3EZ6A

Structure of para-adp complex:tetragonal form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
394
structure length
388
Chain Sequence
b'SQLHKVAQRANRMLNVLTEQVQLQKEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Dna binding protein
total genus 130
structure length 388
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez6A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez6A02
3SYKA 3CH4B 3QKRA 3WP1B 2RKOA 1SQ5A 4X8MA 3NBZC 1G3RA 2OLKA 3Q5EA 4TZ0A 2VYFA 4RD6A 2QP4A 2ZRHA 3KQUA 3AF0A 4RZXA 1ODFA 2YJTD 3SE0A 4TYQA 1SVIA 4HB2A 2V1UA 3CLVA 1N5IA 1NBMA 4FINA 2MMGA 2QNRA 4NDZA 4NYMQ 3X1YA 5EE3A 1RIFA 1OH6A 4TL6A 2FG5A 2CHGA 1Z0FA 5GJVC 4AKGA 1E9AA 4NH0A 4AG5A 4DT1B 1ETUA 3THYB 1E2HA 1XF9A 3D31A 1G8PA 3T12A 4UXHA 4ERNA 2J1LA 3DPUA 2NPIA 2CBZA 3JZMA 1PLKA 5DO9A 1H8HD 4BFVA 4Z8YA 3O8CA 3K9LA 2WWIA 1E4YA 1CRPA 3RC8A 3KJGA 3OFND 3K70D 3U61B 2KI5A 3CR7A 3EC1A 1T91A 3ZVNA 3KFVA 4UXJA 1CIPA 3KFXA 4Q21A 4I4LA 5KNDA 4Q1FA 1AGRA 3BB3A 1CR1A 4M1MA 2FE4A 2DR3A 2GJKA 3UKDA 5IDVA 2GEUA 1NBMD 3JVUA 3GLIB 3AVWA 1JNYA 4HDOB 5FBVB 1Z6AA 1J70A 1UBFA 1X6VA 2AHOA 2G3YA 3U3RA 4MDFA 2QY9A 1L2TA 4R71A 2ZETA 3VMFA 2ZITA 3GJ8A 1AJEA 3DHWC 2IF0A 3FMOB 3TKLA 3GLHE 3DM9B 2Y8EA 4LZZA 4XD7A 4MRNA 3W8NA 3QPWA 5BW8A 4BE7B 3IGFA 5C18A 1W47A 3QXXA 2P2LA 2G77B 3SR0A 4LYFA 4B6FA 4IW3B 3QY0A 4FW9A 2QAGB 1E2LA 3LDAA 4EFLA 5EE5B 3G82C 4URWR 3RS7A 4DHEA 1W0KA 4A6XA 5AUPB 2XEXA 3A4NA 5LD2B 2O8CB 3A1TA 2D2FA 2DCUA 3QKTA 2OG2A 1GRNA 2VL7A 2WOJA 1KO4A 1L4YA 1YZKA 4HAVA 3TH5A 4A6PA 1DO0A 4QM6A 4WA7A 5EXTA 3GLGA 1U8AA 1OYYA 1RYHA 2FF7A 4JLAA 5EXXA 3VR4A 4MRPA 4BUJA 1NJFA 2VP2A 4Z51A 1IN7A 3A58B 4HB0A 1US8A 2C77A 2GA8A 4BQSA 1KKLA 3K09C 4OQNA 2FZ4A 1QG4A 2IYUA 2RGGA 3TUJC 4C0QC 5JRJA 3Q8XB 1D5CA 4ZO4A 5J4VA 1LS6A 1G8HA 1FTSA 4ESVA 3RRZA 3TW4A 3VNUA 2GTPA 4QGHA 2GJ8A 4Q7MB 3N2EA 4I81A 4CZ2A 4IDQA 4GBMA 1F2TA 2BJVA 5FI0B 2ZRNA 1FX0B 2XOKA 2B7CA 2CCJA 2QU8A 4GOKA 2QROA 5DGXA 