3EYZA

Cocrystal structure of bacillus fragment dna polymerase i with duplex dna (open form)
Total Genus 214
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
214
sequence length
580
structure length
580
Chain Sequence
b'AKMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAAVALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWELERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGKELAEQLGTVEQRIYELAGQEFNINSPKQLGVILFEKLQLPVLKKTKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLSSTEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEVTPNMRRQAKAVNYGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDITSRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQAHLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVTLRVPLKVDYHYGSTWYDAK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase I
publication title The Mechanism of the Translocation Step in DNA Replication by DNA Polymerase I: A Computer Simulation Analysis.
pubmed doi rcsb
source organism Bacillus stearothermophilus
molecule tags Transferase/dna
total genus 214
structure length 580
sequence length 580
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00476 DNA_pol_A DNA polymerase family A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 3eyzA04
1.20.1060.10 Mainly Alpha Up-down Bundle Taq DNA Polymerase; Chain T, domain 4 Taq DNA Polymerase; Chain T, domain 4 3eyzA02
3.30.70.370 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3eyzA03
3.30.420.10 Alpha Beta 2-Layer Sandwich Nucleotidyltransferase; domain 5 Ribonuclease H-like superfamily/Ribonuclease H 3eyzA01
3C21A 5KFVA 1L3VA 1ZQFA 5KT5A 3RB6A 1WSJA 3MDCA 1QSLA 5KFMA 1ZQBA 3RRGA 2C2DA 2ZUBA 1KVBA 1BPEA 5DMRA 4DMNA 4M9GA 4DOCA 4TURA 1ZQPA 4JS5A 4IKFA 1X9WA 4ZTFA 2XC9A 9ICQA 3NF8A 4XIUA 3SCXA 3NCIA 1S0OA 2FBVA 4IDKA 3KHHA 2ASJA 3SQ0A 2P1JA 1BPYA 1F21A 4E7LA 4CHQA 1ZQSA 1MU2A 3ASMA 2PYLA 5CYQA 4F50A 4CJUA 4BGDA 4QZHA 4KREA 4RQ0A 2YNFA 5KRTA 4CF1A 5I42A 2V9WA 3TAEA 4Z4FA 4J9KA 3RJGA 5BPCA 4UQGA 1JLGA 2G8HA 4KHYA 2OWOA 1NK8A 4FK4A 1WCLA 4DQIA 1D5AA 3L3VA 1VSHA 3DOLA 4EBDA 3AUOA 4Q5VA 1DLOA 3TAFA 3SNNA 3H4DA 3BQ1A 2HNZA 1B9DA 8ICCA 4PWDA 1BI4A 5DQGA 3OYDA 1NOMA 5HBMA 4KAZA 4YMNA 2YNHA 5DB7A 2XCAA 3V9XA 4ED6A 5FROA 2GUIA 4M45A 4YP3A 4RW9A 8ICHA 1LW2A 3Q8PB 1UA1A 3MBYA 4PUOA 4K4GA 4NYNA 3VQ9A 1XC9A 3L2RA 2VA8A 2NRZA 2OPPA 5BOLA 4DSJA 4FO6A 4BWMA 2FPKA 3V9WA 7ICHA 2ASDA 3RAQA 3H4BA 4KO0A 1ZQNA 3GQCA 4IBNA 4AHUA 3SUOA 4PY5A 5J2QA 1MSWD 3ZD8A 2XY6A 4UBBA 4DQPA 5CHGA 1T8EA 4OLAA 4KHWA 4MF8A 4GMJB 4DLGA 4NCBA 1IO2A 4NLGA 1N56A 1BPXA 3QINA 1ZQIA 4RUCA 4BDPA 8ICSA 5CWRA 3Q8RB 3IRXA 4FJMA 3TFSA 4QWBA 2ALZA 3V4IA 1BI4B 3SV4A 1Q9YA 2E6LA 2Z1GA 3QETA 2DFFA 1WSEA 5BOMA 4ED7A 3M9NB 4CHNA 4FJKA 4RUAA 1KRPA 1HQEA 4W5RA 1VSFA 4CK2A 2ASLA 1DGSA 1RILA 4DEZA 3RB4A 4OPJA 3VQQA 3N97B 3OHBA 1EX4A 5HP1A 3HXMA 1RDAA 3CYMA 4QWDA 3L2VA 3RWUA 2W9AA 5J2NA 3UXPA 4CCHA 1A5WA 1RYSA 5L1JA 5CB1A 3DLRA 2H5XA 4F3OA 1NOYA 2R7YA 3K5NA 3G6YA 1UWBA 2RN2A 1WLJA 2WONA 5KG7A 4CHPA 1B43A 1LAVA 4KB0A 1CUKA 4AHSA 8ICNA 4N41A 3DLHA 3DLEA 3VN5A 4M9LA 3Q8QB 2ISPA 5J2JA 4W5QA 3RTVA 2HB5A 3H8JA 1QSSA 4UB1A 5KRSA 4E7JA 5CZ1A 4EZ6A 8ICVA 5HLFA 1SUQA 5KG2A 3EW9A 4DO9A 1HJRA 1TAQA 2IDOA 5SWMA 2ZE2A 4AH9A 4YFKA 4YFUA 3KLEA 5DBBA 4F4XA 4KI4A 4FBTA 3K2PA 1XI1A 4M41A 2B21A 5KFGA 5HRRA 3RH4A 1LWFA 4F5OA 4O3PA 3UQ0A 2BQRA 3MABA 4O0IA 3T5JA 4ICLA 4CJWA 5KG6A 2IGIA 2OYQA 2I1QA 4B9VA 4AILC 3JPSA 2D0CA 4GVMA 2VA2A 2VWKA 1RT7A 2HHXA 3M8PA 2HNDA 5J2BA 4QZFA 1QTMA 2HMIA 4BE2A 4ED8A 5KGXA 4FM1A 4DTPA 1RXVA 1A5VA 2D5RA 4CGHA 1B22A 4IFVA 5KG0A 5KFLA 4CEDA 1KCFA 3OYJA 1SKWA 5HRSA 4DL3A 1S76D 4F91B 4E89A 5CZ2A 1TKZA 1IH7A 4ELVA 3RH5A 1LW0A 7ICLA 5DGBA 4P4MA 1SKSA 9ICTA 4RQ6A 1NJXA 4ID5A 4QZGA 1BCOA 1TK8A 1RYRA 3VQ5A 3RBDA 5J2DA 4AHVA 4GC7A 1S1XA 1BIZA 3LAKA 3P5JA 4GW6A 4IG0A 4IG3A 2HHUA 2IAJA 4F5RA 1BPBA 9ICRA 5KFHA 5D46A 3TANA 3ZSZA 4HUGA 4P4PA 4I29A 5L9XA 4ED1A 3K5LA 1L5UA 1RCHA 4CJ3A 3K58A 3E2EA 1ZJNA 3SUQA 2C22A 1C6VA 3S3MA 4H4MA 4DSEA 5DBAA 4E7HA 3OYGA 3LP2A 4R5PA 1U49A 3P1GA 3K5MA 4JWNA 4XUSA 4DL5A 1COOA 4CEAA 2BGWA 1C1CA 4CIEA 1T7PA 5KFWA 4GXIA 4EP5A 4NXZA 3C5FA 2KZ3A 5JS2A 1HRHA 1S1TA 3CM6A 3VQAA 4FCYA 3BGRA 1QE1A 2HHVA 4B8AB 8ICMA 1KLMA 2AGOA 3NGZA 4KITB 5J2IA 3RAXA 2R8KA 4CEFA 4YMOA 4YXJA 4KFBA 2P5OA 2W9CA 4KLLA 1Z00A 1V9PA 3AO4A 3QESA 4DTRA 1WSGA 1U4BA 5J0WA 4DF4A 3ZT0A 4YQWA 5J2CA 3NGYA 3LZIA 3ZT2A 1DOQA 3AO5A 1CZ9A 7ICJA 4FM2A 1TL3A 4I2CA 3CFPA 4ECUA 5J2AA 5HROA 4FJIA 1NKEA 2PY5A 4O3OA 4J9RA 1WCNA 2GWSA 1EXNA 3ITHA 3Q8KA 3PO4A 3OYNA 5KFQA 2RF2A 3VQ4A 3PNCA 3GV8B 1S0NA 2ZUDA 1ZJMA 4FJ9A 3TR8A 3IG1A 3HW8A 4HTUA 4ED3A 4RNNA 1JKHA 3MR2A 4QZ8A 1ZETA 4C8LA 4DTMA 1RDCA 1S6QA 3TAGA 2OPSA 3VQ8A 1C1BA 4H8KA 4CEBA 5CR0A 2LSNA 1TKXA 3N4MB 5KFOA 8ICIA 3RB0A 4YMMA 4M9JA 3RMAA 1J9AA 2W9CB 2W8LA 5KFNA 1Z00B 1ZQUA 5DK5A 3MEDA 3TI0A 3EZ5A 4E7IA 4Q43A 4IFYA 3JPTA 4J9OA 4B08A 1CLQA 2RDJA 1JXBA 1ZQAA 9ICSA 4RW6A 2G8WA 3HVTA 3C6UA 2DTUA 4I28A 1QQCA 4ZH4A 4JV0A 4P2HA 2W8KA 9ICKA 4YNQA 3RMBA 3UXNA 2DFLA 4Y1CA 4MEXA 5FRMA 1JLFA 1XU4A 4CJPA 3AV9A 4FZXC 1I39A 9ICIA 4OKKA 3O3FA 1KFTA 2YKMA 4FJHA 