The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
133
|
sequence length |
394
|
structure length |
388
|
Chain Sequence |
SQLHKVAQRANRMLNVLTEQVQLQKEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb |
molecule tags |
Dna binding protein
|
source organism |
Escherichia coli
|
molecule keywords |
Plasmid partition protein A
|
total genus |
133
|
structure length |
388
|
sequence length |
394
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2008-10-22 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF13614 | AAA_31 | AAA domain |
A | PF18607 | HTH_54 | ParA helix turn helix domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 | Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | P-loop containing nucleotide triphosphate hydrolases |