3EYZA

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna (open form)
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3eyzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3eyzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3eyzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3eyzA01
2F8SA 5DLGA 3L2RA 3LAKA 3ORYA 4YXMA 5KFOA 5DKWA 4DQIA 3NTUA 3DOKA 2DFFA 9ICWA 4ICLA 4M42A 4J2BA 4EBCA 3QEBZ 3RJJA 1J5OA 1XC9A 3NGYA 4FYDA 1B9FA 3KD1E 3EW9A 4Z0UA 2AJQA 3P1GA 3AA2A 5KFVA 3HPGA 4CCHA 5DBCA 1EETA 5J0YA 4IG3A 4JK1A 1B9DA 4F5NA 3UPQA 1L3SA 3MEDA 1JLAA 1JX4A 3V9ZA 3B6PA 3HXMA 1QLNA 1IKWA 4YR2A 1J53A 4F4WA 4FM2A 3PY8A 4NCGA 3O4QA 3PO4A 4QWAA 3O3GA 5CB1A 3QEAZ 1BI4A 4FK0A 7ICNA 4Z4CA 2QXFA 3JPNA 4RZRA 4OPKA 3V6JA 4DTMA 4DTOA 4EZ9A 2X78A 4DU1A 4Z6FA 3UQ2A 3Q8KA 5KFYA 3RAQA 1S9FA 4B9LA 3BQTA 3DLRA 4F50A 3KK3A 2PI5A 4ECTA 4N47A 4F3OA 4NCAA 4JWNA 1ZQAA 8ICUA 4DU4A 4J9LA 1ZJNA 3MECA 1UA1A 2AGPA 2KZMA 4RNOA 4EYHB 4ED6A 1BCMA 2ASDA 5L1KA 1ZQJA 9ICIA 3C21A 4CIGA 1HUZA 4HUGA 1KDHA 2BR0A 2HHTA 4TSXA 3VQPA 4C8LA 5CWRA 3DLHA 7ICQA 5J2JA 1TKZA 5L9XA 2DFEA 5J29A 3V6DA 4DTSA 4I9QA 4KV8A 1JLEA 2G8HA 4GXJA 3RBDA 2G8WA 1ZQDA 3QEWA 5JUMA 4NCBA 1NJZA 2FC0A 3RJEA 4MFFA 2JEJA 5DBBA 2WOMA 3ZDEA 2FLLA 4CJ4A 3Q8MA 4FJ8A 1J9AA 7ICTA 3M8PA 2C2DA 3GIMA 4J9KA 5BOLA 4QZHA 8ICEA 3TWHA 4E7HA 1BI4B 1NK4A 4MF8A 4E19A 4Q44A 2VWJA 2R8JA 1ZQRA 1VRUA 4EZ6A 4J9NA 1W0HA 3GQCA 3VQCA 4W5QA 4DFKA 5DLFA 4M45A 4DOAA 4YD2A 4RQ2A 2PYLA 1VSFA 3G6VA 1RPLA 4R66A 3NH1A 4LH4A 1KRPA 2QK9A 9ICVA 3AVAA 4OJRA 2D5RA 4E1MA 3OVNA 3QZ8A 1K1QA 1J54A 3WNFA 3H8WA 4PY5A 4L8RB 3LPTA 4NYFA 3RJIA 2Y1IA 3H08A 2KFNA 1XO1A 5KT2A 2KQ2A 4WE1A 2PZSA 1S9EA 2DPJA 1PZNA 1TFRA 2HVIA 1IM4A 1YT3A 3TARA 1Z3EB 4KHQA 4B9SA 1ZQSA 3IRXA 4YN4A 4RQ7A 4ECVA 3S3NA 4CJFA 5C5JA 1ZQEA 4JS4A 5KFMA 4DQPA 4DLGA 2I1QA 2ASJA 3HX0A 3UQ0A 3RRHA 4UAYA 5KFGA 4PHDA 2P6RA 1T3NA 2R8IA 3OS2A 1L5UA 4M41A 5KFSA 5KFJA 3F9KA 1ZQHA 1BCOA 3RJFA 5KFHA 5IIMA 3RB0A 1S0OA 1JLQA 4YR3A 4J2DA 1KFDA 2F1JA 1RDCA 2BPCA 4BDYA 1RCHA 1S1VA 1WCLA 2HHUA 2OWOA 1RDDA 3LWLA 4QZAA 3V7LA 4F2RA 3S9HA 1G15A 5KFWA 4OKEA 4GC6A 1S6QA 5J2BA 5J2KA 1VSEA 1BPXA 5J2QA 3OYFA 4MEXA 2ALZA 1A5WA 3NGZA 2BPGA 2QKKA 2ZE2A 4FJ5A 1BISA 2PI4A 1EX4A 3ASMA 4JV1A 4O5KA 1S0NA 3NF7A 1RTDA 4KO0A 4Q8EA 3HSTB 2VG6A 1UAXA 1JIHA 4GVMA 1BGXT 3DRSA 1A5VA 3RB4A 8ICAA 4UB3A 2PFOA 5KFTA 1S1TA 3KLHA 8ICOA 2C28A 4JWMA 4YXJA 2GV9A 3TFSA 1GOBA 7ICMA 1D9DA 1JLGA 4J9MA 3K75D 3KHGA 1SL2A 4QWEA 4CEFA 3KK2A 3LK9A 8ICJA 4N76A 4TQSA 1RBVA 1KVAA 4I29A 3CM6A 3QESA 3QEIA 2JEGA 4FCYA 4KN4A 5J0XA 3AO3A 1UWBA 3DOLA 4IRCA 3U3GA 1D5AA 3NCIA 4YVZA 2MUTA 2Z1IA 3DM2A 1ZBUA 3S3MA 3AVCA 5HNKA 4CEOA 4N5SA 4XUSA 4EEYA 2IHMA 3M9OB 1KVBA 2BGGA 3MXMA 2B4JA 4G1QA 2C2RA 1FK9A 5EWFA 3VQAA 3AVGA 4DL2A 3TAQA 1H38A 3ZSQA 1L3UA 3PNCA 4RUAA 3GDXA 1RTIA 2Z1JA 4K4HA 1D8LA 4DQSA 1ZQCA 3T19A 2R8KA 4QZDA 3V9WA 2BCVA 1NJYA 4E1NA 4IG0A 4KLLA 2XY6A 4XIUA 4PHAA 1XHZA 4LZGA 4LSNA 4RQ1A 1X9MA 3QO9A 2IA6A 4CERA 4UB5A 2RF2A 5HHHA 5HP4A 3K5LA 4NLNA 2ZTCA 3RJHA 4UB2A 3SYZA 2W42A 5C42A 3AV9A 5J0WA 3LPUA 4RG8A 5KFQA 3Q8QB 3RR7A 3MXJA 2WONA 1TK5A 2FMSA 3BQ2A 1KCFA 3WNHA 1C1CA 3VQEA 4FM0A 1ZBIA 4JV0A 5CR0A 1COOA 2MUTB 5KT7A 3OYEA 1C0TA 2P5GA 5IIKA 5KG3A 1CLQA 4DOCA 1DTQA 3HVRA 1JXLA 3RMDA 1VSIA 4YD1A 3ZD8A 4QZGA 3FDSA 4ECRA 4KFBA 4Z4IA 1ZQIA 3GIIA 5HMLA 3CFRA 3PW0A 4BE0A 5DQIA 4CEZA 4K4GA 4XRHA 2ISPA 4KITB 2RKIA 1LWEA 5K14A 3AA5X 5J0TA 5DK5A 4LD0A 2W9CB 1ZQVA 4CGIA 1MSWD 4UBCA 2AGOA 4M3TA 3ZSRA 1U45A 3MGIA 3CFOA 1RT3A 3ZDCA 3AU2A 3CQ8A 3NAEA 1NK0A 4AHRA 4O0JA 2W9BB 2JEIA 1WAJA 4CFBA 2P5OA 9ICFA 4DFMA 1T7PA 2F96A 4F3TA 2J6TA 4BGDA 2ZQBA 4P4MA 3AVFA 5J2IA 4ED8A 3PV8A 2UVRA 3C6TA 3NGDA 1QS4A 1RBRA 4JV2A 3V72A 4YCXA 4I2HA 5F9NA 3T3FA 4M9GA 5KT3A 9ICEA 3SUQA 5KFRA 3HPHA 2IOCA 4QZCA 1U49A 3LP0A 5CZ2A 3DI6A 4OLBA 4B9MA 4CECA 7ICGA 3MDAA 1S1XA 5HMMA 3KKSA 3HJFA 1JXEA 3KLFA 1N56A 4I7FA 3MR3A 2IS3A 2FPLA 4C8NA 4M0AA 3RJGA 3BGRA 4E7IA 3H7IA 4KLUA 3OYIA 4M3ZA 4HCBA 1BPEA 1TL3A 3A2FA 3MEGA 1QE1A 3T1AA 5CHGA 3L2WA 4DS4A 4ECWA 4NM2A 4CK1A 5HRSA 3RMCA 4HHTA 2D0BA 4C8MA 2FBXA 2BQUA 8ICMA 4PA1A 2XY5A 1KFSA 1BQMA 1QSSA 4IQVA 4KB0A 3EPIA 4MEYA 4FJIA 4M3YA 4OLAA 3TABA 3NF6A 4UB1A 1KLNA 4PGXA 4Y1CA 1VSJA 1ZETA 5CZ1A 5FRNA 9ICUA 2HHQA 1BVSA 1ASUA 5CJ7A 3PMNA 4EP5A 3SV3A 4LVSA 1RT6A 1L3TA 9ICRA 1RDAA 4KKOA 5KG4A 4RW8A 2BPFA 1IKXA 5BPCA 2RDJA 4CHNA 4HUEA 3M8RA 4CJ5A 4CJ3A 1TGOA 1TVAA 4O44A 4H4OA 9ICMA 7ICRA 4DF8A 2P1JA 1S97A 2RPIA 1S10A 3OYBA 4FXDA 3Q8PB 4ECXA 3GV5B 8ICWA 2KW4A 5J1EA 4AILC 4R65A 2IHNA 4CJWA 4DTNA 3SV4A 1TK0A 8ICCA 5IIJA 1ZYQA 1U47A 3NE6A 5KT6A 4RU9A 4DTRA 2PFPA 3CYMA 1CXQA 4EYIB 3MFIA 2XY8A 3AVNA 1SKSA 3M9NB 2A1SA 1U48A 4DSIA 3MR6A 2VG5A 2YV0X 3M9MB 4B9VA 1HRHA 9ICLA 3DRPA 1CZBA 3IAYA 4EP4A 3SUNA 3K5NA 4KB1A 3AVKA 4ELVA 4O4GA 2Y1JA 4E3SA 9ICAA 3G10A 3NHGA 5J2EA 1LV5A 4ZTJA 4CGDA 2PY5A 3QEPA 3L2UA 9ICHA 3KHHA 1EP4A 8ICKA 2ZUCA 4RPYA 4FJHA 4I2IA 3BQ0A 4IQTA 4BXOA 4K4IA 3HP9A 4FLVA 5EWGA 8ICFA 4CEQA 3RWUA 