3KHRA 4MFBA 3SUNA 3ZD9A 2F1IA 5DGAA 5DQHA 1ZQHA 3AVHA 4DL4A 3OY9A 1ZQCA 5KT7A 4MEYA 3ZSVA 3K75D 3I8DA 3D45A 8ICTA 4RPYA 3O4NA 4CK3A 2XHBA 4F5QA 5J0UA 1NK0A 1LV5A 5EOZA 1A76A 2IMWP 3DLBA 1XSNA 5JUMA 4L8RB 1SZPA 3MXMA 4HCBA 5J0XA 2Y1JA 3ZSYA 1SL2A 1BGXT 4FZYA 3DRRA 3MEGA 1KFSA 4FXDA 3EWAA 4KRFA 3AU2A 1T03A 3ISBA 1DTTA 7ICEA 2BCSA 5KG5A 1S0MA 4LZGA 1VSJA 3B6PA 4ZTJA 8ICKA 2P66A 5KFUA 3S3OA 4DQQA 7ICSA 1K1SA 2WOMA 8ICGA 2X6NA 5IIOA 2FMSA 1S6PA 2YHBA 4KN7A 3M8SA 5EWEA 3HK2A 4KTQA 5HHIA 3HP6A 3S3NA 3O3HA 9ICBA 3C95A 3TFRA 1REVA 4FJLA 1ASVA 1XHXA 4HHTA 2OPQA 1C1AA 1TAUA 4QWAA 2YNGA 3ZSWA 4PGYA 1RPLA 3CG7A 1ZBHA 8ICXA 5KFJA 4I2GA 1ZQMA 3T19A 3EPIA 4CEQA 3L2UA 4FJXA 7ICQA 3AVJA 4CFBA 1D9FA 1X1PA 3IAYA 3LPTA 1HPZA 1NKBA 2PI5A 1LAWA 9ICWA 2ZJ5A 1RT2A 3AVMA 2O4IA 2AQ4A 4GLXA 5KT6A 4I2DA 4FLZA 3NH0A 3AA2A 4CECA 2X6SA 3TAPA 3HJFA 1ZQQA 1C0UA 2PFQA 1S10A 2YHAA 3FDSA 3PUFA 1TKTA 3JPQA 4JUZA 2O4GA 3B6OA 3DI6A 3LAMA 2DFHA 7ICTA 5KFSA 4OKJA 3V81A 3DYAA 2PYJA 2Y1IA 4ECVA 4B9MA 4UAZA 1TL1A 2FMPA 3GFKB 1S0VA 5HRNA 4FJNA 4F5PA 4B9NA 2BCRA 4DU1A 9ICNA 1C7YA 1WAFA 4I7FA 4E3SA 4DF8A 1N5YA 4Z6EA 4KHSA 3QZ8A 3Q8MA 3ZDDA 3SI6A 2OZMA 4RPZA 3NAEA 4LY7A 4RT2A 3S9HA 3MAQA 4CESA 2XY5A 4DTOA 4CGDA 8ICYA 2BPFA 3OYKA 2IBKA 3OVNA 3VQEA 7ICPA 1EETA 1HNIA 4ECYA 1H38A 3TARA 2XRIA 1SV5A 4I2JA 4Z4HA 4M47A 3V1OA 1S97A 4N56A 4QZAA 5J2FA 2FPLA 3GV5B 4JV2A 7ICIA 4Q8EA 2GBZA 1XSPA 1CXUA 3TABA 2ZUCA 4KI6A 2OPRA 2Z1HA 3KLIA 4CGFA 2X74A 5KFFA 9ICAA 4CF8A 4FM0A 3NH1A 2PI4A 1RDDA 3OHAA 2G8UA 4M3YA 3LP1A 1IKYA 2VANA 3QNNA 3VA3A 1A77A 4KPYA 3FYHA 4IR9A 5DQIA 1KLNA 3OYIA 3V7LA 4GXJA 4YR3A 1RZTA 1X9MA 4MF2A 2KQ2A 3HPOA 3KTQA 2JGUA 1JX4A 4M3WA 1ZBUA 2JLEA 4FLTA 4F8RA 3HPHA 2QXFA 3PVXA 4R66A 1FXXA 3SI8A 1RBSA 4QZIA 4FLWA 3T5KA 4F92B 4OJRA 5C24A 5KT4A 4UB2A 1FKOA 4EBEA 2Q3SA 4PQUA 1XS9D 3DRSA 1PZNA 3PR4A 2PXIA 3LP0A 3QEXA 1NKCA 2KW4A 4CFDA 1YVUA 5DB8A 3KIOA 3H7IA 4UB5A 3TAQA 3RR7A 4CERA 4W5NA 3C1ZA 4E1MA 4FS2A 1XSLA 3AVGA 4RQ2A 5J2HA 4DFJA 3CFOA 1KEJA 4CFCA 3F73A 5KT2A 3HL8A 9ICJA 5KTQA 5J2EA 3MXIA 3OYAA 1WSFA 3JPRA 1KDHA 1U47A 4I2PA 5CYMA 1X9SA 4DL6A 1RBVA 1T3NA 1HQUA 4F4ZA 1RT5A 4Z6DA 1BPDA 3GIMA 2Q0ZX 2IA6A 3RBEA 4RW8A 2G8KA 4M6WA 4X5VA 4Z4CA 4CGIA 3OGUA 3OYCA 4QZCA 4QZBA 1AROP 5KFDA 4E0DA 2GV9A 4XA5A 2HHWA 3LZJA 3MFIA 2V4RA 2BPCA 1JLCA 3HVRA 2WTFA 2ISOA 4KV8A 3LALA 4FK0A 4DTUA 4HCCA 5KFKA 1TFRA 1HYSA 3RRHA 5DB9A 1Q8IA 1XHZA 3MR5A 4KHNA 3HO1A 1NOZA 2J6UA 4CE9A 2W9MA 1GOCA 4XRHA 4DS5A 5KT3A 3RJKA 3IM1A 1WSIA 1C0MA 2F1JA 4FJ5A 4CJEA 4UBCA 1ZQGA 5DG9A 1BIUA 1XO1A 3SZ2A 1RT3A 3KK1A 4QWEA 1N6QA 1Z26A 1I3AA 4PH5A 2DY4A 3QEIA 3NFAA 3K57A 3C6TA 3IHQB 4QW9A 2P6RA 1L3SA 4M6WB 4NCGA 3BDPA 3VQ7A 1Z3EB 1UAXA 3ZSXA 3GIKA 1BCMA 3SV3A 1JN3A 4PPXA 4O3SA 3VQ6A 4C8NA 4FYDA 4I2BA 2D0AA 4CJ4A 3AA3A 1U04A 5J29A 3G0ZA 4WE1A 2OZSA 2BCQA 4HUFA 5L1IA 3C1YA 7ICGA 5KG4A 1YT3A 7ICKA 4J2DA 3A2FA 2UVUA 4PGQA 4NM2A 3AVCA 1G15A 3PMNA 5FDLA 4XQ8A 5J2PA 1S9EA 4QZEA 2W9BA 5IIIA 2R8HA 5KFIA 5IIKA 4PHAA 4ED2A 4M9NA 4KN4A 1KTQA 7ICRA 4FLYA 3K59A 4PHDA 4DSFA 4R64A 3NE6A 1RT1A 2ETJA 3NDKA 4CF0A 3OJUA 1W9HA 4Z4GA 3GIJA 3GILA 3HP9A 4G3IA 4UAYA 4OVLA 4TUSA 4FJ8A 4FLVA 2P51A 4CGJA 4KLFA 5EWFA 3V9UA 1RNHA 4CHOA 4OLBA 4EBCA 5IIJA 5KFRA 4M9HA 3HM9A 1JLQA 3KHLA 1VRTA 4QAGA 4YN4A 5FRNA 4LH4A 2PZSA 1ZQZA 3KKSA 4I2QA 4O55A 3ZSRA 2F96A 3MECA 2BHNA 1Y97A 1ITGA 1WSHA 4J9SA 4CHYA 1TVRA 4TUPA 2HHTA 3WNHA 4I9LA 3DM2A 4Y1DA 1U48A 2W9BB 2BQ3A 1VK0A 4YR0A 1RBUA 8ICZA 1TGOA 5J0YA 3LWLA 5KFZA 4ECZA 3BJYA 4JWMA 3KLFA 4QW8A 4KLDA 8ICLA 4YCXA 2I9GA 4R63A 4P4OA 4M3XA 2HNYA 3HYFA 4EYHB 1NK6A 2BR0A 1TK5A 3AVBA 2HVHA 4KLGA 3OYMA 2KN7A 1ZQDA 1D9DA 4NYFA 4NY8A 1IKXA 4IR1A 1BISA 4Z6FA 2BE2A 4ECWA 4NLNA 3U3GA 3PX6A 1Z25A 1S1WA 1QS4A 4Z0UA 2XY7A 1RBTA 5KFTA 4R8UA 2FLPA 2F8SA 1NK7A 3HWTA 2PFPA 3AO2A 3PX4A 7ICUA 4OGEA 4J9LA 2FBTA 4QWCA 3NTUA 1CZBA 1VSMA 4QZ9A 3SJJA 4B3OA 2NRVA 3C2MA 2E6MA 2KFNA 5KFAA 4F2SA 3RJFA 3KD1E 4GXKA 5KFBA 5KGWA 2E4LA 3PW4A 3PV8A 1ZQLA 4RQ8A 5IILA 4TSXA 4M2YA 5J1EA 4LZDA 3KK3A 5J0OA 2AGQA 4E19A 4CJ5A 5C25A 2LYHA 2HVIA 5DG8A 3BQTA 9ICEA 1JIHA 3DRPA 4KLIA 3RH6A 4YXMA 5J0QA 1HNVA 4R8UB 2XGPA 9ICVA 2DFEA 3WNGA 4OKEA 2ATLA 3ZDAA 4KLMA 4J2EA 2Z1IA 2QKKA 5C5JA 3OSNA 5HHHA 2ZTEA 3L2WA 9ICHA 1LWEA 3AA5X 3DMJA 2B4JA 1ZQVA 3VA0A 4YD1A 3QNOA 3KHGA 3JPOA 3RJIA 1QHTA 1KFDA 4CGGA 4M3ZA 1JXLA 3O4QA 4IRKA 4CEZA 4I2EA 4GC6A 9ICGA 3ZDBA 4K8ZA 4FW2A 2QKBA 7ICVA 3MR6A 3V6HA 3OYLA 4DFKA 2IHNA 2VG7A 5D49A 2BANA 2I5JA 1S1UA 2AJQA 4KLSA 1JLBA 5CY4A 4DOAA 3SQ2A 3I0RA 3V7KA 3ZT3A 2XY8A 3KD5E 1ASWA 4CFAA 4DWIA 1S77D 2VWJA 3L8BA 5J0RA 1NK4A 1BQMA 4I2AA 4DLEA 1VSKA 4Z4EA 4MFFA 4KHUA 2DPIA 5IINA 3MDAA 1ZQWA 5J2KA 4I9QA 3IS9A 1YTUA 2A1SA 4ED0A 4FJ7A 4TQRA 1N48A 4MFCA 1CXQA 2YV0X 3NGIA 3OYFA 3RJEA 3QZ7A 4RPXA 3C2LA 5J2MA 1VSLA 4LD0A 1GOAA 4JRQA 3ZDEA 3JPPA 1LWCA 3ULDA 2FBXA 2BQUA 3PR5B 5T7BA 4RT3A 1J53A 2IOCA 4Z4IA 3F9KA 3QLHA 1RXWA 1O1WA 4DL2A 5HNKA 3NF9A 4ECRA 1IG9A 1C0TA 4M42A 4O3NA 4ECSA 3RB3A 2IS3A 4PGXA 4N76A 2KZMA 1JLEA 4FK2A 4YVZA 2ZQBA 3KJVA 5CA7A 1VRUA 3WNEA 1YTAA 3MXJA 3B0XA 1RT6A 4IRCA 3HPGA 1IXRA 3PO5A 3L2QA 8ICJA 4JK1A 5KFCA 3NGDA 3OYBA 9ICXA 4M0AA 5KFYA 4F4YA 2JEJA 4CJFA 