A 2LYHA 1XS9D 5L9XA 3SNNA 1MQ3A 5KFQA 7ICOA 2BHNA 1BGXT 1C0MA 4EBCA 4YD2A 1N5YA 4LVSA 4F5QA 1UA1A 1CZ9A 3U3YA 5L1IA 2YV0X 3SQ4A 2ZTEA 3ZD9A 8ICMA 1BI4A 5J2NA 1J5OA 3AUOA 3MGHA 3RJEA 2YHAA 4PGQA 5J0YA 2KW4A 3V6JA 4RW9A 4FLTA 2UVWA 3OYIA 3OS2A 4EYIB 4CK1A 3AVCA 4KMUA 4I2IA 2Z1HA 4RZRA 1KVAA 4CJ4A 3PO4A 4R5PA 3LP2A 1D9DA 1Z25A 4B9LA 4MQ3A 3HK2A 4DOAA 3HPOA 3HM9A 4KLUA 2FLPA 2HHSA 3JPNA 1ASVA 1X9SA 4FJ8A 3MR5A 5K14A 2ATLA 4JRPA 3VQCA 1HJPA 4F3TA 4JWMA 4JK1A 4KITB 4E7HA 5D46A 2P51A 4JLHA 1KDHA 4CFCA 3SI6A 4OLAA 5EWEA 9ICFA 4BE2A 4CEOA 3Q8KA 4FLUA 2IGIA 3PR5B 3PY8A 5J0SA 2V9WA 3VN5A 4AHRA 3I0RA 4C8LA 4GMJB 3TABA 1J54A 1IKXA 3KK3A 3C23A 4DF8A 5KGWA 4ECXA 5KGXA 1ZBIA 2ZQBA 3C5GA 1O1WA 2PXIA 4W5TA 4TUQA 3OSNA 4NYFA 9ICBA 5KFLA 4ED2A 4CF8A 3H40A 1UA0A 4F3OA 4HUEA 4DSIA 3JPTA 2Z1GA 2IOCA 5KG3A 5J2EA 4I2QA 3NH2A 4OPJA 1LB2B 4O3PA 1EP4A 4RUAA 5I3UA 3MFIA 1BI4B 1KVCA 2ETJA 1DGSA 1C1BA 3HYFA 2OZMA 3L3UA 2KFZA 3NGZA 4CHPA 4HVJA 3NE6A 3PNCA 5FROA 4O3QA 4XA5A 4DSEA 2FMQA 2ZUDA 2C2EA 8ICHA 4FS1A 3OYGA 1RT7A 4OGEA 3SV3A 2XCPA 4F4KA 4FJKA 4PH5A 1ZJNA 2IHNA 4K4IA 3NGYA 3KJVA 4Z4EA 4KLTA 3L2RA 1B9DA 3C95A 4CJLA 3V81A 9ICSA 3QNOA 4M3YA 2JLEA 2BDPA 1Z00B 1VK0A 4FBTA 4Q43A 2KN7A 4GXKA 5DGAA 1A5VA 2FBYA 4EP5A 1KCFA 4C8KA 2ATQA 4OKJA 4B08A 1Z3EB 3OYEA 3VQBA 1RYRA 1TVAA 1EKEA 3LZJA 1QSSA 4G3IA 4N41A 4CF1A 3G0ZA 4KO0A 3NH0A 3Q8MA 1HYVA 1J53A 2P1JA 4G1QA 1JLBA 3QIPA 4E7IA 2XY6A 2NRXA 3KLFA 5KRSA 3DLHA 5I42A 1RPLA 3OYFA 5KG4A 4DL6A 4CF2A 2OZSA 1B22A 4DL4A 3LDAA 3V7JA 3L2UA 3T5LA 4DQSA 1S1XA 3HXMA 4DQRA 2UVRA 1ZQSA 4DSLA 4R63A 5J0PA 4KLDA 3BGRA 4KTQA 4DTUA 3H4BA 1RTDA 3PV8A 1NJXA 4TURA 4J9PA 3LK9A 2X74A 2AQ4A 1J9AA 1WNSA 1HMVA 4DL7A 5DQIA 2FMSA 1BQMA 3EPGA 3H8JA 4RU9A 4CHZA 4M2YA 3EWAA 5KFDA 1ZQDA 4O5EA 3LP0A 1W9HA 2BCSA 3AVLA 4RQ7A 4DSFA 5BPCA 4PHEA 1BPZA 3ZSRA 4M45A 1L3TA 4LZDA 3GIMA 2WOMA 4Z4CA 5KT7A 4DU4A 8ICWA 4RQ1A 3OHBA 7ICNA 3TR8A 4YFKA 1TKXA 4W5RA 4RQ5A 3VQPA 3IAYA 5EWFA 1D5AA 4QZ9A 4ED6A 5KFJA 5JS2A 2ASDA 4HCCA 4KLIA 4CFDA 1X1PA 5CB1A 1QQCA 4IR1A 3CYMA 3MXMA 1UAXA 8ICTA 4ECQA 1ZQRA 1C1CA 4EZ6A 4M9GA 4UB2A 5KG7A 4QWBA 3ZDCA 3AO3A 1JL1A 3C2KA 1JXEA 2I1QA 2PFPA 3V72A 1XU4A 1NJZA 4LD0A 5CZ2A 7ICFA 3OSPA 2B4JA 4TQRA 2QKBA 3M8PA 1WAFA 4C8MA 4N56A 1BISA 1SKRA 2IC3A 2HB5A 4ED7A 3TANA 8ICYA 3MAQA 3LPTA 2YNIA 1JLQA 5HBMA 4N47A 4J9LA 2P6RA 1BPDA 1XSNA 3AU6A 5DQHA 5DQGA 1XO1A 4H4MA 4RNNA 3GIIA 9ICTA 3MABA 4KPYA 5KFEA 3SYZA 4ZTJA 4AHVA 3CG7A 3O4NA 4UBCA 4MEYA 4LH4A 3OGUA 3T3FA 3FYHA 1D8YA 1U45A 3KLGA 2IBKA 4Y1CA 1AROP 8ICJA 4RPXA 3VQ9A 4RNMA 4Y1DA 1JXBA 4EEYA 2KZ3A 3HPHA 2DFFA 3RJGA 1ZQAA 3IS9A 1ZQHA 1Q8IA 1RNHA 3KKSA 4YMNA 1KLNA 5J2FA 2G8HA 4JRQA 3K5LA 1COOA 2PFQA 4YR3A 3EW9A 4KLMA 4TUSA 4UB3A 1JX4A 3V7KA 2XHBA 2ZD1A 4FJIA 2HHQA 2QK9A 4X5VA 3DRRA 3E01A 4DFJA 4AILC 4GW6A 1HYZA 1ZQUA 1FXXA 1RBVA 3L8BA 4IR9A 1XI1A 4RPZA 3CM6A 4YCXA 2FPMA 1ZQWA 4M42A 4OGCA 3RMCA 3AV9A 5DLFA 3ZSQA 3HSTB 4IG3A 4CEDA 3M9MB 2JEGA 1RT2A 5CWRA 4UAYA 4ECRA 4LSLA 1WSHA 2W9BA 3V9SA 5D4BA 3QEXA 1BPEA 1HUOA 3LPUA 4LY7A 2HMIA 4FK4A 1ZQXA 2ASJA 4Q8FA 4QOZB 5HMMA 4C8OA 4AH9A 3AVFA 4RG8A 8ICXA 3B6PA 2D0AA 4M3WA 3K5NA 4YQWA 2NRVA 2PI4A 4CFAA 4CK3A 5CHGA 1TKTA 3PW2A 4M6WB 3AO2A 3L2VA 4DFKA 1ZETA 4ELTA 4FLWA 4B3OA 1SV5A 3O3HA 4O3OA 4QZDA 4QZEA 7ICHA 4KTWA 4MFBA 1GOAA 3ULDA 2AQ0A 1T4GA 1FKPA 4Z6DA 2OPPA 3S9HA 4CE9A 4CJ5A 1KFTA 4DFPA 3SV4A 4E0DA 1RTJA 3OS1A 2IA6A 2Y1IA 1S6QA 4IQUA 3VA3A 7ICMA 5J2GA 3NFAA 5DK5A 3HVTA 4FJNA 1JLAA 1HJRA 5F9NA 2PY5A 4J9MA 4DTOA 5C25A 3OYDA 4F50A 4RW7A 9ICRA 1C0UA 3HT3A 3TARA 9ICUA 1TV6A 3ALYA 3ZD8A 2BGGA 4MF8A 4PHAA 1NOZA 4RQ6A 3LWLA 2YNGA 2ZJ8A 4DL5A 1Y88A 4CIEA 2DPIA 1ZJMA 3WNEA 4CJEA 2O4GA 4FO6A 5KFOA 2BQRA 2BCUA 4GC6A 3UIQA 7ICSA 1LWFA 4J9RA 5J1EA 2PYLA 7ICLA 3PMLA 4CIFA 3P83D 3DLKA 4DSJA 1Z26A 4IRDA 1QSYA 3H7IA 1A77A 4HYKA 4RQ0A 5KFNA 3P1GA 3VQDA 4IBNA 2I5JA 5J2CA 3RH6A 1DTTA 1QLNA 2KZMA 4ECSA 4K8ZA 4FZXC 3OYNA 2FPLA 1ZQQA 4DG1A 1HNVA 3Q8LA 8ICNA 4DWIA 2A1RA 4KN4A 4CGHA 8ICZA 1TK8A 2FLNA 1WSGA 1KLMA 4ECTA 3B6OA 1DOQA 5DB8A 1ZYQA 5HHHA 1CXQA 3MECA 5HRRA 3MXIA 5J0OA 2WONA 1ZQEA 3TAMA 4IFYA 5CP2A 2BCVA 5KFKA 1K1QA 4DQPA 4CJFA 3QEBZ 3TAQA 3PMNA 1LAVA 1ZBFA 1B9FA 2PI5A 3V1OA 7ICIA 