3EZ6A

Structure of para-adp complex:tetragonal form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
394
structure length
388
Chain Sequence
SQLHKVAQRANRMLNVLTEQVQLQKEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 130
structure length 388
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez6A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez6A02
2QROA 3MJRA 3GJXC 3TW4A 1U90A 3NXSA 1BH2A 4TQAA 3KQLA 2PZFA 1HT2E 2ZAMA 1XFAA 2FSHA 3F0TA 3P1JA 5FBQB 4EIWA 1N0WA 1HUQA 4TMTA 1SXJB 2QT0A 4C3ZA 1R0ZA 1ZRHA 5C4MA 2JA1A 1DELA 2FN4A 2FOLA 4O2LA 2WBLC 1NNEA 4OYHA 1ZJ6A 4Z1MD 1UBCA 1IY2A 4G5QA 4U5XA 2KE5A 3CUEF 1G8PA 3K1JA 1VG8A 4LK2A 621PA 1QZXA 1NVVR 2XTZA 1M34E 4IOJA 4XVRA 1WQ1R 2A9KA 1Z6GA 2G3YA 5FL7D 4B44A 3BS4A 4LHXA 1E1QA 4AK9A 1AS3A 1E79A 4DEXA 1G7SA 2QEQA 2ZYWX 1PLKA 2NPIA 3OIUA 2PL3A 2KJQA 4NL4H 4QBFA 2XAUA 2XX3A 4M1WA 4QBGB 3TH5A 4ASUA 1KI1A 3TUIC 3QKRA 2XEXA 3QUSA 1R10A 2X1VA 3BH7A 4FN5A 1R5BA 2ORVA 3I5XA 2HLDA 3X1XA 4ESVA 3FFAA 1L7VC 1HQYE 3RS4A 3T5GA 5LDDC 1N2CE 2Q21A 1G41A 2ZRIA 1BMFD 4TLBA 3U3JA 3PQCA 4B43A 4YMTA 2ZVQX 4RCZA 1I2MA 4TMXA 2ANBA 1XMJA 2A5GA 4C2UA 1LW7A 3GFTA 3NHBA 1TF2A 1R5OA 4KJZA 3SJAA 2JJ2A 1KTVA 2QQEA 3ZVMA 1O87A 3NH6A 3U7HB 1T4GA 4LBZA 4JVSB 3W34A 3VKGA 2PMDA 5LD2C 3M4YA 5H70A 4CVNA 4YMSA 1W2GA 3CNNA 3IEUA 1ZC3A 1WP9A 4IVQA 1P2UA 2CJWA 2CLDX 2O52A 5HKKA 2D2FA 2FSFA 4BEJA 2IUSA 1ZCAA 3LX8A 2ZPTX 1FMJA 4PR0A 2IWRA 3B85A 1XEWX 1ZNYA 1R8SA 2C9CA 5SZJA 4D80A 4JKYA 2IW3A 3L8YA 4C30A 3LXRA 1GFIA 3CF0A 3K9GA 1M7HA 2WOJA 3LVRE 3UANA 4NBSA 1XD2A 1W49A 1G19A 2Q9AA 3MWKA 5F2EA 3R7WA 4DT1A 3L0OA 5G3ZA 2P5TB 3AP3A 3SDZA 1TEVA 5JSZA 3DEFA 4BEBA 3PJRA 2F1JA 4B3GA 1W4CA 2ZSEA 1OIWA 1COWA 3RS5A 3LH5A 1U9IA 1YZQA 1J2JA 2VHCA 2ZSDA 1E2IA 2ZRNA 4QGHA 4MKFA 2D74A 1YZGA 2DCUA 3EA5A 3QXXA 4M9ZA 1N5LA 4TT3D 5DI9A 5JS7A 2G6BA 4TMWA 4UXJA 2H1LA 2DWOA 3AF4A 3SEAA 1F2UB 2BOVA 1SKYB 3AF2A 1AS2A 4JT2A 3S1AA 1GDDA 1QVRA 5KDLA 4DEYA 5JRZA 2FFHA 4FMDF 4DCTA 2AKAB 1IONA 1VPLA 4K46A 1WB9A 1JAHA 1GTVA 1DAFA 4C7OB 2IS4A 1ZU5A 2J9RA 1R6BX 3PR1A 5HE8A 2IYSA 2H8KA 4S35A 1N6NA 3HU2A 3X1YA 1ZM9A 2BCGY 3CRVA 1W4AA 5AR1A 4D4MA 5B64A 2ZRBA 2ZS8A 1PVOA 5JJLA 5JEDA 3T12A 3ZGXA 2J45A 2QT1A 3EPKA 3NVAA 2HXYA 2OFXA 1AZTA 1MR3F 2C99A 2JGNA 3CONA 1Q1ZA 4CEHA 4LC1A 3TAUA 3VMFA 4D81A 4R98A 2HYDA 4LJ9A 3SQWA 2ZR7A 1YHNA 2IA5A 3PUYA 1Z8FA 1DVRA 2P3SA 4JS0A 1NVVQ 1KY3A 4EPVA 5KNCA 1IY0A 3VQTA 4YXWD 3FB4A 2F1RA 5FTLA 2ZSAA 4V0NA 1CRQA 1VG0B 1XCPA 3EZ9A 3W6NA 2F3TA 3FVQA 2JCSA 1GKYA 1SVSA 4HLUC 4TYWA 2V3CC 4MRPA 4DXAA 3FOZA 1HURA 2OBNA 4ERNA 1EX7A 4EQ6B 1P2TA 4IDOA 2V55B 2ODNA 3DMDA 4AWXA 1ZUNB 2ZTSA 3L43A 3TMKA 1XMSA 1S1CA 3WY9A 5HCNA 3ZH9B 4CEJB 2WVJA 3BERA 3VU9A 2P6UA 3ASYA 3BJIC 3MRSA 2XOKD 4D4LA 4MH0R 1TTTA 2QTHA 3ZIAD 3OESA 2O8CA 1TX4B 2R44A 1GVNB 3JVVA 4BFSA 3OHMA 1ZCBA 1P72A 1LS6A 2VTKA 4DIDA 3EZ2A 3K9NA 3ZLJA 3MD0A 3RS0A 3HU1A 1X8JA 4ABYA 4P4SB 5CK5A 3IBYA 3PEWA 1W46A 3FHOA 4BFYA 2IHBA 1ZUIA 5E7MA 4F4JA 1UEIA 3ASZA 4C0KA 5FL3A 2REXB 5TDHA 4LBWA 1NG9A 1AGRA 1D2MA 4PC6A 2WZQA 4B3FX 1F6BA 3NTUA 4PC1A 3BE4A 2ZI6A 4AKGA 3RC3A 1RKBA 2CCKA 1G17A 2BM1A 2H17A 4IOKA 1OHHD 4GI7A 4PC7A 2WMOB 3LW8A 3VX3A 3I5YA 1XPRA 3ZD6A 3L0PA 2CLSA 4RSGA 1MO4A 1GM5A 3KQUA 4KCGA 2JLVA 2LWIA 2DWPA 1NVWQ 4MKGA 4Q1DA 4EPTA 1E0SA 2R6AA 2G9NA 2BV3A 5KNBA 1U0HC 1E32A 3D31A 1HA3A 4NCKA 1F5NA 2OAP1 4CEIA 1FTSA 1L4YA 1E9CA 1X86B 4WW0A 1GILA 1R7RA 2ZSBA 3QENA 4Z8XA 1NMXA 1ZINA 1UBGA 2JDID 1FPMA 2OCBA 3GEIA 4TTPA 1P9NA 4XSHA 1E9DA 2WV9A 1ZD9A 2PT7A 5JHHB 2BMEA 2NO9A 5DSZA 2N1BA 1F2TB 4GOKA 4B33A 4JBWA 4XVQA 5LB2A 4QKQA 1KI6B 5AUQA 3BGWA 1TADA 2KI5A 3Q7QA 3GFOA 4Q9JA 2OCPA 4PANA 2BJWA 2VBCA 3MJHA 4HEJA 2CL0X 2ODBA 4TL6A 1CRPA 4OQMA 2KBEA 2YC4C 4C0JA 1FL9A 4PXAA 2ZI7A 1PUJA 2IYRA 1N6RA 4DLWA 3TGPA 1W1WA 2NO0A 2FF7A 3AKDA 1G16A 4D26A 1ELOA 2QAJA 3OF5A 2EFDB 4C0LA 4OI0A 2FEMA 5JECA 1J70A 1Z22A 5J47A 2ZS9A 4P3YA 3GLGA 5KNDA 2OZEA 3KB1A 3K8YA 4LC0A 3EZ6A 3C15C 4AY2A 1N0VC 2DFKB 3HDTA 2ZYVX 1M74A 4QOSA 4RZ3A 4NONA 4L16A 3ONWA 4LI0A 3DL0A 1P2SA 3QBVA 2ONJA 1E99A 1OB2A 2ZRPA 4JL6A 4ZDIA 4TSFD 2DBYA 2G1KA 1VDZA 5HTKA 3VKHA 1IN8A 4DDVA 5AUNB 2J0QA 2BMJA 3UIEA 2IEYA 4B74A 3C41J 5JWHA 5L3SB 5C18A 1TQ4A 4D0NA 4KBFA 2RHDA 5KTYA 3ZQJA 3NEYA 1CULC 5DHFA 3QIAA 4M1MA 4BFWA 4PAMA 1EWRA 1DARA 2ZYUX 1EGAA 2CCGA 5G40A 2J46A 5DH9A 2VHTA 3TR5A 3LXXA 4MUBA 1W36C 2PCLA 2P65A 1VG1A 1GL9B 4GDFA 4N0EA 1U94A 3IGFA 4M22A 2CNWD 3PEUA 4OQLA 4A0FA 3C7KA 2OCAA 4LSGA 2H92A 2BEKA 3LY5A 1RVDA 4X8MA 5KDDA 1XXHA 2ZRKA 4K81B 4A8JA 1Q20A 4RFSB 4D2IA 2E1RA 1KI9A 3GJ0A 4P4UA 2QU8A 5EE9A 3V4RA 4HLCA 2B8WA 4IW3B 2BBTA 4Q9KA 4A2QA 4LV8B 4B71A 2ANCA 2ZRLA 3IHWA 1Q12A 5AJWA 2O8BB 2ZJBA 4DUGD 3LLUA 2RGNC 5ANRB 3CWZA 4IHQA 2R6FA 3GLHA 4XTRA 4A4DA 1EFRD 4TLEA 4W5WA 1LY1A 5JJIA 3SBEA 821PA 4MYTA 2QL6A 3RS7A 1G8YA 4MQBA 1JR3D 4OBEA 2OEPA 1HEIA 1G8FA 1SZPA 1Z06A 1GRQA 2Q9BA 3LBNA 3OAAD 4M53A 4B34A 5JMTA 3WBJA 3LVQE 4XVUA 5BXQC 1U0JA 2PEYA 4Q02A 3WYFA 1G3MA 1KI8A 1UFQA 3KKQA 4BLSA 5F9HA 4JLOA 3DZDA 5A4JA 