4RQ3A 4RQ4A 4IRDA 4DTXA 8ICEA 4JLHA 1CEZA 3T5LA 3HSTB 4Q0BA 4W5TA 1EP4A 1Q9XA 3OS1A 4UAWA 4I2FA 2G8IA 2BDPA 3M9MB 5HMMA 4DSLA 2JZBA 4UB3A 3NBPA 4BE0A 4E1NA 8ICPA 2BPGA 5JS1A 3V6JA 3G10A 3NF6A 1RT4A 4CJQA 5HP4A 3QIPA 4EZ9A 3C2KA 4CEOA 4M3TA 1MQ3A 2DPJA 4Q8FA 1IM4A 8ICAA 2NRXA 3C94A 4LH5A 8ICWA 2AQ0A 1XWLA 4LSNA 2PFNA 3ALYA 1JLAA 4NM1A 9ICPA 1WAJA 4FS1A 1GOBA 4KKOA 3PX0A 1FKPA 4C8OA 2YNIA 2VA3A 5TZVA 4LVSA 1TK0A 3H08A 4I2HA 2NRTA 1QLNA 4KLUA 4FJJA 4BXOA 3SQ1A 5K14A 2G8FA 5I3UA 4ELUA 3LDSA 3PY8A 1W0HA 4AHCA 2JZBB 2RKIA 4F2RA 5J2GA 3AVNA 3AVLA 4DFPA 4LSLA 5KG3A 1TKDA 2ZJ8A 1QSYA 1UT8A 3ZT1A 2BCVA 3K5OA 2C2RA 1WN7A 5DG7A 1KVAA 2FBYA 2XGQA 2P5GA 3SPZA 3UQ2A 4HYKA 3BQ0A 3L3UA 3HX0A 8ICBA 2KFZA 3ORYA 2B6AA 3GDXA 3VQDA 5HMLA 9ICUA 3BQ2A 5KFXA 7ICNA 5EU7A 5DBCA 3LDAA 2R8JA 3M8QA 1RTDA 1BVSA 2HHSA 3KKRA 2VG5A 3DOKA 4KLOA 1UOCA 1BPZA 1L3UA 3M9OB 1S5JA 4J9QA 4BACA 2J6TA 4BXOB 3VQCA 2MUTA 9ICFA 4I2IA 3DLKA 5SZTA 4RU9A 3DLGA 5D3GA 5DDMA 4H4OA 3U3YA 4KLHA 1ZBLA 4QOZB 2FC0A 3TQ1A 1EXQA 1NJYA 4ECQA 4DTJA 7ICMA 4YR2A 3QEAZ 3D0PA 3E01A 4CF9A 2A1JA 4CJSA 1HJPA 3EYZA 4F4WA 2X78A 1X2IA 3VQBA 2P6UA 4JRPA 2V4QA 3V7JA 4DTSA 3AVKA 3RJHA 4DFMA 1A5XA 4DQRA 3I0SA 3LPUA 4J9MA 2UVRA 3EY1A 3RR8A 2FLNA 3UXOA 3V6KA 5L1KA 4JS4A 4B8CA 4O3RA 3TAMA 4Q44A 2EHGA 4FZZA 3C23A 2RPIA 2R8IA 2MUTB 2ITGA 4DL7A 5L1LA 3SPYA 4CF2A 9ICCA 9ICLA 3SYZA 4DTNA 2G8VA 4Z6CA 4OGCA 1J5OA 1WNSA 2B5JA 1BQNA 4RG8A 2ZTDA 5CJ7A 4I27A 1HUOA 3ISDA 3OYHA 1K1QA 3K4GA 1NJWA 3Q8LA 2A1JB 2PFOA 1HUZA 1TVAA 3ISNC 4FLUA 4CJVA 5F9LA 4ECXA 4J9PA 4B9SA 4KTZA 2F1HA 3QO9A 4RZRA 1S9FA 4K4IA 2EX3A 2ATQA 2C28A 4CJKA 4F3TA 3LWMA 4UB4A 4ID1A 7ICFA 1BHLA 3G6XA 4AHRA 3LK9A 3RJJA 4FLXA 3NH2A 4O0JA 3AO3A 3EPGA 4DQSA 3LP3A 3T5HA 1IKWA 1ZQTA 4C8MA 4KLTA 3CQ8A 4FJGA 3SQ4A 2XCPA 4YD2A 4CEEA 4O9MA 1Y88A 4PA1A 4RQ7A 5KG1A 4CIGA 4FBUA 1RTIA 3PW5A 2R8GA 4RNMA 1SL0A 1LB2B 5EWGA 2KZZA 4NLZA 2FLLA 5CP2A 1ZQKA 3QERA 3QEVA 3OJSA 1ZQJA 4BE1A 3QEPA 3U6FA 1D8LA 3MGIA 3THVA 1L3TA 5C42A 1ZBIA 3AA4A 3ZSQA 4KB1A 2ZD1A 4JV1A 4EP4A 1ZQEA 1NK9A 1RTJA 3B0YA 1BL3A 1DTQA 2OA8A 1U45A 2AU0A 2HW3A 2UVWA 5KFPA 2JEIA 1B92A 2ZJAA 3MGHA 3OS0A 4CK1A 2F8TA 2NUBA 1JXEA 3KK2A 4K8XA 4O4GA 1NJZA 7ICOA 3Q8SB 3ZDCA 4O5CA 1TV6A 4O5KA 2HHQA 4R65A 3G6VA 9ICMA 4B9LA 3AVIA 4RW7A 3GV7B 4N47A 4BDZA 3KLHA 5DLFA 5IIMA 2KTQA 1MQ2A 2BKEA 4MQ3A 1ZBFA 4PHEA 4CIFA 4NLKA 3MFHA 2FMQA 4F4KA 4BWJA 1JL1A 3V72A 4RQ1A 1D8YA 1RDBA 1JMSA 2AGPA 1SKRA 3OYEA 4HUEA 4OPKA 4BDYA 4TQSA 1UT5A 1MC8A 1ZQYA 4K4HA 3V6DA 4J2AA 3NHGA 4QZDA 4MFAA 8ICOA 3PW7A 3AU6A 3H8WA 1EKEA 4O44A 2XO7A 1SL1A 5J0SA 4KLEA 4M3UA 2NRWA 8ICUA 2JEFA 4C8KA 4ZHRA 4PHPA 4RNOA 1ZQXA 4DSIA 3WNFA 3MEEA 2D0BA 3H40A 4DSKA 8ICRA 3V1RA 2MAXA 1KSPA 5DB6A 1RTHA 4Q45A 5D4BA 4G1QA 8ICFA 3ISCA 2W42A 1FK9A 3UPQA 4N5SA 5E41A 2RDIA 1NK5A 2IHMA 3T1AA 3O3GA 1TV9A 3MR3A 4QCLA 1J54A 2YKNA 2FPMA 4IQWA 3RMCA 4IQUA 1HYVA 3ETLA 4DU4A 8ICQA 3QE9Y 3UIQA 3H8SA 3PW2A 3CFRA 2ZTCA 1ZYQA 4CJRA 4FVMA 3OSPA 3LANA 4HVJA 2JEGA 3FFIA 4ELTA 2J6SA 1K6YA 4M3RA 3KLGA 4KLQA 1HYZA 4YG2A 4DS4A 3RMDA 3PW0A 1S1VA 4NCAA 4KTWA 4RQ5A 5KFEA 2UVVA 1JL2A 3V1QA 4O3QA 3T3FA 1VSEA 4TUQA 4EEYA 1ZQOA 1T4GA 2C2EA 3NF7A 3M8RA 3ZCMA 4W5OA 3ZT4A 4EYIB 2BCUA 1VSDA 4ECTA 3AVAA 3ZSOA 3OS2A 9ICOA 5HRPA 4O5EA 5DKWA 4O5BA 4J9NA 3QEBZ 1ZQRA 5DDYA 4F5NA 1ASUA 1UA0A 3JSMA 3P83D 4B9UA 4E7KA 3JYTA 3C5GA 4DU3A 4DG1A 4AHTA 4CHZA 4CJLA 4CJTA 4IQTA 1KVCA 5J0TA 1HMVA 3QEWA 2BGGA 4IQVA 4FW1A 3AVFA 1IKVA 3TWHA 4B9TA 5KI6A 1T05A 3HT3A 1B9FA 3PMLA 4M04A 1R0AA 4J2BA 1U9LA 3V9ZA 5F9NA 3GIIA 2VG6A 2QK9A 3QIOA 4KHQA 2M9NA 3AO1A 5DLGA 2Z1JA 3VQPA 4KMUA 3JPNA 3CM5A 4DOBA 5J0PA 4F93B 3SUPA 4KLJA 2A1RA 1VSIA 3V9SA 1RBRA 4RW4A 1S9GA 2IC3A
chains in the Genus database with same CATH superfamily
1L3VA 4P52A 1ZQFA 2LHTA 5ADXA 1JJHA 4UF4A 4DHYA 1GLAG 1KVBA 1FDBA 5HR7A 3WKBA 4DPYA 1NBEB 3KKAC 4TURA 4OJ3A 1ZQPA 1IKVB 1Q7YT 3QNMA 1PIEA 2CJXB 9ICQA 1R0AB 1VQ8S 3HOSA 1GMWA 2KYZA 4WFNQ 3UB5A 2FBVA 4MKBA 4IDKA 3OXGA 5MLCQ 3EJMA 1UHUA 1Q8KA 1Q8BA 2UUCF 4PJ0U 1ZQSA 1MU2A 2DNPA 4IDHA 3ASMA 2PYLA 5CYQA 4F50A 5ADXH 4I6AA 2D7SA 2QMUB 4A46A 3ETOA 5KL1B 2G13A 2YNFA 2I5HA 1X66A 5KRTA 4RW4B 2RD5C 4J8FA 2PAVA 2V9WA 3K7RA 3A8YA 3TAEA 3RJGA 5BPCA 4X4TA 2F44A 1NK8A 1WCLA 4JMUA 2BBEA 5DS7A 3L3VA 1WC1A 2FSKA 1BA0A 4CF4A 3AUOA 4J9UE 4OJ6A 3H4DA 3BQ1A 1B9DA 4L3KA 1HJOA 4PWDA 4WZMA 1BI4A 4ISGA 3OYDA 4A59A 4YMNA 4IDKB 2YNHA 2HVDA 4X66K 1SV4A 4QS8A 1WBDA 2XHWA 4LR7A 1PUZA 3HILA 4RW9A 3IV6A 2F9DA 1YJWS 1UA1A 3MBYA 1MU2B 4JI8J 4K4GA 4NYNA 1HEKA 5CYQB 5BOLA 2K4IA 5B0AA 3UO0A 2UXBJ 5AKKA 2ASDA 2JX2A 3MM5A 4KO0A 2LQ8A 3VEOA 2YNFB 4NXNJ 4PY5A 5J2QA 1WKKA 3ZD8A 4QPXA 2XY6A 2AT1B 3TWZA 4UBBA 4DQPA 4BGBA 4C97A 4AL7A 2KV2A 4GRSA 2HFOA 1YXQA 3CCSN 5AE3A 2LA6A 2LXIA 4NCBA 1IO2A 1T6CA 2BUNA 3O1LA 1RU2A 1N8RT 2R2UA 2C2ZB 4U7BA 3TFSA 2ZDOA 4PWDB 1BI4B 4CZEA 1R43A 2F8EX 3FZLA 1Q9YA 2YNHB 3GG1A 1WSEA 4IS7A 1X4DA 2VJUA 4ZLPA 4U7CA 2HDOA 1IN0A 1HPMA 3M9NB 2HBMA 3MK6A 4RUAA 1HQEA 1MWQA 4W5RA 3THYA 4RW9B 1VSFA 2J9CA 4LBPA 3JS9A 3PJ9A 2V8DA 3MM5B 3ZX3A 3OHBA 4KO0B 5ETSA 3HXMA 5J2QB 4QWDA 1DK3A 3RWUA 5HQ8A 2OXOA 4UT4A 2ZITA 2PMZD 2EEYA 4FXWA 5RUBA 1A5WA 2D3DA 2DGUA 5MLCV 1JWWA 