2H5XA 2ZUCA 5J2MA 4IKFA 1VSHA 4F92B 2P66A 1R0AA 4FK2A 3SJJA 2F8TA 2R8HA 1T3NA 3S3MA 4P4OA 4E19A 3V6HA 4IQWA 3TAEA 3UXNA 4H4OA 8ICUA 4I28A 2FLLA 4F4YA 3L2WA 4UAWA 3F9KA 1VSMA 1RYSA 3ZDAA 4DTNA 4JUZA 3OYAA 4HUGA 2F96A 4KHNA 1RDCA 3S3OA 1NK5A 4DTRA 7ICPA 1BCOA 2BR0A 4YN4A 4UBBA 2NRTA 8ICRA 2KTQA 3U3GA 5D49A 3PW4A 2BQUA 5IILA 4CJTA 5KT5A 3ISCA 4BDPA 5KFVA 1WSIA 3BQ0A 5KG1A 1XSLA 1NKCA 1S0MA 2J6UA 3ZT2A 4I27A 3DMJA 3U6FA 2WTFA 1ZQCA 4DU3A 5KT3A 3M9OB 2HW3A 2YNFA 2DFLA 4FLXA 3BQTA 3RWUA 2G8KA 4CIGA 1TL3A 2C28A 4O0IA 4RPYA 2OPSA 1YTAA 2J6TA 4FJJA 7ICKA 5KT2A 4O9MA 1ZQBA 3BQ2A 3OYJA 5F9LA 9ICNA 1HPZA 9ICOA 4J2EA 3LAKA 3V9WA 2BKEA 4ZH4A 4FW2A 3H8SA 4DTPA 3QESA 4I2CA 1ZQKA 2IHMA 2OPRA 4FJ9A 4F5NA 5KT6A 3NBPA 4MFAA 3QINA 5KFIA 1RT3A 1WSFA 5DBCA 1IM4A 1JKHA 4RNOA 4BGDA 1RT5A 2BGWA 1RBSA 3MEDA 4DQIA 4DS4A 9ICIA 1I3AA 4ELVA 4R8UA 5TZVA 3ITHA 1ASUA 4LH5A 3RB3A 4Z0UA 8ICKA 1ZQTA 4I2FA 4CJRA 3G6VA 9ICHA 3THVA 3NF7A 4F4XA 5KFSA 2FMPA 3RJIA 4B8AB 4P2HA 3MR3A 4KLQA 4Q8EA 3HX0A 4ED3A 1WCLA 4FBUA 1LWEA 3MR6A 2Z1IA 1TVRA 4NXZA 2X6NA 1RDDA 5KFWA 1JL2A 1MU2A 1MSWD 1L3UA 3RJKA 3ASMA 3C2MA 3RJJA 1LWCA 4NYNA 4HUFA 4EYHB 4QWDA 9ICLA 4AHUA 3OS0A 3NHGA 4ID1A 5DKWA 2G8FA 4BE0A 4FVMA 3KD1E 2G8UA 1SL1A 4F4WA 1ZQIA 3KIOA 4BDYA 2VA2A 4KHUA 3UXPA 3PVXA 4TSXA 1SKWA 1DLOA 3PX6A 1GOCA 4GLXA 4R8UB 4B9VA 4W5OA 4RW8A 3NGIA 4CF9A 4YVZA 4FCYA 4ID5A 3RR7A 4O55A 3KD5E 4FZYA 3BJYA 2R8JA 1VRUA 4ED0A 1LW2A 3JPOA 1C1AA 4F91B 3RH5A 4DTJA 4AHTA 5L1LA 4J9NA 3VQQA 3HP6A 4YFUA 4JV0A 4JS4A 3C2LA 1QTMA 5DG8A 3LANA 4KI4A 3HVRA 4YR0A 4PA1A 3M8SA 3ZT4A 4E1MA 4ECYA 3C5FA 4CHQA 4QZIA 3SCXA 1NK7A 1ZBUA 4OKKA 4RT3A 4Z4IA 1V9PA 1RXVA 2ZJ5A 3MEGA 4KLJA 3QE9Y 1I39A 4HCBA 5J2AA 4F93B 3GILA 2Z1JA 4CGDA 3NF8A 4ELUA 7ICRA 4WE1A 1BVSA 1EETA 3T19A 4FJGA 2P5OA 3SUQA 2KQ2A 4FM2A 3BQ1A 4JS5A 2P5GA 2W9BB 8ICBA 4E7LA 2GV9A 1SZPA 3DYAA 4E1NA 5HHIA 3VQ7A 3SUOA 1XHXA 4QWCA 4KAZA 4DLGA 1K6YA 5IIKA 1YTUA 4GC7A 3SPYA 8ICPA 4FLZA 3RJFA 4DFMA 1RILA 4CK2A 4KHYA 3IRXA 2ZTDA 2BCRA 3QIOA 2E6MA 4DOBA 1LW0A 4YR2A 3RBEA 3AVHA 4YG2A 2D0BA
chains in the Genus database with same CATH superfamily
1XSPA 9ICWA 4LIWA 1WWUA 4O5CA 1RE1B 2RDJA 2E1RA 3QZ8A 4I64A 2P6SA 1IQTA 1SL0A 4DO9A 1Z4OA 1FFSB 2NPIA 1RTIB 1Z2ZA 1RI7A 9ICVA 5ITHA 2MKKA 1S49A 4FN5A 2P9SB 1DT9A 3MCPA 1NM1A 1BMQB 4QPXA 2ASOA 9ICXA 5JJBA 2QWPA 2VA8A 1SC3B 2GVZA 2HHWA 1NZBA 4C0BA 4XO0A 2FZGB 5K8MA 3K9KA 5AE1A 4NXMF 4H0PA 3QMLA 1NHVA 5H1SQ 4Z4FA 1QVFM 4RW8B 2NXJA 3W5YA 2JRZA 1GLBG 7ICJA 3OUYA 2JMGA 3ZDBA 4OZ0A 2BH1A 3RR8A 4KHWA 4M47A 5HRPA 5HBMB 4FYYB 2BE2B 3Q8VA 5IM0A 2A3VA 1VRTA 5D4LA 3TUPA 1NG9A 2YQ1A 4AUKA 1A5XA 2F1HA 4USIA 1X4DA 4QZAA 3MGIA 1UVJA 1HKCA 2GHPA 2BTFA 2VOPA 4JD2A 1D09B 1FO1A 2Q2RA 1N48A 2BUNA 4E7KA 4FS2A 6AT1B 3ZO7A 3QERA 4ZOSA 2OP5A 3D2FA 2F9JA 1PC4A 4R66A 1QQ7A 1WF1A 3TX0A 3N7RC 3TEHB 1WDDA 4F67A 2P9EA 2OEHA 4PYDA 1KW4A 3LOUA 4IL6U 2XMWA 2HHHJ 1ZQ1C 4JN4A 1S0OA 1PVQA 4CF4A 1GXTA 2ZXHA 2FPKA 4ILGB 3RB0A 4MYTA 5AQNA 4PYAA 3PZPA 3SK3A 2D9OA 2AGQA 2D6FC 3GV5B 2A0FB 1S79A 2LYBA 4KLLA 1J2MA 1JKHB 2IPOB 1NKBA 5C5JA 4M41A 1SCJB 4LF5J 2WHOA 4USVA 2VB6A 5CCLA 2BM1A 3GYGA 4YORA 2IVMA 1SV5B 2P6UA 3C16A 2A1AA 1GH8A 4ACOA 5ALXA 3RTVA 1WTBA 4URSA 1ZQVA 3R8EA 1T6DA 5MAOA 2GUPA 3SQOP 2EG1A 1B0PA 2B51A 4O5KA 4KV8A 1KL9A 3AVIA 1PBAA 3M8RA 3IG1B 4KKOA 4ZA1A 3OBYA 4M94A 3EZWA 2QEXN 3EICA 2O8BA 3A1YG 2E1CA 1LKZA 2M4MA 4KRWA 3AY9A 3ZSVA 4GXIA 1RGIA 2YKAA 3KNGA 3GG1A 3OR1B 5E3QA 3LPYA 1LW0B 2F1FA 4I2JA 5AQMA 2H5EA 2ZKUA 4MJKA 2KXFA 4QZVB 4CI0B 3KZXA 3KK2B 3F5EA 2B5JA 2XSJB 5GTHU 2EX3A 4AHSA 2P9NA 3HHKA 1VSLA 4Z6EA 4Y0WA 4OHXA 1TKDA 5ETQA 4DV4J 3R1LA 4J9SA 4JKGA 3B9JA 4CECA 4OJRA 3JQJA 3KKRA 3QT7A 2I9GA 3JAMO 2MB0B 2HVHA 2DL0A 1NGHA 1KVBA 1M0SA 5DO2A 2HMPA 2Y9HA 4X2BA 5LL6Z 1GXLA 4Z4HA 4DUZF 1U49A 3KWGA 1SV0C 4RTFD 1RCHA 3TO8A 7ICTA 5ETKA 1RHRB 3LH2S 4QZGA 3MEEB 2CNOB 3CRXA 1JROA 2HS3A 3OBWA 2W9CB 4Y2UA 1QQ6A 1XN9A 2NPFA 2UUWA 1VBZA 1EX4A 2HOEA 2HDOA 3GFXA 1LKYB 1AT1B 3W2VB 3CCLN 2YQ3A 2HS0A 3W66A 2P9UB 1S6PB 2MHEA 4I0WA 4I6AA 2ZXIA 2YX4A 1LV5A 2PIIA 3OV7A 4P9SA 5ALVA 4P7VA 4ISFA 1IBKJ 1MWKA 1NK8A 4NLZA 3HHLA 1X42A 2DVIA 2FHOB 1C0GA 4BX9C 3MPWA 2F1JA 1XNRJ 2XRIA 3H8WA 3QO9A 4UAZA 4WF9L 