5L3RA 1W36D 3D7MA 1JBKA 1D8TA 3U60B 1CTQA 3CBQA 4AKIA 2B8TA 1AM4D 1QHHA 4Y0AA 1NJFA 1S9HA 3NDPA 1W7AA 1IJFA 1XDBA 4X8LA 3TUJC 4PQFA 2J7KA 2N42A 1XTRA 2XZOA 5FUVA 1KNXA 1SVKA 4QJ4A 4LHVA 4M1YA 3DOEA 5HE9A 2W2TA 3GJ6A 5HZHA 1E96A 2ZITA 4OHWA 3RS3A 1MOZA 5AUOB 3P4XA 3QKRB 4B6FA 3SHWA 4Q18A 2JLWA 1KYIA 3WP0A 2MMCA 3EC1A 3SN6A 1XJ0A 5EXPA 1Z0KA 1CP2A 5FBVB 5F9FA 4B3BA 4ZDWA 2WM9B 3WHKA 2G77B 3A1WA 3PV0A 3CO5A 4A15A 5JS8A 1E2PA 1R2QA 2ZM5A 2P67A 2W6IA 3GFPA 2J0VA 3D8BA 3X1DA 2ZJOA 5HCIA 3EIQA 3GLGE 1Z63A 4IRUB 1F3OA 3EPJA 5GJBA 4E5UA 4JBYA 1M7GA 1IXZA 1WRBA 4P33A 3A1SA 1EX6A 1T6NA 4P32A 4TMVA 4PQYA 3LBIA 1N5JA 3CR8A 3IKJA 5FOTA 1JXOA 3DM5A 1JR6A 1VYUA 2Z0MA 2XJ4A 3VR4A 1XZPA 3VFDA 2OV2A 1X3SA 1RE0A 4AG5A 2CJWB 5H8WA 1IY1A 1CJMA 1E2FA 2QGZA 3QKSB 3FWYA 4AIIA 2FGKA 1D2EA 3AGPA 3OIVA 2KBFA 2W0MA 3RABA 4KI0A 5FI0B 3Q9LA 3BFKA 2PBRA 3FKSD 2D4HA 1M6NA 2I4IA 4JLMA 4G5RA 2MSEB 1R8QA 1ZC4A 2GESA 1GAJA 1XD2B 1P9WA 3R7WB 5H68A 1XTIA 2QPAA 4DLXA 4EPYA 2JLRA 2VSOA 2V54A 4ZO4A 1NBMA 4AKEA 1W44A 5JSZB 2WPDD 4OK6A 3MLEA 1QG2A 5EJEA 2KWIA 3ADDA 2H16A 1T5IA 1T0HB 1N25A 1Q21A 3X1WA 4DKXA 4ACBA 3Q85A 1T0JB 2V4ZA 3BB3A 3LDAA 3EZFA 1YR7A 3EXAA 4NCHA 3QEOA 5TB5A 2ODWA 5IF9A 4LGMA 4HDQB 1RRPA 2ZJ2A 1HV8A 1G1MA 5J4YA 1AJEA 2XB4A 2J7PA 3A8TA 4F4CA 2GEVA 4LRWA 2GJ8A 3FGNA 2ZE8A 3S1AB 3CB4A 4QBIA 4MYCA 4QXAA 1VCIA 2WMNB 4M21A 5AWFC 3GLFA 1AKYA 3BH0A 3GLHE 4DSTA 3FMFA 5KSYA 1AQYA 3AB3A 1OXVA 1P61B 3ND9A 1AN0A 1S1MA 3WMEA 1U81A 1E2HA 1G4AE 1E1RA 4OJQA 421PA 5EUMA 4EFLA 2PLRA 2QE7A 1K5DA 3BORA 4LJ5A 5IDVA 2F55A 2VL7A 1OH7A 1T3LA 1N6LA 3IO5A 2A5JA 1TEXA 2GJAA 1KSGA 1P6XA 4D0GA 4EJSA 3KJHA 2XXAA 4TLCA 2OAQ1 1N5KA 2QN6A 3PUXA 4XWAA 2F1HA 2IYUA 1L2TA 1O3YA 4CIDA 1KK1A 4YC7A 2J87A 2QMEA 2ZRCA 4Q21A 4A2WA 4CEHB 3IPXA 4JSYA 4HDCA 4LV5B 3EW9A 1ZNWA 5CLLA 4FD2A 2QTFA 4B6EA 1TU3A 2BVNA 4NZYA 4NYJR 1YE8A 2F1IA 2GZAA 2I1QA 1N6OA 3EARA 221PA 1AKEA 1N3BA 4FMCB 4JLPA 4BLOA 2B92A 3L82B 2JLXA 3BBPA 3ETLA 1U8ZA 5TMPA 1OW3B 4QHYA 3EX7C 3RWOA 1H8ED 4N0DA 1Q1EA 5IK2A 1Z29A 1H8HD 1G3RA 1Z6XA 1Z0AA 1BOFA 3EAQA 4MRSA 5FOXA 1G18A 5EQTA 3IHLA 1S96A 2EW1A 1N6KA 2BBWA 3BXZA 1KO8A 3QE0A 1ANKA 1TQ2A 4LPSA 4ZIRB 1WBBA 1SVLA 3VU9B 3O8BA 2Q3MA 1TUIA 4MKIA 3QPWA 2WSSA 3RSOA 3SZRA 4PQRA 1FNMA 3R9IA 2O8CB 5BQ5A 2W2VA 1Q44A 3TW8B 3PUVA 5AJZA 2NZJA 3P20A 1KAOA 1NSFA 3IPYA 1EXMA 3FKQA 2JATA 1F60A 1KK0A 1IXSB 1NP6A 4LYJA 1W5SA 1TF5A 4F93B 5JBQA 4KFUA 4TQUS 4ILEA 1KSHA 3B60A 5DNYB 1JAIA 4NMMA 2JLSA 3U44A 1CKEA 1GOTA 2PJZA 1EFUA 2FWRA 4LHYA 3AV0B 4YLGA 2NMVA 2EYQA 1LTQA 3BOSA 2IXFA 4M9SA 4KV9A 5FTNA 2H57A 1H65A 1RPZA 3CNLA 5EE1A 2GXAA 3EPHA 1RRGA 1II9A 2FPKA 2PCJA 2AKYA 4X8HA 3TBKA 1Q3HA 1KK3A 1Z3IX 3G5UA 1OFUX 3OIYA 4LY6A 4M9QA 2VP2A 5DI3B 2F9LA 1PLJA 2VP4A 3N5CA 4QNRA 2ZROA 2AWOA 1KDRA 3HJNA 5EP2A 4EPXA 3I61A 1T5LA 4HDOB 3CWQA 2XSZD 1LVGA 2XNDD 2QTVB 3RRZA 3A36A 4XIGS 1G21E 1OKKD 3KTAA 4AYWA 4M4SA 4Q4HA 5FI1B 4A0GA 4GSYA 2ZQ5A 4Q1FA 1DBSA 1P7CA 4LJAA 2W83A 3H86A 1JQJC 2ZRDA 3FDIA 3GLFE 1RYFA 2P6RA 3OEHA 5FBWB 1CU1A 3B1VA 1L8QA 2CE2X 2YINC 3U3RA 4Q66C 2XZPA 2BEJA 2OSBA 2ERYA 3B13B 3I72A 5JCPA 2FGJA 4JT4A 2ZETA 3E5HA 1CR0A 4U02A 2J59A 2ZS7A 3DMNA 1E9EA 4US0R 4V03A 5FPYA 4JLAA 1U98A 2DYKA 2REOA 1DAMA 3UWOA 3AKCA 3U7EB 3CNOA 3VX4A 4F92B 2GAAA 1G7RA 2BWJA 4QM7A 3CRQA 3K9HA 2RGBA 3CM0A 1BKDR 1LB1B 4OI1A 3GLGB 3AVYA 2CXXA 4WXPA 6Q21A 1YVDA 1XTJA 3I3SR 2FFBA 4RD0A 4KXFB 3MWJA 4YDSA 1HE8B 3TK1A 1HYQA 2JLYA 3DZ8A 3VTKA 2LKDA 2FSGA 4C9BA 4PPNA 2IS6A 1NY5A 4GFDA 4OKSA 4DVGA 2WWWA 1SGWA 2ZU6A 3AF0A 4IXNA 4US1R 1SXJC 2HJVA 4GMXA 3B2EA 4LJYA 3SYKA 4HAVA 3B82A 4JSTA 1Z0FA 1ZNXA 1KMHA 2CHGA 4EUNA 1KSJA 2VO1A 4NYJQ 1NI3A 1HQCA 3T1QA 1MABA 4CT4B 1JEEA 2LKCA 3VR2A 4MRNA 1TF7A 1W0JD 5E7IA 4L9WA 5KSOA 2WHXA 1YKSA 2C04A 2GILA 2V9PA 3VR3A 4ARZA 1NVUQ 2HXSA 5G53C 1ZD8A 1Z0IA 1A2KC 1G3IA 2FPMA 2GBLA 2PH1A 1QRAA 1XNJA 4BE7B 3WBKA 4PPGA 4GZLA 4TL8A 1XXHB 2OO7A 4U00A 1U2RA 4A8JB 3T61A 2YKGA 3P27A 4D6PA 4LJ4A 3QKUA 4TWZA 521PA 4GL2A 4HB0A 2W6JD 2VF8A 1VECA 2CVFA 2XITA 3DO6A 5FTKA 4QRHA 4DIEA 4BFTA 1CLUA 1UKEA 3LV8A 1RJ9A 2KSQA 1C9KA 4HZUB 4S2EA 1ZAKA 4B76A 1GNRA 4ZI3A 2BBSA 1NLYA 1SXJD 4EFMA 3GLHB 4V02A 1OXXK 3QOFA 3KUCA 4LOAA 3UG6A 3ZD7A 2PX3A 3I8SA 3CX7A 2QI9C 3OEEA 3NWJA 4AYXA 1N6IA 1WDTA 2GAOA 2GXQA 2N46A 3I4LA 3LA6A 4G0NA 4MKHA 4UXHA 4V0LA 3K0SA 3K9LA 1FQKA 2J3EA 2WSMA 2ZI5A 2PX0A 3WNDA 1DG1G 4DJTA 2RH5A 3U4QA 4NTZA 4EDHA 3QEJA 3K09C 4QC2A 4OQNA 1GIAA 4ZDJA 4Q9LA 4JZKA 4D4JA 1QHHB 4TMZA 3TSZA 3QVVA 1E9SA 2CEAA 5KUTA 2X2FA 3THWA 2E9SA 2X2EA 3TSOA 1KI3A 4OK3A 4Q9IA 3R9XA 2FG5A 3LAWA 4A2PA 1GRNA 5FH9A 4HLQB 1B0UA 2IL1A 2ATXA 4NYIR 1Z0DA 3T1OA 4A0RA 2C03A 1XX6A 4AC9A 1J8YF 1ZYUA 3U5ZB 3Q5DA 2C9YA 2JLQA 1XPOA 1W5TA 2V7QA 2WWIA 1YQTA 5FBRB 1IN4A 2VYFA 4RZXA 4LPKA 2GXUA 4GPTA 4Q1BA 2HCBA 1Z0JA 1E2NA 2ZRHA 2R6CA 3FFBA 2GEDA 3UATA 2W00A 4H9GA 2W2XA 2QAGA 1Z28A 2BHRA 3AP2A 4GMDA 1N0UA 2GWHA 3QY0A 4TYQA 5CK4A 3OFNA 5EE5B 4Z51A 3FHTA 1MH1A 3THOA 4QJ5A 1P4SA 1SULA 4G3XA 4N1AA 4PAOA 3W8RA 4PSAA 3X2SA 1QHXA 3HR8A 3MAAC 