2C2NA 3EX7B 5L1JA 3DLRA 4MDAA 1YBUA 1PAUB 1NOYA 4Y2TA 1UWBA 3P5BP 2WONA 1WLJA 4GIBA 4H03B 1B43A 1LAVA 3DDHA 4MIAA 3JSBA 3VN5A 3Q8QB 2ISPA 3UN2A 2LM1A 4EX6A 4W5QA 3DGVA 1HQEB 5KRSA 4E7JA 3THYB 4EZ6A 8ICVA 5I9EB 1SUQA 5KG2A 3GZ7A 4P2MA 1HJRA 2RS8A 1MG7A 2IIRA 5AQJA 3EVWA 2QMWA 2LKZA 1KWMA 2NYIA 5DBBA 4F4XA 1WG1A 1Y11A 3CC2N 4KI4A 3OPXA 1VBXA 1XI1A 4I6MA 2B21A 3DDKA 2XVTA 4PCQA 4B3RK 5KFGA 3A12A 1NB7A 3A13A 2OI2A 1KHWA 3T5JA 3CCZA 3M1YA 4LFCJ 4EAHD 4JKBA 2PMWA 1N33F 3P96A 3CWJA 4NLDA 3OFFA 3MDFA 4X64K 3EDQB 1DZ5A 2FZKB 5EN1A 1UWBB 5J2BA 1UJ4A 5JJBA 2WONB 2N3LA 4P72A 4DCOB 2MJUA 4ZOSA 4DTPA 1RXVA 4OJLA 3OL6A 4FWSA 1TUYA 4WIQA 3LVVA 5F8GA 5KG0A 2ZH2A 4LF7K 1SUQB 1K8AO 2IY5B 3HHLD 3BBFA 1IG8A 4H5WA 4U9RA 1SKWA 1QQ5A 2FJ6A 3GYXB 3G9CA 3IMXA 1S76D 2WBMA 1QCKA 4X2BA 4I6MB 3MD3A 1LW0A 2J0QD 2XTJP 5DGBA 4P4MA 2QLJB 2Z7JA 3OFGA 1NWKA 4QZGA 1FVSA 4QJVA 2CDQA 5J2DA 4CBUA 4GW6A 3NG8A 5AIAA 4G9BA 3HI0A 2HHUA 4CLYA 3ZSZA 1N0UA 1T9UA 3K5LA 3A8EA 2NXEA 3E2EA 1ZJNA 4DV1K 3VZIA 4CW7B 2FVPA 3EMTA 2C22A 3RFAA 3UD5A 4ZVPB 2P9UA 5IV3A 4DL5A 3GSDA 1C1CA 2FJBB 4CIEA 2EBEA 1T7PA 2EPIA 4GXIA 2BZ2A 1LW0B 1HNZK 1R8BA 4NXZA 2EKNA 4HT7A 2ZH5A 3LW5C 4CO1A 2XNQA 3GG0A 1XMQK 4ZPVR 3VQAA 3CJAA 2IJNA 2UV8G 1L7PA 4FCYA 4OL8A 2VPZB 3CJ5A 4FF1A 3US5A 3TNVA 1LXNA 3QMLA 4B8AB 4KPCA 4LJXA 1KLMA 3CCSS 3ZLJA 5J2IA 5E3PA 3R3LA 3TW0A 1Y7PA 1WG5A 1I1GA 5LJ5Y 5FPEA 1ZRMA 2FJVA 4J90A 1HHTP 2WVDA 4USHA 4CO3A 2P5OA 3HI9A 2JMGA 2A0FB 4KLLA 2W43A 1WSGA 4IOAL 2OHDA 2CFXA 2V8PA 3AM9A 4DR2F 4O3MA 1VQ9N 5FPDA 2HS3A 4YQWA 2N3OA 4USWA 2P9UB 4C0ZA 4K50A 1EX8A 1DOQA 2B9EA 2X1BA 1UEVA 1CZ9A 3QT7A 1C1CB 6FD1A 2E2OA 3ENHA 3CFPA 4FXVA 4ECUA 5HROA 1G3OA 1NKEA 3G82A 4ZCIA 3RSEA 1SXLA 1I94F 2BM1A 4JK7A 2QW9A 3Q8KA 3OYNA 2RF2A 1WWUA 4TLQA 3PNCA 3M1VA 2ZUDA 1ZJMA 4FJ9A 3TR8A 3VVUA 4MJKA 4ED3A 4OYIA 2BJ7A 1Q3VA 1KLMB 5HJXA 3TAGA 3GL1A 3CJSA 4AFFA 3QU5A 1HD0A 8ICIA 3RB0A 4ZPCA 3RMAA 3IG5A 4YDXA 3H2LA 5AKGA 3TI0A 3AMZA 3CIZA 4Q43A 5F0UA 3BZKA 1P9YA 2H51B 4IFYA 2E5LF 3JPTA 3ZTOA 2WFAA 3R27A 4B08A 3HHLC 1SGGA 1ZQAA 4M63A 5HROB 4RW6A 3G82B 3C6UA 4LF4F 1QQCA 3RSEB 2XZDB 2B9YA 1N34K 4K0KK 1WG8A 2W8KA 3ZZYA 2KRRA 3UXNA 1O03A 2RF2B 1QZ5A 2P9SA 2DFLA 4Y1CA 4MEXA 2XSJA 2MYFA 3AV9A 4ZP7A 3M1VB 3J81O 5DETA 1KQSM 2F1IA 3J80Y 2EZZA 5DQHA 4L3QA 1ZQHA 3AVHA 1B3TA 4DV6J 3EZUA 4MEYA 3ZSVA 4YMEA 3R8EA 4EK2A 1K44A 3D45A 1M6YA 2LVWA 5LL6d 4RPYA 3RZAA 3NGSA 2C3PA 1CC8A 3D54A 1KKHA 3WQPA 1Q8LA 4Y3CA 3U4LA 2IMWP 2ZHBA 4PAAA 3IMQJ 2CH5A 4IFYB 4F04B 1OSCA 3D2QA 2ZH3A 3EVOA 1X6IA 3G8QA 1QVFM 2J7KA 2V63A 4A4JA 1M1HA 4RW6B 4NLUA 3PSPA 2RLTA 1BLUA 3C6UB 4RNFA 1KFSA 4FXDA 3GDQA 4KRFA 1KAZA 1PK1A 2VBYA 2P9SB 1IV8A 3ZZ0A 2XSJB 3ISBA 1DTTA 1FTCA 5KG5A 4LZGA 1FJGF 3TTDA 2L9WA 2HQDA 4WFYA 2GV1A 1JALA 1YJUA 1K1SA 4QPTA 2NQPA 3IXQA 3K8WA 4U67Q 4OYMA 2YHBA 1VDHA 3M8SA 1WWVA 2YVSA 1B0VA 5EWEA 3D4JA 3HP6A 5AIBA 2I1RA 3S3NA 3ZX2A 2LBOA 7FD1A 4GV9A 2D8CA 4NLCA 4HHTA 3QICA 1NXIA 1B0PA 4PGYA 1RPLA 3CG7A 2W6KA 2W2PP 8ICXA 2DGZA 4JI4J 4I2GA 3L2UA 4FJXA 5AKXA 3UVJA 1D9FA 5HATA 2QL5B 2Q31A 4K4UA 2RQCA 1X1PA 1HPZA 2CPZA 4YOUA 2PI5A 3HJEA 4NZ7A 1KAXA 2DD8S 2ZH8A 1PK1B 2CPEA 1KD1O 2ZJ5A 3AVMA 4GLXA 2VBXA 4FLZA 3NH0A 1DTTB 2WVEA 2YQ3A 2GGPA 5HSPA 4H0TB 2OM6A 1V9OA 3WXLA 3FKBA 1ZRNA 4MK8A 3D3BJ 3UDCA 2MMYA 3C3LA 5JMVA 2DFHA 3WX8A 1HNXF 3DYAA 2P6TA 1JB0C 2HLUA 2AX0A 1DRGA 1FESA 4PXEA 3KMQA 4NZ0A 2VQEK 4DU1A 1C7YA 4MMOA 1K5OA 3Q8MA 3SI6A 2J7UA 3MUVP 5JTIA 4LY7A 3S9HA 1SCJB 3MAQA 3Q8YA 4CGDA 1H6KX 1COKA 3F56A 3UVJB 1DBDA 5AK4A 3RAMA 1N54B 2Z57B 3ADAC 1NGEA 3OVNA 2PE8A 3ZYYX 1EETA 1VQ9S 1H38A 3EDRB 3TARA 1HPZB 3M6KA 3SCKE 3RG6A 1SV5A 2JXJA 3KVGA 3GOIA 4OZNA 4N56A 5K8MA 2FPLA 4JV2A 2OSRA 2P8IA 2GGPB 2D3UA 2HF3A 4CNZA 1FXRA 2NLXA 2EANA 3TABA 3VEXA 1XN9A 1WWHA 4KI6A 2QV6A 2QSWA 5D0EA 3NCQA 3BKUA 1IBLF 4NLBA 3NVWA 5ALYA 3DYAB 4CBWA 1IM6A 4CIOA 2FVRA 4A8SA 4ZCMA 2CG4A 2KI2A 3QNNA 5ETLA 1WEZA 3D3CJ 3VA3A 3IRWP 3I6PA 4KPYA 4RX6A 4JI2J 5DQIA 3OYIA 1X42A 3TZXA 4YR3A 4JBCA 4K8RA 1X9MA 4V19X 4YHHK 3KXDA 3HPOA 3CMAN 3KTQA 3IAM9 2JGUA 1JX4A 1W2BR 4M3WA 2LFVA 4FLTA 2J0WA 4F8RA 1FFVA 4WXOA 4BC7A 4EO8A 5IV4A 3HPHA 1VQPS 3OBWA 3KWIA 1JJCB 1EETB 4BY9C 2FXUA 2PMHA 1SJFA 1SV5B 2H65B 3D2SA 4OJRA 4UB2A 5IT0A 4EBEA 4ED5A 2Q3SA 3S41A 3L3CA 3DRSA 2CA9A 1PZNA 3MTJA 1NKCA 2GCFA 2IM3A 2XIDA 2FQQB 4W5NA 3C1ZA 4P10A 4KH4A 1OKJA 4XH4A 3SIPB 3BSOA 3LGMA 1AXQA 3CFOA 4NEYA 5KT2A 1YKWA 9ICJA 3GSIA 2XO6A 5J2EA 3OYAA 1KDHA 4OJGA 4DUZK 1Q82O 1X9SA 3CPEA 4CRXA 1HQUA 4X66J 4F4ZA 2XNRA 1S72N 4KJIA 2IA6A 1XR6A 4X5VA 4Z4CA 4LC9B 3OGUA 3BZQA 1NGIA 3OYCA 5JRTA 1AROP 2CGKA 1WHYA 4BR5A 1FF2A 2V34A 4XA5A 2HHWA 1E3MA 2V4RA 3DRSB 4DPXA 2ERRA 3NVZA 1Y10A 1JLCA 4DN0A 2ASPA 2L41A 2WTFA 2YWGA 3LALA 3J7Z5 2AYMA 1TUUA 2WB1F 5KOXA 2KICA 3P6YC 5IT9Y 2XMJA 1VS3A 4DV3F 4DV4K 1Q8IA 3J7A1 3B9JA 1HIYA 2ZWOA 3MR5A 1Z4OA 2IPOB 3M4XA 3TO8A 3HO1A 1WC0A 1WOQA 1RM6C 3AQFA 1GOCA 1XO0A 3O2IA 1B0TA 1V3SA 2R7OA 1WSIA 4B1YB 1WHWA 4FJ5A 3N6LA 1OYEA 2WK4A 1YJ9S 1ZQGA 2BJ1A 3SZ2A 1RT3A 1Z26A 1I3AA 2RUSA 3QQCD 4PH5A 1HQUB 3NFAA 1N32J 1L3SA 5JLFA 4JI5K 3BDPA 3CDAA 1JK9B 3ZSXA 3T1YJ 3LDOA 1JN3A 2E5SA 4C8NA 2P9GA 4KHRA 4BG9A 1JLCB 1FJCA 5GAGI 3M2UA 4ZPWR 