4DDTA 2AK3A 2PX0A 5FOXA 3WYAA 3RS4A 4B34A 1U0HC 2GDJA 1KDOA 2BV3A 4KFUA 4UNQA 3DO6A 1Z08A 2FGJA 4IFEA 3ZVMA 2EU8A 5FTNA 5D3MB 4FCVA 4QC2A 5E7IA 4EPTA 2KBFA 4DRZA 4HAUA 1QBKC 4PHHA 3CRQA 1BMFA 4Q9IA 2XXAA 4M1KA 1F6BA 3B7GA 1XMVA 2YINC 1J2JA 5GJBA 2CVHA 1E79D 1XCPA 2JDID 3SBDA 2A78A 4I1SA 1IXSB 4O2LA 4OKSA 4F91B 5IT5A 4TZ6A 4B2LA 4LK2A 4S2EA 2NIPA 4ITRC 3ZGXA 2AKYA 3NDPA 2HDNB 3I73A 2JJ1D 1M74A 1EFTA 2DFTA 3GFPA 5DE3A 1IQPA 5JJIA 5SZHB 3SQWA 1XU4A 3PG5A 4IFBA 1Y63A 2VPPA 2ZAMA 3THXA 3B2EA 4ACAA 2C9OA 2AD5A 2G1JA 4LC1A 3QOFA 2ZRLA 521PA 1YZQA 1LF5A 1GSIA 1W2GA 3WBKA 4DBLC 4C30A 3FMIA 4CEHA 2O8BA 4O25A 2JIZD 2PT7A 1XEFA 1GL7A 2ZVPX 4GFDA 3SFZA 2G0TA 3ICEA 1Z5ZA 4NL4H 1N6IA 4C7OA 3ZVLA 1JEDA 4C0BA 1XTKA 1C1YA 2WKRA 3LRPA 4G5SA 3VU9A 2DBYA 2Q9BA 4RZ2A 4PTLA 2QSYA 3AEZA 1P2VA 4QBHA 2OCBA 3GJ0A 4BFTA 5CITA 3IIMA 4QOSA 1WRBA 1DAGA 1E2NA 2FFBA 4CRWB 3ICQB 1GKUB 5FR1A 2IHBA 2J7PD 1ESMA 4PSAA 1X8LA 4FD2A 1IBRA 3NBXX 4QM7A 4NP6A 4BFUA 4BZQA 2IUUA 3O47A 2GBLA 3R20A 1K5GA 4LI0A 5EXSA 4PR0A 1TNDA 1F3OA 5EE0A 1SKQA 1UF9A 2IBMA 3L8ZA 4TYYA 2XX3A 2EWWA 2FEMA 4NONA 3HWSA 1OW3B 2V1XA 1TAGA 1AGPA 1UEIA 4HEJA 4OHXA 3GLFB 3TBKA 4OHYA 3BFVA 4V0OA 1IOZA 3RRMA 3TSWA 1T0JB 4XVQA 2NTYC 2F9LA 4DLVA 4O0MA 1E0SA 2H57A 4E5UA 5A4JA 1CXZA 3KL4A 4F4IA 4WXRA 2AFIE 1ZYUA 4EKDA 4P4TA 1JI0A 2CXXA 1ZJ6A 2FPKA 4ZPXA 3MAAC 4JSTA 3HP1A 3N2IA 1E4VA 1DVRA 1Z6XA 4TYNA 5HZKA 4I1VA 1M2OB 4GMDA 4LJ5A 4XWAA 2C96A 2HLDD 1FNMA 2IYQA 4HZUB 1KSJA 2ZANA 4BLSA 1Q22A 1DOAA 2VF7A 1QHHB 3VR3A 1F48A 2J87A 2R62A 4FWIB 4NYMR 4Q1AA 1SXJC 4L9SA 1NMZA 3KQLA 1F60A 1N6RA 4XSGA 5DISB 2GF9A 3GJ6A 5DIFA 1R5NA 4TMZA 3IO3A 1U0JA 4LYHA 4ZI3A 2H92A 5HKKD 2ECKA 1OXXK 1VCMA 1ZM4A 1KMHB 3NG1A 5DI3A 3OEHD 4B43A 1E1RA 4TTQA 4D4KA 5JWOA 3PCRB 4FMDF 3I5XA 2F1RA 1GG2A 4KFTA 3ZH9B 5FR2A 2ZSFA 4LDJA 4WZ6A 4D26A 3GFOA 2ZYWX 1S4QA 1DELA 3C5CA 1COWA 2VLIA 3Q9LA 1FQKA 3NVAA 4K46A 5CIWA 3I8XA 4HAXA 2GCNA 3LXRA 1DBSA 3T5GA 1X8JA 