3V9PA 3C14C 5DYGA 4BWYA 1Q1QA 1IN5A 1PZNA 2WWGA 3IIJA 1KO7A 1HH4A 3KB2A 4NP6A 3PEVA 5JZVA 2QM7A 5KPJA 5P21A 1XB2A 2QA5A 4N3NA 1KO5A 1RYHA 2F43A 3QXSA 3EG5A 4BFUA 2WWYA 5J4KA 3QI2A 5CYPA 1ZVQA 4UKDA 1LV7A 4HB2A 1OT3A 4E03A 2IF2A 1C4OA 2ZJZA 1XTQA 1G3UA 4LZZA 2AK3A 2F6RA 1ZM4A 4HLDA 1VYVA 1XPUA 2IS1A 1VG9B 2OE2A 2WIAA 4C0SA 2QSYA 1XEWY 4TYPA 4PHFA 3T06B 1GG2A 1GZSA 2GZDA 5KO2A 1GUAA 2QSZA 3A1TA 3F3YA 2RAPA 4D82A 1G8GA 1G5RA 2DWQA 4ZCMA 4Z1MA 4ESHA 2NZ8A 1ESMA 3VR1A 1UADA 2FV8A 4B3XA 2GK6A 2ZEJA 1HE1C 2YWFA 3UKDA 2VLIA 2RKOA 4LCBA 1V5WA 5FL7A 1Y3AA 2MMGA 1EFHA 5FBLB 5JI3E 1XD8A 2R6GA 2J41A 3GLFB 5DGXA 1TPZA 5J4LA 2V6IA 4AI6A 3I8XA 4ZKDA 2ZRJA 2GCPA 3SYNA 1OIVA 1JECA 3SU8A 5D3QA 3G0HA 4DLZA 1YR9A 4RZ2A 1J8MF 4ZCIA 4GT1A 3BFVA 3C8UA 1NN1A 4KFRA 3GD7A 4OI4A 5CLQA 1EESA 1X1RA 2C77A 4ON9A 2WKPA 2GF9A 4Q7LA 3CPHA 4EJSB 1AIPA 2XXAB 4LDJA 4US2R 1KI2A 2IYXA 2HEIA 1BMFA 2QG6A 1PV4A 3O8DA 5CM9C 1KSFX 3M6AA 1UBEA 3WRXC 3I92A 2VP6A 1A82A 3H1TA 1ZW6A 3SJZA 4XWKA 4IEIA 4A6PA 5DO9A 1E2LA 3D6TB 4RKEA 3TLXA 8OHMA 2ZIAA 1QVAA 4WBSA 4GNKA 1KGDA 5JRJA 4CRWB 1KDPA 4F38A 1ZM3A 1E2EA 1RFLA 3CZPA 4PX9A 1II0A 3K0CC 2QUZA 3K53A 1DTSA 2CCJA 4DCUA 1BO6A 1W2HA 5CJPA 3K70B 3GJ5A 1AGPA 2OILA 2VP0A 3V4FA 5BN5A 4GZMA 2JAQA 5TVKA 2WWFA 1F48A 1ZP6A 1XEXA 4NYIQ 2JLUA 3HYRA 5KSZA 1U99A 1QBKC 1OSNA 2YWHA 1I2DA 4OL0A 1W48A 2DFTA 2ZU0C 3QVUA 4HI0E 3SBDA 1IXRC 5HPYB 2B21A 4DSUA 3A1UA 3HWSA 5C1BA 2CE7A 3UMSA 4WVFA 4BQSA 4JYCA 5FTJA 3U3MA 1Z83A 2GZHA 5B57C 1HY3A 1G64A 3RAPR 3GMTA 3NBFA 2OXRA 4TTQA 5LBIA 4BLQA 1D5CA 1IN6A 2YOHA 2CHVA 3QF4A 3UPUA 3PG5A 4TT3A 2WJHA 1D6JA 2ZSFA 2JIZD 3X1ZA 1XMIA 3U44B 2XJ9A 4PC2A 4B32A 2NO6A 2WTUA 2P0EA 4DDUA 1U8AA 4A0HA 4DDWA 5BN3A 4BLRA 3KQHA 1YZLA 2XGJA 2NGRA 2TMKA 3RLFA 2ZVPX 3Q5EA 1UEJA 2ZUDA 3CX6A 3FYHA 5TV2A 3U7FB 1QHGA 1I4LD 4HZIA 2HUPA 4BZXA 1SVWA 3KZ1E 2QORA 1D9ZA 3TUZC 1E2MA 1R0YA 3WYGA 2SHKA 1XD9A 3KXLA 1MO5A 1EK0A 2IXEA 1P5ZB 1RIFA 5BYKA 1E9RA 4I1SA 5DN6D 1DAIA 2J0UA 2FEOA 4MA4A 4NDZA 2ORWA 3VKWA 1T3HA 2UZ3A 5E95A 3VAAA 4QG7A 4AURA 5KYKA 1CR1A 2E87A 1FX0B 4KYUA 5CM8B 3LNCA 3T35A 3TNFA 5B58C 1DO0A 4PHTA 4E22A 4KVAA 4L5BA 2XNSA 4AD8A 3RHFA 1BYUA 5BWMA 4L15A 1YZNA 4KU4A 2VSFA 3TSWA 3KTAB 3PUWA 3N2IA 4ZPXA 2IWHA 3ZDQA 4Q4HB 4FINA 4URVR 4KFTA 3PIRA 3N2EA 2Q0HA 3AVPA 3MWLA 4C2TA 4JLKA 5KU1A 3AH8A 4GOXA 2OBLA 1TQ6A 1EFCA 3BB1A 2VEDA 4Q1AA 4NCJA 3TVDA 3T15A 3CRMA 4DCSA 4H1UA 3VR6A 4PO8A 3LRPA 1Z5ZA 1Q1BA 4YXWA 3ZS8A 4ACAA 4XJXA 2QGNA 4GBMA 4F4IA 1XMVA 1G7CA 5EUQB 4R71A 3LW7A 3KXIA 4DLRA 1AZSC 3AEZA 4HUQA 1VIAA 3ECCA 4JL8A 1E0JA 2VQSA 1KJYA 3NBZC 4C0QC 2BIFA 3MCAA 2YWEA 5EXTA 5E3HA 1A4RA 4PPQA 4NU0A 4IOMA 4M1KA 3J81k 2XOKA 2ATVA 1VMAA 1ZUHA 1QDEA 3AF1A 1K5GA 3ZIAA 3B1ZA 2PJRA 3ICQB 2NQ2C 2O0KA 3HPQA 3BC1A 3AVWA 2RGEA 4MYHA 4A9AA 2IEZA 3PFIA 1NG1A 3THYA 1JQLB 1E69A 1W0KD 1WBDA 4LYHA 4PZYA 1KMHB 3AVQA 1IJEA 3ZZTA 1F2UA 1OFHA 1GNQA 1XCGB 3W3AA 2CHQA 4B73A 2GJSA 1MABB 1DO2A 1Q22A 5J4HA 1CJTC 3C5CA 1E9FA 3HYTA 1OHHA 4MGYR 4O0MA 4ARZB 3ZVNA 2YJTD 3OE7D 4HLUA 3KJEA 4OJKA 4MDEA 1KK2A 1XTSA 1NKSA 2EFHB 2Q3HA 2ZI3A 3CPEA 5KPDA 1NIPA 4UJ3A 1NIJA 1GWNA 2HV8A 3KX2A 5FPHA 3NH9A 4XD7D 2P2LA 1XTKA 4Q4JA 3RC8A 4MGIR 4A1FA 3BB4A 3KKNA 4PPFA 2WWHA 1GRRA 2OFOA 2GVZC 2JDIA 2IYZA 3ZJYA 5FR1A 3QG5A 4R9UC 2PLFA 1RJ9B 2YWGA 5IRCD 2IBMA 2RHMA 5E4FA 4JJZA 4B48A 2VHUA 1QHNA 3WMFA 5TARA 5K8LA 4DT1B 1XCMA 1Z08A 4CDGA 1NY6A 3QKTA 3GJ8A 4POAA 2OG2A 3GLIA 5FUWA 1I4TD 4HAZA 1M8PA 2D06A 2ZRMA 4I4LA 4EQ6A 1QF9A 3U4QB 1S2MA 2O8DA 5H1YA 5GVRA 4HB3A 4BRWA 2WJIA 4PFSA 1OPXA 1E1QD 1KI4A 2QP3A 1YR8A 1YZTA 2J1LA 1E79D 2WKRA 3M0EA 4PZLA 2OUKA 4DLTA 2DB3A 2EWVA 2WAYA 3LLMA 3THWB 5EP4A 5EZ6B 4IFBA 4Q00A 2IC5A 4MITA 4MGZR 5DHAA 2IHYA 1G5TA 3ZVLA 4ASUD 4LV6A 4TTRA 2A5FA 1W47A 4P4SA 2P5SA 4IDQA 1OFIA 1P75A 2HLDD 2X19A 5AJVB 5K8UA 3QF7A 1FNNA 4BRUA 5SZHB 2FZLA 1NN5A 4TSFA 1UDXA 4JVNA 1U9IC 2MSCB 3EASA 4IKEA 5G41A 3UG7A 1NMZA 4NE2A 2K5UA 2BCJQ 2VPPA 3I32A 1J99A 4TZ6A 3Q8XB 1YU9A 4D4KA 5M04A 1FUUA 2QAGB 4XWOA 3EWAA 1WCV1 2JJ2D 3A4NA 3QBTA 4DB2A 1AK2A 2PZGA 1E9AA 1SKQA 4JMPA 4K8OA 4BFXA 4L8GA 2UKDA 2G88A 1Q0UA 2CNWA 5JI2E 4ZI2A 3EIHA 4OI2A 2ZJ5A 1DAGA 2NG1A 5HKKD 3TQCA 2GTPA 2CL7X 3QXCA 4URZR 5CB6A 2UVQA 2DR3A 2F43B 3SOPA 4LHZA 1U8YA 2EWWA 1SKYE 4G1UC 1E2JA 4HAXA 4NCIA 1LF0A 4QFMA 3EIEA 4BLPA 1E0KA 1M7BA 1IM2A 1UDWA 4RVCA 4YQFA 4B3CA 4DUGA 4Q19A 4MYUA 1SQ5A 1JNYA 1KMQA 2ONKA 4LYAA 1ZIOA 5D3MA 1COWD 1EFRA 2AWNA 2B6HA 2I1VB 4BECA 4UXIA 1JR3A 1US8A 3ZQ6A 4ZCLA 2C78A 2EVWX 3UK6A 1DAHA 2QMUA 3OAAA 4LWZA 2VRWA 4URWR 2QBYA 2VA8A 3SQXA 3PENA 3GJ3A 3AUXA 3H0KA 3T1TA 1WXQA 2RMKA 4QGGA 4FW9A 2EU8A 4JYBA 1GNPA 1QHSA 4V0OA 1XF9A 4TL7A 2KB0A 2RGAA 1VKJA 2OXCA 1KZGB 2IYLD 2QQ0A 3IUYA 4M8NE 4BFZA 2H18A 1E2KA 2OESA 1E4YA 1E4VA 2FZ4A 3TQFA 2IUTA 1Z6TA 5JEEA 2YOFA 4JIMA 3GLIE 2VHJA 5B30A 2F3RA 4DSOA 4CW7A 2YV5A 2ZUCA 3FMPB 4JKIA 1MRNA 2QPTA 4TLDA 4OK5A 2RGNA 3IQWA 5JHGB 3IDQA 5CYOA 2CMKA 4ITRC 1E2QA 1YRBA 4IDNA 2AXNA 2W0SA 3D3QA 2OLKA 4BASA 4A92A 4YMUA 4L9SA 2EYUA 3QJYA 1D9XA 4AG6A 