2DH9A 3MD1A 1TFYA 4XDDA 2BCQA 4HUFA 5L1IA 5KG4A 3ATVA 4JI8F 1YJRA 4PGQA 2RMLA 4CZGA 2XYPB 3N7SC 4XH1A 5FDLA 4XQ8A 4A57A 4QZEA 3H2VE 1RWXB 4AM6A 4FDFA 4NXNF 1T44A 5IIIA 1N0VC 1RT3B 5KFIA 5GAEU 3W5XA 5AKYA 5E0OA 4M9NA 3C66A 3MN5A 1QHAA 3K59A 5ALJA 3O6QA 4FWNA 4PYAA 1EQ0A 2ACMA 3SMPA 1LOTB 4Z4GA 4HR2A 2ZJQQ 3CD6S 2JH3A 3HSGA 2B4PA 2B0CA 4CI6A 4JI1F 3R7NB 4NRTA 5ELZA 4G3IA 2EBGA 4FJ8A 3M2UB 4FLVA 2P51A 4JHDA 3CMQA 1FW6A 1S5LU 4DU7A 4CHOA 3HM9A 1EQYA 3MCPA 2N1RA 3KHLA 3IDWA 5F8NA 4QAGA 4YN4A 1ZQZA 2WVCA 5FDLB 3MECA 2F96A 4J9SA 1TVRA 4I9LA 1UCNA 5D6GA 3DM2A 4ZVGA 1TUGB 3I32A 3G6EN 1RBUA 2V52B 3HLUA 8ICZA 4CLSA 5B8HA 1VC6A 5HR6A 5KPTA 4QW8A 2QLXA 4YCXA 2I9GA 4M5IA 4R63A 3SDEA 4EYHB 2ZWHA 1NK6A 4LF7J 2KN7A 1SH3A 2UXCK 2V8GA 4NY8A 3SFUA 1WKJA 1DKGD 2XHCA 4NLNA 2B51A 3U3GA 2FHJD 4B3MF 1S1WA 1QS4A 1X3MA 4ZVFA 4R8UA 1BE4A 4JHDB 4LQ9A 1VQ4N 1D8BA 4C8ZA 4OHYA 5F1XA 1NK7A 1KHVA 1U6ZA 4OGEA 1F9FA 2J9DE 5LMUK 3NTUA 5ETMA 4YB5A 3A5OC 3MECB 4QZ9A 5AFUA 2O01C 1TVRB 3HFVA 1KQFB 4AP9A 3TX8A 3DM2B 3RJFA 2AH5A 5ALGA 5KGWA 1VBKA 2JC1A 3SBTA 1PK3A 5ETOA 3ZTPA 1VQON 2CQ4A 4IUFA 3NOCA 1C20A 4RUBA 3TACB 2AV5A 5AQPA 5IILA 1QY7A 2MU2A 1N5QA 3FBEA 3SDEB 4IQXA 1CULA 3PCOB 2MB0B 4US9A 4M7YA 4CJ5A 2HVIA 2FHKA 1RA7A 4WXWA 3HD1A 1S1WB 2CNKB 3FCHA 4CDIA 1FTRA 4R8UB 5E3AA 1HNZJ 4OJHA 5AXLA 2DFEA 3A8JA 2ATLA 3ZDAA 2MHNA 3O9QA 1FJ7A 3Q8UA 3GONA 2QKKA 1YLXA 3GMGA 3T41A 5F8LA 3DMJA 2C2MB 5A2QU 2G09A 3N7PD 3G4SS 1U1KA 4B6JA 1OSDA 1NGFA 1D9AA 3CP8A 3AA9A 2BOAA 4M3ZA 5BR8F 3TTCA 1CULB 2FJAB 4CEZA 4GC6A 1WELA 2V8VA 4BVOA 5GINA 3HM8A 4K8ZA 1U7LA 4I67A 2QKBA 4IKAA 3MR6A 3OYLA 4DFKA 2IHNA 2DR6A 2ZZTA 3VGSA 2I5JA 1S1UA 4K2JA 4CLLA 2HVZA 3EKUA 4DOAA 3SQ2A 2E5HA 2Q3PA 3I0RA 2EWHA 3EKSA 4CWBA 3VCDA 4Y65A 1J5EK 2B43A 1L7OA 2W54A 4DWIA 2VWJA 2MPUA 3L8BA 3HFZB 4WFAQ 2DGOA 2HAIA 1VJWA 2Y9UA 3PEJA 3DMJB 4I9QA 1WDDA 4X84A 2AJ1A 4ED0A 1M5SA 2WC9A 1YRTA 3MUMP 4TQRA 4MFCA 3LTOA 4IC9A 3OYFA 1YK9A 2Q1LA 3W62A 4KIAA 3CRXA 2OCEA 3FJ2A 1VSLA 2Q36A 4OPAA 1QAJA 1GX5A 4MO5A 4DR6K 4JRQA 3ZDEA 3JPPA 2UUAJ 2H1YA 3PR5B 4A8MP 2M52A 3ZZTA 2I5JB 4Z4IA 3MM7A 1S1UB 3F9KA 3C29A 3OTOK 4MYTA 3G86A 1KVKA 3I0RB 1N34J 2LPEA 3H8MA 1WC4A 1TMJA 3FEZA 4K0KJ 2CG8A 3WKDA 3OR1A 5AKZA 4HTJA 2V8HA 3K0SA 1C0TA 5EXWA 3N4QA 1Q7LB 4URGA 4ECSA 3RB3A 1RQ0A 3TSPA 1IJFB 3VAKA 4AQYJ 3C46A 4BCAA 2KH9A 1OS5A 1X0PA 2D1CA 3HPGA 1IXRA 4FZMA 3PO5A 2C3YA 5ALXA 4KH0B 3C6AA 2QM1A 1RG6A 3NGDA 3OYBA 3DXBA 2J5AA 2G08A 1Z19A 1N62A 4Y2UA 4DTXA 8ICEA 3T5LA 2YY6A 3VAHA 3G25A 4QS7A 4Q0BA 4W5TA 3H3OB 3OS1A 2CZ9A 3MM7B 1JRPA 1XERA 4BE0A 4E1NA 8ICPA 2G07A 2FSNA 3OR1B 3LPYA 3V6JA 3SQGA 1RT4A 5DZ7A 4CJQA 1C0TB 1QDUB 5HP4A 1VQ4S 2DHSA 3MM6A 4EZ9A 4H4KC 2ADCA 1S79A 5H1SV 2YJEA 4M3TA 1MQ3A 4GO7X 3T6JA 1IXKA 2HS0A 3OFEA 8ICAA 2NRXA 1IBCB 4LH5A 2YWHA 4C4TA 1NH7A 1S48A 2PFNA 2PT0A 4CLZA 2AEJA 5AQSA 4L76A 5B0FA 1V38A 4CZCA 3L3FX 5LJ3Y 2RS2A 3U02A 2EAPA 4YOYA 1VQOS 4JI3K 2Y3YA 1RZMA 4CT9A 2OAUA 3PYDA 1G6BA 4DX5A 4I2HA 1X5SA 4AF1A 3UM9A 4Q0BB 5TISU 4BXOA 2DNMA 3PYFA 4O5FA 2G8FA 1F3FA 1W0HA 4F2RA 5J2GA 1R89A 3RU0A 3AVLA 2L08A 1VIOA 4A8KA 2FTRA 3CETA 3DKDA 5KG3A 3SQGB 1RT4B 2ZBCA 1UT8A 2BCVA 2MZ1A 2WW4A 3MM6B 2E9RX 1KVAA 2XGQA 3D68A 3PIPQ 4HYKA 5L39A 1ZQ1C 2ZUAA 3BQ0A 1FE0A 8ICBA 2M3DA 3KNGA 3ETRA 1FI4A 2VQEJ 2YN4A 5DBCA 4QYRA 2FJEB 2MLXA 3QUTA 4CZLA 2ILZA 3M9OB 1NMDA 4J9QA 4BXOB 2DIVA 1BNOA 3DLLQ 2PBDA 5M1PA 9ICFA 3MN7A 4OMFG 3OVBA 1P8GA 4LF1A 4TU8A 3DLGA 3BBCA 3WK6A 3DV9A 4LJMA 4LRDA 4NL9C 4EEKA 2B8PA 3VF6A 2KVSA 4JEPA 3P4IA 3TQ1A 1EXQA 1H1VA 1URRA 5AQVA 1L7MA 4F9OA 4YR2A 4QR2A 3K9JA 4NLOA 5F0XA 3D0PA 3E01A 2V50A 2CPIA 3H0MB 5KNIA 1HKBA 3OPKA 1K8AT 4DB3A 5THWA 2V4QA 3V7JA 4YN3B 3X1LB 3RJHA 3LPUA 2ROGA 3EY1A 2DVIA 2FLNA 3UXOA 3V6KA 5L1KA 4JS4A 3ILIA 4YHHJ 3VGTA 4W90B 1IBMF 2FC8A 2LXFA 3TAMA 1IV0A 2WF6A 4B3SF 4FZZA 4H5VA 4CTAA 1XJWB 5LOQA 2DR5A 3R2DJ 3Q83A 2OFHX 3GCWP 3SPYA 4CF2A 4KT0C 3DLGB 1UTAA 5B7WA 3MTKA 9ICCA 3SYZA 2PEHA 1H98A 4Y00A 4OGCA 2ESEA 2YB4A 2WSFC 3O9TA 1J5OA 1RLDA 4GVEA 1BQNA 4RG8A 3C8YA 3WXJA 1HUOA 3WBZA 4DX8H 1VAZA 2CADA 3HFKA 3BM7A 2XS7A 3OYHA 3K4GA 1NJWA 3E01B 2HBKA 3FQKA 1W7WA 1PJ6A 3BPSP 1G7CB 5F9LA 2BXJA 4LFAJ 4B9SA 1YAGA 4CJKA 5ALRA 2BUPA 1DQAA 2QWPA 2HQ3A 2ZHOA 3WHIA 5ALDA 1XQIA 3AD7C 3TAMB 1BMQB 1P8ZA 4FLXA 5BPNA 2VCPA 1VQ7N 4CTAB 3QAEA 1KQGB 2MLYA 4PXCA 5IQ6A 1TP7A 3E9LA 3CCVN 1XNQJ 1GLFO 5AQNA 4YD2A 4CEEA 4O9MA 4P6QA 4PA1A 2V0NA 4RQ7A 3DWLA 2HOQA 1YUWA 3HHDA 5B08A 3NRWA 3PW5A 1GK8A 1SL0A 1J5OB 2Y1LB 1BQNB 3TADA 1ZQKA 3MMAA 3QERA 4YOTA 3QEVA 5A0YA 2RRAA 1QQMA 5JVHL 1WC5A 1L3TA 1KEKA 3L95X 5AI0A 5B0CA 3ZSQA 4KB1A 2NO4A 2KM8C 1A7GE 1ZQEA 4EP4A 3S7RA 1NK9A 3B0YA 1BL3A 1ITPA 1BD6A 1TE2A 2E8NA 2BE7D 2HW3A 1BOTO 2BRLA 5KFPA 2ODGA 2ZJAA 4JP8A 4CK1A 2F8TA 2NUBA 2JHDA 5CAAA 4K8XA 4C3MA 4C7YA 7ICOA 4H0OA 3Q8SB 2MTLA 3NAIA 3ZDCA 1RWPB 1S8OA 4PL7A 4R65A 9ICMA 3D7EO 1X9JA 1ZZNA 4RW7A 5B0EA 3MM9A 1V3ZA 2AF6A 2P9EA 4NLVA 3MMAB 4WQ4C 3KLHA 5DLFA 2GWJA 5A0YB 3GU3A 4USAA 4X66F 1Q81T 3NOGA 2ALYB 4F4KA 1PYOB 4RQ1A 3ZI4A 2ILYA 1RDBA 1JMSA 2MZQA 1RISA 5CZXA 4OPKA 4TQSA 4JV5J 4X62J 2LEPA 3V6DA 4J2AA 2HQGA 3QU4A 3IGNA 8ICOA 3A3OB 1EKEA 5J0SA 2YX7A 3W3SA 3IFRA 3CJCA 4IO9L 1REGX 