3PR4A 4XQ8A 5KRSA 2DPIA 4B9UA 3JPSA 4B8CA 4DU3A 4KI6A 4YR0A 4XA5A 1TKXA 3GV7B 2IC3A 3OJUA 3LZIA 4FJNA 4EBDA 3DMJA 2ZJAA 5HBMA 1NK7A 5I3UA 2BHNA 3G6YA 3HT3A 2FPMA 2HHWA 1MU2A 4ED1A 4GC7A 4JLHA 4CJTA 2BKEA 1ZQZA 5DQGA 3OJSA 4ELUA 5DMRA 4IQWA 2IDOA 2XRIA 4OPJA 1N6QA 1RBTA 1BPDA 4HCCA 3MDCA 1XI1A 1ZQOA 3H8SA 4IR1A 4J2AA 3U3YA 4KLHA 7ICEA 1KLMA 3MR5A 2V4RA 4NM1A 3QERA 4ID1A 3HVTA 4I2EA 3AO1A 3S3OA 4MFAA 4ZHRA 1DLOA 2BANA 2O4GA 4CHQA 4RW7A 1WNSA 1TAUA 1UOCA 2X6SA 3ZD9A 3IHQB 3RTVA 3BDPA 5HP1A 4M9JA 1RTHA 2BCQA 4IFYA 1BPBA 2ZD1A 1C0UA 1RT1A 4AHVA 4ECZA 4M3XA 4KLJA 1RILA 3KLIA 1CXUA 3QIPA 4LSLA 4FLTA 4CE9A 3OYJA 4NYNA 3SI6A 4GXIA 1HJRA 4UQGA 4QWDA 1IO2A 1ZBLA 3OHAA 4KN7A 4HTUA 8ICTA 4B08A 9ICPA 3WNEA 4R8UA 3ZDDA 5L1LA 1ZQWA 1HUOA 4DSLA 4CEDA 1Z26A 1WLJA 3HO1A 1BL3A 4R63A 3K57A 4DMNA 4PHEA 3UIQA 4QZIA 4H4MA 2FMPA 2UVVA 4KLTA 3TANA 2A1RA 4I2CA 1RTJA 2BCSA 1X9SA 3AVJA 3PVXA 4CF0A 2NRTA 1IKYA 3RAXA 1X9WA 1ASWA 3ZSZA 1XSLA 2ETJA 9ICCA 4F5PA 5KG6A 2E4LA 4FBTA 3NGIA 3TAPA 4M3UA 3SQ0A 4O3QA 5KFFA 4FK4A 1QSLA 3V4IA 4IDKA 1HNVA 2NRXA 3UXPA 5HRNA 5J2NA 5BOMA 4OGCA 2V9WA 4LY7A 4CFDA 4F92B 4QZEA 4O3SA 1QSYA 1ZQUA 2PYJA 9ICKA 7ICIA 3GV8B 4QZ9A 4RNMA 8ICGA 4CJVA 1SL1A 1TV9A 3ZSOA 2HB5A 1SL0A 3SUPA 2FLPA 4UBBA 3L2QA 5KFPA 3V81A 5JS2A 4UB4A 5SZTA 3SZ2A 3CM5A 3JPOA 1ZQTA 3AU6A 4FZZA 4N56A 1DGSA 2BCUA 4QWBA 4TUQA 4I2GA 1NJWA 2GUIA 1W9HA 2PXIA 1S0MA 1VSMA 2F8TA 2JGUA 3T5LA 2IGIA 4KTQA 5CYQA 3TI0A 1UA0A 1I3AA 1EXNA 1XU4A 7ICJA 4Q8FA 3VA0A 3RB6A 4F91B 3KHLA 3HK2A 5J0QA 1ZJMA 4AHTA 3K59A 2ZTEA 9ICBA 3JPQA 2W9MA 4Z4GA 4W5NA 4O3RA 1U9LA 2XHBA 3OS1A 1A76A 2XY7A 5EWEA 3PW2A 3AO2A 4CJLA 3KK1A 3QETA 3SNNA 3JPPA 1SZPA 5FDLA 1Y88A 1HMVA 1WSEA 1SKRA 2HVHA 1HPZA 1RBSA 1HYZA 3OGUA 4FJXA 4B9NA 9ICJA 4LH5A 4N41A 2B6AA 1FKOA 5J0SA 5KFBA 5F9LA 1ZBFA 1V9PA 2IAJA 4J9QA 1NKEA 5CYMA 3ISCA 2ZUBA 4HVJA 4DFPA 4HUFA 4CGHA 1X2IA 1UT8A 3E01A 4M6WA 4ECUA 2W9AA 4F4YA 1JLCA 4CJEA 3OSPA 3VQ9A 5J2FA 4KLSA 4RW4A 1S1WA 3K58A 9ICOA 3V7JA 5D3GA 4KHUA 3B0YA 2WTFA 3Q8LA 4IBNA 5DG9A 2OPPA 2A1JA 7ICLA 3HW8A 1KEJA 2OA8A 3L8BA 4YP3A 3V6HA 4YNQA 2IBKA 3CFPA 4Z6CA 5DG8A 3T5HA 8ICSA 4Q5VA 4RQ8A 4KHYA 1JLBA 4DTJA 4KLIA 1ASVA 4CFAA 3RB3A 4RQ3A 2OPSA 3RJKA 4F5RA 3KJVA 1AROP 4OKKA 4NY8A 3KTQA 1RBUA 3EWAA 2G8UA 3OY9A 8ICZA 3OYGA 1ZBHA 3TAFA 3U6FA 3C94A 3ZT2A 5KT4A 4GLXA 1LW2A 3QZ7A 4FK2A 4CK3A 3EYZA 4KLDA 5HLFA 4RUCA 4W5RA 1SKWA 4C8KA 3LDAA 4Y1DA 3PX0A 4P4PA 1VSKA 3K5OA 1C1BA 3DLBA 1N5YA 3KIOA 3SQ1A 2E6MA 3OYMA 3BJYA 3VQBA 1U04A 3AA3A 2YNFA 2UVUA 3V9XA 3P5JA 2UVWA 4M6WB 3VQ4A 4DEZA 4RT2A 1RXVA 3NH0A 4I2PA 3V1RA 1TKTA 4M9NA 3DLGA 4BACA 4M9HA 4FW2A 4ED0A 2FBYA 2I9GA 2ATQA 5J0OA 3G6XA 2XGPA 3OYHA 2GWSA 4G3IA 2A1JB 4DL5A 4CJUA 4BDZA 1LW0A 3B6OA 4Z4FA 3LALA 3C1ZA 3RR8A 4FZXC 5IINA 1EKEA 4FBUA 3OYAA 5J0RA 4FJMA 2R8HA 4BWMA 2XGQA 3V1OA 4CJKA 3PR5B 3HL8A 2XC9A 3ISDA 4DSEA 1S5JA 1QTMA 3JPTA 4DLEA 2AQ4A 4EBEA 4QZ8A 3C2MA 1KSPA 4C8OA 4E0DA 4CIEA 5DB6A 4FLYA 4AHCA 5KG5A 1DOQA 4I2QA 4NLZA 2F1HA 5J2GA 4KHSA 4F5OA 7ICFA 3C2KA 3OYDA 1DTTA 1S77D 3K2PA 3RH4A 2HHSA 3DLKA 2G8IA 4I28A 1A77A 4YG2A 1BPYA 5J0UA 2EHGA 1IH7A 4F4ZA 2BQRA 1NK5A 2EX3A 4MF2A 5KFIA 5SWMA 3FFIA 2HNYA 2KFZA 4O5BA 4IFVA 4CEEA 5J2AA 5DBAA 1B92A 4FS2A 1BIZA 5KI6A 2Q0ZX 1ZQNA 3O4NA 4O3PA 3TR8A 4E7LA 1U4BA 3ZSXA 4FJ9A 1ZQQA 1HNIA 3QLHA 7ICVA 2OPRA 4Z4HA 4UAWA 1S0VA 3D45A 4FS1A 4NLGA 1F21A 8ICHA 4KAZA 3LZJA 1WSHA 4YFKA 1C6VA 1VRTA 1TAQA 3H4DA 5KG7A 3VQ8A 3VA3A 2XO7A 2H5XA 4CF9A 4CJRA 2YKMA 4PWDA 4Z4EA 1BQNA 3ZT3A 4PUOA 2LSNA 1YTAA 3AVMA 2ATLA 1SV5A 2NRVA 2VA2A 4CJQA 2Z1HA 8ICQA 1B43A 3IM1A 4DS5A 3SJJA 4R64A 3AVLA 3EPGA 2E6LA 1TK8A 1WSFA 1BHLA 4NXZA 1MC8A 1S76D 4J9SA 2RN2A 4DF4A 1LB2B 5DDMA 4B8AB 3LWMA 3TFRA 3ZSYA 4KI4A 3C2LA 3K5MA 4Z6EA 1HQUA 4ZH4A 3QNOA 4FJJA 2BGWA 3Q8RB 2ZJ8A 5IIIA 4DL6A 2R8GA 1T8EA 1KTQA 4I27A 2X74A 7ICOA 1XWLA 1KFTA 5DB9A 4YFUA 1VSDA 4I9LA 8ICIA 4I2BA 4YQWA 2YHAA 2P6UA 5DGAA 4B3OA 5KG2A 3V6KA 2IMWP 2KTQA 1C7YA 1B22A 3OYKA 9ICXA 2ZTDA 4TUSA 3SQ4A 2W8KA 4J2EA 2HNZA 4ED7A 2DFHA 3SCXA 3SI8A 3L3UA 4FJ7A 4KTZA 3VQDA 4DTUA 3ZCMA 4CFCA 1VK0A 5KG0A 5HHIA 4O9MA 3VQ5A 4NLKA 2PFQA 1Q9YA 4AH9A 3M8QA 5DDYA 2ZUDA 4PHPA 4QWCA 3PW5A 5HRRA 1WSIA 1T03A 1RDBA 2YKNA 4CHYA 1RYSA 4BWJA 3OSNA 3MGHA 4CGFA 4I2DA 5KRTA 1MQ3A 3ZT0A 5IIOA 1O1WA 1ZQFA 3H8JA 4IRKA 4TUPA 4Q43A 1RT5A 4GMJB 3I8DA 5T7BA 4FJGA 1YVUA 1NOZA 3K4GA 4E7KA 3ZDBA 7ICKA 1ZQMA 1IKVA 3C23A 4H8KA 1ITGA 3ZSVA 1LAVA 1MQ2A 1XSPA 4M04A 1K1SA 4F93B 4CGGA 5KT5A 3RRGA 1WSJA 4QZBA 1D9FA 2F1IA 2VA3A 3AVHA 4F4XA 5KGXA 5HROA 4KRFA 1A5XA 2M9NA 2BE2A 1FKPA 4MQ3A 4W5OA 1C1AA 4ECSA 1TL1A 4DTPA 3JSMA 4OKJA 4F2SA 1NKCA 1FXXA 3N4MB 1RYRA 8ICPA 4PH5A 4O5EA 1WCNA 4KHWA 1C0MA 1XS9D 1WN7A 5DG7A 1L3VA 3NH2A 3JPRA 5D46A 2OPQA 2DFLA 4DSJA 3OHBA 3V9UA 4CESA 4BXOB 3ZDAA 4M47A 5CA7A 4CHOA 4RPZA 2X6NA 3LAMA 4DTXA 3AVBA 5FROA 3DRRA 3P83D 4CF1A 2D0CA 1HJPA 2GBZA 3VQ6A 2NRZA 2D0AA 4HYKA 4O3OA 4QOZB 4ED2A 8ICXA 3RH6A 4FLZA 4RQ6A 2XCPA 9ICGA 3ZT4A 1TV6A 3M8SA 4F8RA 3RBEA 3QE9Y 4O0IA 3L2VA 3THVA 3KHRA 