4OHXA 2IUUA 4DLUA 3RWMB 4TYNA 3CPJB 3QPVA 5A0FA 5L3QA 3CIOA 2Y8EA 3NBXX 2GF0A 3MUFA 2QENA 3TVTA 2R62A 4UJ5A 1NJGA 1RZ3A 4Q48A 5J4VA 2D62A 1A7JA 3B9QA 4C0HA 4EKDA 1II8A 3IILA 4JLVA 4M1OA 4Q47A 4RD4A 1KDTA 4WZAE 2O8BA 1SVOA 2O0JA 3LO5A 3FKSA 1ZD1A 2D7DA 1DE0A 2V8OA 4KSBA 3M1IA 1NKTA 2ZRFA 1QG4A 5G3YA 4LUCA 3C16C 1OXSC 3SC3A 2WPDA 4MUAA 3NG1A 3K0EA 3LD9A 2GNOA 3VR5A 3B7GA 3FPAA 1ZM2A 3KDSE 2H7VA 4QHTA 2QPOA 3PITA 4XOIA 2BC9A 3AKYA 2CVHA 3QF4B 4Q01A 4RZUA 2OHFA 1LFDB 1P2VA 2R8RA 3MMPA 4I99A 2CK3D 4KLZA 2W58A 3WNCA 4C0BA 2F7SA 5FUYA 4IVRA 4URXR 2NTYC 4UNSA 4CYMA 2Z4RA 4W9MC 3TAHA 3AVOA 1W4BA 3KQKA 2WJJA 3AM1A 5LD2B 3O47A 3K0AA 3REFA 1EFTA 2PEZA 4KVGA 2ZJ8A 5SZIA 5CJ2A 4RCYA 5FTMA 3ZZ0A 4EPRA 1E6CA 2RB4A 2A5DA 1FW6A 1OIXA 2J0UB 1S9DA 2P6NA 3DOFA 4PZZA 1JR3E 1VTKA 4P4TA 3ZVRA 2OM2A 2B7BA 2A2ZA 4CEIB 2QBYB 2GEUA 4KYIB 1GKIA 2OT3B 4IOLA 2ZRAA 3CW2A 3P4YA 121PA 4V0KA 4JLBA 5K8IA 3ZS9A 3THXA 3PEYA 1Y63A 3B1XA 1B23P 3E2IA 5EE0A 3W5JA 4B47A 2RGGA 3DHWC 1NLFA 1RRFA 2GCOA 4V0MA 4DB4A 3U3KA 1ZM7A 4B3DA 2O8EA 1X6VA 2UZIR 2C95A 4YONB 2FFAA 1C1YA 1XU4A 2DFNA 3SJBA 4C0AC 3QKSA 1GP2A 1MT0A 2ORIA 3UXMA 1MV5A 3A1VA 2FE4A 1VHTA 1FZQA 2R2AA 1H8EA 4HUQB 1S8FA 1J90A 3QXHA 4JVLA 1H8HA 1WMSA 4M0LA 1WE2A 3T34A 4Q4AA 5UKDA 4OHZA 5CB8A 3VNVA 4A8JC 1P60A 4A36A 4P31A 3PCRB 1BYIA 2FJUA 1KAGA 4G5OA 1RRCA 2AD1A 5AJYA 5FOVA 3RDPA 1VYTA 2YVUA 1NSTA 4BLTA 3GJ4A 2NOAA 4FMDB 2ZRGA 3DDCA 3WYAA 1Z2CA 2HF8A 5HZKA 4Z54A 4CGZA 2IK8A 2JJ1D 2HDNB 2C98A 1IQPA 1TU4A 1XRJA 1T3SA 3B78A 3THYB 1UPTA 3AVTA 1P62B 4JLJA 4CF7A 4LYFA 3ZZUA 1UF9A 2EQBA 3I73A 4ZDKA 1XJCA 5C46F 4URUR 4URYR 1A2BA 4LBYA 4UNQA 3KKPA 4R7ZA 2HCJB 4HB4A 2IYYA 4DC9A 2L0XA 2R65A 4B2IA 2WIBA 2RCNA 1GSIA 2EFEB 4PTLA 4RFVA 2YC2C 5EE3A 4JJKA 5GJCA 1FFHA 1YZKA 2O0HA 1BIFA 3NC0C 4BZPA 4II7A 2CBZA 3IIKA 1M1YE 2ZE7A 2OCYC 3EC2A 3MWYW 4GP6A 4O25A 1QHYA 1ESNA 3FMIA 5KOYA 2V1UA 4LJ8A 5KHOC 1R4AA 2R9VA 4O2RA 1SHKA 2GCNA 3SNHA 1P3JA 3E70C 3Q7PA 3C4JA 5BW8A 1LS1A 1MO3A 1ZU4A 3PVSA 4Q4JB 1CF4A 3H4MA 2XSZA 2XNDA 2IXGA 2AL7A 1UBFA 2QNRA 3GEHA 3I62A 1CS4C 1OKKA 3CH5A 2Q6TA 2QMHA 5JCZA 3O8CA 1ONBA 2Z6VA 1Q3TA 2D2EA 1PJRA 2HF9A 1FQJA 4KODA 4TN1A 1UJ2A 5DE3A 3QSYA 1Z6AA 1CR2A 1AS0A 1FOEB 2ZR0A 3MSXA 4DRZA 3KKMA 4LX0A 4QBHA 4LJ7A 4FMBB 3TIFA 5JWRA 3U61B 1KKMA 3TRFA 2BMDA 5FPTA 3ADBA 3GLIB 1ZMXA 5CITA 3BH6A 1OFTA 2QP9X 2RGXA 4XSGA 2ZANA 5F98A 2O8DB 1Z6YA 2X77A 3NKVA 4ZKEA 3AP1A 2NPFA 2PMKA 1PLLA 3U3OA 1LF5A 1S3GA 4ZIRA 2GDJA 3PUZA 5JLJA 3EPLA 3Q72A 1NLZA 1T9HA 5LB4A 2YYZA 4NPHA 2XTMA 1DPFA 1CBUA 4V0ME 2DHRA 5CIWA 3WHLA 4PHHA 5HR5A 4KLNA 1NMYA 1BS1A 3A58B 1Z07A 2Z5FA 5JJKA 3ZYCA 2WAXA 4GP7A 1KJWA 3T5DA 4A82A 4WXRA 4HUTA 4U7DA 3B8HA 1NN0A 3CRW1 2B7CA 2CK3A 3P26A 2W6ID 2GVDC 4F7WA 3W5IA 4M2LA 1KIMA 1OE0A 3LQRA 4W7SA 5IT5A 2AX4A 2DFLA 4RKFA 2A30A 3T1VA 1CJUC 1W0JA 3AKEA 4UNRA 3NEJA 1EWQA 3ADKA 1KHTA 3K0FA 5DI3A 3WRYC 4NCNA 3AVUA 2O8FA 3G82C 2FFQA 4G5GA 4WZBE 4A6XA 3CF2A 4FXPA 4UQOA 1E98A 1T8TA 2GHIA 1A1VA 1JB1A 5GJWC 3CF6R 4Q7KA 4PO9A 3KJIA 5L8VA 4DHEA 3F8TA 2RGCA 4DCNA 4JLDA 4TQ9A 2VHQA 1VCOA 3GPLA 3TJZA 4TMKA 2W6JA 2YZ2A 2IT1A 3SFVA 2XZLA 4EJSC 5A5GA 4ZV4A 2D7CA 1ETUA 2GJKA 2GJ9A 1XP8A 1VHLA 3IIMA 2Q3FA 1DAKA 5J5CA 1JPJA 1YR6A 3KL4A 3A4LA 1NBMD 1E0AA 4QM6A 1CR4A 2QMOA 4JBXA 1SXJA 2DY1A 3HP1A 1JJVA 5D3MB 3AGQA 3QG1A 4FIDA 4UNNA 5J40A 4QJ3A 3W8NA 2PT5A 2ZJYA 1KKLA 4I81A 4PSVA 1MKYA 4B2LA 3AVVA 1US8B 2BJVA 2HYIC 5B2ZA 3QQ5A 4IFEA 2FSIA 2IX3A 4OHYA 2IYQA 4B35A 4DLSA 1AA9A 2Q9CA 3HPRA 2ZE6A 3H2YA 1N6HA 2J7PD 3BFXA 1IOZA 5FR2A 4Q4LA 2X8AA 3BWDD 3KUDA 3K70C 2O5VA 5ELXA 1W36B 5LPNA 3EZ7A 2BMFA 4Q7MB 3VHXA 2VIIA 4QL3A 2GETA 4OHVA 1G3QA 4KFSA 1DS6A 1CXZA 1E1RD 1NN3A 2D3WA 5KDOA 1IBRA 1R0WA 2QE7D 1FP7A 1OF1A 4RD3A 2JJ1A 3V00A 3KJGA 1VCNA 4X8OA 1E9BA 1X8KA 721PA 1JI0A 2BBOA 1G6HA 3SR0A 2EFCB 2FMXA 3TKLA 2WJGA 4IVPA 1OYYA 3WNBA 3SI7A 5FOUA 2WOOA 3L0SA 1OYWA 3FE2A 4Q03A 5GJVC 1KI7A 5JFGA 4Q1CA 3Q3JB 2QZ4A 3GEEA 2LCFA 3QXJA 4DCVA 4P0TA 2WJYA 5BYJA 1K6MA 1T8UA 1TNDA 4PC3A 5C4GB 2FDCA 5IHPA 2ZXUA 4KITB 4W5HA 4LBVA 3W90A 3LBHA 2OBMA 1G9XA 1V43A 5L3QB 5L3VA 3KFXA 3CKLA 5GVSA 1K8RA 4RD6A 4RY2A 3HU3A 4FI3C 3B5JA 3BIFA 4FCWA 5IK2D 5EP3A 2AD5A 2ZR9A 3K09A 3W6PA 4HAUA 3K70D 3R8FA 3JZMA 4QNMA 2A78A 3F5FA 2GK7A 4HSEA 3DPUA 4R2HA 3WXMA 4EPWA 1II8B 1DG3A 2VSXA 2XB2A 4FCVA 4HZUA 4JL5A 1XWIA 3I1FA 4BPBA 4QGFA 1MO6A 2WSSD 3R20A 5TY0A 2C9OA 5GADl 4DBLC 1TUEA 1UM8A 1VCMA 1JJ7A 2AK2A 2JLZA 1MRSA 2Z83A 1PUIA 1G6OA 1VIYA 4R2IA 1RC8A 3DKVA 1YRAA 5TXGA 4MRRA 1GITA 2BDTA 4QHSA 2Z4SA 1LNZA 4LJ6A 1R0XA 2R6DA 4HYYA 4UNPA 3VHLB 3B1YA 1OXUA 4Q1EA 1QHIA 4FWTA 3AQ4A 3EA0A 1E2GA 3SS8A 1KOFA 1T91A 2FX3A 4MRVA 3IBGA 3NIBA 4H1VA 2AR7A 4CT5A 2QP4A 4IJMA 1HTWA 2GA8A 3K0AB 4PSKA 2C96A 4BGDA 3REGA 1SXJE 2VP9A 4C7OA 4PO1A 5CIQA 2A7QA 2QRZA 3W3ZB 3B9PA 2MSDB 4E07A 3FTQA 2V6JA 2ASEA 3OZXA 4LHWA 2ZI9A 4M9XA 5CDFA 2ZAOA 3A37A 2ODEA 3O8RA 3AF3A 5FPSA 4IXMA 3UMRA 1OB5A 3MG9A 4E09A 3FHCB 5C2JB 2ECKA 1E3MA 3GJ7A 4L4UA 4HATA 4RD1A 2OLJA 4B2PA 1I4DD 3BRWD 4B75A 1UAAA 1ZIPA 