1YHQN 4ZHRA 4PHPA 1R7IA 3ZTSA 3MEEA 2D3ZA 1H7XA 2D0BA 2KJ8A 2QA1A 4DSKA 8ICRA 2E1MC 2D9OA 3V1RA 2KYXA 4JKGA 3NGKA 3R5GA 4P75A 4KSEB 3JQMA 1R27B 2Y0SF 2E2PA 5ETPA 4G1QA 1PBUA 3BN7A 2XQCA 1GX6A 2HFVA 4RW7B 4HEA9 3CJBA 3MM9B 2QWMA 3UPQA 4N5SA 3KLHB 2Z8QA 5L46A 2OHFA 1UPMB 4ZOHC 1GLJO 2VBWA 4IQWA 2K3IA 4ED4A 5C15A 2V51B 3QE9Y 3PXGa 3W0LA 5A8WA 2ZTCA 1U8SA 1ZYQA 1K0VA 2KRBA 3V6DB 3OSPA 4HVJA 2XM3A 4NXMJ 2JEGA 3FFIA 4YOWA 4WJ3B 1RLCL 1X4FA 2ZIVA 1NPKA 5A6WA 1S1VA 2QTDA 4KTWA 5EX3A 4ZHRB 4URQU 1UFWA 3MEEB 3T3FA 3D2NA 4EEYA 2CRXA 2HMXA 5BYQA 3TUJC 2VDIA 1RACB 3NF7A 2VKZG 4JKGB 4JI7J 4W5OA 2UXCJ 1ZPWX 3KKFA 1R8PA 3ZT4A 8RUCA 4G1QB 2GS8A 3GB0A 4CLTA 3R7SB 4YB1P 4BHQA 1OH6A 4FWQA 2QA2A 3OS2A 9ICOA 4MT1A 2XS5A 5DKWA 1X4AA 5IT4A 3AQEA 3P31A 4O5BA 5IFMA 5DDYA 3SCLE 3D1OA 3CCJN 4YUDA 3M6VA 3M1FA 5A8WB 5SUHA 5LMUJ 2E1EA 1V85A 4TY9A 2CPHA 3FFIB 1U2FA 4IQTA 1KVCA 1PVRA 1FD2A 1HMVA 4DR5K 4B3RF 2ZIVB 2CQ0A 1DJ0A 1S1VB 2GW8A 3G71S 4ZJLA 3AVFA 4YOVA 3TWHA 5T7LA 2R7SA 4B9TA 1VQLN 3TTFA 5GMDA 2FJXA 1N33K 3PMLA 3V9ZA 3LH2S 3MC1A 3GIIA 3A3PB 2QK9A 4X64F 4DMZA 2KHQA 2LYAA 4KHQA 3QU9A 1U2CA 3CD7A 2MQNA 3VQPA 2ZJRL 4ZVOB 1TELA 2PDAA 4BBYA 2N4DA 3CDWA 3JPNA 4DOBA 1LK7A 2E8PA 1WNEA 3TZWA 1PVQA 1GMWD 1FEHA 1YJNN 2CQPA 1UL3A 1GNKA 3V9SA 3KNAA 4LF7F 2ASYA 4WFZA 2ZJPQ 3HRGA 2BOPA 5KFVA 1APSA 5KT5A 3RB6A 3R6GB 1WSJA 2QARA 1QSLA 1HMVB 1AA1B 2ZUBA 3HHEA 4ES1A 1GLBG 4DMNA 4M9GA 4DOCA 1QAYA 4JS5A 5T7LB 4AYBF 4ZTFA 1XUPO 1GH8A 3NF8A 1LKZA 1SWWA 3UDVA 1N5SA 5CQGA 3R8YA 4OLOA 3NCIA 1VK8A 3KHHA 3SQ0A 4P73A 1BO5O 1RYUA 4PL2A 5DM7L 1F21A 3NVMA 4F7VA 4A8EA 4CHQA 4PR6A 4LRFA 3I56S 3CF5Q 4BGDA 2KT3A 3M6WA 1VI7A 1F9EB 2ADBA 4DV1F 3UMCA 1PO6A 4KREA 4FVUA 1SXDA 4RQ0A 1N4LA 4DQ8A 1J5EJ 4OX8A 3A0BU 1N52B 3FMWA 1NNLA 4UARA 4CYUA 4KHYA 2QARB 1RAJA 4DQIA 3K17A 3WK9A 4TU9A 1VSHA 3ZZPA 1HNZF 5LL6Z 3NCRA 2EFNA 3DXSX 4JK9A 1XMQF 1KONA 4KAZA 3ATUA 5E7OB 4ED6A 5FROA 4JI6J 5AQLA 4K4ZA 2R18A 1Q7YO 3JTPA 4FSVA 1LW2A 2DNOA 4PUOA 2BV3A 4PL8A 3VQ9A 3FZFA 4DSJA 1LVHA 4FO6A 2GMLA 2YKPA 2DXDA 2QL7B 5LT5A 4DCHA 1ZQNA 1N5XA 4DR4J 1Q82T 4KHWA 4RCHA 4MF8A 4FWRA 1Z4UA 4CYUB 4U8VA 1VQSA 4WKYA 4I69A 3MZIA 1N56A 3QINA 2JZ5A 1ZQIA 4RUCA 4FJMA 3Q8RB 3P45B 2ALZA 1H2TZ 1RWVB 3UPFA 3FM9A 3MCAB 2X7IA 3U1MA 3G8TA 1JUDA 2KNJA 3QETA 5BOMA 1IQTA 4FJKA 2ZZNA 4WCEQ 3OW2M 2XYHB 4ICAA 3GWCA 4QIEA 1RCOB 2IVOA 1LW2B 1DGSA 4PUOB 3T7ZA 3L9ZA 4DEZA 3J81j 2DGSA 4OPJA 3N97B 1EX4A 4BS2A 4DUTA 3MHYA 2FGOA 1OMSA 5J2NA 1S6OA 5CRXA 2BKNA 3MURP 1NO8A 1CQNA 4DV0J 1JQGA 5CB1A 3BKFA 5GAHP 1FFGB 4Y2QA 3I4HX 4NYPA 4ILLA 1N34F 4K0KF 3ILJA 1A6SA 4JB8B 1CUKA 3AXKA 1WI6A 4AHSA 3CEDA 4N41A 3FZBA 2CJAA 2ZHAA 1T0TV 5J2JA 2F4VK 1N36K 4E2FB 1NB2A 4LF9J 2E9TA 4GKJJ 3UWTA 3E8OA 4AH9A 4YFKA 1Y3KA 2DH7A 3OFHA 4U7UD 4C7ZA 4ANDA 3GFYA 2ZM6J 3RH4A 4F5OA 2Y8YA 2EXUA 4O3PA 3NNHA 5J2NB 1KTVA 2AXTU 2QI2A 4CJWA 3S01A 5KG6A 3O9UA 4DKWA 4B1XB 3JPSA 2NV3A 3D6FB 4C98A 2VA2A 2MQQA 2VWKA 2QG9B 3EO3A 1F5AA 3I8BA 1NGJA 3IWNC 4M7XA 2HMIA 2HFNA 3I1YA 2J9EA 4ED8A 4DPTA 3ZFVA 2Q0RA 3AARA 2D5RA 2JH1A 2VGMA 2DEIA 2O8BA 7AT1B 3MN6A 2WB1C 4JAXA 3K9KA 2RH3A 3OYJA 4FYYB 5HRSA 5CZ2A 1IH7A 2W55A 3PJWA 4PZVA 4LRBA 3RH5A 3RRKA 2ZVIA 1NJXA 1MA7A 1ZM4A 2ZWPA 1TK8A 1VR6A 5LJVA 1I6JA 3RBDA 4AHVA 4NWIA 1FKAF 5CD4H 3LAKA 4IG0A 4QQBA 2NO5A 1SH0A 3FCWA 3QFPA 5HMXA 1FNMA 2H5JB 4K4YA 2H48B 1BPBA 1EKSA 2V4JA 2HMIB 5BRDA 4GKKK 2ZOMA 3EZOA 3B82A 5L9XA 4RLEA 1SI9A 2HURA 4ED1A 1L5UA 3HBTA 2KMDA 2O8BB 4C3LA 2XI3A 2DK2A 2VC1A 5DBAA 5AM4A 4E7HA 1U49A 4LF8K 3P1GA 3K5MA 4KH5A 2M0GB 2VJ5A 4XUSA 2VB6A 2VQEF 2VPXB 4CEAA 3FC4A 2JV3A 1LKYA 3BSNA 4DXLA 4Y2CA 2GNKA 3NS5A 4ZVEA 4USTA 3C5FA 3D1QA 2O8EA 2KZ3A 5EX5A 5CCMA 3BN4A 1S1TA 4CD3A 4IG0B 4C4SA 3BGRA 1URNA 5AJ3J 1KVJA 2QB1A 2HHVA 4C9DA 2FC9A 4ZPTR 1VJ5A 3AGKA 2AGOA 3NGZA 2V4JB 3H2UB 3AEVA 4WP3A 1Z4NA 3O1WA 1N60A 4KFBA 2QEXN 4HI1A 2E66A 1N63A 1HR0J 2XBPA 1ATRA 4B3TK 2W9CA 1HFEL 4KHPJ 1V9PA 3AO4A 1FEEA 3MMBA 1H72C 4MHVA 2ZXHA 1U4BA 4ZIVA 5J0WA 4DN9A 5F8JA 5J2CA 1RFQA 3NGYA 3LZIA 3ZT2A 5A2QY 2QWNA 1UPHA 2JFKA 4FM2A 4I2CA 4Y2KA 5I3QA 3UDEA 1WI8A 1LKYB 5LSOA 4KR0B 4FJIA 2PY5A 1F2GA 4O3OA 3A3NB 4J9RA 2D41A 1WCNA 1DGKN 3FSYA 3ITHA 4KYZA 3PO4A 2O8EB 5KFQA 4EELA 3VQ4A 2VPWB 1S1TB 2YBVA 2W2NP 2KVQE 1ATNA 2DCLA 2UUCJ 4M5JA 3BGRB 3HW8A 4HTUA 4RNNA 1JKHA 4QZ8A 1ZETA 4C8LA 3OHRA 1XC3A 1K8KA 2OPSA 1NHUA 2BABA 4H8KA 4RWWA 4CZKA 1TKXA 2FLOA 3MX2A 2L9DA 4KFBB 5KFOA 1PVPA 1MWKA 1HARA 2NLWA 1J9AA 2W9CB 3CC7S 1ZQUA 5DK5A 3MMBB 3ID6A 1L8LA 4GY2B 4GV6A 4C4RA 2XWXA 3AFGA 1P7DA 2RDJA 4WZQA 2NZ4A 4UZBA 4BRIA 3HVTA 1FDNA 4ZH4A 4JV0A 1XEZA 1D1UA 3ITHB 9ICKA 4U67L 3QGIA 4YNQA 3LDPA 4DUZF 4HVZA 1UVMA 1JLFA 4FZXC 1I39A 3O3FA 3KHRA 2O1PA 4ETZA 1VBZA 2RRDA 2QMXA 4B9QA 1JKHB 1U0SA 3OY9A 4C4WA 4DL4A 4MDBA 3DRYA 8AT1B 2B4UA 1K8KB 2OPSB 3I8DA 1TKXB 3QUQA 2A6AA 3O4NA 1P6TA 4CK3A 4PZOA 4F5QA 1NK0A 1LV5A 5EOZA 1V4SA 3EE9A 5ALUA 1QQNA 4X65K 4DV4F 1SZPA 2I8EA 3CCLS 3TVZA 4L8RB 3MXMA 3BGUA 4HCBA 5J0XA 2B4VA 1WOPA 2I0XA 1NHKL 1RKIA 3KFWX 2D1KA 1BDGA 1BGXT 4PG5A 2A40A 3HVTB 5L1MA 4FWMA 2A3VA 1T03A 2JLFA 1SIWB 1JLFB 2BCSA 3SFGA 3B6PA 3MX5A 4ZTJA 2MKHA 4YDDB 2LU1A 4ZPDA 2AD9A 2ZH6A 5KFUA 2G0JA 2MA1A 3GLJA 4YDUA 7ICSA 2D74B 