5FRMA 3LP3A 1X1PA 3SQ2A 5KFAA 4KLFA 4QZFA 1Z00A 3C6UA 3MEEA 3PMLA 9ICQA 3FYHA 3DLEA 4FM1A 1CEZA 2NRWA 3SPZA 3LP1A 2LYHA 3RMAA 3NBPA 1RT7A 3ETLA 1RXWA 3HPOA 5DGBA 4DOBA 1RZTA 8ICRA 3HM9A 2QKBA 5KG1A 2JEFA 2O4IA 4J9PA 5EU7A 1NK9A 4BDPA 5D4BA 2BDPA 5I42A 4MFCA 3DYAA 4I2FA 4GXKA 2OZSA 1R0AA 2NUBA 4CEBA 2B21A 1ZQYA 3Q8SB 3TAMA 2G8VA 1EXQA 4CK2A 4DL4A 1T05A 1XSNA 1T4GA 1ZQXA 4ECQA 2JLEA 7ICPA 5DB7A 5L1IA 2ISOA 4PQUA 2YNIA 3MAQA 4CEAA 1LWCA 4FVMA 5C24A 3BQ1A 1ZQKA 1ZQLA 2AGQA 4KREA 1WAFA 1S1UA 3ZT1A 2Q3SA 3ISBA 3PW7A 3O3FA 3MFHA 3RMBA 4R8UB 2HHXA 4QAGA 4IRDA 3G0ZA 1BPZA 1Y97A 3KKRA 4O55A 8ICBA 4CF2A 2OZMA 1WSGA 3LDSA 4M9LA 3JYTA 5C25A 1QQCA 2V4QA 2J6SA 9ICNA 5JS1A 1Z00B 3ITHA 4JUZA 1NJXA 5IILA 3CG7A 2HNDA 4P2HA 5KFLA 2HMIA 5DB8A 3QINA 3F73A 1CZ9A 3KLGA 1VSLA 3WNGA 4RPXA 5DQHA 1VSHA 1NOMA 5KFCA 4P4OA 1I39A 8ICLA 4BE1A 4KHNA 3MBYA 4FJLA 4DO9A 4O5CA 2W8LA 5J2MA 4J9OA 1TKDA 5L1JA 3UXNA 2VANA 3E2EA 2FBTA 3NFAA 3LP2A 3SUOA 1JMSA 4QW8A 1XHXA 4JS5A 3MXIA 4KLEA 1JXBA 1K6YA 3C5GA 4UAZA 3AO4A 5CY4A 4FW1A 4FLWA 2MAXA 4PPXA 2DTUA 4RQ5A 2R7YA 4KPYA 2KN7A 1IXRA 3TAGA 5HRPA 5TZVA 3T5KA 4RNNA 2FLNA 3IG1A 4J9RA 1LAWA 4X5VA 5J2PA 5KFZA 3QEVA 3PW4A 1JL2A 3C1YA 4Q45A 1JKHA 3ISNC 2P51A 3QNNA 4AHSA 9ICTA 4KMUA 3N97B 4ZTFA 1JLFA 2BQ3A 1UT5A 4ID5A 4DSFA 2BCRA 3SPYA 4W5TA 3PX6A 4AHUA 3GILA 4DQRA 4FLXA 3ALYA 3EY1A 2W9CA 2C22A 1GOCA 3MR2A 4IR9A 2FPKA 1Q8IA 1JN3A 2VWKA 1LWFA 5J2HA 4KLMA 3HWTA 1Z25A 4LZDA 1S6PA 4K8ZA 2W9BA 5EOZA 4R5PA 4ELTA 1TVRA 4ECYA 4CJSA 1ZQGA 1QHTA 3OYCA 3OYLA 8ICVA 4TQRA 1ZQBA 5KFUA 3VN5A 5J2CA 4CHPA 1S9GA 4FO6A 2ASLA 4CIFA 1HYSA 3UXOA 2ZJ5A 2B5JA 4GW6A 3ULDA 2JZBA 1RT4A 4BE2A 2G8FA 3B0XA 5KFDA 4RQ4A 4I2AA 1HQEA 4QCLA 2J6UA 4Z6DA 4RT3A 3OS0A 2FMQA 4DFJA 3H40A 4YMMA 3RH5A 1RT2A 2VA8A 3EZ5A 5KTQA 4M3RA 2ITGA 3NDKA 1RNHA 4FZYA 5D49A 4OGEA 3QEXA 2G8KA 4RW9A 1NKBA 1GOAA 3AA4A 3PUFA 4RW6A 5CP2A 1ZQPA 8ICNA 4DL7A 3LANA 2AQ0A 5KFKA 7ICUA 4DQQA 4F4KA 3KLEA 4MFBA 3NF8A 2RDIA 4E7JA 5E41A 3T5JA 3AVIA 4B9TA 4YMOA 2YNHA 5KFEA 4KLOA 4CF8A 4DG1A 3C95A 5KFNA 2DY4A 3HP6A 1SUQA 2AU0A 5KGWA 3PX4A 1YTUA 2XCAA 2HHVA 3AO5A 4RQ0A 4KLQA 4CGJA 1IG9A 2PFNA 2YNGA 3NF9A 5J0PA 4O3NA 2Z1GA 3ZSWA 4K8XA 3MABA 4CHZA 4M3WA 4DL3A 2VG7A 4JRPA 4E89A 3D0PA 1NOYA 4CJPA 3IS9A 4JRQA 3I0SA 2C2EA 1Q9XA 2JZBB 3I0RA 3OYNA 4Q0BA 3PO5A 5J2DA 4PGQA 3AUOA 1REVA 4ED3A 1CUKA 4M2YA 5KFXA 7ICHA 4TURA 4I2JA 1HYVA 4IQUA 2FBVA 2I5JA 4KTWA 4PGYA 3H4BA 1NK6A 3QIOA 2KZ3A 8ICYA 2HW3A 4QW9A 3HYFA 4FJKA 3C5FA 4DSKA 2YHBA 3TQ1A 2KZZA 2P66A 1NK8A 3O3HA 9ICSA 3VQ7A 1JL1A 3GIJA 1N48A 1BIUA 1D8YA 4DWIA 7ICSA 3L3VA 3GIKA 4YMNA 4FLUA 2OYQA 3TAEA 3V7KA 3GFKB 3VQQA 1KVCA 4IKFA 4KLGA 4OVLA 3V1QA 3KD5E 3V9SA 4F5QA
chains in the Genus database with same CATH superfamily
1N36J 1PIEA 5DLGA 4YXMA 3CCWA 3TNVA 5DKWA 3DLKB 3NTUA 3DOKA 4J8FA 1YLXA 2BBEA 2G1DA 1FCAA 4M42A 3RJJA 4WK3A 4LRAA 4FYDA 3KD1E 4Z0UA 2AJQA 5AQFA 3AA2A 2HRUA 3UN2A 3OXFA 4FYXB 4CCHA 2P9CA 5DBCA 4IG3A 3CC2N 2MHEA 1WDTA 2DR7A 1JLAA 4JI8F 2IVFB 4BLGA 1U2VA 4F4WA 4FM2A 4DCCA 3O4QA 1X9XA 3W60A 2LHTA 4QWAA 3O3GA 5AFUA 3MDFA 5GAHI 2CA9A 1N4LA 1QJHA 1BI4A 4FK0A 1JJ4A 7ICNA 3W66A 4Z4CA 1VRTB 3KJNB 5AQRA 3AD7C 3ZXWA 1YJVA 4JKCA 3Q8KA 4JKGA 5KFYA 3FKBA 1TFYA 2OD6A 5IS2A 5DJBA 2VF3A 1OY8A 2ZH6A 2QYCA 4F50A 1PK3A 1XEZA 4N47A 5BR8F 2YHXA 4OJ6A 2I7NA 3WKDA 1RU2A 5AQVA 1ZJNA 2I7PA 1UA1A 3T1HJ 4EYHB 4ED6A 5ALMA 3W2VA 1BCMA 1OSCA 4WP8A 1ZQJA 3AJDA 4U95A 9ICIA 1HUZA 3T1YF 1KDHA 4HUGA 1Y7PA 1HQUB 4JI2F 3DLHA 7ICQA 2V34A 3ISZA 5L9XA 5B66U 4GKKJ 1S57A 3OLBA 2KHVA 5A76A 1JLEA 1PJ6A 3CDEA 2ZKTA 4GXJA 3RBDA 2XI3A 1YX2A 4MKBA 5JUMA 4M5IA 2CQ3A 4ZN3A 4KHPK 5DBBA 5AKKA 3ZDEA 1WDDA 1SC3B 1M5PC 1CJKB 4CJ4A 4NCGB 4FJ8A 4UY8O 3MR7A 1X66A 1VQ6S 1RWKB 2C2DA 4MLHA 1Q95G 4B3RJ 1X5PA 4MN4C 2PAVA 4DKWA 1NK4A 2ZEJA 2CNOB 4E19A 2MKHA 1XNRJ 4F72A 1RA6A 1MN7A 4EELA 1U6ZA 2AH5A 3GQCA 2DTJA 4TVAB 2IY5B 3LDQA 4W5QA 3ETOA 5DLFA 4YD2A 5ETVA 2VBZA 1RPLA 2XNQA 5M1PA 2RS2A 3MMVA 2OEMA 2HI0A 2AEMA 3ADAC 1UVIA 4K4ZA 3US5A 5AI4A 1JCGA 4C0OC 2KL8A 4OLOA 1K1QA 3IR7B 2ZDPA 3MGJA 4BC9A 1PC4A 4JI8J 2WSCC 4ISGA 4PXBA 3QBWA 3EVMA 2HQIA 4IO9Q 4JI6K 4ZVRB 1RCOB 3CMAS 5LJ5Y 3V6DB 3ZZ0A 2ZIXA 1TFRA 1SS6A 1IM4A 3BM7A 1HBMB 3J81Y 4KHQA 5GIOA 4M5KA 4OMFG 2DBBA 3AD9C 1Z4OA 3H90A 2GQCA 3DXBA 5C5JA 1ZQEA 1HI0P 1Y3KA 4KE5A 4F04B 3IR5B 2EFNA 2ASJA 1CBKA 4KBIA 5KFGA 1T3NA 2Z57B 2R8IA 2OMLA 1L5UA 3EO3A 5BR8J 4M41A 2KU7A 1KC8O 5KFSA 3O5TB 3F9KA 4IH6A 5KFHA 1U8WA 4CD3A 3ZZYA 5AQGA 4LFBF 2F1JA 5ETMA 3CC4N 2BPCA 1Z2LA 3EE9A 2HQ3A 3LGNA 3T1YJ 3MOJB 4JI2J 1OY6A 2H3EB 1RDDA 2VBWA 4A8XA 1SC6A 1Q79A 3DDKA 3EKSA 3KHYA 1FVQA 2P9SA 3ZO7A 4QOTA 2ASMA 3VENA 2ZM6F 3P49B 1VSEA 1K8AT 5J2QA 3OYFA 3DXKA 2ALZA 4LBPA 1A5WA 1NLVA 2J0WA 4FJ5A 2G06A 2AD9A 1TYQB 4ZPDA 1IWGA 2MPUA 4WQ4C 1WG1A 4KO0A 4LF6F 4Q8EA 2WF7A 3KZXA 3LP1B 1UAXA 4GVMA 1BGXT 1A5VA 2CQ2A 3G2XA 1VJ5A 2PFOA 3OFHA 1NZAA 1SXDA 4JWMA 3M2RA 3KMSA 1VYAA 2O01C 4IKAA 4M5NA 4J9MA 5JJBA 4QWEA 1SJRA 1C4AA 4HH1A 4OV6A 2EH9A 1M1GA 5BXIA 3AQOA 5B0FA 1HIWA 