1GKUB 3THXB 3OIWA 1TMKA 4I1UA 3LX5A 1IN7A 1FTNA 1NRJB 3KFVA 3OEHD 3AVXA 2PZEA 1M2OB 4RJLA 4FCTA 4G01B 1UKZA 2FNAA 4YMWA 1OLOA 2IYTA 3DM9B 2GCOB 2I3BA 2QY9A 1ZBDA 3IO3A 4GOJA 5AK0A 4BZQA 5JWOA 2O8EB 4EFNA 2JEOA 1JPNA 4C4PA 1NF3A 1Q57A 1FUKA 5EP1A 2G0TA 4I1OA 3H84A 4WIAA 3RRNA 4O3MA 2CL6X 1OV4A 1G4UR 2GBLC 1JEDA 1SVMA 4AKHA 1W4RA 2G1JA 4Q4AB 3RRYA 3CLVA 1J7KA 1ODFA 3TE6A 1X8LA 2CDNA 4CEJA 5FPKA 2QRNA 1XZQA 1FMLA 3BAFA 1ZNZA 1U0LA 2YNMA 2REBA 5DYIA 4BFVA 2CLCX 5DLQC 4NHOA 2FPLA 3A4MA 4Q7JB 3IEVA 4NYMR 1G8HA 4M1TA 4XTCS 4F91B 2ZREA 1N6PA 3RRMA 2JJ8A 4YMVA 3A6PC 1XXHE 3WP1B 4QGAA 1OXTA 1TQDA 2AFHE 4NKRA 2EFGA 2AHOA 4D25A 5FUXA 1GL6A 4DSNA 1Z2AA 1KO4A 2GKSA 2JIZA 3NC1C 1G20E 2G83A 4IDPA 3CX8A 4PAQA 2BKUA 3U2QA 4MGKR 1G291 5AJXA 2IYWA 5BN4A 3U6KA 3WMGA 3MFYA 4TZ0A 1KJZA 2ERXA 3GCGA 4G5SA 4GRAA 5F3WB 1EG7A 2AFIE 2GRJA 1OH6A 3K0CA 4KHZA 5EXSA 4AYTA 1FP6A 4PHGA 3U6BA 1OJLA 2VP5A 3LWNA 2ZYTX 3B6EA 3EWSA 4I1VA 4KSCA 1OH8A 3B1WA 1X1SA 1WA5A 4TLAA 5DN6A 1OH5A 3VNUA 2C8VA 1DEKA 4Z8YA 4XH9B 3CR7A 4HAWA 2Z43A 1S3SA 3RANA 4EAQA 3RS2A 1NL3A 2HT6A 5FOWA 3TR0A 3L8ZA 4W5JA 1SVIA 4DZZA 2WKQA 2YOGA 3NHAA 2NIPA 4FWIB 4WAUA 3NDBB 1XEFA 2YHSA 3BK7A 5AUPB 2IF0A 3IQXA 1L4UA 1IAQA 4DLVA 1JALA 1E2DA 4WA7A 2NO1A 5SZKB 1F2TA 3AUYA 4TYYA 2BKEA 2FU5C 2WWXA 1KI6A 2ZE5A 3L0IB 3HR7A 3JZAA 4IEEA 2QAGC 5EZ5A 3W9YA 4Y0VA 3BD9A 1JXMA 5K8TA 4TL9A 3OEED 4Q9HA 4JVMA 3SYLA 1DAEA 4FMCF 4DDTA 1KY2A 1KZ7B 1UKVY 3UMFA 1Z47A 4MDFA 1CEEA 5DISB 1YJ5A 4J0QA 2A3RA 3CH4B 1G5PA 5EXXA 1D2NA 5CDFE 3RSLA 1IHUA 5DIFA 1P73A 1SHZA 2AXPA 2NO7A 1CJKC 1UKYA 4OQXA 1WF3A 2VH5R 4HAYA 3KQNA 2J0SA 1KDOA 2XTNA 4KO8A 1DADA 4YDHB 3QPUA 3W6OA 3PXGA 1E94E 3CRRA 4OQFA 5E7JA 3CZQA 2IS2A 2C5LA 4JLNA 3SJCA 3DVLA 1RW4A 2GXSA 1S4QA 2IYVA 2OFWA 2ZUBA 3L2OB 2QM8A 3NBYC 3ND8A 3SE0A 3LFUA 3MGCA 2WJVA 3QNUA 3RVBA 4RD2A 1P9RA 1S0UA 4KAXA 2V7QD 1R5NA 1N5IA 3KXKA 2C2HA 1KNQA 3RYTC 1CJVC 2FH5B 4WZ6A 2H5EA 1W0KA 1AQUA 2J5XA 5L3SA 3GQBA 3U7GA 2VF7A 2V1XA 1CIPA 4WOPA 2F9MA 2AN9A 1NVXQ 2BM0A 2DPXA 3R8CA 1G7TA 3OFND 2HT1A 3ADCA 2HJGA 3LQQA 4M1SA 3JVUA 2ZJAA 3SHFA 1NBME 4BUJA 1KO1A 3SFZA 5FFMA 3E1SA 2JASA 1HT1E 3GP8A 3DKPA 4Q5IA 2G0NA 3K0FB 3P32A 4KBGA 3FMOB 1XJQA 4DWJA 1TAGA 3OE7A 2A5YB 2O8FB 1XBTA 1FX0A 4IDHA 3RNLA 4RFSA 1YZUA 3R9WA 3KKOA 5KSPA 2RGDA 3UWKA 2ZI4A 1GL7A 4CZ2A 1A5TA 2FA9A 5FOSA 4DLYA 4XD7A 4NYMQ 3N70A 2WICA 3C5HA 4D0LB 1TL7C 1DOAA 4NH0A 3ICEA 1XEXB
chains in the Genus database with same CATH superfamily
4AB1A 3KQLA 4WMLA 1OTYA 3S2UA 2FSHA 2R25B 3GP4A 3P1JA 5FBQB 3L0ZA 4PIVA 1NFFA 4LGYA 4C3ZA 4TTJA 2QZSA 5BSUA 3QOXA 4HHEA 3IAOA 1Z38A 1ZRHA 4MW1A 2FSVC 1LX8A 1DELA 2FN4A 3IOMA 3LECA 4FGUA 4O2LA 1MC1A 2OVFA 1QB8A 2WBLC 4YIKA 1NNEA 2Y9MB 4OYHA 5HDBB 1PNRA 4C6RA 4Z1MD 3NXKA 2QQ5A 3PXEA 1MAVA 2ADMA 4S1PA 3ESYA 4JKOA 3QTTA 4ZMBA 1VG8A 3AR6A 1K92A 1FTGA 5F2NA 1U28C 3P9YA 1K3FA 1Z6GA 1K89A 4DR4B 5EKTA 2G3YA 4KIUA 2IELA 1Z15A 3BS4A 4MWGA 1SY7A 1E8MA 4Y2QA 1W87A 4G9BA 1JE0A 3BEDA 2PBZA 2RGYA 4QUAA 4MTCA 2ECFA 4R2KA 3CEPB 1AHHA 1G7SA 3RVKA 2ZYWX 2J9FB 2QRQA 4JT9A 5D1NA 3RIGA 2NPIA 1RLMA 4BNGA 1UXGA 2KJQA 4QBFA 4AQ7A 1X9IA 2DGDA 4M1WA 4QBGB 5KJCA 3L8FA 4NBUA 3RVMA 4ASUA 3TUIC 2Z8YA 2R6HA 3QKRA 1SVNA 2XEXA 3TTXA 3ZV7A 4YUWA 1AUVA 2YZKA 4FN5A 3MYRA 3I5XA 4AZ3B 2BD0A 3KVRA 4E14A 1U7HA 3ANTA 4XVCA 2K6GA 1L7VC 4MR9B 2CNOA 4PYIA 3P9ZA 2W5UA 1GY8A 3DMRA 1A5ZA 3H42B 5ETJA 1NJ1A 2RBKA 2Q21A 5THQA 2FRDA 2ZRIA 1BMFD 2GGSA 3MJFA 4Q3KA 2WNHA 5DB4A 5I9BA 3U3JA 3CUSA 1BVHA 5DGDA 2QQGA 4TMXA 4C1NA 4PLPA 3COYA 4C2UA 1LW7A 2IZOA 4TRJA 4B3SB 2AQKA 1SA0A 5IKOA 4R0NA 3CLHA 5KYXA 2JJ2A 1L1QA 4AZSA 4UMVA 3ZVMA 3U7HB 4RHCA 3KQTA 5DXAA 2EJVA 3W34A 3WGLA 4AY5A 4EO4A 4QDKA 4IJUA 2ENWA 3M4YA 4RXUA 1QO7A 1FYDA 5CDYA 2XYRA 2FRVA 3AIKA 3ER6A 3GVCA 4JN6B 3ULKA 4X95A 1VL0A 3AL0C 2IU4A 2QDKA 1KYZA 2CVQA 3FLMA 3O7MA 4IVQA 2QTLA 2CJWA 3QUTA 4MJ3A 5A3JA 4IYJA 4WGFA 1ORRA 4W1SA 1QGUA 4PR0A 2ADFA 4QU5A 4IJVA 3ETHA 3TPCA 1Q0QA 2JFYA 3CCBA 4ZAXA 3U48A 1HGXA 3VDRA 1W75A 1RWOA 2Q2NA 4ZQHA 3SSNA 4C30A 5IX8A 1GFIA 2ACWA 3K9GA 2I71A 4BPRA 3UANA 4NBSA 3DHEA 2TECE 4MQUA 2ERCA 4I9FA 3MWKA 4TPKA 2A92A 2IIVA 4ED9A 4UQLA 2IHJA 5GTDA 2BEWA 4ZOEA 1ZHOA 3JQ7A 3PFHA 1TEVA 2L18A 4Y2YA 3KLPX 3GCDA 3PYLA 4HO1X 2ZM6B 1W4CA 3DZJA 5DK6A 1OIWA 4YTEA 4B3GA 4BC1A 4EJMA 1Y37A 1WHTB 4XQ0A 5JQGA 2HFKA 1SD1A 4TSRA 2R1VB 2ZSDA 3E22A 3H5VA 3EIWA 5LLSA 2FDXA 1ATIA 1C7QA 1Y7IA 4TT3D 1DJPA 3EA5A 3O3MB 3ZGLA 5JS7A 3O95A 1UJNA 2VCEA 4X7RA 3F9IA 2GPAA 1JG7A 1OWPA 1QVZA 2G6BA 4HTFA 4UXJA 5CXSA 5C1PA 1RXWA 4ADSG 3FNGA 4C21A 2JIBA 4DBLE 5D3KA 2RD2A 3SEAA 4MGEA 1SKYB 1HORA 3MT9A 3HVJA 2PGJA 2NPOA 3GRAA 1UZNA 3IKLA 1IMOA 4RZSA 1KL7A 1QVRA 4DEYA 1V47A 2CXPA 4GBED 2AF3C 4K46A 4YRAA 2IBTA 1ZD3A 3R7LA 1P6UA 2VRNA 5C80A 1WQ4A 5K6AC 2QLFA 5AI6A 2DTDA 4BE4A 3IKMB 3EFBA 2ZAGA 1U3DA 1XZ8A 2OGUA 3CF4A 3V4LA 4BUCA 1A9RA 4KRFA 1VBFA 3X1YA 5B4VA 1NUHA 1W4AA 4B8WA 3GA5A 4MLPA 2O8NA 2ZTVA 2B9VA 5DW3A 1WZIA 4RPKA 3HVIA 3R0QA 5EPEA 4OAOA 1CQIB 4ZVOA 1ULAA 4IF6A 2X22A 3PI6A 3MFQA 5DASA 3GLSA 2F3SA 