5AM4A 3JSBA 1YVFA 2E88A 2BCQA 4KHSA 4GVLA 3TKAA 1U9LA 3ENHA 2HWTA 2NLWA 4YXMA 3O5BA 4M0AA 3VV2B 1EETB 4CLPA 4J2AA 3LDLA 5T41A 1CC8A 2M7SA 8ICIA 2RF2B 1B7YB 1Q81O 4DV3J 4PXBA 1LAWA 4UOCA 1TKZA 4ZHRA 2QA2A 4IRKA 4YOEA 5F8MA 3ISNC 1O8BA 4B9TA 4FLYA 1N0UA 5F2RA 4PHDA 2Q1LA 5IIIA 2F3JA 1GT8A 5J2MB 2CH6A 4I1TA 1PC5A 2YNHA 5ALOA 2IOFA 2O5DA 3V1RA 1BE4A 4UB6U 1ZBLA 2N1RA 2LXFA 3I56S 5F41A 2V4QA 1ZA1B 3AVNA 1QS4A 4CLLA 1Q8KA 2GJFA 3TADC 3FBFA 3BUZB 3I0SB 2IDEA 2MQPA 3GBTA 5A6PA 2Q66A 1N54B 2DISA 3MMAB 3THTA 2UUBF 4PHTX 3HO1A 5DB7A 4DR7J 1T94A 3AA5X 4ZCIA 2UVUA 1AA1B 1I51B 4BC9A 2GVDA 3CCLS 1M90O 4AXIA 1NGFA 4N7TA 1P1LA 3ORYA 4JV5K 3OR2A 3ZT0A 3WDOA 1HWJA 2WVCA 3KK2A 2Q43A 3AODA 9ICPA 4AQYK 1UVKA 3L0QA 1OIAA 4E1JA 4CJWA 5CQGA 1FRMA 4JKEA 3R5BA 3IWNC 3W63A 5FJ4A 1BA0A 4M5JA 4QIWC 3H2VE 2P5VA 4FJMA 3K75D 4DV1J 1YVUA 2JZBB 1GAOA 5KFBA 3T5KA 5J1PA 1RU1A 3L3VA 3CFRA 4CJPA 2PYJA 4GVBA 3ICXA 2Q3PA 1IG9A 3AEVA 4KHPK 3FFIA 3M3ZA 3ETLA 4HHJA 2MZSA 1Q5YA 2B43A 1VSDA 5LY3A 5FIIA 5EU7A 1S9FA 4H5NA 3GJQB 3QT5A 2LA4A 3CJSA 3DRSA 2BPCA 4UTGA 5C15A 3MM9A 3PYDA 5AK3A 3ZC4A 1HW9A 4RW7B 2P9KB 1S5JA 1TL1A 1NMNA 2W7AA 4F5PA 1RDBA 3A0IX 1DTQA 4XRHA 4X4PA 3KDNA 2G2YA 2O67A 3H98A 4TN2A 2AEJA 3MHYA 2OPPB 2GUIA 3IP0A 4M5GA 4JKCA 1DAXA 4FZMA 3AL0B 1Y3JA 1NSKL 4CJKA 3W5ZA 4M5IA 4DUTA 3AVAA 4M5DA 1TP7A 2P9KA 4M9HA 4FJ5A 4ICAA 2R9LA 3AO4A 1ZXOA 2GV1A 3LGMA 5HP1B 2JH3A 1XWLA 4RT2A 1S6UA 1IG6A 3ET6A 4NM2A 1M1GA 1B0TA 1XTZA 2OTLN 3ULEA 5J2PB 2LP4A 4KQZA 4XIUA 2AZ1A 2F5GA 3TX8A 2OA8A 4AL7A 4JK7A 4RUBA 4Y2CA 3AN1A 4Y2XA 2FJVA 2QJ3A 4LF9K 5LJ3Y 4K59A 3MWBA 2CQPA 1V9OA 2CPJA 5BPNA 1Y0HA 4DOCA 2JEFA 5AM2A 3H90A 1SV0A 3THPA 5HMLA 2VJVA 2Q0ZX 2CQIA 1IM6A 5C42A 2HSZA 2FF6A 2UXDF 3POTA 4HACB 4PL7A 2ZH3A 2JOQA 5LOQA 1T95A 2BMBA 2X1FA 2BW2A 3G82B 1RWUA 2LCWA 2ROEA 1N60A 2V69A 3CCRN 3PIPL 2X6SA 4YD1A 3A5LC 5HQ8A 3W64A 1Q82O 1PO6A 3AU2A 3N4QA 2CQ2A 1X6IA 3TSQA 3N9UC 2ZUAA 4WKRA 1ELOA 5JLHA 1PVRA 4NLQA 3EDRB 5C24B 2G9OA 3TAGA 3OTEA 2A1SA 3C16B 3RH4A 2LEBA 1UVIA 2D69A 3DXMB 2DNMA 4C48A 1OVQA 4TQSA 5AI0A 1HNIA 5ADXH 2NYIA 5J0TA 4CESA 4OX8A 4M1KA 4OZ5A 2KHDA 2VQEF 1PAEX 2Z2ZA 3VAHA 5IIMA 3PJWA 4CGJA 2RU9A 4K4VA 4J7CA 4DL2A 1RTIA 3DOMB 1GQEA 3NGDA 2FDRA 5FDLB 2KVCA 4EZ9A 5LSLA 4K8XA 1FVSA 1VSJA 4X4NA 1S0VA 2QMWA 1N33J 3KLFB 1SQGA 4B1ZA 1AUSL 3ZETB 1NHKL 5CJ7A 4U6PA 1FKOB 2K2PA 3QAEA 4XUSA 2YKMB 3LP1B 4ZVSB 2RS8A 1CS4A 2RD5C 3OYBA 3TFRA 3NGUA 3A8YA 5AQUA 4PXDA 4NV0A 1MWYA 1ZQJA 1ACMB 4P74A 2JHEA 9ICAA 2CJQA 2AGPA 3HVAA 2MUTB 1F9FA 3GV7B 3JAMU 5L1MA 4LFBJ 3CC4N 2JEIA 5HAOA 4NY8A 2MZTA 4CJUA 7FDRA 3T5HA 4CF5A 3JTPA 4GO5X 2ZIVA 1JALA 2YHBA 2QGFB 4FJ7A 4OZ2A 4RQNA 2W01A 2DFHA 4XAKA 1LXNA 3I5BA 1Q8LA 2BDUA 3BZQA 5F3TA 2XCAA 2VQFF 1CJTA 2BOAA 2G0CA 4KLEA 5C0YA 4CO2A 5ALZA 2VWJA 4YHHF 4FPIA 2E9ZA 1VQ6S 3NVKA 2ZTCA 1VC6A 1L8LA 4CRJA 4WU2A 4O44A 2JX2A 4MK8A 1C0TB 8ATCB 1SL2A 3N79A 4HWIA 2FYXA 5FPMA 1TAQA 5IS2A 4JK8A 3E2EA 1NH8A 2K7JA 1BQNA 4NCGB 3WX8A 3Q8SB 1QE1A 2YB1A 2Y1JA 3IP4B 2NO5A 3AM9A 2LDIA 1VQ5N 4CD3A 2HWIA 1S1UA 4IG0A 2QB1A 3G6XA 3OL6A 1HLUA 4M9JA 1CUKA 2W8KA 3J7YI 5C42B 3M2RB 3LF0A 3TQ1A 1UCNA 4ISGA 2AIRB 5T14A 3O6WA 4OHWA 4PG6A 2HNYB 3CXCR 4ED8A 3VZIA 2BE7D 4GKJF 4ZVOB 1CJVA 1U1NA 2KO1A 5KFPA 5HVHA 3VF4A 4DB3A 1VSKA 3MN7A 3WNFA 2D4WA 3IG1A 4HTLA 1RYUA 2YH1A 2HHTA 2N4DA 2VQFJ 1F6TA 3VAJA 2Q3SA 2FTRA 2D7SA 3EVMA 1GMWA 4GXJA 1XMQF 1RT6B 5KFYA 5ETTA 2PE8A 4NPOA 3UPFA 2V4RA 2W24A 4BCAA 2BJ8A 4ZN3A 3VA0A 2EG2A 3MWPA 4CEEA 5JVHQ 1QM9A 4FFDA 2E44A 4G9BA 4KLSA 1T8EA 3L09A 1X9WA 4OYXA 1QHAA 2RKIA 2HRUA 3JB9k 2Q1NA 1WHVA 4NL5A 5AXKA 3W8GA 2ZZNA 2LQ5A 2HIYA 1KC8O 3M6VA 5LMNK 4JOUA 2V68A 2L08A 2ZIXB 2F9WA 2OEKA 3GIJA 1Z2LA 3SUPA 4OPKA 3MN5A 4ZVUB 3QZ7A 4CFBA 2AH5A 4BWJA 2KHCA 4MFFA 4NZ7A 4K0KF 5HATA 1L8OA 3M6WA 4OYMA 4JI7F 3MMCA 4UB4A 3NP5A 2EHGA 3E3XA 3SSSA 3MM8B 1WYGA 1KFSA 4AHCA 1M5OC 3GR1A 1HKAA 4CW7B 2A1JB 4DV3K 1ZRMA 2V8DA 5J2HA 3GSIA 3MM7A 2C2DA 4XTTA 1SJ3P 4FWMA 1WG5A 4ZMMA 5EE0A 5U47A 4I2EA 1TYQA 2HSTA 4E89A 4IOCL 3RBDA 2DO4A 4KB7A 1AFJA 7FD1A 3KBBA 3RMDA 4F0KA 4DV1K 4CEZA 2X1GA 1X9MA 2FXUA 1WEXA 1SH0A 3WXKA 2M0NA 5BPMA 1HYSA 3SNNA 2EC0A 3D0GE 1BGXT 1CI4A 4EBCA 2JJ4D 1X9XA 3V6DB 3G6EN 2ZH2A 5F8LA 