2XVTA 3CCJN 1T0TV 4N76A 3MAHA 1JLQB 2V6AA 5CCMA 3MMCB 2O8CA 4FCYA 2XTJP 3PNIA 4WF9Q 3AO3A 1WBBA 3D0GE 1LWCB 3EE3A 4YVZA 2MUTA 1RAIB 3M4XA 1JALA 2F4FA 2MB0B 3AVCA 5HNKA 3W9IA 5H2FU 4N5SA 5GINA 1ZOLA 3WXIA 2E5GA 3HCXA 1Y10A 2CQ1A 2MJUA 2NRRA 1KVBA 4O4RA 2BGGA 3MXMA 4G1QA 2B4JA 5B09A 1V4TA 3Q8UA 4LR7A 3CCTA 2MQPA 4YHHF 4ZPBA 1L3UA 3N28A 4RUAA 3G71N 2Z1JA 2CADA 4K4HA 4B3SK 4EO8A 1RXOB 1P9YA 3CIZA 3BF3A 1D8LA 4EIAA 3BS5A 2ODGA 2VONA 4E1NA 4WXWA 3HHKA 4AXJA 3NY0A 1RDFA 4XIUA 5HK4A 4C3KA 3G8SA 4LSNA 1T9TA 4RQ1A 1VS3A 5HHHA 4LFBJ 4NLNA 2ZTCA 4NLOA 4I6YA 3SYZA 3GP9A 5F1XA 5C42A 4RG8A 5KFQA 3MXJA 3RR7A 4EK2A 3RZAA 4JI5F 1VQMS 4CO1A 3UNYA 1ZTWA 4DUZK 3DWLA 3EXYA 2HFSA 1ZXIA 4CGZA 2ZM6J 3NAIA 3CNQP 3G6EN 5B0EA 1F5BA 3DOLB 1FRMA 4MLEA 1XQIA 2B4PA 3DM2B 2P5GA 5IIKA 3DNCA 2J8SA 5D0EA 1KBRA 4LF6J 1JXLA 2XWXA 4LSZB 1VSIA 1DJ0A 3O6QA 4YD1A 3ZD8A 3NNHA 4ERDA 1R31A 2V52B 2X1AA 2LCWA 3CFRA 1U25A 4BG8A 3A5LC 2ZKUA 2QV6A 1RTIB 5IV4A 4K4GA 3LUYA 3KJQB 2ISPA 1GH8A 2LA6A 1LWEA 2D3DA 2H3FA 4CDIA 2BJ8A 4PAAA 5DK5A 3WKAA 5JVHL 5L9NA 2DR6A 1VQPN 2HMXA 1CVJA 2W9CB 1U02A 1V3ZA 4M3TA 3ZSRA 1GLCG 2ASYA 2L41A 1RT3A 4UUXA 3AU2A 3CQ8A 1LWFB 3LDNA 2J0QD 4GNIA 4DR7K 2MKSA 3W5XA 2W9BB 4IS7A 2JRSA 3H1VX 4NV0A 4I67A 4BGDA 3FC4A 4NX9A 3C6TA 4BUGA 2EK6A 5AQJA 5HN0A 1VBZA 4H0YB 5F9NA 1HKCA 2D7SA 3D2QA 4WKRA 2V5HG 2Y1LB 4QZCA 2UXBK 3TA2A 2DGTA 4OLBA 2FHJA 4HTJA 4B9MA 1HR0K 4CECA 4YHHJ 4QIWD 1C0TB 5HQMA 2NYIA 1S1XA 2E8OA 1DTQB 2EFQA 4C8NA 4M0AA 4BY9C 5DM6Q 3AAQA 3P45B 4HCBA 4M3ZA 1TL3A 2WSEC 2LP4A 3BB5A 3T1AA 5CHGA 2F4VK 4FF1A 3V2UC 1CRXA 2OTJS 2LQ9A 3RMCA 2D0BA 4XH5A 3N9UC 5K14B 2RKIB 2MLZA 1BQMA 2HMPA 4IQVA 3GR0A 4FJIA 1NSKL 1I94F 3DLJA 3MUMP 1NMNA 1ECWA 3PKMA 1KLNA 1NZPA 4JI5J 1RABB 4YN3B 2FY8A 2NZCA 4DPOA 2YCHA 2IPOB 5CZ1A 3MCNA 4P2FA 2FY1A 4L6V3 2XWYA 1O03A 2B4OA 2EC2A 2GVDA 4YOXA 4LVSA 2MKYA 2BPFA 2HPUA 1HA1A 3M8RA 4QPTA 2A0FB 4CJ3A 4Z37A 4O44A 2D74B 3SD7A 3D66A 2P1JA 2GGPA 2W7PA 4QIWC 3HRDD 4FXDA 4XO0A 2EC0A 3CIPA 3LP0B 4ECXA 2KW4A 4QIVA 3TEHB 2IHNA 4ILGB 2AHOB 4FE3A 4C3MA 2LEAA 2R7TA 3T9ZA 1CXQA 1BC6A 3BGRB 2GVZB 4CF3A 3MFIA 4P0QA 4YOUA 1VQ9N 2DEJA 3T6JA 3AVNA 4RR5A 4CLKA 1F2GA 4DSIA 1UQVA 4MKAA 2YV0X 4DV1K 1L7PA 4B9VA 1HRHA 3DRPA 3IAYA 4GKJF 1XR6A 2Z2LA 1ACMB 3SUNA 4ELVA 5J1PA 6FD1A 1LV5A 4CGDA 3QEPA 1S4FA 1PAEX 5CEHA 9ICHA 2ZUCA 4HT5A 5IT9O 3CCLS 2WFAA 3O2IA 4EHUA 2O8EB 1HKGA 4BXOA 2G0AA 5EWGA 3H2UB 3QBCA 4DCPB 3RWUA 4GVBB 1X8DA 4ICLB 2E7WA 5F2RA 2C3UA 2HBJA 4KI6A 4Y0WA 1IKXB 4PL1A 1ZAWA 2VC1A 3S01A 1DZ5A 5C2FA 3LZIA 4BRFA 1TZ0A 2L9DA 1UPHA 1ZS6A 5HBMA 1NK7A 1NPRA 2QLFB 2BHNA 3OUYA 1IKWB 5MLCV 3VALA 1JRPA 4OHYA 4C8ZA 1V9OA 3RBXA 4GC7A 5LOQA 2BKEA 2KHDA 1TAMA 3MEKA 5DQGA 4ELUA 1I94J 2W24A 4IQWA 4ETZA 2K4IA 2VYPA 2YQ0A 3SMPA 1HL6A 3MDCA 1XI1A 3H8SA 3HLUA 2YX8A 4KLHA 2ZGZA 2DR5A 2DNOA 4NM1A 4TU8A 4NLXA 4K4UA 4ZHRA 1RTZA 5ALNA 4OYWA 4RW7A 1FRJA 3VOVA 3ZD9A 4UOGA 3RTVA 3BDPA 4M9JA 5CR4A 3A5MC 2A3VA 3MECB 1DQAA 3D3BJ 1BG3A 3QIPA 4LSLA 4JAXA 4X62J 1KKHA 3EVWA 3SI6A 2XBPA 4CLWA 3C28A 3TA0A 2XZDB 3M7DA 3WNEA 3MURP 5K20B 1E6YA 3KUGA 1WEZA 4KIAA 2DNKA 1Z26A 1WLJA 1BL3A 5AQSA 3K57A 5EVZA 2OP5A 1Y5LB 2ZH4A 3W65A 4NWIA 1RHKB 4GKJJ 3MN7A 2FMPA 2UVVA 3TANA 1X9SA 2ZJPQ 3PVXA 1X9WA 2CKWA 1ASWA 4JYAK 2ETJA 2E5LJ 2IM3A 4CH7A 5KG6A 2E4LA 4FBTA 3NGIA 3TAPA 2HFUA 4M3UA 3SQ0A 4O3QA 4FK4A 3LDPA 4MYTA 1QSLA 4RPFA 4ILJA 2JWNA 2W3SA 5HRNA 5J2NA 4OGCA 3ENAA 4LY7A 4CFDA 2KHQA 2KG5A 2K8BB 1N5XA 1ZQUA 2PYJA 2FYXA 4QZ9A 4CJVA 8ICGA 1NBEB 2NYVA 3IG5A 1GXUA 1SL0A 3SUPA 2FLPA 3TTDA 4UBBA 1OSDA 3K8WA 5AXLA 3L2QA 3HOTA 2V8PA 3TX8A 4MK7A 1FXDA 1R43A 2WVEA 5EOYA 2KV2A 1XNRK 2EZYA 2A5XA 3SLCA 3JPOA 1MWZA 1UZDA 3ALRA 4FZZA 3GB0A 3GYXB 4TUQA 3N4PA 3I31A 5F8LA 4I2GA 4PQAA 2GUIA 4FOIA 1S9EB 1W9HA 1S0MA 2E7XA 2IGIA 3KLVA 1Q5VA 4ZLLA 3CJ0A 1XU4A 3VA0A 3KHLA 2KSOB 2N4CA 5J0QA 3VHQA 3HHDA 5HR6A 4W5NA 4JI8K 3LPEA 5ALQA 3BGLA 4FPAA 2F44A 5EWEA 4WFAQ 1TUVA 3PW2A 1RP5A 4CJ7A 5AE2A 3AO2A 4CI6A 5KQ8A 1M1KO 5FDLA 1WSEA 1SKRA 4YOYA 4H03B 2HVHA 1CG2A 4IDKB 4WBFA 4C9DA 5LXYA 2ZIUA 1IG8A 2E8AA 4X4SA 1UVMA 2B6AA 2RRNA 3DGVA 1UWAA 2K8AA 3GG4A 1V9PA 3MM9A 2ZHBA 2IAJA 5IC6B 2KIVA 2DVIA 4N7TA 5AIAA 4HUFA 4OYOA 1X2IA 1QM9A 2XICA 4OJ1A 4OI3A 1SQFA 1ZD3A 3OSPA 3TPQA 1WOOA 2W7OA 1S1WA 3V7JA 2W4PA 3POTA 1BE4A 1GTHA 2W2MP 2GLEA 1H6KX 7ICLA 2OA8A 2WZ1A 3L8BA 1RLDA 3SMSA 2FJVA 3A3NB 2IBKA 1Q18A 3H0LB 2LYAA 4Q5VA 4RQ8A 2KKZA 2CQPA 4KLIA 2IBOA 3UR0A 4DV5K 1X4HA 4EO6A 3RJKA 2FVRA 3KJVA 2XMAA 2B4VA 2P9LA 2PE8A 4JD2B 4OKKA 3KK7A 1SH3A 3BBCA 3O9UA 1GQEA 8ICZA 2M7SA 4C0BA 1LCUA 1ZBHA 2JV3A 4K4XA 3DC2A 3KK1B 1Q86O 1KTVA 4WJBA 4FK2A 3M6VA 3UN3A 5HLFA 1HPZB 1SKWA 1RYUA 4C8KA 3LDAA 4ZLNA 4L3KA 2E2PA 1UP1A 4BRIA 1UWBB 2FJ6A 1FXRA 5EX3A 1SAZA 2E66A 3OHRA 1EO1A 3H7HB 3M8ZA 5ADXA 1MNEA 5CYMB 1WC3A 2FGOA 3DRYA 4PZVA 4WYBA 3V9XA 3DDIA 1RCXB 3P5JA 2GMJA 1HNZK 1M5SA 1Q8BA 2QC3A 3EEQA 2I6XA 4M6WB 3R5BA 4CLZA 4I2PA 2RILA 1FK9B 4M9NA 3K8VA 3OV7A 1GLBG 2RHFA 1F3VA 2CPJA 3CSKA 5G4DA 3QSIA 2L9NA 2AA4A 3F5AA 3KBBA 2XGPA 2QLTA 