3VYRB 1FRVA 1AZTA 1BG6A 5KX5F 4BGUA 2JGNA 4KHPB 4LC1A 2I76A 4D81A 3NMUF 4XYGA 2HYDA 2D1YA 4RELA 4DC1A 3SQWA 3ODPA 4LF9B 4KPFC 3TLGA 3H9JA 4WFIA 2ECPA 1FRQA 1C0PA 1Z8FA 3U9SA 2Y0EA 1CD5A 3JALA 1NVVQ 4MS1A 5ITVA 3EDCA 3LY8A 4YI5A 4J91A 3VQTA 3VNBA 3NBMA 2ZSAA 5BNIA 1GYRA 1VG0B 4JODA 3EZ9A 1UBRS 1Z5NA 4I1RA 3W6NA 2I91A 2VDUE 5EHIA 4BKQA 3K1TA 4J4BA 3I2FA 4DXAA 1HURA 1DC5A 1HSOA 5JAHA 3FOZA 3NNSA 2ODNA 3S7TA 1QH8A 3EZLA 3GEDA 2WM2A 1XMSA 1HMPA 2J5KA 2WVJA 5D85A 3KZNA 2P6UA 4PCAA 3ET4A 1F7VA 5HIKA 3UJPA 4PYNA 5FI3A 4D4LA 1E4EA 3AR9A 4MH0R 4EVSA 3PGVA 2HPZA 1VYHA 1UWKA 1D1SA 3JVVA 3S6JA 5CXXA 4EJ2A 5MDHA 1XVIA 3K9NA 5IH3A 3HU1A 1X8JA 4UFPA 1XVVA 4PLWA 5CK5A 1JVBA 1HG0A 2A35A 4OYRA 5F5LA 3B7PA 3LT4A 2XMBA 1LTKA 5F12A 2IHBA 1ZUIA 4KE8A 1BWRA 3PFFA 4D0RA 1N2OA 2D3TA 5KTKA 4K0KB 1SBTA 2ZHGA 2B1JA 3NM4A 4R1QA 4P08A 5E1MA 3SNKA 3W3AD 2ZZNA 3R3UA 4LRTB 1NG9A 4C7MA 1RRVA 1SUDA 2JFNA 5BN4B 2ZI6A 3Q4GA 2FK8A 5HVNA 2M98A 1XGKA 4QU9A 3RC3A 2CCKA 1G17A 3EDMA 3E84A 3W5UA 3FUVA 3HZOA 1RQNA 1OHHD 1C81A 3S2YA 3T0IA 1OOEA 1C9JA 2WMOB 5DHTA 5ULLA 3SZLA 4EB3A 1A9PA 4PLHA 1Z4PX 1F8GA 3UMBA 1OD6A 3DNPA 2H29A 3WK9A 1GFWA 2QXUA 3VVCA 1GM5A 1L5LA 3DVSX 4K6GA 3VSBA 5DWDA 2DWPA 1NVEA 5HRAA 3EVTA 5FADA 3A6DA 3NUZA 4LZPA 4Q1DA 4BAUA 1GA6A 1DO8A 4HY3A 4KKXB 4MAFA 1ICEA 2BV3A 2G9NA 4YR9A 3EISA 4UM9B 1GZ3A 5KNBA 3NHMA 2YJ4A 4NMLA 5C5CA 4OUKX 1F5NA 4U3JB 3TGWA 3MWFA 2P9CA 1GYPA 4O33A 2EZUA 2ZSBA 1ZINA 1UBGA 4TTPA 5E6RB 3GEIA 4R8SA 3UW1A 3RU9A 3PD1A 3UAOA 3IV9A 1QP8A 3QVKA 5JHHB 2VA9A 3IAAA 1QAQA 2NO9A 5F7JA 3GJRA 4DF3A 4XVQA 5LB2A 3IQFA 4Y30A 1JYSA 4IXTA 4LDZA 3BGWA 1GGNA 4DL9A 4C7BA 2B4TO 5ELLA 2BJWA 4HEJA 5KWEA 3MVEA 2CL0X 2ODBA 3OD5A 2IXDA 3QVSA 1ZCFA 4MCHA 4Z2YA 4Z3DA 2EFYA 3VYVA 3WL3A 4ZQCB 5BVHB 3HCBA 4RVSA 3FPLA 1WD7A 2NUAB 4BP3A 3ABQB 3PQ5A 4H31A 4D3ZA 1NI4A 1CQPA 1VL1A 1XKTA 3U9TA 3OX3A 1XNHA 4YIHA 5L7YA 1LPOA 3PHHA 3BMOA 5D2CA 1A9TA 1NYRA 5I8WA 2VJDA 1ZA2A 2HJSA 3V3KA 5K09A 2IHNA 1OWNA 1RPNA 3LHFA 4G4GA 3RLIA 4F8EA 3OMLA 1YCFA 4CDRA 3JQGA 2OZEA 1C3XA 3KB1A 3R7AA 1CY4A 2GZ2A 2VQFB 1UAYA 4WJZA 3EZ6A 2F1KA 2XRMA 1YRQA 4G1VA 4RCVA 4AY2A 1N0VC 4OAQA 1NDUA 1M74A 4RZ3A 3M3PA 1E59A 1JFFA 2H5LA 3IALA 3ONWA 3EODA 4QYIB 1KJ9A 1YMUA 4V38A 5F2KA 3S1LA 1JA1A 3AFIA 4DR7B 2XUDA 2ONJA 1E99A 1VLLA 2D2VA 2ZRPA 3BD8A 3DZFA 4ZDIA 3OU6A 1OB2A 5AHRA 4GLBA 1Q19A 2HDOA 3AW9A 1L4MA 1U7OA 2G1KA 2UZ0A 4FLEA 4XARA 3UBTA 4HK4A 3GC6A 4DIUA 1BQEA 2J5BA 3UIEA 1LLUA 4PFJA 2X0IA 3C41J 4B74A 5L3SB 3LGSA 3GQBB 2MYNA 4IMJB 1LPBB 2ZUWA 1TZBA 3BREA 2VWHA 2DP4E 5JJ5A 3AWDA 4UATA 1EHIA 1CULC 3EAFA 1UXHA 2I4LA 4I2NA 4BFWA 3WAGA 4R4EA 1EWRA 3HKCB 4QFDA 1ZMBA 4M7OA 1D1PA 4UOZA 2GD2A 1WXDA 2F00A 5JU6A 3BIOA 2DJ5A 4MUBA 1UMBA 1QCCA 1W36C 2GASA 3RB8A 2JH9A 2LD4A 3FSGD 4I50A 1F6DA 2ZJFA 3C7TA 4N0EA 4UD6A 4WOKA 5THKA 5HW0A 4QBKA 2OGZA 4C6HA 5JDCC 1M1NA 4J3FA 1P4HA 1T8SA 2HUNA 4LSGA 4R1NA 4D3FA 5BR7A 2V4MA 4P4UA 5EE9A 1N2JA 4EG4A 4HVTA 2JFGA 3TOZA 4A2QA 1WMBA 2A9FA 1JLHA 4RYDA 4D9BA 2C84A 1IBSA 4PLTA 4X3CA 3BG5A 4WBNF 1YJCA 2C2ZA 3KKLA 4RACA 2O8BB 2ZJBA 5HS4A 1ZJ4A 4D8WA 1B41A 1EIWA 3LUHA 4OLJA 3G1WA 1P1CA 3GLHA 4XTRA 3N8DA 3QLJA 2ZBQA 1KXJA 4KPGA 2C4UA 5JJIA 4FIZA 4FKBA 2FPSA 4NK5A 5FDFA 5I9NA 1G8YA 4FLMA 4UE3S 2WNIA 3ZWKA 3VNRA 3DFUA 2R84A 3OEYA 4OBEA 3CV3A 1NONA 3KJQA 1EFKA 2GAIA 2OMKA 4CQMD 1D2CA 1JLMA 2JH8A 4M53A 4Q05A 3CXRA 4MUHA 3DMPA 5TGZA 4BS9A 3LVQE 4EW3A 2PJUA 5CEEA 1CVIA 2PEYA 4QD3A 4Z4EA 1G3MA 3UUEA 4BJ1A 2Z4TA 4JLOA 3L1IA 5L3RA 3QW2A 1W36D 4L6AA 3G89A 4E5DA 1MHTA 4C7KA 3RBXA 5KYNA 3E8MA 3H2GA 1WB5A 3IV6A 1A7UA 2B8TA 4AKIA 4Y0AA 4BJ6A 4CLOB 2D13A 1J39A 4RVNA 1NQXA 5E0OA 2C7PA 1N92A 4FCCA 2N42A 1QMGA 3H6HA 4C6SA 2BEUA 3I1YA 4LHVA 4M1YA 5FWXB 4K6CA 3FVWA 1ECBA 4N18A 4BCBA 3RS3A 1D03A 4WKBA 4Q18A 1RLTA 3SN6A 3A32A 1ENPA 4GNRA 1R0LA 1FY2A 2NQ8A 4PBSA 4ZDWA 3WHKA 1JPUA 2G77B 1B1CA 3A1WA 3PV0A 3CO5A 4NULA 4H6PA 4PICA 4RVGA 4BQPA 4CG1A 4A15A 5A9SB 1O0BA 1R2QA 2RHTA 3A3OA 3H9UA 2WVGA 1KFEB 4MA5A 1RD4A 3GFPA 2J0VA 3HCAA 4LE2A 5J58A 1XZKA 3EF3A 3W6ZA 1XRPA 4LNUB 3EG9A 4Y2JA 3IP8A 3EB9A 2I66A 2I6QA 2V59A 2VJYA 4G1BA 3EIQA 5K2MA 4KVFA 3JD0A 3T4UA 1F3OA 1SCUA 5GJBA 3FGZA 1SCAA 3CO0S 3KETA 1IXZA 4UC0A 5A3VA 3AR7A 4W5OA 4CMAA 2VDWB 3V1LA 3DD1A 4KE9A 1MZPA 4P32A 3LBIA 3Q10A 1T10A 2Y2UA 3O21A 1JR6A 2FLKA 3QUAA 3IIIA 3Q8WA 3QQPA 4PX3A 1KPHA 3KHKA 1I3KA 2VJMA 1MJHA 4QXMA 3DE2X 2PLNA 3KFLA 3L8CA 3QKSB 4LMBA 2I54A 4IGFA 2V7PA 1XTVA 2FGKA 1KJIA 2JGLA 2I8AA 5A9TA 1NQTA 2KBFA 3L0CA 3RRFA 2O23A 1GNSA 1YQWA 2W0MA 2DFVA 3V33A 4MMXB 5FI0B 1K7YA 3Q9LA 2PBRA 1M6NA 2I4IA 1KYXA 5JCJD 2I7DA 4G5RA 1QP0A 4FNGA 1ZC4A 2XMDA 4B6RA 4ZYUA 1IEWA 1S02A 1XD2B 1T25A 3I6IA 1P9WA 1F0KA 4J7XA 5DIZA 4DLXA 1Y8AA 5B1EA 1OAOA 1MW9X 3IX7A 1I14A 2MYUA 1IBKB 3RIHA 3LG2A 2NXJA 4OK6A 4EK9A 3IUBA 2NX2A 3GNLA 1QG2A 1MGPA 3H5WA 5EERA 3VR5D 4C4TA 4CCWA 2KWIA 3H2BA 4FDMA 2O4CA 1Q7EA 1T5IA 1VHJA 4FM9A 3ADDA 4ACBA 3Q85A 5KC8A 5KWIA 3EXG1 3M49A 4WZBB 4FOPA 4KTVE 3L49A 5ALNA 5KQSA 4PSDA 3ZK8A 4ER6A 3CJQA 2Q3DA 1HXHA 1U11A 3QUQA 