4JI5F 1VQ6N 2WOMA 2CJQA 2H54B 1S22A 8ICGA 1Z1ZA 2X6NA 3NNAA 2BH1A 4C0HA 1T9TA 3EUNA 3B8HA 3O3HA 3DAWA 4U96A 2N4CA 1REVA 4FJLA 1RAEB 2QO3A 4QWAA 5M1FA 3D2EA 1T9WA 4WQ5A 4OYAA 1JJ2M 4NEZA 3NVKA 3T19A 3EPIA 1O6XA 7ICQA 3AVJA 4CFBA 2WCXA 4QYZK 2DYAA 3LPTA 3I87A 1DRZA 3BKTA 1EZZB 4CZIA 1T03B 4I2DA 2HQFA 2NXJA 1RDWX 4KY3A 4E8UA 3IG8A 2KO1A 3TEHB 2YKOA 5J8YA 1ZQQA 2ZBPA 3AD8C 2PFQA 2BJEA 3T79A 3KD3A 3PUFA 1TKTA 4ANEA 2WOMB 2E29A 1VISA 2KXFA 2IVFB 4IWVA 3LAMA 4FPIA 5KFSA 2VHGA 2MY8A 3V81A 4JI1K 3J7YP 4ECVA 4M63C 4WIIA 4B9MA 5ALZA 4UAZA 5D4PA 3N28A 1S0VA 5HRNA 4FJNA 4F5PA 3RBZA 1REVB 4KHSA 3PFOA 3IA0A 4AD6A 4RPZA 1Q78A 3D2EB 1GMVA 5EY4A 1N33J 2RQ4A 1LFPA 2XY5A 2KP7A 5K4LA 3VQEA 7ICPA 3CQYA 5AQRA 4CO4A 5HOOA 1ZM9A 3R9LA 4I2JA 2OMOA 4LF2A 5J2FA 2EFQA 5AK5A 2QA4G 4EHUA 7ICIA 1KQQA 1RAGB 3ISND 3VVTA 5B09A 2MKIA 4Q8EA 3H6EA 3O3LA 4DV7K 3PSTA 1FT8A 1CXUA 1ZD2P 1FWPA 4Z2XA 1M5VC 1HIWA 3F2DA 1ZAXA 1TKTB 5HAOA 5BXIA 2W3RA 3EM1A 1YG0A 2VFRA 4FYWB 2UXCF 4CGFA 3ONNA 2X74A 4ZA1A 1S6UA 3V81B 2RHFA 3PRBA 3NRBA 2PSZA 2PI4A 1RDDA 4BX9C 3PLAA 1NLKL 4USUA 2XMWA 4Y2RA 4HL9A 3FYHA 5M1QA 4OI4A 4GXJA 1RZTA 3CJ0A 1VQKN 4DR1K 4MF2A 3TRGA 1S7HA 2XZWA 5AKLA 4N7TA 5LMUF 5K9FA 3VF0B 2GIFA 4OHZA 1KC8O 1FEZA 3SI8A 1XR5A 4QZIA 1RBSA 4MLEA 3D67A 2MQMA 5C24A 1QD1A 2HZCA 1FKOA 2CAJA 1QUVA 4PQUA 1BC6A 3PR4A 2OMLA 2KW4A 1YVUA 3KIOA 2WAQF 3H7IA 2KK0A 3CCEN 4CERA 3M6XA 2KXHA 3ENVA 3AVGA 2DHGA 2CWXA 2IRYA 1KEJA 3I9V9 2O3DA 1CSJA 5JU5A 4PG8A 2QGFB 2PA8D 1SJQA 2EFGA 2VD3A 3K2YA 4PKDB 5AQTA 2AJ0A 2ZF5O 1OW5A 2G2ZA 1T3NA 2DR7A 3VAGA 4Z6DA 5KQDA 2GLEA 3H7HB 3GIMA 1CPZA 3RBEA 4RW8A 4CT8A 4M6WA 2GIQA 3VCBA 5AQXA 1QM9A 3H8YA 4QZCA 2QXLA 1WSVA 5C24B 1FKOB 1RHJB 3NMUA 2QA4S 3JB9k 2WHOA 3MFIA 4PQUB 1YITN 1SKUB 1GMUA 2G1HA 2VQFK 1SJ4P 1R6YA 3SAFA 3H1VX 2OELA 4BC4A 3OT9A 1MW7A 1NOZA 1FNOA 2HRTA 4EIAA 1I94J 1UMJA 3HULA 3PG9A 4DS5A 5KT3A 1WHXA 4KGXB 2HIQA 3ZNJ1 4CJEA 1J5EF 1NGCA 2ZJQL 1N6QA 2P9IA 2ASMA 4ZP8A 4ZP9A 5CA5A 2DY4A 1TL5A 3C6TA 4QW9A 4CM2A 4RW8B 4M6WB 2FE9A 4NCGA 3VQ7A 1Z3EB 4KH6A 4RJVA 2F8HA 1BCMA 2Q2RA 4PPXA 3CO0P 3VQ6A 1HWUA 4ZKAA 4EFHA 2V68A 2ZNZA 4I2BA 2D0AA 4TYBA 4CJ4A 4ILHA 2OZSA 4DR6F 4DZ6A 7ICGA 4CLFA 3KOAA 3SSQA 4HWIA 2K7KA 3IGVA 4I6YA 3PMNA 2C3MA 1S9EA 3OTOF 2Y0SD 2IRUA 4PWWA 3LDQA 4CVNE 1N88A 2W9BA 2DRAA 2VV5A 1F2HA 4BC2A 2R8HA 1NGGA 2DO0A 1N6QB 2P9IB 5IIKA 4PHAA 2YMMA 2E5IA 5G5HA 4FLYA 3C6TB 4OD0A 4PHDA 4LRAA 4D3HA 3R5CA 4NCGB 2MJNA 3FSXA 2W3SA 2A10A 4NA2A 5IZHA 3OJUA 3NS6A 1UFKA 1WDTA 3GIJA 2GWKA 4J7CA 1FRJA 3HP9A 4UAYA 4OVLA 3JAMO 5D0HA 2UUBK 4YS2A 5EWFA 3V9UA 4LF6K 2E1CA 1RNHA 5AK3A 4EBCA 2NZCA 1ZC6A 4UOFA 2FY8A 3W9IA 4A8FA 1D8ZA 4LH4A 4OYXA 1S9EB 3KG1A 2IOHA 4Y1DA 1FJGJ 5M1KA 2W9BB 2BQ3A 2CZ4A 2YY3A 2CQ3A 3VZHA 3PKYA 4BQLA 1RWMB 3QGPA 1YZ7A 4OFZA 5J0YA 4Z7YA 4NLTA 3KLFA 1VC0A 4OJ1A 1NGDA 8ICLA 4L6V3 5ALIA 2HNYA 3OYMA 4KLGA 3FFKB 1ZQDA 1EARA 2C3UA 2HKEA 1IKXA 2K8CB 1NJIT 2M2BA 4XDCA 4X4VA 2CQ2A 4YY3K 4UY8T 3F0NA 1Z25A 2H3EB 2QRRA 2DGQA 2CN1A 3SJHA 5FIIA 4JI3F 2EQYA 2KT2A 5AI6A 5EE1A 1C0GA 1U1LA 1LOUA 1G99A 1MWYA 3MMVA 5FLXU 3AO2A 7ICUA 2YWKA 2FBTA 3UKUA 1SC1B 1CZBA 4KAIA 5GAEP 4B3OA 1W97L 3AQPA 4FWKA 3GJQB 2F40A 2KFNA 2E6MA 3UQSA 2W4CA 3ULHA 4GXKA 5KFBA 3C6HA 2OKQA 2E4LA 1A9NB 4WP8A 3VESA 4B1UB 4QIVA 2HBJA 5IWAK 3KLFB 3SQOP 2GVDA 2HNYB 5LMNF 2IVNA 2AGQA 2HFUA 2EAOA 4ZK7M 1ECWA 2LYHA 2G0IA 1IKXB 4LF8J 3MWBA 1WTFA 3W5ZA 1JIHA 1SQFA 1ACMB 1H2VZ 1LCUA 4KLIA 4WFAL 5E3CA 1FRMA 2B8QA 1MDUB 3UR0A 4TKTA 2NXCA 9ICVA 4OHXA 4AYBD 4YB7A 2QYCA 1OPZA 1CZAN 1ZOLA 3IN5A 4KLMA 3ZX0A 4J2EA 3UKUB 2Z1IA 5CHIA 5C5JA 4JKFA 5AQHA 1O51A 2ZTEA 3GR1A 4B3OB 1LWEA 2ES6A 3R1XA 1E6YA 4OHVA 1ZQVA 1O13A 3QSYB 4YD1A 3VF4A 8ATCB 2HWHA 2F63A 3H59A 2Y0SC 3QNOA 4O4RA 2OEHA 2RQMA 4A8WA 3KFUF 1KFDA 4B3TJ 4BRPA 4CGGA 1IBLJ 3VGMA 2GVDB 1JXLA 1WJ9A 5AQKA 3O4QA 4IRKA 4I2EA 1B4SA 1ZH5A 3TUZC 2IOFK 1U0HA 2A3JA 2VPYB 3Q2TC 1R0BG 3V6HA 2VG7A 1HKAA 1RAHB 3H0RB 4KLSA 1IBMK 4FYXB 2XY8A 2BJ9A 1RHUB 4FWLA 4F0MA 1ASWA 4Y2AA 3KD5E 4IEEA 4IFEA 5J0RA 1BQMA 4I2AA 4KHUA 1FXDA 5L38A 1LWEB 1E6YB 3IS9A 5AR0A 3VEZA 1YTUA 4NLSA 3WEEA 1N48A 1YJ7A 2VC0A 1N5WA 3KUGA 1SPBP 3V4MA 2JL9A 1RWKB 5DM6L 3RJEA 3C2LA 4LF5K 3CT9A 1U0HB 3ULDA 4WFXA 1L7NA 5HQLA 4K41A 5T7BA 4RT3A 2VG7B 2JH7A 3NMRA 3QLHA 2VODA 3SK3A 3DDNA 2C2OB 4DL2A 1NBWA 2DBBA 5HNKA 2W4PA 3EL2A 1J6ZA 4ZCKA 2VYPA 1IR1A 1BQMB 4P9SA 3IBWA 4NV0A 2WBRA 4M42A 2F3NA 3M8YA 1ZTWA 5CA7A 3IS9B 2ZKTA 4DPWA 3WNEA 3WEEB 2DR9A 3B0XA 1SB3C 1W26A 2OGUA 2Q66A 3H5XA 3L2QA 3U27A 4BRFA 4EHTA 4DV3J 9ICXA 3CNQP 1OY9A 3CO9A 3PIOQ 4EWTA 4X65J 3K89A 2QJ3A 4CJFA 4IRDA 3FK4A 2DBYA 3HSTB 2DY9A 4QS9A 1EP4A 3MN9A 3CPWR 4UAWA 5ALPA 3M8ZA 1X60A 3I5BA 3QLHB 2NCKL 2BDPA 3M9MB 4C0OC 4DSLA 4UB3A 3DCAA 4WK1A 4BGAA 1DURA 3PNIA 3THXA 4AYBC 3FBBA 3AHPA 2KB2A 2R2TA 2HBLA 1NSPA 3UCZP 2Q6CA 4ZVRB 4CEOA 2DPJA 3EGNA 3C94A 8ICWA 4LSNA 1RSCA 5GAHU 3ALYA 4NM1A 3HT0A 1WAJA 3DLLL 3PX0A 1FKPA 2VA3A 3W7BA 5TZVA 3VMFB 2W03A 2YHYA 3AGRA 3KG0A 4FJJA 1EP4B 5I3UA 4ELUA 3PY8A 2UV8A 3DJCA 3AVNA 1Z1VA 1X9XA 4LSLA 3QJLA 3THXB 4PL1A 1QSYA 5CZVA 2I9SA 3ZT1A 3NL0A 1NGBA 2FBYA 2P5GA 3SPZA 3WKCA 4HTLA 2H5IB 4XPCA 3UKRA 3NUQA 5B66U 2F5GA 4JI1J 4A5AA 3GDXA 4LSNB 