3RG6A 2V4JA 3QYPA 4A48A 1Z2ZA 3S6JA 4WWSA 4CO0A 1B0PA 4RUBA 1EKEA 1O8BA 2R8HA 2A6MA 3KVGA 3Q2SC 3DDHA 3CJ9A 1U26A 1K73O 3IMQJ 3MMBB 3V1OA 2YWWA 3QO9B 4FPRA 2XC9A 2CRLA 2K4PA 2M88A 5CZXA 2FZKB 2HF4A 4QYZJ 1QTMA 1ZAVA 2GCFA 2OTLS 4DI6A 3GYNA 5FPDA 5DB6A 1SXEA 5KG5A 5F8NA 5IZHA 3W9JA 4NLZA 2F1HA 4BG9A 3VMFB 3PRVA 2E88A 5BPNA 3C2KA 1DTTA 1ZZNA 2HHSA 1TMJA 2AV5A 5AZIA 4EX7A 1N5YB 3W61A 4UF4A 4Y2SA 1TL4A 1YWXA 2QEXN 5D78A 4LFBK 3FFIA 4DUTA 3KNAA 3ETMA 5J2AA 1BIZA 3FLCO 5KI6A 2YVSA 5M1QA 3CEDA 3ZSXA 4JOUA 1ZQQA 1HNIA 5AQUA 3R97A 2OPRA 4CTAB 1S0VA 3D45A 1F21A 1N32F 3VGSA 2I9SA 1C6VA 2O8DB 1TAQA 5AQOA 3H4DA 1FD8A 4JI1K 3UD5A 1SJ3P 4US9A 1F9EB 4DZDA 2Z0GA 3VQ8A 3C2PA 3VA3A 2XO7A 2B43A 2GV1A 4LF6K 4G6VB 4JK9A 2AP1A 3ZT3A 4PCQA 3C16B 1HBOA 2OJ3A 1SV5A 2VA2A 4MTPA 4CJQA 8ICQA 3SJJA 4R64A 2YX4A 3R9LA 4LF4K 2P9IA 4NXZA 2C42A 1EWRA 1OVYA 1QTNB 4U6PA 3HJVA 2LXUA 5JVGL 2F9WA 3TFRA 5F0WA 2VPZB 4U67L 1QQNA 4GO5X 2YKOA 4Z6EA 2IYGA 2QWLA 4DR4F 3QNOA 1XO0A 2R8GA 1T8EA 1KFTA 2V8DA 1OMSA 1VSDA 2CQDA 4I9LA 8ICIA 1WC5A 2J8AA 2OELA 5HVFA 4MKYA 4Y2MA 1RM6C 4M5JA 2XQCA 2YHAA 4LF9F 5DGAA 4UTGA 2C1EB 4BR4A 3V6KA 2IMWP 1OVQA 9ICXA 5F3ZA 3VZHA 4TUSA 2MSTA 3CWJA 4DCOB 4J2EA 1Y5IB 1HKBA 1LQ9A 4ED7A 1G1XA 3MCPA 1FFUA 3VF6A 2IIRA 4KBOA 4NWBA 1YSJA 2PA3A 2DITA 3RSEA 4ZVFA 1G6BA 5AJ3K 1JMTA 4O9MA 1AZSB 4WIQA 4HLBA 2OO4A 2YKMB 3DLLL 5DDYA 3TOQA 2D3ZA 2AJ4A 5ITHA 4KY3A 1WSIA 3AJ1A 3R2CJ 1RDBA 3MMAA 4PJ0U 1RYSA 4BWJA 3OSNA 3EICA 3MGHA 4U7UK 4RNFA 4I2DA 1KD1O 1VQOS 1H72C 2KMDA 1W2BM 2LU2A 3AAWB 3R2DJ 4GMJB 2QX0A 3CC2S 4FJGA 1YRUA 4AL5A 1NOZA 3K4GA 1FX2A 4KGVB 4DJBA 3BV8A 2KO1A 5KPZA 1LAVA 2YQ3A 5KOWA 1N32J 1WG5A 1K1SA 4TY8A 2NXCA 2VJVA 4JV5F 3BUZB 1A7GE 1D9FA 5F0XA 2G5HB 2F1IA 2VA3A 1JUDA 3GE1A 4PXDA 3CMEN 2Z56B 2QWNA 4MQ3A 4W5OA 2JC1A 3HT0A 3THYB 5A8KB 1T9UA 1KW4A 1VC0A 1CJVB 3UE5A 1TL1A 2HNZB 4DTPA 3JSMA 3VPZA 3HKWA 4O4GB 3NCQA 4F2SA 1T3OA 2GX8A 4EMDA 3MM8A 1QAJA 1VQYA 4TU7A 5ETRA 5DG7A 1RDRA 4QNLA 2AP6A 4DPWA 2KKHA 1SZ2A 2OPQA 4J9VA 1GLLO 3V9UA 1VCTA 2QZ8A 3ZDAA 2BJ1A 4OJ5A 5CA7A 1T03B 4RPZA 4DV3K 3THXB 2ILYA 3CD6S 3FE1A 3LGHA 2EXUA 4OI2A 4DR4J 3NRZA 3AVBA 4BX9C 3L7UA 2NZ4A 1VK8A 5FROA 1X5TA 2OSRA 3P83D 3CJRA 3ENVA 5LXRA 4B1VA 3VQ6A 3UQSA 1NAQA 3UMGA 4JKDA 4MIBA 5IWAK 3UMCA 3OXLA 3D2EA 2KJWA 4LF9J 2R7UA 4IEEA 3GJTB 1TV6A 1GLEG 3QE9Y 4LFAF 1XJWB 3KHRA 5FRMA 3LP3A 1GLJO 3M30A 4K4TA 3SQ2A 3C15B 1Z00A 1H73A 2DT9A 4L74A 3MEEA 3U1MA 2EAMA 2K3KA 3FZ2A 4F36A 2W11A 1KQKA 3AAPA 4CO3A 3LOUA 3ETLA 2D8CA 4C97A 3MUVP 2E8PA 1WC0A 3EKUA 5HL7L 8ICRA 2D6FC 2P9GA 2O4IA 5EU7A 2JX2A 1NK9A 3CCES 2QA2A 5D4BA 4GV6A 2VUGA 2CAJA 1R0AA 5B7WA 4YB7A 3TAMA 2YWEA 4DL4A 2ZD1B 1KN6A 3WK8A 7ICPA 5DB7A 5L1IA 3HM8A 1RACB 3A13A 3EGVA 3BQ1A 1LEOA 2YKPA 5CQGA 1ZQKA 2GW8A 4ANEA 2AGQA 4YMEA 4KREA 2P9NA 3HTVA 1C0GA 3ZT1A 3PEJA 5ETPA 1YJWN 4I1TA 1WKJA 3MFHA 5FLXO 1VLOA 4UB6U 2HFZA 5CA5A 4KPCA 3KKRA 4O55A 3JXOA 3PYGA 3FZFA 2XS7A 2QLBB 3A0HU 1QUVA 1YUWA 5HOOA 2OZMA 4CYUB 2IFXA 1WSGA 3DRXA 1K0VA 4M9LA 4ED4A 2VWBA 1XN9A 2C2NA 2HAFA 3JAMO 1R8AA 3W5ZA 4LIRA 2QARB 3C14A 3LVVA 3C6UB 4X62K 3DLEB 1BNPA 3CG7A 3QJLA 3CCQN 2H5IB 2HF3A 2WVDA 1WOPA 3ENQA 1S12A 4DV0F 3NBPB 5DB8A 1RT7B 3WX8A 2YWKA 3D0HE 3NGRA 5LSLA 1VSHA 2G07A 3FVYA 4GVEA 3GFYA 4ZJLA 4BR0A 4KHNA 3MBYA 5DM7Q 4FJLA 4O5CA 3H6EA 4BS2A 3BR9A 2E8NA 1YXQA 3CQYA 1X4EA 3NUQA 3NFAA 4AE5A 1XHXA 3MXIA 3LM9A 4KLEA 4FW1A 1WWHA 2R7YA 2E5LK 4WIIA 2KN7A 3TAGA 1WTBA 4PWUA 3U9ZA 3IDWA 4P52A 4LFAJ 3AODA 2CPHA 1X4BA 4RNNA 2FLNA 3BREA 1WWVA 1X3NA 4J7CA 2GJFA 2UXCF 4A8KA 3QEVA 1PJ7A 2HOEA 3QNNA 4C11B 4NLSA 3TUIC 3Q2TC 1FO4A 2J9DE 4KMUA 3N97B 2R7OA 1UT5A 4ID5A 1EQYA 2BCRA 3JYTB 3PX6A 5EE1A 4FO0A 5LJVA 2VCPA 3MUTP 1HWUA 4TLQA 2HMIB 4WU3A 1GOCA 1CULB 4IR9A 3KLGB 2DHGA 5J2HA 2Q6CA 3CJKA 3CCJS 4LZDA 1GMWD 2JFKA 1N8RT 5E0OA 3VV2B 3LDOA 1QHTA 1Q82O 3OYCA 3BDEA 2O8BA 3OYLA 1OH6A 5FLXU 4FN5A 1K8AO 4X65K 2RQ5A 5CYJA 3L0QA 5AI6A 4ZVSB 1OYEA 4GV3A 1FTCA 4NMLA 3VN5A 4YDXA 4MMOA 4CHPA 1S9GA 5L39A 4FO6A 3VAGA 3CJ1A 3ET6A 4P7TA 2B6GA 2GC8A 4B1WB 1U1QA 3UB5A 4OZ3A 1FFGB 2B0GA 3JAMU 1MROA 3UM9A 3MCSA 3B4DA 3G71S 3MM5B 3IG1B 2G8FA 1PK1B 4JKFA 2HFNA 4QCLA 2D41A 2FC8A 2J6UA 3R3LA 4RT3A 1HD0A 4DV0J 4LFCK 1RHQB 1K8KB 3GZFA 3J80Y 1RT2A 3G87A 4DL0C 5LSRA 3N6LA 1RNHA 2UU9F 1Z6RA 4HACA 3GPAA 1QH9A 3CPWR 3I9V9 1W25A 5F0UA 4NXMF 4OJPA 1ZQPA 4DL7A 5A2QO 4EGLA 1GTEA 3GCXP 4MFBA 1N0UA 1FKAF 2H4WB 3R5JB 2MGZA 1CC8A 4KLOA 4DG1A 2EBEA 3C95A 4HR2A 4HDHA 3CJCA 2MSNA 5KGWA 3PX4A 1YTUA 4X4UA 3D7EO 2XCAA 3G6ES 4JI4F 4OHWA 4DR5F 2UUWA 3CCMS 2RH3A 2M5YA 1YRTA 2I0XA 2AF6A 1IG9A 2PFNA 1F5SA 2EKNA 1G99A 5J0PA 4PKGA 3ZSWA 3MABA 4CHZA 4M3WA 1HYSB 2VG7A 4E89A 2ZJRL 1Y0HA 2P9UB 4NRTA 2B9EA 1R3NA 2V94A 3OYNA 3DLGB 1K0TA 4X2BA 4PGQA 3NXZA 5THWA 1QCKA 5KFXA 1VAZA 4TURA 3TADC 3BBBA 1QVGR 1NGDA 4QJFB 1HBUB 1HYVA 4IQUA 1RU1A 3PLAA 1Q3VA 2KZ3A 3GFHA 3TQEA 3NWRA 3CJ8A 2A2CA 4FJKA 1C20A 1FJ7A 3C5FA 2YHBA 2KZZA 2NS1B 1F0XA 4MKVA 4FZNA 1JL1A 4RW6B 3GIJA 3PIOQ 1UMJA 4E98A 1D8YA 7ICSA 1Q7LB 2EANA 3KLEB 4FLUA 