4B1WB 3BPDA 1CZ9A 4YOVA 2YV0X 1UJ6A 4USKA 3A0HU 4IYQA 8ICMA 3NCQA 4S0MA 1J5OA 2G5IB 3KMQA 3MGHA 4KHRA 4PGQA 2KW4A 2HFVA 3V6JA 2UVWA 3K1ZA 4EK2A 4EYIB 1N5YB 4WFBL 1H7XA 2CPXA 3AXMA 2B4UA 4BG9A 1NU4A 3IGNA 3LP2A 1Z25A 2WF8A 1NSPA 1TUWA 5B8HA 4KLUA 4YOXA 4LF9J 2YX8A 1U26A 3MR5A 5HO4A 5IT9O 3OA9A 3G87A 4E7HA 5D46A 2P51A 3OD2A 1HNZK 3G8SA 2R7SA 4CEOA 5AKXA 2LKYA 4FLUA 2IGIA 1DURA 2LQBA 1W7WA 3NASA 3OL9A 1EQMA 3VN5A 4AHRA 5GMKa 2DRAA 2MU2A 2B6AB 4IO8A 3TABA 4H5TA 2R7WA 1M5HA 5BR8J 4PG7A 1OQ6A 3ZNUA 3ID8A 5C7PA 1ZBIA 4JI0F 2ZQBA 3C5GA 2PXIA 3F56A 2B4VA 2M8DB 2QN6B 5KFLA 3R1HA 1FE0A 2YQEA 4K2JA 4JI7K 3HHNB 3H40A 5GIOA 1FDDA 4HUEA 5HQLA 5IM0B 3KJVB 4QR0A 2ZC4A 1YJVA 3G71N 5J2EA 2DXEA 4I2QA 4OPJA 2EW9A 2ILYA 3HTVA 3ATVA 4CZCA 1VR6A 1KDNA 5I3UA 1NLKL 2C3UA 2P9CA 2ETJA 3E8OA 1RAFB 3WC0A 2KRBA 3M8QB 3WK8A 3PNCA 4BRPA 5FROA 2EZZA 4O3QA 3NGRA 2E2NA 8ICHA 2GAHC 1L6NA 2XCPA 2KP7A 4F4KA 1DQ9A 2HBKA 4PH5A 2KN4A 4ANCA 4DCOB 4EFAC 2JLFA 2RAQA 4KLTA 3FGVA 1T6CA 2MLYA 4TY9A 3SIPB 4BR4A 3C95A 3NS6A 5DDPC 3M2VA 4DV0J 2HMIB 2WB1D 3M8YA 3MX2A 4Q43A 1DFDA 4OYBA 1A5VA 1KCFA 4C8KA 1JLBB 2ZBRA 1Z3EB 3FZLA 2ZJQQ 5KL1B 2H3EB 5ETLA 4GKKF 4M7XA 1QSSA 4N41A 2H1YA 4KO0A 3Q8MA 3NH0A 3A5NC 2P1JA 4X4TA 3IWXA 5AKZA 4X66J 3QIPA 2FJBB 4RBTA 3DLHA 3OYFA 5KG4A 3NRBA 5DM7L 3BF1A 1M6YA 3QFWA 2PA8D 4JKAA 2ZITA 4URQU 3D68A 4RLEA 4DQSA 1S1XA 2EFGA 3HXMA 4DQRA 3IWLA 2RUGA 1X4CA 4R63A 5J0PA 3BGRA 3H4BA 4J9PA 2HAFA 1RQNA 4B3MK 2YY6A 1HMVA 1JNRB 1WNSA 4DL7A 5DQIA 1BQMA 1V4SA 4M2YA 2DKOB 9ATCB 3N6MA 1O5JA 5BPCA 4X4SA 4PHEA 2MSNA 3O6QA 2DWQA 4IH6A 4F7VA 2WONB 3EO3A 4OHVA 1J27A 1S1XB 3G6ES 2WSEC 3SFUA 2XZTB 4UB8U 4PRFA 1VQSA 3NRZA 2FE9A 2GIFA 4B3MJ 2GJIA 5BJRA 3SQIA 1K9MO 5KFJA 1HLWA 1YZ7A 3HF5A 2I6XA 3W3SA 2DNKA 2R2RA 4Z7YA 4YMEA 2N7CA 1X1PA 4GV6A 8ICTA 3BN7A 1HBNA 2HEKA 4OI0A 4EZ6A 4A62A 2GW8A 5KG7A 4P6QA 4B9QA 3I96A 1ZM4A 4ZIVA 2DF4B 1FKAF 4QR1A 2Z7JA 3V72A 2HZCA 7ICFA 3HD1A 3OSPA 3ID6A 1B99A 5EVZA 2DPNA 3WKCA 5IOLA 2QA1A 2C42A 3NVWA 1XNQJ 2HB5A 4ED7A 3LPTA 3C28A 5HBMA 3FVYA 2EFVA 2K89A 4ZCKA 2F4FA 3ONNA 3ILLA 1CC7A 2RT3A 4BRLA 1BPDA 4B3RJ 1PK3A 4BY9C 1XSNA 1MMDA 2OTJS 3AU6A 3HVTB 1XO1A 2QMXA 4RNNA 3GIIA 2WVBA 1XMOJ 4BC5A 4KPYA 1YK9A 1Q53A 2HG4A 5BYQA 4AHVA 2V8PA 3O4NA 4CD1A 4LH4A 2EAOA 2KVIA 1N88A 3KLGA 2HHHK 2CPZA 4JHDA 5AQXA 2UU9F 4RPXA 2A19A 1X4BA 2WAQC 3D66A 3EKSA 3TZYA 4X4QA 2KZ3A 4DV2F 3FM9A 1X4HA 5HMZA 2QB0B 2QWMA 1RNHA 3F5AA 4LF6F 1KLNA 1P9YA 2ZZMA 4O4GB 3QT8A 1YDLA 1COOA 3DOLB 4QNLA 4KLMA 4TUSA 3WK4A 3FJ2A 1JX4A 3S6JA 3V7KA 3WKAA 1COKA 2QK9A 2NS1B 4P2FA 3CDAA 1IBLK 4GW6A 1ZQUA 3TA1A 3L8BA 4RPZA 2YKOA 5HL7L 4YCXA 1Z4NA 1ZQWA 1VLOA 2DH9A 3UR0A 4NZ6A 3GDQA 1YJ9S 1SWVA 4ECRA 1F2GA 2W9BA 4LY7A 4FK4A 4I6WA 3G2XA 1SXLA 2ZH5A 3PIOL 4JMUA 3Q83A 4QQBA 3AVFA 1NNDA 2UUAJ 2GX8A 4FXVA 4IC9A 3LW5C 3K5NA 3E0FA 2PI4A 4R0EA 2ASYA 2PFDA 3EE8A 3PW2A 4M6WB 2D3UA 3AO2A 3AY0A 4DFKA 1ZETA 4IEIA 2YX6A 3O3HA 3R3TA 3NAHA 4QZEA 3AQFA 2VGMA 1GOAA 5M1QA 4CBUA 3TJ8A 5A6WA 3HT0A 1T4GA 4KMOB 4JI5F 2R7QA 2FD2A 1KFTA 4AQYF 3QFHA 4E0DA 1RTJA 2E5JA 3OS1A 2KYXA 3DOKB 1VRQC 4IQUA 4GV3A 3SLCA 5J2GA 5DK5A 4DUYJ 3HVTA 2MRLA 3CPEA 5IT9U 2AV5A 1KHWA 3O9TA 2D0PA 2YCHA 2V7ZA 3OYDA 4F50A 2XI9A 3TARA 2JGAA 5CD4H 5IT9Y 4MF8A 2H54B 2OGUA 2ILZA 1R0CB 3LWLA 2NR0A 2ZJ8A 4K43A 1CJKB 3SBMA 4A48A 3K8VA 4MKVA 2DPIA 1FJEB 5DS7A 1FJ7A 4NMLA 3NGSA 1DKGD 4FO6A 3AA9A 2KIVA 2BQRA 3JS6A 5LMUK 4LR9A 7ICSA 1LWFA 2KLAA 3LDNA 2QG9B 4RBUA 1RA7A 2BBEA 1OPIA 4NA2A 4HYKA 4NLOA 4W98A 3P1GA 3VQDA 2CJXB 1PJ6A 3CO0P 5J2CA 4E2FB 2VASA 1DTTA 1QLNA 2KZMA 4OYOA 2P35A 2CG4A 4FZXC 1ZQQA 1DQ8A 5ALTA 2KXNB 2Y0SF 3HFVA 2JHDA 4MLEA 2IM3A 1KD1T 2BM0A 8ICNA 3CJQA 4KN4A 3ET6B 2P9UA 1OWXA 2FLNA 4CM0A 3CCRS 2XMTA 4OCZA 3A3OB 1U7LA 1ZYQA 1QQMA 1OVYA 2OM6A 3MXIA 3B82A 2C2OB 4PXCA 4JI4J 3TAMA 1WBDA 3DNCA 1A9NB 2F8HA 2BRLA 4JI4F 2G5HB 3GFHA 3CDEA 3FC9A 1Y5IB 3FZKA 3PMNA 1LAVA 1B9FA 1VFJA 4HEA9 4K5RA 4CTAB 2H5XA 2ZUCA 2DBYA 3FQKA 1R0AA 5FLXY 4DR2F 4TLRA 3J80O 4P4OA 2Q6CA 1CBKA 3RU0A 3T9ZA 4G1PA 5J1NA 5B0EA 2J8SA 3MCSA 2ZEJA 3AA8A 3H46O 4UAWA 5JVHL 3QNWB 2DGTA 4B3OB 4DTNA 1HQ2A 3G25A 3OYAA 4KHNA 4ZJLA 3NOGA 3E9OA 1KC8T 2JRSA 2FSKA 2BR0A 2VD3A 3ZTSA 2XM3A 5D49A 1IBLJ 2BQUA 1XNRK 