3F74A 2ZJ2A 1DQYA 1HV8A 3DC2A 1XA3A 2J7PA 3ZLUA 2W8ZA 3HCOA 1Q2UA 2GEVA 1QFZA 5LA6F 3AEUB 2GJ8A 3DBHB 1IWBB 4N4AA 3KZOA 1U2TA 3V1MA 5CBPB 3CB4A 5AVSA 3P2KA 4UBNA 2Q9UA 4QYSA 3H7AA 1AKRA 4O1MA 3W4JA 3AFGA 3GLFA 1V16A 1TOAA 4Q3EA 3UAWA 3K05A 3N86A 4MVJG 3FMFA 1I6MA 2A0UA 2H4FA 2PSJA 2H1RA 1RT9A 2JF0A 1KVSA 1S1MA 3WMEA 1E2HA 4BO4A 1C4KA 1TTQB 4OJQA 5CR9A 3EQ9A 4OFXA 2PD3A 3VC7A 3N74A 4EI2A 1R6UA 4G24A 2VL7A 2XVYA 1T3LA 2ISSD 4LX8A 4PQEA 1OH7A 3SGLA 1VB5A 3SYMA 3VU8A 5HUJA 4JITA 4F9GA 3J7AC 1N5KA 1RWQA 2KYRA 2XGSA 4NXMB 3QU2A 4C78A 1FFXB 3I6BA 3NTXA 2IYUA 4U7GA 2Q5JA 3MUEA 3EJWA 4MI1A 1KK1A 1ECCA 4KYVA 1A50B 1QYCA 3OJFA 2BUCA 4Q21A 3PYXA 5KOHA 1JH9A 4POOA 6YASA 2V5VA 3MWDA 3LXUX 4TYMA 5KMGA 1Y42X 4LV5B 3H87A 4XOUA 8LDHA 4V0QA 3V1TC 2A0WA 4R8MA 4FD2A 1EJ0A 2C00A 2QTFA 4B6EA 1M2HA 4M0FA 2PZMA 4NZYA 5IT4A 5LQJA 4UOEA 2I1QA 3FNRA 5EXEA 3JZFA 4BLOA 4MVJM 3MBKA 3L82B 4LOHA 3ETLA 2JLXA 4QTTB 3UOAB 1IIRA 1PG5A 4PRYA 3EX7C 5IK2A 2D1RA 2NWQA 1QWOA 4M89A 1Z2EA 3TM5A 1E1KA 1RHUA 2NVBA 4D1YA 1SZJG 3NT5A 4EGCB 1Z0AA 4ENRA 1NSYA 3ZVKA 3RUAA 5FOXA 3TLBA 1G18A 1JA9A 4BNZA 1XDGA 1TK2A 2P79A 1U9YA 3F78A 4H7PA 2BBWA 4CV2A 3PLNA 4FSDA 1JZTA 1SIBE 1SVLA 4UDXX 1WBBA 6AT1A 2I4RA 2Q3MA 3PQFA 4RDCA 1PAUA 2AJTA 2WSSA 3WB2A 3LLCA 3RSOA 3T0GA 3C1TA 4PQRA 1F8FA 4BVGA 1VBMA 3I23A 3KT0A 5AVKA 1EGMB 1Q44A 2XA1A 3VM6A 4YJDA 2VDQB 3ROFA 5D7BA 2PIAA 2PO5A 1YS2X 1KAOA 1ZVJA 3FWZA 2NSLA 3H5IA 3GFGA 1YD7A 2JATA 1F60A 4P3XA 4CKEB 1KK0A 4IWXA 1NP6A 1YVPA 2QL9A 4O02B 5TT0A 4H6VA 4OHMA 3UCXA 5LIRA 2WU1A 2PT6A 2PQMA 4MIOA 4YQYA 3RU2A 4DW8A 3HO8A 3U44A 3DTTA 1CKEA 4PZ9A 4AZ0A 3OD1A 2PUEA 4H7DA 4LHYA 3E61A 4RLHA 2EKLA 2GBIA 3EEOA 2PN1A 3N2GB 4G25A 2C31A 3DSRA 4GR9A 5AVQA 2GXAA 3EPHA 4OB7A 1HLPA 5AXDA 1E3DA 1OX4A 1DMSA 2HEGA 4FEEA 5KYUB 4IMRA 4X8HA 1KK3A 1Z3IX 4ZVRA 4LY6A 4WUVA 4I1PA 5JPIA 2X4DA 3HRKA 4QNRA 3G2OA 2EZ8A 1I7QB 4CDMA 2P9TA 1SHJA 3ZLBA 3QEMB 1T5LA 1CZLA 3B9BA 2WA2A 3AJAA 1AB5A 3CWQA 4BP9A 1SEVA 1YOVB 2BHNA 3L7OA 2HPAA 1RQ2A 2RCYA 3DVAA 3HJFA 4TUYF 3DOOA 4AYWA 4M4SA 5CGQB 1ADGA 4GSYA 3TLJA 4A0GA 5C8DA 4Q1FA 3IJ5A 4ZU6X 4QARA 1M3SA 2J9GA 1JQJC 2ZRDA 2P6RA 3OEHA 4X92A 3U13A 1SAYA 4AP5A 1CU1A 4BNTA 2AJ8A 3B1VA 4PTZA 2UXBB 3T8YA 1KYVA 3B13B 2ERYA 5KKAA 4O63O 5JCPA 2X2PA 3GT0A 4US0R 2DCMA 4CV1A 3IDZA 1YK0A 2ZS7A 3MRXA 4UM7A 4BN4A 3GOQA 4Q3NA 2V7UA 1C1DA 1U98A 5I7EA 3ZY5A 2REOA 4IH9A 4RH0A 1JAXA 1WPXA 3S2SA 3H5NA 4U2CA 2XCSB 1GHTA 3GJTA 4NU5A 2WMYA 4HGOA 4BVBA 3CUKA 3WL5A 2H4JA 2NXWA 5IJ9A 4G85A 3ZBPA 5JO9A 3VDMA 2WAMA 4L5YA 1IE3A 3JQAB 1ND6A 5AM1A 1YULA 3CM0A 3URKA 3VPSA 2CXXA 6Q21A 1YVDA 3OCVA 1NC3A 2XT9A 4G1FA 1CK4A 3WLRA 2ZUUA 1NW3A 2AZTA 3MWJA 1Q84A 2AYZA 4I4TA 1BW9A 2CXQA 1P4JA 3PQ6A 4ZC1A 2EGUA 3WLTA 3USES 4JJ8A 1JTFA 3LQYA 2FSGA 4I6JA 4PPNA 3DFIA 3DDZX 4NR0A 5C7IO 3BRQA 3I53A 1SGWA 4IXNA 3PPIA 2ZTMA 3M5WA 4Q9NA 2XXJA 3RBAA 3K4PA 3SXUA 3HTXA 4LJYA 4HAVA 5ALEA 4KLAA 1J00A 5EVCA 3OKFA 1Z0FA 4Q6WA 4LN1A 5CB0A 3UNXA 2B3TA 2O07A 1PEAA 1QIDA 2QXTA 4IH4A 4OQYA 5F2OA 2VO1A 1XTPA 4KRYA 2RI1A 4NYJQ 5TQ2B 1HQCA 1F7UA 2LBPA 3KP1A 3HVKA 2BSXA 3M4NA 3VR2A 1XHEA 1OLXA 5EXDA 2IOFA 3HCFA 1YRLA 3OE1A 5EEGA 2WHXA 4HVCA 1ENOA 4UUNA 2WQZA 4DWOA 2VQEB 5TX7A 1NVUQ 4GQAA 3F2IA 3WKAA 2X42A 1Z0IA 2HA5A 3AEKA 1A2KC 5CT8A 2PH1A 2PL5A 3MTEA 4P4NA 4XGRA 3IE1A 1ZGBA 2Q5HA 1YR1A 1N5OX 2PRIA 2H8GA 3CG4A 4PPGA 3I2JA 1VE1A 2IY8A 4TL8A 3V1UA 4R5HA 4U00A 3WOVA 4A8JB 2CGEA 5DLPA 2YKGA 3QE4A 3ROQA 1H2XA 4TV8A 1PK8A 3H3FA 5I7OA 4F8JA 5LZ9A 3D70A 3VC3A 4ZK2A 5AW0A 3IBSA 2XITA 1ORWA 5FTKA 1XVTA 4DIEA 3JQDA 2PL1A 1EHCA 3Q3HA 1UKEA 3C7CB 4QWMA 1RWBA 3OCYA 1RI3A 3WV4A 1GD1O 5I44A 5L3ZA 1NLYA 1GPBA 1SZCA 4OB6A 4EFMA 3RF7A 2YMLA 2P6PA 4NHEA 2GR9A 3NWPA 5JE8A 5GAJA 5GPBA 1ILEA 2QI9C 4KUEA 4JI0B 3VZBA 4AYXA 5D51S 5CLFA 1RACA 1EEHA 1OA1A 2N46A 4G0NA 3EXG2 1IVYA 4OHCA 3RT9A 2A33A 4L5IA 2ZGVA 3K9LA 1D09A 3EC7A 4IF4A 4KO1S 4DJTA 1T5HX 3LHDA 4DJAA 4WY5A 4BKPA 2CLOB 4CF4A 5FFNA 2PMBA 3SDBA 4KQKA 3UJAA 1QQTA 3K09C 3OJXA 3OFKA 3FCCA 1JMKC 2OXTA 2C88A 2FPPA 2BFBA 3VV2A 3ZUGA 4ZDJA 4D4JA 1A5AB 4DWVA 3GPDG 3DV9A 3THWA 2X2FA 4J6FA 3N05A 1FFWA 2X2EA 1XZJA 2ZIZA 4UVEA 1GSHA 5CUQA 4CLDA 5HZGA 4D9IA 2QN8A 3GHHA 4Q9IA 4WK2B 3SKVA 3TNLA 3R9XA 2LUOA 3N6VA 3GH1A 1RXCA 2VAPA 3DL7A 3N0WA 3UGQA 4IICA 2IZ0A 2A1TS 2C03A 1JS1X 2X4GA 3D7RA 4JXKA 2GTHA 1N0IA 4NAVA 1Z37A 4IDDA 5HIAA 4HCJA 4GOLD 5DTMA 1TZMA 4DABA 3UQYS 1YQTA 3WGJA 5BUQA 1UANA 1A9QA 1Y1QA 3QITA 5T4HA 2IEGA 5GZ1A 3PQDA 4R0MA 4GPTA 1PJLA 1VL6A 3IVGA 2DOKA 2HCBA 1Z0JA 4B6GA 1IBCA 3COVA 1DBIA 5CT6A 5I7RA 1UJBA 3FYUC 4KXLA 1Z28A 4S1TA 3AP2A 2ZVJA 1N0UA 3QY0A 3ZS9A 4JUCA 1Z4JA 3OFNA 5EMKA 1JDSA 3ZE9A 3OHPA 2FZ5A 1MVOA 4OHPA 3H2JA 3RREA 4EA7A 3AOEC 4IJ6A 1Y7HA 4D9EA 1PUXA 5ICCA 5FTWA 4U8GA 4Z9AA 3SHQA 1I2CA 3CNEA 1QHXA 3HR8A 1XK6A 4K9NA 1BTOA 1KZYC 1Z34A 4NU6A 1MX5A 4BWYA 1YB1A 1NKVA 3K6SB 5A05A 1HH4A 1QOPB 1M2VA 4NP6A 1C0LA 4QUJA 3ZHCA 2QM7A 5KPJA 2LCIA 1XB2A 4AMVA 3U5TA 1N3LA 2I9PA 3AINA 3BRSA 2ZK7A 1SBZA 2WSYB 4I6GA 4M8LA 1U0BB 1M6VA 3EG5A 3GLUA 4BFUA 