4QIFA 4CZCA 3V7KA 4ZVGA 1KVCA 5AFUH 2AWZA 1O6XA 2XM3A 4I2QB 4CBWA 3V9SA 4FWMA 3M2UB 4Y0FA 1GNKA 3ORYA 4ZVTB 1C2PA 4EEKA 3H20A 1PO6A 2OEJA 1B9FA 4RWXA 2YNGB 2MU2A 2XZTB 1XIQA 2MKJA 2CWKA 4M95A 2IDEA 1RADB 4QYZK 1S8OA 3IS9B 4K43A 4JK1A 3GOIA 4FL9A 1L3SA 4FYWB 3FCVA 3HI0A 1FNMA 3HXMA 1YJNS 3ONNA 1J53A 2ZH3A 1YBAA 1CJKA 4WFBQ 2GH1A 2LDIA 3Q8VA 4NCGA 1YZ7A 5ALTA 5A2QU 4Y2TA 4M7XA 4NXMJ 3NGKA 3FBCA 3VAJA 2RHSB 2GAHC 2EI5A 4JB8B 2QXFA 3DHXA 4AM6A 3DHWC 2HEKA 4OPKA 3I87A 3T41A 1HW8A 4OZJA 3VF2A 3V6JA 4EZ9A 4DU1A 4Z6FA 4KX3A 3GIRA 1S5LU 5ALYA 2MJNA 5LMUF 3QRPA 1BQNB 3SQOP 1H2UX 4DR5J 2B9XA 3KK3A 2PI5A 4C3LA 3MM6B 1CJUA 1AXQA 4NCAA 3T69A 3BGUA 1YF5L 1ZQAA 5FIIA 3KJFB 4OZ2A 4ZVQB 2RNEA 5AM3A 4N8OA 3KG0A 1IR2A 2WSFC 2ASDA 5L1KA 2B8PA 4ZCLA 4CIGA 4KH5A 4F67A 3CP8A 5CXTA 3P38A 2YWFA 4ER8A 3OVAA 2MY8A 5J2JA 4KR0B 5J29A 2QMXA 4Y2CA 3CQXA 3SJHA 4FF3A 2LI6A 3V6DA 1SJFA 1RWPB 4I9QA 2IM1A 3G86A 2Q0RA 1J2NA 2N3LA 1NCLA 2G8WA 1H2VZ 2VD3A 2OFHX 1NJZA 3RJEA 5KNIA 2XMJA 4MFFA 3I5CA 2JEJA 4B3OB 4BREA 4MDBA 2HBLA 1NGIA 3CMAN 1J9AA 3FMWA 1COKA 3IXQA 2R2RA 4J9KA 5BOLA 4QS8A 2FPHX 2RJZA 3BH6B 8ICEA 2B9WA 2M4MA 4Q44A 3WIUA 2VWJA 1HI1A 5AM1A 1SV0C 1LFWA 2BVZA 1N2XA 3EVOA 1VIOA 3AA9A 1I3OB 5F8GA 1R8BA 4DUYJ 1UVJA 4M45A 2MMYA 3CGIA 3CCVS 1VSFA 1PVPA 3G6VA 3PZPA 2PMHA 3NH1A 1MDUB 4KB7A 4C4WA 2F9DA 4DR1F 4K4SA 2D5RA 2ZDOA 2KI2A 3CRXA 3PFOA 3D6HB 3ENBA 3K7RA 1FJGJ 3H8WA 4MIAA 1URNA 4U7BA 3QRRA 3H08A 3NGSA 4PG4A 4OX6A 1XO1A 3WXKA 3I76A 5TKYA 4BC7A 1TKZB 5GADU 4LIWA 3CJ7A 3A5NC 4H4KA 2K1RB 3HHLA 4KV8B 2DPJA 1FRIA 2QXLA 1BNOA 4JN4A 2HVIA 1YT3A 3BO2A 2R2UA 2FXUA 4CVNE 5AQTA 5HROB 4C7YA 1VQKS 3D1HA 4ECVA 3PM9A 5BYSA 2PFFB 2E9ZA 3EGWB 4JS4A 1TTHB 3CJQA 1JCFA 3M8PB 5LMUJ 4DLGA 2I1QA 2ZBRA 1SV4A 4MH8A 3UQ0A 2DNPA 4UAYA 4DQ8A 2H3ZA 5LL6d 4PHDA 2P6RA 3G82B 5DDOC 4X4VA 1NGGA 4TKTA 2QYGA 5KFJA 1VRUB 1ZQHA 1IBKJ 1BCOA 3B8AX 2NCKL 2OCEA 1N32K 1NU4A 2DHHA 3RB0A 1JLQA 4YR3A 4J2DA 3MMCA 3M05A 4P2XA 1U1NA 3UVJA 3SDEA 1MWMA 3E9PA 4BDYA 2IOFA 1RCHA 2Z58B 1JQGA 2VFRA 1LOTB 2HHUA 3LWLA 1HX1A 4F2RA 1KOHA 4OYIA 3UMBA 3KOOA 1H7WA 1Y4ZB 1Z05A 2WRMA 4OKEA 4YUDA 1VDVA 3UNGC 1HW9A 1BPXA 2CJ9A 1BD6A 3MM7B 2X7IA 4H5VA 2QFJA 2W2PP 3ISND 5KL8B 3GCWP 3D5MA 1EX4A 3IV6A 2CVEA 4A47A 4WE1B 3ZZTA 3NF7A 2H48B 3L9ZA 4QJVA 2LU1A 2HLUA 1B70B 2KEYA 3SCKE 4DR4K 3K17A 8ICAA 4OI6A 3MPUB 4IC9A 4PZNA 4WKYA 8ICOA 2C28A 3OXGA 2FDNA 2GV9A 5AKJA 2K89A 1ELOA 4Y2KA 1ZM2A 1GOBA 7ICMA 3KHGA 2Y3YA 4PKHA 2HZAA 2PD1A 4DR1J 1TQLA 3T7ZA 8ICJA 1IR1A 1KXPA 2JLFA 3CM6A 3QESA 2JEGA 2J9EA 3I8BA 5GIPA 1WF2A 2VICA 5GVQA 2ITMA 5JMNA 3DOLA 3O8MA 4IRCA 5C24B 2ZITA 2PGCA 2Z1IA 3DM2A 1S1VB 2CVIA 1S1UB 2EFPA 4CEOA 2CG8A 3AJ2A 5A8WA 4CM2A 3P5BP 4EEYA 3H5UA 2IHMA 2EWHA 1S6QB 2QWPA 1FRHA 5J8YC 3H2VE 2O8FB 4P73A 2GJ2A 4E1JA 5AZJA 4M5MA 3TAQA 3MCOA 3QYYA 1N34F 5M2RA 3ZSQA 4CIOA 4IOCQ 3H45C 3JSRA 1SJ4P 3GDXA 1RTIA 3K9KA 3QGPA 1IWAA 1ZQCA 4NA2A 4I64A 2R8KA 4PL2A 2EG1A 1K44A 4URSA 4M8LA 5IOLA 4KLLA 2HNDB 1TL5A 3C19A 2ZC3A 1MA7A 1X9MA 2IA6A 1S1TB 4UB5A 5M1KA 5HP4A 1Z1BA 2DH9A 3RJHA 2AW0A 4UB2A 5ALWA 2B56A 1RA7A 1YI2S 4Y28C 3LPUA 3L7PA 2W2NP 3KUHA 2XHWA 1RAOA 1G3OA 1TK5A 3QAEA 1S6UA 2EZZA 4JHDA 3BQ2A 3AA8A 4NLQA 3FRYA 1PUZA 2R9LA 4JV0A 6AT1B 2WUSA 4KGKA 3J7YP 2V51B 3OR2B 1COOA 1FESA 1C0TA 5GADI 1RJJA 5BN8A 4KHPF 1L6NA 1YJTA 2QRRA 4DOCA 1DTQA 3HVRA 5J2PB 3PJWA 4QZGA 6FDRA 5K8NA 3LA0A 3GIIA 2CH5A 1TUUA 3N4QA 1EHWA 4OD0A 1TU0B 3H5SA 1HI8A 4Y2RA 2MLXA 5K14A 2RKIA 3QGGA 3AQFA 5DETA 2LVWA 3CULA 5J0TA 4Y2VA 2GQQA 2QT7A 2YMLA 4A8YA 5E3AA 2HBYB 2KJ8A 1U45A 4TNOA 4DU7A 1QQMA 2OTJN 2Z2YB 1QAIA 1NK0A 3H1QA 4AHRA 4EFAC 2RF2B 9RUBA 2AEJA 5IQQA 2JEIA 1WAJA 4CFBA 3NLCA 4GO7X 1T7PA 2F96A 4F3TA 2CJKA 3NEKA 2XI2A 1X40A 2Y0BB 2UVRA 1QZ6A 2W6LA 1PYSB 2QLXA 1XNSA 1QS4A 4JV2A 4YCXA 4I2HA 1C1CB 3EE8A 5GMEA 4U9RA 1KQQA 3BGOP 2QA1A 2BM1A 3LP0A 3KNGA 3DI6A 1N34J 1MLAA 7ICGA 3CNHA 4Y65A 2W01A 2ZIVB 2LECA 2J7WA 3KKSA 3KLFA 1N56A 3MR3A 1EWQA 1FRKA 4BR2A 4JI0K 3N4WA 3BGRA 2ZIWB 2GVZA 1U7LA 3ZC4A 4E7IA 4KLUA 2CPYA 4KFBB 1BMQB 2HFVA 2BUPA 3QU9A 3LYSA 3O5BA 4PG8A 1X60A 2KYZA 4CK1A 2HKEA 5HRSA 2VBYA 4CLTA 2HWTA 1RAHB 4BR9A 4C8MA 2NPFA 3J7A1 2FBXA 8ICMA 4PA1A 2XY5A 1QSSA 3HZEA 2GX9A 3A5OC 2P9KB 3RRKA 4OYZA 3NVMA 4UB1A 3BEGB 5BR9A 4Y1CA 4K42A 2QTDA 5EX0A 3W2WB 1VSJA 1T3QA 2G2ZA 2R7XA 2OUGA 2BJ9A 3M1VB 2O8EA 1ASUA 5D8HB 4OYXA 4A46A 4EP5A 5AKIA 9ICRA 4OJGA 1XMOF 1ESVA 1HEKA 4KKOA 2WMMA 4CHNA 1IKXA 2RDJA 4Y2UA 4KHPJ 4MO5A 2QEXS 1B0VA 4QQBA 3CCLN 2DUYA 4H4OA 9ICMA 7ICRA 4Y3CA 3GDQA 5AQQA 1Q1KA 2CXYA 2L9WA 2DXEA 3A12A 5G5GA 3CJ3A 1BOTO 3Q8PB 5J1EA 2CQGA 5B8HA 1OS5A 3I0RB 4AILC 1XNQK 4CJWA 5C0YA 4EENA 1U1MA 5AKGA 8ICCA 2GELA 2YMMA 5KT6A 5AQXA 2Q1NA 4I7FB 4EX6A 5AK6A 5AICA 2ZZTA 2K8CB 4EYIB 4DXLA 1BQXA 1QE1B 3HFVA 4K25A 4MIWA 3M9NB 3CPWM 2A1SA 2R18A 1LKZA 2BJDA 1U48A 2HQCA 3UKUB 1VISA 2O1PA 3M9MB 3VGMA 1X4GA 9ICLA 3M6WA 2OXOA 2ZF5O 3MTJA 3QB0A 4EP4A 1Y64A 2BJ7A 4KB1A 3AVKA 4M63C 3TSQA 4ILLA 4TYBA 9ICAA 2J0XA 3CCSS 3G10A 3Q8YA 3AGKA 3QWPA 1QY7A 1T9WA 