1YLXA 4CJTA 5KT5A 4BDPA 1S6OA 3ILIA 2ACYA 2AF6A 5EX0A 1WSIA 2KJ9A 1GLFO 2RHQB 2KG5A 3U7JA 4I27A 3DMJA 2LEPA 4LFCJ 3CC2N 1DZ5A 3L95X 2KHQA 3M9OB 2QL9B 1J2NA 3UMBA 2G8KA 2CYYA 4CLWA 1TL3A 2VFSA 2C28A 4RPYA 3LP2B 1FXLA 1YTAA 2J6TA 3D3BJ 4OFZA 1YI2N 4O9MA 1FT8A 3H25A 5AIBA 4DI6A 3BQ2A 3OUYB 2R7XA 3OYJA 1KKHA 3CC4S 5F9LA 3GZ7A 4CLFA 5KPZA 1N8RT 2XO6A 1A6LA 3V9WA 2UUCK 4BUGA 1BHNA 1RG6A 4FW2A 3H8SA 3HBTA 3GTYX 1FTRA 4DPTA 4BGAA 4B3TK 3ZZ0A 1ZQKA 1HNWJ 2Y9UA 3LP0B 3VF2A 2UXBK 5KT6A 3VAFA 3QBCA 3QFUA 1KWMA 4CWBA 4B3RK 3L4IA 1JKHA 3ZX0A 4BGDA 3UE5A 3H0PA 2ROGA 4R8UA 2HFSA 2HF4A 3ITHA 3QMQA 4PKHA 1V5VA 5ALUA 3ENBA 3DKDA 3ZNJ1 4OV6A 5CE3A 3I4HX 2H48B 4CJRA 3I5AA 1QZ6A 1RAGB 1PG5B 4ZCMA 5KFSA 4KLQA 3IO1A 3DMJB 3OFEA 1P9QC 3T41A 1CVJA 3UCUP 4NLDA 3HX0A 5E7OB 3Q23A 5KPRA 1LWEA 4X65J 3BSNA 3AB4B 5DM6L 1XIQA 1BNPA 2NYVA 1VQ4S 1RDDA 5KFWA 1Z4UA 4KO0B 1N36K 2LI6A 4X4RA 3RJKA 4ZIWA 3M6GA 4PWUA 1KAZA 1WTFA 4EYHB 4QWDA 3VQSA 3OS0A 3NHGA 3W1YC 1ZPWX 2W1BA 4DZ6A 2J0WA 1EWRA 1R8CA 5E33A 3H7HB 3DN9A 2PO4A 5M1NA 3NG8A 3CC2S 2WFBA 4HTJA 4CLYA 3KHYA 2EZXA 3PVXA 4TSXA 3S1TA 4H4KC 4H5VA 2QL7B 1GOCA 4R8UB 4B9VA 4LF4K 4KX3A 3NGIA 4OV1A 4IDKB 2DGQA 3IM8A 4FCYA 2GWKA 2IBOA 1S6QB 4U8YA 4O55A 3KD5E 4FZYA 1IBKK 4ATNA 2DHGA 3UNYA 3C7NB 2AJ0A 2Q36A 5T7LA 1DGJA 4DTJA 2APOA 4AHTA 5ALEA 4V19X 2FJXA 5F8NA 1XMQJ 4MN4C 5DG8A 4AT1B 1ZM2A 3M32B 4DUYK 1RTHB 2HURA 1PK1B 1FEZA 4ECYA 1N5SA 1UZDA 1ILYA 8AT1B 3SCXA 2R2SA 5BYSA 1NK7A 2G1HA 3FE1A 4K2XA 1VQMS 2VZ9A 1TKTB 4PPZA 2EANA 3Q86A 1I39A 4JNEA 5C2CA 2GA7A 4CGDA 1XUPO 1WKLA 4DZDA 4WE1A 4BROA 3I82A 2KKZA 1URJA 3T19A 4K0KJ 3BS5A 1NPKA 2FJEB 1FE4A 4P2XA 3BQ1A 8ICBA 2RRNA 2DBBA 3FRZA 3SUOA 4OIXA 4USWA 1XHXA 2CH5A 2NRHA 3VF0B 1XNQK 3UQSA 2OHDA 4GC7A 8ICPA 4FLZA 2FUG9 2EK6A 5H9FJ 1LW0A 4LF5F 1TQLA 3MEKA 1RHKB 4H0YB 4DV4K 2GLEA 2AGOA 5CR4A 3CQXA 4DV6K 1QJHA 4F2RA 1SIZA 9ICEA 4U7CA 4Y2VA 2OAUA 4F5RA 3OQ2A 1RAOA 4OZJA 1GMVA 1SJFA 2GGPA 3M32A 5I4MA 5HI7A 3AVBA 3FSYA 4QZFA 1IBLF 2J8AA 2R7OA 1NDPA 4K8RA 3SENA 1S9EA 2V8GA 5JLFA 1N56A 4E98A 4OX9F 3B0YA 3CD6S 4RPFA 1T3VA 1FXDA 3EE3A 1CJTB 1HI0P 1BPXA 3V4MA 2JH7A 2E4LA 3KHGA 4DF4A 1KAYA 2ZE2A 1DEJA 4RUCA 4NMXA 4DU7A 2IDLA 1TL7B 5A2QY 5J29A 3C1YA 4C8ZA 1VQNN 3F73A 1GXUA 1L7PA 3CB4A 3AVJA 1J5EK 4XPCA 1N33K 2M88A 4HHTA 3PLAA 2W6KA 5AKIA 4F25A 4CHOA 1OUQA 1Z1ZA 3BDEA 4LMZA 1MDUB 1Z19A 2IHR1 2I7PA 4K7QA 2YNFB 1JJCB 3EGWB 1DK3A 4JI1J 3BY5A 3ULHA 4XDDA 5IXUA 3K0SA 2HNYA 2YI1A 3JYTA 2IM2A 1CJVB 1WAJA 2M52A 3BYPA 4N76A 1ZBTA 3U26A 1YBUA 2XY7A 1WC4A 3VGKA 3N6LA 3O3GA 3FEXB 1Y64A 4MK7A 4X66K 4TYBA 2IVNA 4RKUC 3CQ8A 1MMLA 2DY4A 2DB1A 3P96A 3K58A 4WE1B 2ZNYA 3B8HA 2VV5A 4US8A 2UU9J 2VJ4A 5KG2A 5KG0A 4MFCA 1BQNB 2FVPA 2DIUA 3FBCA 3LAMA 4RX6A 1GEHA 2OUGA 3OFGA 2RDIA 2XLIA 1HBMA 1G4CA 5J2IA 3MC1A 5B0AA 1MA7A 2XMVA 1N6QB 2R8IA 3J80U 1RTJB 4U7UK 2VHGA 5LMNF 3MR2A 4KRFA 3QUTA 5DM7Q 3D67A 1K5OA 2KL8A 2Z0GA 3JPPA 1FRLA 1FFGB 4ID5B 1RFQA 4Z6FA 3EVWA 2YBVA 1N8RO 3J81j 4QWAA 3VQ5A 3O4QA 1FRIA 2XS2A 2R3VA 4ZPVR 4Z37A 5AFUA 2QZ8A 3H5XA 3BKTA 3H4DA 5BPLA 3TUIC 5KFAA 3O5TB 5AQIA 4WYWA 2O4IA 2F9DA 2RSQA 3M1VB 2XY5A 2RF2A 5EX5A 3DU6A 3H59A 4NXMJ 4M6WA 3QSYB 3Q8PB 4HDHA 4BR7A 1FIQA 2XG8A 4JI3J 2A1BA 5KFUA 4TVAB 4NRUA 2KZZA 3BO2A 4JKDA 3MDAA 3UDCA 2F8KA 2QYCA 4NXMK 3VPZA 3O08A 5E3PA 2DYAA 2VIHA 2G0AA 4C3MA 2CZ9A 1S5LU 2KT5A 5J1EB 3R2CJ 4WXOA 2B6AA 3QUCA 3KZBA 1MWZA 2K60A 2OELA 4PKIA 4BRGA 5AQZA 3GU3A 3MMCB 3CC7N 1ASWA 1MA9B 4GKJJ 2M9NA 2E2PA 5L1JA 1HQEA 4R65A 2HQ3A 3HILA 4AE5A 4RW6A 5D4OA 1NAQA 3G8TA 4A8SA 5AICA 3K5OA 4F72A 4JV1A 2PEHA 1UTAA 1OH8A 2ZUBA 1REVB 1ZQLA 1KRPA 1A76A 1SGGA 3QPIA 1ULRA 4CQ1A 3L4BC 4NL9C 2H4YB 4NCGA 1FNMA 3QYPA 1C20A 1VOMA 1YQHA 3Q24A 4B8CA 4FWLA 3L2QA 2W25A 3I0SA 1E4FT 3PX4A 2V4JB 2HBQB 4WYBA 4QZBA 3A8IA 4A5AA 5LJVA 5BN8A 1N34K 1RDRA 3R6GB 4FLVA 1FRKA 5AXNA 3GIKA 4B9NA 3ZDDA 3UQ2A 4DTXA 1T0TV 1BUPA 3FSXA 3Q2TC 1OH7A 4WQ4C 1NOYA 3AVGA 3NF6A 5ETPA 4LUBA 5C2FA 2W54A 2BJ7A 1RAAB 5EDWA 1IIPA 1U8WA 4CF0A 1SXEA 3H1VX 2MMYA 2EFNA 4JV2A 3DXKA 4CZEA 4YOYA 4WF9Q 2Y3YA 2WF9A 4EMDA 1S97A 2EBGA 2QIFA 3T6JA 3CJAA 3MAHA 3RB4A 5M2UA 3NNCA 3AJ1A 4LRBA 3KFUF 3D6FB 2UV8G 4I2BA 2RJZA 1X2IA 5FLXO 3CJ7A 2D3DA 4OZ1A 3RW7A 1VJQA 1YITN 