5CFQA 4I55B 1FSSA 2C3MA 1JWAB 2NW6A 1SUIA 2PJDA 4MICA 5CYPA 2FK7A 5B58T 4Z4GA 4KQJA 4ZAZA 1C8VB 1MNAA 1YE3A 2B0CA 5E1OA 2ZJZA 3EJ6A 3LU1A 3ONFA 4EI7A 3FOBA 4MINA 2WHYA 4LZZA 2M2IA 1ZM4A 3ZQ4A 1D07A 2OE2A 2WIAA 2NSJA 3ZY4A 2CLFB 5ESDA 4BQEA 5K99A 2CXTA 1P0QA 4F2HA 3QX3A 1DEHA 3T06B 3HDVA 4UTOA 1DV1A 1ML4A 3G1UA 2GZDA 1CHDA 3LBFA 3A1TA 5ELMA 2VHZA 1I80A 5T4BA 3MOGA 3DXFA 4DUYB 4HS4A 1G5RA 1Z2PX 4UEJA 3FVTA 4HAOA 1N9ZA 1PWHA 1M76A 2O2JA 3DL2A 5JAIA 5T4FA 1IUKA 2GCIA 2FV8A 1PFVA 3DOCA 1PTKA 1B8OA 2YWFA 3V4VB 4JEUA 2VLIA 5CHEA 2FEKA 3TLAA 2DTEA 2UUCB 3OG9A 3G0IA 5FBLB 3UWMA 1XD8A 3CBGA 3RUIA 2ZLBA 1Q3KA 3QE3A 4TM8A 5J4LA 2PMFA 3KCQA 4NECA 4NV0A 4Y2PA 5LDGA 4ZTUB 1N78A 3UQZA 3V9AA 1MGOA 2YNMC 1QTQA 1J9GA 3FWPA 2GCPA 1OIVA 1QV6A 3SU8A 2FWPA 1YR9A 4PCUA 2JGIA 2ZUFA 1VPEA 1CY0A 4IILA 3TD2A 3BFVA 4O1IA 1I7SB 3LDUA 3WXBA 1N3IA 4YCJA 1QTNA 3VOTA 3GD7A 2EEZA 3HH8A 1KPIA 1A8PA 1X1RA 4DCZA 1YSCA 4BQOA 2GF9A 1YFJA 4WNIA 1AIPA 3II6X 3W0LB 3F90A 3FPKA 4AFNA 4BNHA 4NZ9A 4US2R 2Y68A 2QG6A 5KYGA 1K2WA 3UPTA 3G0BA 2O4UX 4Y1RB 5JANA 3M6AA 1W96A 2FPIA 3I92A 4RF2A 5EUCA 1YDHA 1KORA 2O05A 3TQIA 1TM1E 4PNEA 3GT3A 4HWGA 1BHSA 4RPHA 2NZYA 2PV0A 3KZMA 4XB6B 1LBSA 1OI4A 3QWHA 4E5KA 4EZEA 1PS0A 1KQFA 1Y4SA 2HXGA 5B2EA 1E3SA 1QVAA 3OZAA 1KZ9A 2C5SA 1Q0TA 2YJ5A 2QUJA 1NPTO 4FZ5A 4KQHA 4PX9A 3K0CC 5K4HA 1LPMA 4LNAA 4LHEA 2P2YA 1NJ2A 1DTSA 4XAQA 4D46A 1EVZA 1R6VA 2V3VA 2W2KA 1W2HA 2HZBA 4K9QA 4M3NA 4P58A 4BBZA 5KIAA 3K70B 1PN3A 3GJ5A 3QU4A 5ILGA 4IIBA 3U40A 1CUEA 3OM8A 3WAKA 3EXEB 2G63A 5BN5A 5KCZA 1QG6A 3GYBA 4QVKA 2ODAA 5LQSA 1XRLA 4IV5A 1GUBA 2GBFA 1AGNA 4ZAWA 5KBYA 2NU9A 2YNMD 1QBKC 3NHYA 3TECE 3PEEA 3Q5SA 2YWHA 1UOOA 3PDHA 3QVUA 2Z57A 2HMYB 2PH5A 4HI0E 1IJKA 4LCEA 1O4VA 3PUIA 5DSXA 1ST3A 1YZFA 2BP7B 5TS3A 1ABBA 3UMSA 3GJYA 4BQSA 5DXFA 5EC8A 1P5FA 2PFGA 3PQ3A 5FTJA 3C6BA 4B7ZA 2B4QA 5J2TB 5LN1A 1G64A 1C0EA 3AFMA 1PJQA 4FU0A 3TLCA 2VYVD 3KQPA 1D5CA 4NG5A 3R5FA 4RSHA 3RKSA 3ABRB 4BNWA 1NLMA 4HMOA 4LXTA 5EJ8A 2ZSFA 3C98A 1IXKA 4ZO7A 4FJ2A 1XMIA 4IEFB 2QLBA 2XJ9A 2PSEA 2NO6A 2VWGA 4GMHA 4B32A 2CNNA 3K0HA 1U8AA 4X20A 4B3JA 2OYCA 3KQHA 2XGJA 4Y9UA 2A9PA 4LW8A 3RLFA 2QS9A 1YR2A 3W1WA 5EHNA 1UEJA 3FYHA 4MSUA 1POXA 1QHGA 1Z7GA 2I2FA 5B1YA 4QWWA 2HUPA 3KZ1E 1FZTA 3FPGA 3I8OA 1D9ZA 1L5FA 3KSDO 4FBLA 3AJ9A 3QVWA 5H16A 4ZYLA 3O94A 4O2BF 2IXEA 3AETA 3ZHOA 1F6WA 2O7VA 3FRJA 5BYKA 1EXJA 1TIBA 3RTBA 2FEOA 3PS9A 1H1TA 2YIDA 1DBWA 1AU9A 1T5SA 4W7HA 2UZ3A 1VCHA 3HA5A 3RSHA 4AURA 4C6TA 1QGZA 1ECFA 4J1NA 3M4XA 1THZA 5IP5A 1R64A 3OQ6A 1E6WA 4KYUA 5CM8B 2CKMA 3TNFA 1AV6A 4PHTA 3SZ3A 4KVAA 4AY6A 1PVDA 2XNSA 2QVXX 1FTWA 4RK5A 4YCLA 5LXTB 4BO3A 4QUIA 3KWJA 1DC3A 1YZNA 1JHQA 1USVA 1XJ5A 4CKCA 3TSWA 4EHAA 3CA8A 3ZKWA 1JIUA 2IWHA 3RODA 4LXGA 1PJ4A 4IV0A 3SJUA 4R24B 2Q28A 2Q0HA 1RADA 4UDYX 3UHAA 4G23A 4JLKA 4CLEA 5KU1A 3FLEA 1DCFA 1TQ6A 1ZCJA 1G5IA 1LPAB 4QQKA 2RHGB 2VEDA 3BILA 2FPGB 4NCJA 4R8RA 1UPAA 2NZUG 2PM8A 4ZV7A 3TVDA 4CG0A 5C9ZA 3G1TA 1A98A 3PSAA 3LRPA 5EUBA 2DU8A 1HL7A 4B4DA 3L8DA 2QGNA 1J33A 3K30A 4OCZA 4Y2GA 4XJXA 4D96A 4F4IA 1EQAA 4KXVA 1NW5A 4R71A 3GAFA 3TOSA 5DVZA 1AZSC 2POCA 5C81A 3H9BA 1VLQA 2J3DA 1PWYE 5JRDS 3M6VA 4B9AA 2X9NA 3RAFC 1UIRA 2QN7A 3CUYA 4JL8A 4BEVA 4ENTA 5FWDA 5AM2A 2OD9A 1IN1A 1KJYA 1QAOA 1ES9A 2OG1A 2PTGA 3LLSA 3NBZC 2GHRA 3AC0A 4RAQA 4UOQA 3TSAA 5JW6A 4GWGA 3QV1A 4M6WB 4BMYA 1P5JA 4O4JA 1EE1A 2YWEA 4Q16A 4QDJA 1JHUA 4PPQA 2VTVA 3W5CA 1KQOA 3J81k 1JLRA 4I6EA 8ADHA 1VMAA 1AHNA 2DHDA 1ZGGA 3HB5X 3HY4A 1X15A 1ONOA 3ZIAA 3FCUB 2O0KA 3AWIA 4OHOA 3QNWA 4AG3A 5ALXA 5BQPA 4B85A 1HNZB 1TK3A 2M6RA 3UFXB 2G8NA 4HQFA 3NBAA 2EV9A 2XA9A 4EL0A 3TL3A 3THYA 1JQLB 4DV4B 1E69A 3B3AA 5LP6F 3GGJA 5I4KA 2GN8A 4HXFB 4YASA 3DUFB 3L04A 3FCEA 2J3KA 3IODA 2CYCA 3IHTA 3O38A 3IVXA 3ZDEA 5IBCA 3S2EA 1PSZA 1TA9A 5IDXA 1QFXA 5E4JA 1PL6A 2HLPA 2JPDA 2YN2A 5CDHA 4KR2A 3BSSA 3GGOA 4Z7JA 3O4JA 3OU7A 4QRIA 5GV7A 2AQ8A 4FFBB 1SIUA 3UOGA 2WSIA 2VSQA 4CFYA 4Q3OA 2JGEA 5J4HA 5FPQA 3MNFA 1MOQA 3K4HA 3U1TA 2VAWA 4D44A 1X0XA 4YI3A 1Q0SA 4RF5A 2ZUTA 1W85A 4BO8A 2YJTD 3OE7D 1EINA 4HLUA 4TWBA 4XA8A 5KYYB 4LDQA 4JK3A 2L2QA 1ZJWA 3JQ8A 4MDEA 3HMQA 1XWWA 1XTSA 3CLUC 1NKSA 3KEOA 3B3JA 2ONZA 2ZI3A 4KWIA 3VKUA 1UP7A 3DQZA 5KPDA 1NIPA 2HO5A 3BM5A 4UJ3A 4ZOLB 1GWNA 1NVMB 1RYNA 4XD7D 2ZIFA 3N7TA 5AO9A 1NVGA 2AA3A 4JH0A 1JSZA 3TNDA 1VI2A 1JEQA 1L5WA 2D1QA 3E53A 3MM4A 1C3OB 1XZGA 3E7XA 3HKBB 4M98A 2OCXA 3GN1A 1X39A 2GVZC 2JDIA 4K9OA 3IP5A 3RRJA 5FR1A 4ZHQB 1GU1A 2BGNA 2FRDC 2YWGA 1KOLA 4AJIA 4GRIA 5IRCD 1ZGAA 4QSHA 5AM4A 1W94A 1QFMA 4JJZA 4B48A 4ARCA 1QHNA 5A62A 1M66A 3GRPA 2H2WA 5TARA 3H5OA 3WMFA 4DT1B 5BR8B 5A5DA 4YJ2A 4RA6B 1KWKA 5EL0A 4PCVA 4BNDB 4HD8A 3HBFA 3QKTA 3RIEA 3FROA 1K88A 1A95A 1FQWA 1RXEA 4NDNE 2WHPB 5FUWA 3WDMA 5HSGA 1CY2A 3G3EA 2XWBF 4LECA 1V7PC 3UKJA 4I4LA 1M8PA 2D06A 3U4QB 1WXHA 1QF9A 4QDOA 3D2LA 3DXYA 1MVLA 3SZUA 4B7AA 2PQ2A 4KXXA 4BRWA 8ABPA 2FOXA 1VGQA 5DLYA 3GA7A 3AL3A 3GXOA 1N32B 1ODTC 2HBQA 4G0UA 1CVLA 4ZHSA 1YQUA 5A6SA 3EGDB 4R1TA 5C51B 3LLMA 2XYPA 3D71A 4EHFA 1HM5A