2B7CB 5HMLA 9ICUA 2QWRA 2HIYA 4OYWA 1HI1A 3F5TA 1CJTA 1N2XA 2MSTA 5EU7A 2R8JA 1FKPB 1PGZA 2FI1A 4ETXA 2HHSA 2DNZA 1V97A 4EX7A 1UKUA 3DOKA 4KLOA 3QBCA 2R7WA 2AYBA 4OLPA 1S5JA 1T3QA 5H9EJ 3MGJA 2E5JA 5I3UB 4I2IA 5SZTA 3TA0A 1CJUA 2AZ3A 5DDMA 2GZOA 1GXTA 4H4OA 3U3YA 2K7JA 4CLUA 1ZBLA 1AT1B 1ZM2A 3ENWA 3AH6A 4LSLB 2FC0A 3O8MA 1NJYA 2Y0BB 1YI2S 4X4UA 3I55S 3EGZA 5D4LA 3K0JA 1HA1A 4CF9A 2VJ4A 2HFZA 3CJKA 1HJPA 3UKRB 1RBLA 1BUPA 4LREA 2EFVA 4B3MJ 4F4WA 1T11A 3NRZA 2VUGA 3Q0AA 2P6UA 4JRPA 4WTOB 1M1KT 4DTSA 3BO4A 4DFMA 1Q0NA 3VTIA 4J9MA 4XEIA 1CJTB 3TPQA 1M5OC 4EENA 3RGIA 4B8CA 2IA0A 2ZBIA 4O3RA 3A5NC 2EHGA 3DOKB 2O8DA 1GLEG 2RPIA 4Q7AA 2VZ9A 2R8IA 2FVQA 4DL7A 4ERDA 3HZ6A 4DR5F 1CJUB 3QRRA 1NSAA 4H4OB 2EC2A 4DTNA 1F5BA 4ZLNA 4CGZA 2HK2A 5CABA 5LXRA 2DL0A 2D0OA 4PEOA 5CJ7A 5F0WA 4KBIA 1PSDA 3O0FA 3FNNA 3Q8LA 1NGHA 3CJKB 4FP9A 1J27A 2MRLA 3HVAA 3MAAA 2DO4A 1VQMS 4BRMA 2BW7A 4RZRA 5ETTA 3ZC4A 4K4IA 4F3TA 3LWMA 2IYIA 2RU3A 3W8GA 4RWXA 7ICFA 4LFBF 1OQ3A 2DXFA 2KG5A 1HWJA 5BPMA 1H74A 2WF7A 4FE3A 2BTFA 4AHRA 3LK9A 4CLKA 4TU7A 2W1BA 2VKRA 4WF9Q 3NH2A 3DFEA 2W40A 5LSRA 2O8DB 1J97A 3AO3A 4R0JA 4P7VA 2HGMA 1UVJA 2BEFA 3IP4B 2AP6A 3SQ4A 1RGIA 4WWSA 2PMZF 3GZFA 2MZTA 5BN9A 2R7VA 4ILRA 3NCPA 1RTIA 1XNRK 1VMBA 4RNMA 5EWGA 2KZZA 5BR8J 4NLZA 2KHOA 2HFSA 4K4VA 5M1OA 1M1GA 5LJWA 3MCMA 3QPIA 3WU2U 1MMDA 2MQLA 2GO7A 3MAAB 3M2RA 5ALMA 2B3TB 4IJAA 1SV0A 1DTQA 1F5CA 2YI1A 3MWTA 1U45A 4C23A 2AU0A 2P6SA 4WU2A 1B92A 3MGHA 1HW9A 2M8HA 5A8KA 1JXEA 1RK8A 4DV2K 4O4GA 1UP1A 3LPEA 5I4MA 1DK2A 1H0HB 3N5FA 1FDDA 1TV6A 2VKQA 2ZGZA 5E2QA 4O5KA 2HGLA 1Y9OA 2H3FA 3KOOA 4B9LA 3UD3P 2OTJN 1WHVA 1RTIB 2V7ZA 2NUHA 5ALOA 2GELA 3OL8A 3IKMA 2Y9TA 4BDZA 2K60A 5M2PA 1VLBA 1HNWF 3CD0A 1Q5VA 2XMMA 1JL1A 3V72A 4HTIA 1VLYA 3MMJA 3M2RB 4Y2SA 2YCHA 1UT5A 3QAUA 2R7TA 3CERA 5HJYA 3NGUA 1DQ8A 1DTQB 3ILLA 2RAQA 3A1YG 4QZDA 3T1HK 1P1LA 4MFAA 1OUQA 2FVSA 3M7VA 3OR2A 3H8WA 5A8KB 4O44A 4BRQA 5T14A 5CHCB 3WK4A 3ENAA 1Y00A 4O4GB 1T9VA 2BYCA 1ZQXA 4DSIA 3WK5A 1ZAVA 4O0NA 2FHJA 2HBQB 3H40A 2OUGA 2F8KA 2EK6A 2IJFA 1TV6B 2F9JA 2MAXA 1KSPA 5DB6A 4Y2IA 8ICFA 1RTZA 3HRDD 3GYNA 2RE2A 5AM5A 1NG9A 3O3GA 3O80A 1TV9A 3MR3A 4LF6J 5A6PA 2FPMA 3RMCA 1UJ5A 2PO4A 3ETLA 1CS4A 2GQQA 2KDOA 1EKRA 1Z6RA 3U9DA 3CFRA 5E26A 1Q81O 2GJFA 3GFHA 2E8AA 4CJRA 2EAMA 3LANA 1Q86O 1T95A 1VQPN 4PPZA 3OR2B 4DS4A 1RDFA 4O44B 3J7ZO 3RMDA 3PW0A 3K8VA 3MOJB 2X1AA 2VASA 4RQ5A 3TADC 2MEWA 3HTVA 2UVVA 3MPWA 3Q2SC 3U1NA 1VSEA 4TUQA 3KUHA 2H3QA 3C14A 1T4GA 4WP9A 1RABB 4Y2VA 5EE0A 3UMBA 4Y2XA 1JXVA 2A42A 3SSRA 2BCUA 3WX4A 1GT8A 2E5GA 4ECTA 3WKAA 4LRCA 2ZJPL 3AVAA 4B1VA 2YWWA 3ENBA 4O5EA 2GA7A 4OX7A 2D9PA 2F4VF 1N36F 5ETKA 3QEBZ 1J2MA 1MLAA 1UA0A 3JSMA 1KXPA 5D4NA 1CS4B 4E7KA 5ALFA 1RAFB 3PDNA 4TY8A 1BU6O 4H0XB 3C5GA 4P0QA 4MH8A 3VERA 4DU3A 1CQMA 3BO3A 1C4AA 3PM9A 4CJLA 1MWMA 4JKHA 5J0TA 5GADP 3DHWC 1PC4A 2BJ3A 2G0CA 3J7YU 1SIZA 4KGKA 1HI0P 1T05A 1ZZFA 1CG2A 4J2BA 2DISA 3C14B 3OTBA 3Q8VA 4M1KA 2VG6A 3BR9A 2M88A 4DCPB 3CF5L 1SB6A 2R42A 2F76X 1TAMA 1WF0A 1YVNA 3QIOA 1Z1BA 3C16A 2IVYA 3H45C 2XICA 5DLGA 2X3DA 1VFJA 2NYVA 5J0PA 3I33A 3J7AN 2JC0A 2DNHA 4OYPA 2DNQA 4HAIA 5AKEA 5AE1A 2A1RA 3JSMB 1RBRA 2UXBK 1KBRA 1OIAA 1FRLA 1NCLA 4NX9A 1S9GA 4TY8B 3W8PA 3MAHA 1SVDA 1YJ9N 4P0QB 1YSJA 2V94A 2QYGA 4ZLLA 1VQ5S 3OL7A 2KEYA 4NYOA 1WTBA 3MDCA 5KFMA 5GTIU 2C2DA 1E6VA 1BPEA 3N5BA 5DMRA 2BJDA 2DQNB 3UCUP 1G4CA 2XMTA 1T05B 4J91A 2GH1A 1S5ZA 3I9ZA 4BLGA 4XIUA 3SCXA 2RRBA 4Y34A 4HLBA 5EVZA 3U1LA 2VG6B 3GE1A 1U1NA 1EIYB 1Q18A 2P1JA 4CQ1A 1BPYA 2QLBB 2WAQD 2JR5A 3C16B 2AYGA 4ZMMA 4E7LA 5B0BA 4E98A 3OD2A 4GKKF 4FPAA 4BJQA 3DU6A 3LQVA 2DNYA 3C65A 2OTJS 3J80O 1IBMJ 3H3NO 3TJAA 4B3SJ 2NXNA 4G1IA 4CF1A 1S9GB 1QJHA 4WBFA 4U7UK 3TYTA 4LF8F 5A0LA 1Y5IB 5ALEA 2CQHA 4J9KA 4UQGA 1JLGA 2LDYA 2I7NA 2OWOA 4QJFB 4NOHA 4ZVQB 3RYLA 5H9FJ 3NAHA 1KC8T 1E6VB 2CQDA 3DOLA 4EBDA 2NR0A 2VIXA 1DLOA 2CQCA 3SNNA 4WCEL 3L09A 2MHEA 8ICCA 3D2FA 1NOMA 3CD6N 1U8WA 2DGWA 4CP5A 3V9XA 1YIJS 2ZIUA 4LF5J 4M45A 4YP3A 3EEQA 3AJ1A 1HHQA 3P5TL 1TMMA 3Q8PB 3IBPA 3L2RA 2E1YA 2VA8A 2FZGB 3NGRA 1RBAA 3VPZA 3BF1A 2FPKA 3V9WA 4B3TF 3RAQA 3H4BA 4P71A 4IBNA 4AHUA 2G2OA 3ISZA 1MSWD 2QKQA 2I38A 2WVBA 4IQMA 3W1YC 1QVFR 1KR4A 5CHGA 3TEGA 3POTA 5KL8B 2IOFA 1JLGB 4NLGA 2E1RA 4B02A 1NZPA 3M32A 1K0TA 3DOLB 4LFCK 4JKDA 1DLOB 2WZ1A 4F0HA 4EGLA 3W2VA 2AWZA 3UFCX 4QWBA 2E1AA 5HO4A 2O66A 3D2FB 5AZIA 3SV4A 2YX8A 4EMDA 2Z1GA 3FRZA 1H73A 2DFFA 4H5NA 2ZIUB 4ED7A 3AAPA 1OH7A 4V19J 5CR4A 3PZPA 2FYXA 1KRPA 2HOEA 1YRUA 3FGVA 2F4FA 1GLDG 5E84A 2MSSA 5AICA 1RILA 4PG6A 3RB4A 2EG2A 2M70A 1P90A 3D1HA 5HP1A 3CYMA 4L72B 4RQMA 3L2VA 3E9PA 3L0QA 3UXPA 3POTB 4CCHA 4G6VB 1RYSA 3M32B 1M5KC 3O9SA 4Y2JA 3D6TB 1S7IA 4Y6IA 4F3OA 1L8OA 2R7YA 3W2VB 3KLVA 5HMWA 4N8OA 3EXCX 2CPFA 5KG7A 4KB0A 5AZIB 8ICNA 4FPRA 3AQOA 3DLEA 2DIUA 4M9LA 4NLQA 5C10A 2NXUA 2HB5A 5HQMA 2CGJA 4KGVB 4UB1A 5CZ1A 2CJ9A 5HLFA 1FFWB 4DO9A 2WAQC 4RWTA 2VIHA 5SWMA 4KHMA 5B0DA 1EJ7L 4XAKA 4M41A 5AQZA 5HP1B 4OZ5A 4RPFA 4X65F 4KH1B 4WFBQ 3N79A 2BQRA 2MKSA 3G4SN 2FHOB 4O0IA 1BXNA 1F6TA 3BGOP 5ETNA 4CM0A 3C28A 2LLZA 2F77X 2I1QA 2ATCB 2WRMA 4AILC 1XTZA 2GQCA 4F0KA 4A2AA 3RJMB 4NE9C 4QBUA 3M8PA 2HNDA 2CVIA 4QZFA