4NA1A 1JLGA 1H1VA 4Z4GA 1IKYA 5JS1A 5AKYA 1NK4A 1K0VA 2J4RA 4WWSA 1HJOA 1GNKA 1VQNS 1N34J 5AQPA 2Y8WA 4DCJB 4NLGA 1BPBA 3TOQA 2A41A 4K41A 1RDAA 4GRSA 4CO5A 1AFIA 4I7FA 1N52B 2DTJA 5AE3A 5AKGA 3F0NA 4A2AA 4BWMA 1UT5A 3SPZA 5E79U 4MF2A 3BH6B 2QWNA 4EP4A 1A0OB 3I76A 4IZ9A 3S6EA 4W5QA 2ADBA 2YHYA 3NWGA 4L73A 2ALYB 2YMPA 4M63C 1NKEA 4C11B 2NLXA 1JMSA 2BANA 3JAMY 2E5HA 4E7JA 2BZFA 3FEZA 3V2UC 3GCXP 1B70B 3CPWM 2F1IA 2LYAA 1RTHA 5A8WB 1FFVA 3QLHA 2YB4A 1RT5B 3HP9A 2M0GB 5CAAA 4BQZA 3G96A 2YMLA 4PZNA 2DIVA 1F3FA 5KRTA 4YB6A 3W62A 5I3QA 4Y2QA 3K5MA 4KHQA 2Z30B 3W9JA 3K17A 4CTAA 1IO2A 3OHAA 4ZPCA 2OLWA 1YJRA 1D8ZA 1GOBA 1FW6A 4HAIA 1SIWB 4UUWA 1U4BA 3KMSA 2RP5A 1I5OB 1XERA 4OLBA 3D2WA 3F2BA 2XHWA 4RJVA 2MLZA 1WKJA 1EXQA 4HVZA 4CYUA 2D0OA 3THWB 1VK3A 3DLGA 3L9ZA 1TFRA 5AT1B 4DV6J 2VFTA 2WFAA 4BRFA 4C4SA 1FDBA 2XNQA 4QS9A 2Z2MA 3FCHA 3DLEA 1FFUA 4KT0C 1NJWA 2IJFA 3OYCA 5CA5A 2KFNA 5EX3A 1UZHA 5J0XA 4RL1A 4NLUA 3UB5A 1WHYA 2DO0A 4PWWA 2JEJA 2YKMA 3LP1A 2NZCA 4N8NA 1HHQA 2UXDJ 2K4EA 5C12A 4YOUA 4LF7J 4FWQA 3QEVA 2OFGX 1NJIO 3TAPA 3NNHA 4IJNA 3A12A 4BC3A 1J5EF 2GELA 1SH2A 5D77A 2MKIA 1Z05A 3VGMA 1H2VZ 1WCNA 4Y2AA 2GEMA 1MNEA 2H3GX 5D4PA 1GFWB 4JI2F 3OXFA 2E8PA 4K4SA 1RBUA 1IKVB 2F77X 3DM2A 4AF1A 1K8AT 1QAXA 1KOHA 1FWLA 2N82B 2HBZB 5AI9A 1JLEA 1G7CB 2CPDA 3IR6B 1WG1A 4LQ3A 1S3XA 3WBZA 4F5OA 3D6MB 4F26A 2JC1A 1D3WA 2WVEA 1IKVA 2NZ4A 3GJTB 1HNZF 3HZEA 3MDFA 2MQNA 4PQUA 1FCAA 2HGLA 2IJRA 4IO9Q 1E6YB 3UD4P 3K2YA 5TKWA 4IDKA 2UUAF 3D1QA 2FBXA 4TYAA 4WU3A 2WF5A 4BVPA 2GIQA 4RO0A 3K57A 2V5HG 3CI5A 5AQGA 3QEAZ 5F0XA 2OXOA 4NLXA 2JR5A 2MSSA 4KR0B 1WN7A 4KLGA 1V6HA 2DGXA 4NRTA 4BREA 5CD4A 3X1LB 3AJ2A 1BIZA 1OY8A 1SC4B 1NJYA 2KFYA 1HR0K 1QAYA 5E0OA 4GMKA 3V9UA 3MM8A 4MT1A 3N4WA 3AVKA 1Q81T 2CPIA 2ZJQL 1Z1BA 5D6GA 2IAJA 5AQQA 3ICLA 3IDWA 3DLGB 2G8VA 5IZHA 2CQ4A 1RM6C 4DEZA 3ELHA 1IBCB 3EZ5A 5E3RA 4YUDA 1U1LA 3SQ2A 3WU2U 1IBMJ 3BGFA 1HRHA 1T03A 1ZTWA 5AKKA 3GZFA 5CHCB 4O4GA 1KAXA 2XLKA 3TI0A 3LGNA 2F65A 3WKEA 2IYIA 4ED1A 3CCTA 2F7VA 4Q44A 7ICEA 4Q0BA 2LQJA 2EXUA 3WIUA 3OJUA 3EJMA 3RG6A 3PW5A 5ALFA 3PW7A 4CEBA 3ZSXA 5KFFA 3IHQB 1F2HA 2OI2A 3K4GA 1KEJA 1DRZA 4UQTA 4JHDB 2I1RA 1RT3B 2G13A 2AJQA 2LECA 3IR7B 1VYAA 2YNHB 1CZAN 2AZ3A 3F41A 1UCVA 2NO4A 3UE2A 1GLCG 1OYDA 2DR5A 3ZYYX 4IJAA 4FNIA 1YVNA 4BBYA 1LEOA 3JTOA 5EWGA 3ISND 3RAQA 1VSIA 1ZQPA 2AYMA 3BSOA 3WQUA 2A18A 1JNZB 3PRDA 5HMWA 3CM5A 4JI5K 1JIHA 5LJ5Y 3QU2A 4KLOA 7ICVA 4K5SA 5SUHA 1X0FA 4EBDA 4FJLA 4JV5J 4J91A 2BUPA 3CCMS 4FOEA 1TAUA 1JXLA 5AQHA 3LDQA 3O3LA 4JK9A 1VQMN 3PFEA 1KQQA 1Q95G 2FHMA 2CUYA 3SQGB 2DR9A 2VH7A 4PGYA 2MSTA 4N8OA 4IQTA 1Q9XA 1ZQOA 5DB6A 3A8JA 4CEFA 4OX6A 3QEPA 2JVOA 1L7NA 2H3FA 1ZD2P 3W8PA 2VG7B 2ZIXA 1RXOB 3CCEN 1JUDA 1HBUB 2K8AA 4OJGA 1N5TA 3F44A 2E6LA 1PZNA 5HANA 1C6VA 5KFMA 3KHRA 1H38A 2GOLA 2W4CA 4DR5K 1RSCA 5DLGA 3CIZA 4NXNK 3MPUB 4PZOA 4GFJA 4CJ3A 4ZS6A 3PIPQ 2MJNA 4M9LA 4DR6J 3HSGA 2UXBF 3IM1A 3C15A 3IN5A 1R59O 3MK6A 1QD1A 4QAGA 2R2UA 4FZZA 3V6KA 4BRKA 3H8YA 3NNAA 2ZM6J 4OKEA 2AP1A 1ZQGA 4DV0K 1NLVA 4LR8A 1JJ2R 4W90B 3L7OA 3QLHB 5F1XA 3SCKE 1UWBA 1BC6A 3GV8B 1N32J 1W7AA 2FJ6A 4HHUA 4NCAA 4K4WA 3TA2A 1RAHB 4ZLPA 3G4SS 2IRYA 4ECWA 4WP9A 5G5HA 1YJNN 2VKRA 4BG8A 3RRHA 4YMMA 3HFZB 1SVDA 5ALLA 2B9YA 4B3SK 4RQ3A 1KFDA 2HFNA 2IIRA 3QICA 3V4IA 3SQ1A 1RWVB 1FNOA 4ZK7M 4FVUA 4A8WA 3N4PA 8ICEA 3TVYA 4IQVA 2YX1A 1C1CB 3TRGA 1MWQA 4I2DA 1LWFB 1SKSA 3KOOA 4IXCA 2I9SA 3KD3A 2GVDB 3NF9A 1BL3A 3H20A 4JI2K 2KOBA 2R18A 4PABA 5DZ6A 1NOMA 1NBWA 3MI7X 4JYAF 4EO6A 5IINA 1W25A 5AKLA 3CWJA 3RMAA 1A7GE 5THWA 3VEYA 4P4MA 4KV8B 4F02A 1KSPA 4OQJA 2K06A 3HZGA 3EGZA 2A5XA 1JRPA 5KFZA 2M9KA 3HW8A 1U48A 3VEZA 2FSNA 5DG9A 2AYEA 1B7FA 4BRIA 3J7AN 4DSKA 2DY9A 2H3ZA 3ZTRA 4PGXA 2ZVIA 4IWVA 1M90T 5AI4A 2QLTA 4P71A 4IH5A 1CSJA 2RVJA 3I8DA 1V3RA 3DXSX 1ZBHA 4Q5VA 5AKJA 3FSIA 4GKKK 3L5KA 2EFPA 3ILOA 5IC6B 4ZVQB 1PVPA 1TL3B 1U1PA 2QKKA 3W61A 2MDAA 3QFPA 3ZSWA 4DTMA 2J7UA 1SPBP 4IFEA 3LZIA 1HNVB 4OI3A 3PR4A 3NS5A 1NK0A 3D1OA 4KN7A 4OVLA 1NGGA 4F2SA 4NO7A 4CT8A 2O1PA 2C2MB 5SZTA 2RUSA 4H8KA 4J2DA 2HGNA 4KPCA 2MQLA 9ICCA 1QSLA 2B0GA 4FYXB 1PYTA 4BQLA 4ZLJA 2KI2A 3RRGA 1FF2A 2F9TA 2YWFA 1VAZA 4PUOA 2H3QA 3HI9A 3ETMA 1TK5A 1KBUA 