5J2EA 2HHHF 4ZTJA 4QR0A 3TTFA 4O5FA 3KHHA 2UUAK 8ICKA 4FJHA 1KWMA 4UB8U 3J81O 3BQ0A 3HJEA 3OR1A 4K4IA 2WB1F 2M3DA 5LM7E 4FLVA 8ICFA 1RT6B 3DOKB 3PR4A 4CQ1A 5B08A 4QIEA 2RDDA 5IFMA 4B8CA 1RWOB 3GFXA 1ED1A 4M1KA 4FJNA 1EARA 3NRWA 2CNKB 4CH1A 1FDBA 1AB8A 1I51B 2XLJA 4X4RA 1HNWJ 1JLAB 1YG0A 1WEXA 1NUEA 3IKMA 4X64K 3G6YA 4I4BA 4A8MP 5AE3A 5ALDA 5BREA 2DL0A 2A3ZA 4CJTA 3OJSA 3VEOA 2XRIA 2FJBB 1N6QA 1KOOA 2D3UA 2ZXIA 1DRZA 4HCCA 1ZQOA 1T11A 2BM0A 2R7RA 2WAQF 2HS4A 1KLMA 1V5IB 5M1FA 3MR5A 4ID1A 2AYBA 4JKGB 3O9QA 2XLKA 4LR8A 1MMDA 2BABA 2A1BA 3TEGA 2BANA 1XMOJ 1UETA 1NHKL 3MPWA 5L38A 1WNSA 1PBAA 2EZXA 2X6SA 2WB1D 5HP1A 3SBGA 1RTHA 3PYFA 1EP4B 2BCQA 1WHXA 2VZ9A 1GXLA 1CXUA 4L73A 2DKOB 4FVCA 4CE9A 5BJRA 3BN4A 4NYNA 4GXIA 2IOHA 1M5OC 4CLYA 1HJRA 4JMUA 4QWDA 2CGJA 9ATCB 4A62A 2JH3A 3LDLA 1TKXB 3OHAA 4KN7A 4HTUA 4B08A 4JKHA 9ICPA 1RHJB 2D69A 4MK9A 2X1BA 3GE9A 3HULA 1WI8A 1ZQWA 4CBUA 4DR5K 3IAS9 3O9RA 1HUOA 2WHEA 2LM1A 5I3UB 4CEDA 1X5OA 3HO1A 1IJFB 4DMNA 1SIZA 2EFOA 3AM9A 4P74A 2HBKA 3UIQA 3R27A 1WD6A 2HHPA 5HVHA 3EDRB 4KLTA 4DR7F 2BCSA 4HT7A 2NRTA 4DHYA 2KM8B 2A19A 5H9EK 4PXCA 2HHHJ 3IBFB 5H1SQ 3TZYA 2DHXA 4CLPA 2VGNA 1DY3A 2LYBA 4YB6A 3H3OB 3HD2A 1YJ9N 4IDKA 1WEYA 3ZZPA 2NRXA 1URRA 4A4JA 3ZX3A 1FFVA 1RHUB 2F3JA 5BOMA 4MT1A 4R79A 4K4WA 4B6JA 4O3SA 1QSYA 2E3TA 1TV9A 3O1LA 4BRKA 4IFYB 1J2MA 2GJIA 5EE0A 2Y0SC 3AQEA 2H5JB 4DX7A 4WFNQ 5IQ6A 1F5CA 2KXFA 1VQ4S 1HNXK 3GWCA 3V81A 5JS2A 5F8MA 2HOQA 1KEKA 2F4VF 2VH7A 4WQ5A 1DGSA 2BCUA 2A6OA 4DUYK 3ILLA 4WK1A 4B1YB 3F2DA 5D4NA 1NJIT 3T79A 4FKXA 3T5LA 3N7PD 1R8CA 3TI0A 2FE9A 1UA0A 1EXNA 3RB6A 4F91B 4H4MB 4HHHA 3R1LA 3K59A 2GIRA 1V3SA 5B0BA 3I55S 1FJGK 1RTJB 3CD7A 3JPQA 2W9MA 4C1NK 4Z94A 4Z4GA 2B7CB 2HSZA 4KJIA 2OD4A 2XHBA 2OI2A 3OS1A 2XMUA 1A76A 1SC1B 2QLWA 2RE1A 4Z2XA 3KK1A 3VTHA 3JPPA 3WIVA 4BBYA 3V4IB 4BC2A 1RGIA 2CQ0A 2HZVA 5AXNA 1HPZA 3KWGA 1HNVB 1HYZA 3AH6A 3ZFVA 4FJXA 2KDOA 1UJ6A 3D3CJ 9ICJA 4O23A 4LH5A 4N41A 2I5HA 4BGBA 1T3VA 4F0KA 1F0MA 1NKEA 5CYMA 1YJWS 2WHOA 1GT8A 3DU5A 5LMUK 4DFPA 3VEXA 3UDCA 1FVSA 1KP6A 3G25A 2P9SB 4CGHA 4P9SA 4CW7B 1IBLK 2ZH1A 5GAEU 1CQNA 1UT8A 3E01A 3P5TL 4QU6A 4M6WA 4ECUA 5J2QB 3PCOB 1J5EK 2JVOA 4NL9C 1D8ZA 3DXKB 2NXNA 2V9KA 3R1HA 3WDOA 1IBKK 1JK9B 9ICOA 1YBUA 3EZOA 4X84A 3L4QA 3Q23A 5AM0A 1W97L 4DV1F 3T6BA 2ABYA 3FZLA 3M6GA 5ADXH 1U0HB 1IIPA 8ICSA 3JS6A 5AQYA 5HQ8A 4DTJA 1IXKA 3MMBA 3RB3A 1SI9A 1HLUA 3DEEA 2D1CA 2DGWA 3KTQA 3D2NA 2KHCA 3M2RB 3R8YA 4YB1P 3M1YA 2MZQA 3OYGA 1GFWB 2Z2ZA 3C94A 3EGNA 1HMVB 1LW2A 3QZ7A 5A8RA 4ANCA 3K2YA 3FNNA 4W5RA 2R3VA 2ZBQA 3IP4B 1O13A 4O8KA 2GNKA 4OJLA 1S79A 2OTLN 1FKOB 3K5OA 1C1BA 3ID6A 3KD3A 3QATA 1N5YA 1AW0A 2F4VJ 2Y9TA 1QDUB 5CH7B 5D15A 3VQBA 3TRGA 3KXDA 3TU5A 5EE3A 1QVFM 4LRDA 4DR6K 4NLVA 2A41A 3PJXA 4YDDB 3A8YA 2UVWA 1Y11A 1RXVA 1TKTA 1YIJN 5AKEA 2ACMA 2B7BB 4OCZA 4FW2A 1AFJA 3ONQA 4ED0A 5ALJA 2OMOA 4RW4B 2I9GA 5JRTA 3EZWA 3PKYA 5D3GB 3G6XA 2GWKA 2ZOGA 4YY3K 1NWKA 3OYHA 3AHPA 5TISU 2OPPB 4CJUA 1CPZA 1OUQA 1NG9A 5M1NA 4Z4FA 3LALA 2O8DA 2BRLA 3RR8A 5GAGU 4FBUA 5FPMA 4LR9A 5J0RA 2LQJA 2QO3A 2D4WA 2XGQA 1FTRA 2AX0A 4B3TF 3PR5B 3G9CA 4DSEA 4F3MA 3FEXB 4F02A 1S5JA 4OV1A 1R59O 3AARA 3C16A 3CB4A 3HHLD 4NE9C 2Z8QA 2IDLA 4WCEL 4WP9A 4CIEA 4FLYA 2BV3A 3U27A 4DPXA 3IN5A 3C29A 4KHSA 4F5OA 3OLAA 7ICFA 2AMCB 3OYDA 1UW9A 3K2PA 2IRXA 2G8IA 4BRDA 3AMZA 4FF2A 1TMMA 4PG6A 1CS4B 4ZLJA 4KX5A 3D2WA 1IJJA 1ZD5A 1N88A 2VODA 4XPCA 3I4HX 1IH7A 3I1YA 5SWMA 3UCGA 4CO5A 2YNFB 4O5BA 4CEEA 3U1NA 3CF5Q 1OO0B 3FSIA 2VFSA 4FNHA 2YX6A 2Q0ZX 3IM8A 4JYAF 4O3PA 1V85A 4FJ9A 2LDYA 4UAWA 2J7UA 4P71A 5IM0B 3CJ5A 2FJWA 1LWEB 5E3RA 3WZ0A 5LT5A 3R7SB 3PFEA 2JFDA 4F7VA 4YOTA 1YTYA 5B0GA 5BRFA 5ALXA 2RQCA 3CTRA 4ETXA 1KQGB 5ALZA 1YGYA 1V97A 2YKMA 2PN6A 1IM6A 2HOFA 2LSNA 2ATLA 2NRVA 2Z1HA 3DKDA 3IM1A 4DS5A 3CCZA 1XNRF 2E6LA 1ZD2P 4MAKA 1I5OB 1N33K 1TK8A 1BHLA 4CZGA 4J9SA 2W40A 3WK6A 4DF4A 1LB2B 5GAEI 1KAXA 4U7CA 5AI0A 4AYBF 3GMGA 3PACA 1Z1VA 4DBQA 1XC3A 1VQON 4OZLA 4XTTA 4MK8A 1S1XB 2CJQA 2BGWA 3Q8RB 3L4PA 5K8PA 2X74A 1XWLA 4YFUA 1NPKA 2HBZB 3K9JA 4USKA 3H8MA 4YQWA 2P6UA 3MOZA 4B3TJ 1UFWA 1ZM3A 3QLHB 2GZOA 1C7YA 1B22A 3THYA 4P7VA 1EB0A 5A8KA 3VC8A 1BQMB 1HWKA 2HNZA 3SCJE 4ZCMA 2NUUG 2DFHA 3TUZC 3SCXA 3SI8A 4FJ7A 2VPWB 5MLCQ 1J6ZA 5AQPA 1N34K 2G1HA 1VK0A 3EUNA 5KG0A 5HHIA 3M32A 4MJKA 1E4FT 3RAMA 2M0GB 2PFQA 2VJ5A 2OIHA 8RUCA 4PWDB 1U2CA 3PW5A 4PUOB 3QU2A 1YITN 4FXWA 1T03A 4CHYA 1YK9A 3THXA 1KC8T 5JLFA 4NLYA 4CGFA 5IIOA 4AYBD 3H8JA 2E1MC 4I6MA 4O44B 4FWNA 4OFZA 4S0MA 5ALOA 5AE1A 2K7JA 1NRKA 4WZMA 3SEIA 4JYAJ 3OFEA 3VERA 4E7KA 3CD6N 1JB0C 1ZQMA 4EHTA 4NI2B 1WHWA 4KAIA 3L7OA 4DV5F 4XH4A 3HX9A 1TUYA 4F93B 3EWGA 5GAGI 3VAMA 3RRGA 1WNEA 4QZBA 2XSJB 2AZ3A 4P0QB 4F4XA 4C80A 1VQ5S 4DR2K 1V3RA 3L95X 2BE2A 3DRPB 5ALHA 1X4CA 4LRCA 1NGFA 4YDUC 1RAJA 3A8IA 4ECSA 3W8PA 2BRKA 2I38A 5B0CA 1FXXA 4PH5A 3GLJA 1WCNA 3HSGA 3EZUA 1FXLA 1WG4A 1L3VA 3NH2A 1LXJA 3OVBA 1S7IA 5D46A 3CCEN 3M8QB 4C6AA 2OHDA 4B3MK 4BXOB 3A4TA 3ZEUB 3KKAA 3D2SA 4XH1A 1HNZF 2VIHA 2X6NA 2Q1LA 3W5YA 