2B21A 3HJVA 2RLTA 2O8DB 3IS9B 2XC9A 2VFVA 3M5RA 1J97A 1XS9D 3HULA 4M5DB 1YRUA 1N5YA 4F5QA 2RIJA 4JV5F 4C97A 5M1FA 3U3YA 1XK8A 2KSOB 1TMJA 4Y34A 3DC2A 3HD2A 2RQ5A 2W4PA 3KLGB 5L39A 5J2NA 1Z1VA 1EKSA 5A0YB 1F1BB 1AUDA 5J0YA 3R3LA 4RW9A 4DX8H 5M1PA 1ZA2B 4XH5A 3OS2A 3PHEA 2RE1A 4CK1A 2Z1HA 4CJ4A 3PO4A 3TPQA 1SJQA 3LPEA 4OJ1A 4MQ3A 3ZTPA 3UKRB 4JI1K 1U1RA 2FLPA 2EWHA 3PTWA 2I2YA 5B09A 4FJ8A 1X9SA 5HN0A 1OQ3A 5BN9A 2PMZF 3KOAA 1SIJA 5L38A 1HJPA 4JWMA 4JK1A 4JLHA 4MTPA 1KDHA 4OHZA 3SI6A 4AYBF 3CNHA 5H1SV 2MQ8A 9ICFA 3AD9C 3ZLJA 3CDBA 3PR5B 2NYHA 2QTWA 3OVSA 4UZCA 2BJDA 5HQMA 4GMJB 1J54A 1HBNB 2CKWA 4OYPA 3BEGB 2CVIA 3MZIA 5KGXA 5G4DA 4EI2A 1OPZA 3ULEB 1O1WA 2Y0SD 2QO3A 5GAGI 3R5JB 4C3LA 2LPEA 4CNZA 4V19S 3ENQA 1C2PA 4NYFA 1IV8A 9ICBA 1FD2A 3EZUA 2B9XA 4C1NI 2NUHA 2WCXA 3H0RB 2VFUA 2HFOA 3THWA 1UA0A 4F3OA 1B0XA 1T9WA 1TUVA 3MR7A 4DSIA 3JPTA 2IOCA 5KG3A 3OL7A 2OFHX 1Q3UA 4C9DA 1WOOA 2HBYB 2AMCB 4MDAA 1Q7YO 3MFIA 1KVCA 3KLEB 4JI6K 1WWVA 1V3SA 2ASMA 3HYFA 3NGZA 3FAHA 4WP3A 4EO8A 3WKBA 2W7OA 2X3GA 2JZ5A 2LXUA 4OI2A 2DY1A 2FMQA 3QXGA 4C23A 1BXNA 2IHNA 5CH7B 1WOQA 4K4IA 4USTA 5CZXA 3KJVA 5HJXA 2WB4A 1YJNS 1OSDA 3DCAA 3DRYA 1RWPB 3A13A 4GIBA 2E8AA 1PYSB 3U9ZA 4CJLA 5A8KA 9ICSA 4M3YA 3Q7BA 1WUDA 3CCQS 3NGTA 1UKUA 4FBTA 2PBDA 2NV3A 2LQ8A 2KVSA 4DJBA 2QW9A 4DN0A 4EP5A 2FBYA 3KK7A 3QIPB 4I56A 2ATQA 3OYEA 3P5BP 3POTB 2HYIB 4G3IA 1IBMK 1SZ2A 3G0ZA 4CF1A 4CM2A 4BR0A 4K4TA 4LIRA 1QVGR 3BBBA 4IEEA 3EL2A 2NRXA 3KLFA 4BC7A 5KRSA 1RPLA 3QBXA 4KH1B 3DGVA 2C2ZB 1IJFB 1YJWS 2ZKTA 1B22A 3FZFA 2ZWPA 3LDAA 1ATNA 3V7JA 2BABA 1AZSA 1HR0F 5ALJA 2UVRA 1ZD3A 5IWAJ 2PN6A 1NJXA 4DV5K 4RNHA 4CDIA 3W9IA 2X74A 2GJ2A 4KIAA 1TUGB 2HK3A 2FMSA 1ZZNA 1BWFO 1F60B 4QIWF 3EPGA 2V52B 1QQOA 2FHJD 3L4PA 4O44B 2E8NA 1ZPVA 2MZ1A 1W2IA 3LO3A 1LW2B 1NSAA 5KFDA 3UN5A 4A8EA 4Q2MA 4O5EA 2KK0A 1W9HA 3AQOA 2WBNA 4DSFA 2BOPA 1VIXA 4M7YA 1CQNA 3D0HE 1AZSB 2J76E 2DR8A 8ICWA 4RQ1A 3QDKA 3TR8A 7ICNA 3KWMA 2JVRA 1CJUA 4TY8A 3IAYA 5EWFA 2QE5A 4QZ9A 2R4FA 2AYGA 1ZC6A 2EKNA 3SBTA 1N61A 1YGYA 2KDOA 2DRDA 3LM9A 2WB1C 2CQ0A 3PKYA 3BGUA 2UUCF 4IR1A 3CYMA 3VGVA 3MXMA 3SSRA 4C7ZA 1F5CA 1E4GT 1ZQRA 1OKJA 3I8BA 1C1CA 4UB2A 3UWTA 2FF3B 1HEKA 2PSZA 3ZDCA 1JL1A 3C2KA 1JXEA 3JXUA 1N4LA 1NJZA 4LD0A 1TL5A 1FJCA 2B4JA 3TYTA 4TQRA 1HQUB 3TA0A 1EIYB 3SCLE 1IG8A 4C8MA 2RHFA 1BISA 4H4KA 1SKRA 3SAFA 2L9NA 1VQ6N 3TANA 4DN9A 5A8KB 1LKYA 4K4UA 4QJVA 2P6RA 2ADCA 1Q7LB 3PEHA 1YJWN 3DFEA 3O8WA 5DQHA 5DQGA 3W2VA 1U1QA 4HT7A 1ZTTA 1FESA 3MABA 3H45C 4HR2A 3WX4A 2CGJA 5F8JA 3SYZA 3GIRA 4FPAA 2QWOA 4YOTA 1Y9OA 3GCWP 3CG7A 4U7BA 4UBCA 3WXJA 4MEYA 3W2WB 3T3FA 1D8YA 1U45A 1O0PA 3NBPB 4Y1CA 3L3FX 5AM3A 4UF4A 3IBFB 4EEYA 3HPHA 2K4HA 1YJ9N 3RJGA 2E5IA 1ZQHA 1Q8IA 1U2CA 3KKSA 2ZJPL 2E5LK 2G8HA 2BJEA 4KX5A 4JRQA 1UPHA 1SB6A 2HMXA 2PFQA 3U1NA 3C0BA 2XSFA 3EW9A 3GG0A 2ZD1A 3QWPA 2VPXB 4AQYJ 4JI7J 2HHQA 4JKGB 4FJIA 4X5VA 3JXOA 2M8HA 3D0IE 1U09A 4M63A 3CMQA 4TU9A 2MKSA 4LFAF 1FXXA 2OEJA 4JKFA 3SXLA 3ZZZA 1RBVA 5AJ3F 4IR9A 2AYBA 3Q8UA 3SAHA 4M42A 2V6AA 4OGCA 3AV9A 4JI1F 3MM7B 3FBEA 2JEGA 4QOTA 1H72C 1JXVA 1RT2A 4QBUA 3V9SA 5D4BA 1I94J 2UXCK 1BPEA 1HUOA 4KH0B 2GMJA 2HMIA 1ZQXA 1LK7A 3HDSA 3BV8A 3OR1A 4B3SF 2ASJA 2ZD1B 5AHXA 1UVLA 4RG8A 8ICXA 3PM9A 4JKBA 4DR3J 4U8VA 2NRVA 2IM1A 4FVCA 4CK3A 2A2CA 5CHGA 4NI2B 4NEZA 1LQ9A 3US5A 2K3KA 4ELTA 4B3OA 4LVNP 1YIJS 2QKQA 1QCKA 4O3OA 5J8YC 2B6GA 3VCBA 2HSEB 3ZTQA 3CC7S 2VPYB 3ULDA 3TZWA 3K8WA 4URGA 3UR3C 2AQ0A 5AE2A 5CABA 5ALRA 1FKPA 4Z6DA 5EUHA 2OPPA 4ICLB 3S9HA 3JTNA 1TZ0A 2KEYA 3CF5L 1VQ7S 4P10A 3JQKA 1AYEA 4FF3A 4DFPA 3SV4A 3AFGA 4I6MA 1T3OA 4C4WA 2XHCA 2Y1IA 1WUUA 3VA3A 4A8FA 4H4MB 3NFAA 4B3SJ 2ZM6K 2KKHA 4I2QB 1NU0A 4FJNA 1JLAA 2J5AA 3C6HA 3IFRA 4RW7A 3MM9B 4RUHA 2FSJA 3ALYA 3ZFVA 1LCUA 4PHAA 2BANB 4KH6A 4CO4A 1S12A 1NOZA 2MXYA 2YNGA 1VQ8N 2EZYA 1Y11A 3A3PB 3QU9A 1W2BM 1FX2A 1ZJMA 4CJEA 2BXJA 3M8PB 5KFOA 4R25A 5JTIA 4J9RA 3IA0A 2B8QA 2AD9A 3DDNA 1EHWA 3HHLB 1Z26A 4IRDA 3KNAA 3LTOA 4IDHA 3U9DA 4M5KA 4IBNA 1G2EA 2IMOA 1KKXA 2RRDA 4K8ZA 2XBPA 3D2EB 2EVZA 2WTUA 2FPLA 1U1MA 4DG1A 1HNVA 2K7KA 1KXPA 3VGLA 3VEOA 3ZZOA 2A1RA 2ZG6A 1Y5LB 2GTDA 4CGHA 4U96A 2NXCA 5HHHA 1CXQA 3MECA 5HRRA 3RSEB 1NZAA 3M6KA 2AEMA 2CZ4A 4FOIA 5CP2A 4F9OA 2BCVA 5KFKA 2E20A 1WB9A 4DQPA 3CD7A 5A0YA 4CJFA 3TAQA 2V51B 3TTCA 2UXCJ 1I94K 5G5GA 5AQFA 5J2MA 2DGWA 1E6VB 3SJJA 3S3MA 3OT9A 3LUYA 4ZVGA 1SI9A 4NJ8A 3V6HA 3PSFA 3GYNA 1GLAG 4IQWA 4ZDNA 4H4OA 4MFBB 3CJ5A 8ICUA 1RTDB 2SXLA 2ZIVB 2FLLA 2RQCA 2UU9K 4I6YA 1VSMA 4DR1F 3I31A 1RDCA 1GX5A 1SAZA 2XB2D 3S3OA 3GJRB 3SJHA 1NK5A 1VLYA 4ZJQA 4AFFA 4KH5A 4YN4A 4P7TA 2NRTA 8ICRA 3U3GA 5GIPA 4LREA 5IILA 1XQIA 3ZZRA 1UFKA 1R6VA 3ISCA 3MGJA 2K4PA 5GADP 3BQ0A 5KG1A 1X60A 4CLUA 2J6UA 4HI1A 2W2MP 2DNHA 2WTFA 1HWUA 5AZIB 2HLUA 1H98A 2ZH8A 5GMEA 4FLXA 2AJ2A 3BQTA 3PRBA 1IJEB 2DUYA 3H6EA 3O8MA 3MN6A 2N3LA 1N32K 3ENWA 2A6OA 7ICKA 4X62F 1F5SA 2HWHA 1XMOK 4OYWA 4J2EA 2LU1A 5AI8A 3CHWA 1UP1A 3CMES 4EEKA 4DU8A 1MWMA 1LFPA 3QESA 4I2CA 4P0PA 2IHMA 2OPRA 3FKBA 3C15B 3PIOQ 3O9RA 2XYPB 4UAVA 1X4FA 1H74A 4J8FA 1YF5L 2QMUB 3PSTA 1RWMB 4RNOA 1UPMB 1RT5A 1T9TA 3MEDA 4USHA 4DQIA 9ICIA 2QEXS 1F0MA 2HK2A 3D6RA 3DAWA 3I55N 1HWIA 2HFZA 3C3LA 2XTJP 5ALQA 1KP6A 4Z0UA 5M2PA 4I2FA 4LBHA 1N5WA 3H5UA 1HBUA 3ENAA 4FF4A 4J5OA 3NF7A 2VQEJ 2A42A 3J80Y 3DI6B 1L7OA 1RBOB 3MR3A 1HWKA 1GO3F 2G0IA 1IKXB 1K8AO 4F36A 3I0RB 1NRKA 3DLKB 3MR6A 2P9PA 2Z1IA 3W7BA 4CH1A 1MU2A 1MSWD 2AP6A 3J7YP 2QRRA 3CIPA 3KJQB 4ZPWR 9ICLA 4AHUA 2E29A 2KXHA 5GAHP 4R79A 2FB0A 2ZH6A 1VQ8S 4FVMA 1KQGB 1MN7A 4OMFG 1HNXJ 3RYLA 1CJUB 2EFOA 1GMUA 2Z8QA 1A0PA 4LF6K 5KQDA 2G2OA 3O80A 3C29A 2DNPA 3D3CJ 3PX6A 4ES2A 3NVYA 2RILA 1URNA 4W5OA 4RW8A 3R7SB 3MEDB 2DXDA 2ZGZA 3RR7A 1Q86T 1EARA 1TL4A 3BJYA 3CCSN 4DPYA 1VRUA 4ED0A 2V63A 3VQTA 1XC3A 1LW2A 2Q31A 5CRXA 2L5YA 3EUB2 2WMMA 3JPOA 4BRCA 2YWEA 2QA4G 2FGCA 4K0KK 3RH5A 4CZMA 2UXBJ 4UOFA 4Y2RA 1RTZA 4YFUA 1FFWB 4JS4A 3C2LA 4ES1A 3L3CA 1OH5A 3HVRA 3MUMP 4YR0A 3FRYA 1K8KB 1Q8BA 3M8SA 4H0VB 3M30B 2P9IB 2VC0A 4QYZJ 1VQPN 1VISA 3GJSB 4ZPAA 4CHQA 4QZIA 1UAWA 5LL6d 5DZ7A 3IAM9 4KJIA 2QL5B 1ZBUA 2EQYA 4MK9A 4QJFB 3I28A 4Z4IA 3PHTA 5A2QO 1VDVA 1FDAA 3NF8A 1AXQA 1BVSA 3MN9A 4YB1P 1IBKF 4FJGA 1G3OA 2P5OA 3SUQA 4Y3CA 3NCPA 2JWLA 2KQ2A 4JS5A 2W9BB 2GV9A 4WIQA 4AYBD 1WC6A 3VQ7A 1R43A 3BBCA 3HSCA 2GQCA 2RRAA 1ZBSA 2WF6A 1Q82T 2N7YA 3MMJA 1UW9A 4KHYA 3C6TB 3IRXA 2ZTDA 2Y9TA 2BCRA 1HI8A 4WQ5A 3UDVA 3F2DA 2E6MA 2HOQA 2V7YA 4YR2A 5CHIA 3QAUA 2YNGB 1FJGK 3I9ZA 3WC2A 1S7IA 3EE9A 3DDHA 1RACB 3DOLA 3H1QA 2KHVA 1NGEA 5FP0A 3FMWA 3A2FA 4DR7K 4ZPBA 1P8ZA 3M1VA 3VQ6A 4PQUB 4DQQA 3KHLA 1VQOS 2W9CA 4C4TA 1PKUA 3DDIA 1R6YA 4AP9A 1TV9A 2ZJAA 4AYBC 9ICJA 2L3MA 4I2PA 3Q8QB 1MROA 4I6MB 4RCHA 4F4ZA 1Q78A 2E1MC 1R89A 4G1IA 1EX8A 2CXEA 2A3ZA 2PA3A 1RDWX 4P4PA 3A5MC 4OYZA 1Y10A 4F0HA 1U6BA 4O8KA 4M3XA 1N6QA 3NY0A 3BDPA 2F8MA 4TU8A 1ZQFA 2XYGB 2MHNA 3MXJA 5CR0A 1MROB 2CJAA 1RAJA 2PFNA 5BOMA 2E1PA 1HL6A 3MECB 4QR2A 2DQNB 2C2RA 3CFPA 1Y7PA 5ALGA 4H0XB 5FPEA 1XHZA 3KLIA 1WNEA 1BUXA 1JJ4A 2VDIA 4KFBB 4KH4A 4ILHA 1KQSM 5JMNA 3V9ZA 4DLEA 1FEHA 1HI1A 2PFFB 2CFXA 2ZBPA 2D74B 1RT2B 3IRUA 2BVZA 2YKNA 1D9FA 4JEPA 2OPQA 4UASA 3S8SA 3OYMA 4J9QA 3TTDA 4F8RA 3BSCA 1RQLA 3OLAA 4DV1F 1WD6A 3RAXA 4GO7X 3V4IB 4L3KA 3T69A 1RHJB 4HTUA 4CGZA 5HSPA 1DQAA 4O0NA 1VLBA 3V81B 3P45B 5FRMA 4DCPB 2PT0A 4N77A 4WIIA 5IIOA 4IKAA 4DS5A 4Q2LA 4A4JA 2AXTU 1U02A 5K8PA 2ZH9A 3OTDA 4O5FA 2KG0A 1S1TA 4CJVA 2XIDA 1VK8A 7ICGA 2ZHOA 1XEZA 3P8BB 2ZZTA 5CYMA 3WK9A 2NSCA 3PRVA 4BR2A 4GVMA 2V67A 1I6JA 3Q8RB 2BJ1A 5K8NA 3E58A 1JLEB 1UVMA 3HRGA 4YDDB 4L8RB 4UARA 2EPIA 4DU1A 4WP8A 2YWGA 4I9QA 2O01C 2GWSA 4X84A 4NOHA 4DR6K 8ICGA 4CGGA 2VA3A 1HBMB 3E66A 3O9UA 1M1HA 1WC1A 4ITSA 2ZJRL 2HF3A 2E5LJ 3NAEA 2QA4N 1RT4B 3M2UA 4FJXA 4DL3A 1J5EJ 3EUNA 3FDSA 4OZLA 5LT5A 2D5RA 3CXCM 1QZ5A 1UMJA 1YJUA 1MQ2A 4DL0C 2W3SA 3CD6N 3NXZA 1F21A 2L48A 3DRPA 1P7DA 3UXOA 5JXSA 1VQPS 3GR0A 1ZXIA 4IRCA 1RWWB 5BXIA 4ZVEA 4L3NA 3C65A 5IT0A 5G0RB 1F9HA 2FIUA 4MAKA 9ICMA 4MIAA 1RADB 8ICSA 1FK9A 4ILMA 4NXNF 2F3NA 4PKDB 2GBZA 2MA1A 3TZZA 3A0BU 2KJWA 2NRZA 1FI4A 1RLCL 1WOSA 4TUPA 4PY5A 3UKRA 1ZM3A 4BRHA 1QHTA 2FJDB 2EC2A 2CRLA 5AXMA 2QXFA 1J2VA 1E6YA 4Y28C 5EY4A 5JUMA 1RU2A 3RMBA 1T7PA 4LF9F 5HP1A 4P52A 5D3GA 2NZTA 3CW2C 1N0VC 3UMCA 5KFXA 4RQ2A 4IOCQ 5KFGA 4X64K 5HP4A 3SZ2A 1R0AB 4B9MA 5J2NB 4MEXA 1B92A 4Q0BB 5BRDA 2DJWA 2D8CA 2DHSA 3KG4A 3DLJA 3OHRA 2BPFA 3KKAA 2OYQA 4QZHA 1UVNA 1KONA 4FNHA 1GK8A