2F7TA 4OHZA 2GHVC 3TVYA 4DTXA 3VZIA 2R7WA 1RT5B 2YPYA 2D0CA 2LKYA 5EDWA 1NDPA 1SIJA 2VDIA 2NRZA 4C48A 5HBMB 3M6XA 4K2XA 2XYHB 5LMNK 4ED2A 3RH6A 4PG5A 3IP0A 1AUDA 3ZT4A 2H3QA 4F8RA 3RBEA 3L2VA 2E1RA 1X6IA 1Y00A 4KLFA 4QZFA 1S3XA 3C6UA 2RHQB 2P2CB 1VC5A 2BJEA 1BA1A 3SK3A 9ICQA 3DLEA 2NRWA 3BYRA 2LYHA 3NBPA 2BKOA 1RT7A 4A8OA 1RZTA 3VGLA 4FKYA 1VQSA 4DV6F 2ASOA 3OQ2A 3J8AA 2KHOA 1WI6A 4J9PA 3ZX0A 1U1PA 2BDPA 5I42A 1VHIA 4USUA 4Q2LA 1HNWK 1Q53A 4CEBA 4FWRA 3Q8SB 4KH0B 4XK8C 2R42A 4ISFA 5F3XB 2YKAA 2QIFA 4CK2A 1T4GA 4ECQA 2MY7A 2CJBA 4A2AA 4NLRA 4LSLB 2ISOA 2YNIA 2KJ5A 4UQTA 3MAQA 2LQBA 4CEAA 2CQIA 1B7YB 3QMQA 2FC9A 3OTQA 2ZZNA 1NB2A 4ILRA 2HLTA 5AM2A 4RUHA 1H2TZ 3ISBA 3PYEA 5IT0A 3PW7A 3DRRB 4DV5J 4FDFA 2OKQA 3RMBA 5DZ6A 2HHXA 4QAGA 2XB2D 4ID8A 5BN9A 2XMVA 1E6YB 1XMOK 2NR0A 3LH2S 3F9MA 1NH8A 5AKXA 5H1SV 4IFEA 4ZVOB 4JI1F 4JI7F 3JYTA 9ICNA 1S6OA 5JS1A 4PYAA 4JUZA 2VFVA 2UUCK 4L3QA 1WJ9A 2KB2A 2HMIA 3MWTA 1VJQA 3F2CA 5E7OB 3KLGA 2JJ4D 4USAA 4GVLA 4UZBA 1NOMA 2F8LA 4LF4F 1I39A 3ULHA 4DMZA 3CC7N 5J2NB 1HNZJ 2BJ3A 3DYAB 1RWVB 4A5BA 1LK5A 4EU0A 3OL9A 2H4YB 3OL7A 3E2EA 2P6TA 2RD5C 2DNQA 2I1RA 3FM9A 1JMSA 4LF8F 2X3GA 2NLWA 3C5GA 4Y2YA 4LBHA 3AOAA 1WOQA 2PBDA 1GO3F 1W2IA 1GLFO 2HHHK 2P5VA 1IXRA 3N79A 4ES2A 2E1PA 4EWTA 2GO8A 3MM5A 3IG1A 3QWUA 1JJHA 1PK1A 4QIGA 4H5NA 3RGIA 1FWKA 5AI5A 2AJ2A 3PW4A 1RWNB 2ZJQL 2DXFA 2E20A 1K8KA 2BQ3A 1IR0A 2G0CA 3EMTA 2VIXA 4DV6J 3VCDA 4DSFA 3F44A 3SPYA 2DH7A 3BKFA 2B8QA 5AJ3F 4IYQA 3GILA 3THWB 2IYIA 3D6MB 1CZAN 3SENA 4FLXA 3ITHB 3CW2C 2NNWA 3HKZF 4NYPA 4NRUA 1B0TA 4WYLA 4RBTA 1IN0A 4IH7A 5A6WA 1D4XA 5FDLB 2KKPA 4NLUA 2JC0A 5HQLA 2VGMA 1WF1A 2YMPA 4K8ZA 3FK4A 4R5PA 1XERA 1ZQGA 2OM6A 2F8HA 2H1YA 8ICVA 2IAJB 2R7QA 3MN5A 3RYLA 2ZWPA 1HYSA 2C3MA 2ZJ5A 2WF5A 3MGVA 2DNRA 2HQGA 3KFUF 4C2MA 3CCMN 1IBMK 4ZJOA 3MK6A 3UN5A 4JI1J 4JI7J 2K2PA 1RT4A 3AXKA 2DNHA 3Q89A 2E7VA 1D09B 1HQEA 4RQ4A 3D6RA 1HBUA 4C0ZA 2KK0A 1GX6A 4UW2A 1JKHB 5F3TA 2VFTA 4NYZA 4FPIA 2OAUA 5JVHQ 3HKZD 5KTQA 1GXTA 5H9FK 4BROA 1BXNA 5ETOA 5L46A 3TZZA 5HANA 4LF4J 1PSDA 4C7ZA 5BYRA 4FZYA 4OGEA 1S72S 2ZOMA 1YZ6A 2ES6A 5AM5A 3KJVB 4U7UD 4RW9A 1NKBA 2MZSA 4RW6A 3PUFA 2APOA 2MZTA 1P90A 3JS9A 5KFKA 4DQQA 7ICUA 4F4KA 2F1FA 3KLEA 2ADCA 3DAWA 1EAYC 5A0LA 3F56A 1NDKA 3RBZA 3NF8A 2KLAA 4DV3F 2K8GA 2WVBA 2WF9A 2GS8A 4B9TA 4LF8J 2V8HA 2YNHA 5KFEA 2QW9A 4CF8A 3IC1A 1S6PB 3LM2A 1A9NB 3Q86A 1WC6A 2LKZA 3HP6A 2DRDA 2AU0A 4HI2A 1OWXA 2OH2A 2BW2A 4WQ4A 1K5OA 2KG1A 4KLQA 4ZVEA 5IWAF 3QNMA 2NUHA 5ADZA 2MKCA 2HWIA 1S48A 1UTAA 1AYEA 2YNGA 3TTCA 1FE0A 3E66A 4BRMA 1F9HA 3IS9A 2VPYB 2E5HA 3UKRA 4JRQA 2C2EA 4I2PB 1UPMB 2JZBB 1FEHA 4ED5A 3Q24A 1W2BR 4ILMA 4CBXA 1ZA1B 2MLYA 3GG0A 4USWA 2LEPA 5AJ3J 5HJXA 4ED3A 4KSEB 1CUKA 4M2YA 4JP8A 4R0JA 3CXCM 2JGAA 7ICHA 1U6BA 3F5TA 1D9AA 2FBVA 4WTYA 1NNDA 4KTWA 2V4JB 3H4BA 1YRXA 3QIOA 3SMVA 1E6VB 1UL3A 1YJNN 5HR7A 1PG5B 1RHRB 4A2BA 2XULA 7FDRA 1NMEB 4HHJA 1YVFA 3SBMA 3BY5A 5HSPA 4OQJA 2QL9B 1N48A 3QU5A 4LF1A 1BIUA 1NNLA 2YB4A 4DWIA 3ZX2A 3GIKA 3MM6A 4BRCA 1R8PA 1VQ7S 3GFKB 2F8KA 2GHWA 3FJ2A 4R25A 4ENOA 3IDHA 1RG6A 3L3FX 1W7WA 1U2FA 1WWUA 3HSJA 2F63A 2F8SA 3LAKA 3U02A 4C8YA 1M6YA 3UCUP 1IQTA 9ICWA 2DFFA 4J2BA 4EBCA 3QEBZ 1T6DA 1GK8A 1XC9A 3NGYA 2YJEA 3EW9A 5A2QY 4IJAA 4BJQA 5KFVA 1WYGA 1X42A 1EETA 5J0YA 1B9DA 3WK5A 3UPQA 3MEDA 4X62F 4X66F 1UCVA 3I0SB 3V9ZA 1FW6A 1ZRNA 3B6PA 2MZJA 1QLNA 1OPIA 1HUXA 4YR2A 4UOCA 2VOPA 3PY8A 1HNIB 2OPRB 2CWXA 3PO4A 2CQCA 2J9DA 5CB1A 1ATNA 3QEAZ 2I5JB 1OQ3A 2EW9A 3DJCA 4RZRA 3KMQA 4DV3J 2JOQA 5GAHP 3WU2U 1JWWA 4DTOA 5HMWA 4Y2AA 2X78A 4IOAL 1LOUA 1ZM4A 3UQ2A 2Y9UA 1S9FA 2OHFA 3BQTA 1PVQA 2QWRA 3DLRA 3N7RC 3TVKA 5IWAJ 2DNLA 3E8OA 4ECTA 2V68A 1YAGA 2E5LF 4F3OA 4JWNA 2F9JA 2C3YA 4W92B 2YQ1A 4CDGA 1HHTP 1M5KC 2Y8YA 2P9IB 4DU4A 1QHAA 2KZMA 4RNOA 1HWLA 4WJ3B 2QB1A 1O0PA 2ZGYA 3BN7A 4HAIA 3CCVN 4UW9A 1SIWB 3LTOA 1J5OB 2N7CA 2K7KA 2VASA 1TKZA 2DFEA 2DGZA 4PPZA 2P9PB 4DTSA 1FFWB 1SZHA 4KV8A 4RBUA 5CABA 2Q3PA 2G8HA 3CCUN 4LMZA 3EUB2 3IFEA 1ZH5A 2FC0A 3KWMA 2FLLA 4NXNK 4IO1A 5G0RB 2XHCA 3IRWP 3M8PA 4P6QA 2HGNA 4ZVUB 3M8WA 3QICA 2XSFA 4CT8A 3TWHA 1P9QC 2GIQA 4QU7A 3TACB 4MF8A 3G82A 2PIIA 2R8JA 2ZBCA 1ZQRA 4X65F 1VQKN 3QUBA 2WC9A 1VRUA 1L8OA 1S49A 4EZ6A 2H3VA 5E3CA 1W0HA 1TUWA 2IOFK 3VQCA 2O66A 4F25A 4DOAA 4JK8A 2PYLA 2Y1RI 3IA0A 4R66A 1KRPA 1S22A 3BO4A 2QK9A 1M1KT 9ICVA 4B3TK 3KKFA 2FVCA 4OJRA 3VETA 2WVFA 2DNGA 2V2QA 4ZMMA 1M0SA 5CHCB 1IQZA 2LMIA 3WNFA 2CGLA 4PY5A 4X66J 2MKKA 3ZTOA 3PRDA 3MM7A 4EFHA 4LFCF 2CJAA 2KFNA 2QGFB 1VFJA 1NNEA 2GMHA 5KT2A 2KQ2A 2PMZF 1G7CB 4WE1A 2PZSA 4TY8B 1RWXB 3AEVA 2XMMA 5K4LA 2UXDK 3TARA 1Z3EB 1ZQSA 4A8EA 2WOMB 4RQ7A 3S3NA 4K0KK 2ZWHA 4AM7A 4CJFA 3MX5A 5KFMA 5E79U 1CJTB 4M5GA 2H3IA 2ZBPA 2CPIA 2DGQA 3RRHA 3JSMB 2NO4A 4DV2J 5IT9U 1UFLA 2NREA 4YOVA 3OS2A 1FNOA 3MM8B 3SQGB 3ZTRA 3QXGA 3ENOA 1N63A 4ZP7A 5IIMA 1HIYA 1SWWA 2OSQA 3TUJC 1KFDA 3WQPA 3T9NA 1MA9B 2FGCA 1SH2A 1S1VA 2OWOA 3V7LA 2KVCA 2DNZA 4OZ5A 4FXVA 3TYTA 3M2VA 3QMLA 2CZ9A 3NCRA 5KFWA 3DXSX 4GC6A 1S6QA 3W64A 2O8FA