2J41A 4BGDA 1TU3A 2RCNA 5HR5A 1VECA 3ZQ6A 4LHYA 4HYYA 1JB1A 1DG3A 4Q01A 1NLYA 2CL6X 3AP3A 5JI3E 4ON9A 4B2PA 2FSGA 1BYIA 3K0FB 5CYPA 1IN6A 3TVTA 1GNQA 1G17A 2V7QA 2OLJA 2ZYVX 3NXSA 1WMSA 4D4JA 2R44A 2D06A 5EP4A 1V43A 4Q9JA 3C8UA 2EW1A 4R98A 3U44A 1E3MA 1HYQA 1ZP6A 2RGDA 2O8EB 1U8YA 2QEQA 3ONWA 3KXIA 4N0EA 4TT3D 2MSEB 5HCIA 2QE7D 3M1IA 4X8LA 2VIIA 2VQSA 3G0HA 3ZD7A 1SXJA 3CW2A 1XP8A 4MKIA 4D6PA 2C2HA 2W6JA 3B6EA 4IOLA 3K70B 1NMXA 1KO7A 4BRWA 3OIYA 2ODEA 4M8NE 4YMVA 1QZXA 4ZDKA 5BXQC 2ZJOA 3SN6A 1E9FA 4H1VA 3EX7C 3RABA 4A4DA 1G21E 4JBXA 1R8QA 4ASUA 3BOSA 2VTKA 3QBVA 4GI7A 5P21A 1E2GA 4URXR 2C98A 3IEVA 2YC2C 4Q19A 4RKEA 5ANRB 2C9CA 2J46A 1OPXA 1N6LA 2V7QD 4OI1A 3UWOA 5DNYB 1G3MA 221PA 2ZJYA 3C16C 3T1OA 3WNCA 2E1RA 3EZ7A 3HDTA 1N6OA 2XNSA 4UJ3A 2ZRJA 1W4RA 5TDHA 3NIBA 4IEIA 4DLRA 1XBTA 2Q6TA 1IN4A 5FTJA 5LB2A 1EFHA 4URUR 5A0FA 1HE8B 3LAWA 1UKZA 3AM1A 4M9XA 3WYGA 2IA5A 2D3WA 3CNOA 1G20E 3VR5A 2JLSA 3EA5A 4P0TA 3CX7A 1OV4A 2DWQA 3FHCB 1NKSA 2X77A 2GHIA 1DARA 1P2UA 5DHFA 5LDDC 1CJVC 1EFRD 3WXMA 2NQ2C 2CLCX 4JLKA 4LPSA 2JLXA 4A0GA 4ASUD 1N0WA 2CLDX 2C99A 2WWHA 1KJYA 1IN8A 2QAGA 3PUXA 3AVPA 2FFQA 4XOIA 2I3BA 5J4HA 1WBDA 3GEHA 2QMEA 4D2IA 1KK3A 1S1CA 1VTKA 5KPJA 2GAAA 3AKEA 2KBEA 1YJ5A 4JIMA 1CRQA 1JAIA 2GZHA 3B1VA 2FSIA 4RCYA 3VX4A 4MYCA 3K1JA 1G3QA 3A8TA 3NEJA 2XAUA 1OFUX 1VDZA 5G53C 1N6NA 3IO5A 2OXRA 4B71A 1P61B 4OQFA 3M6AA 3FE2A 1GKYA 2IWHA 3KX2A 5KTYA 3EPHA 2CMKA 2CLSA 3VHXA 4Q1DA 5JHGB 1XPRA 1D2EA 2ZE7A 4Q47A 4A1FA 1H8EA 1HH4A 2ZRGA 1LB1B 1NVXQ 1IY2A 4Q9LA 5FTMA 4A0FA 1CR2A 2QTFA 3ZIAA 3FMFA 3T5DA 1WXQA 4PC2A 4FWTA 2ZI3A 5KSZA 4N0DA 4KFRA 3PUVA 2W2XA 1P9NA 3EIHA 1CJUC 2R65A 4QL3A 1FPMA 1E2QA 5L8VA 3AKCA 4NMMA 3E1SA 3OE7D 4Q1CA 1VHLA 1FX0A 3PUWA 4ILEA 4LBYA 3CPEA 4L15A 1OF1A 4GP7A 2B92A 1W4CA 2ZRAA 4HLDA 3WNBA 1G4UR 1XJQA 4OHZA 2L0XA 1OB5A 5FL3A 4OJKA 4E03A 1Q1BA 2DPXA 2Z4RA 1JPNA 2FSHA 2YOHA 3TIFA 1MO6A 4PAMA 2F6RA 1VYUA 3I62A 1OXSC 3CO5A 3VKWA 2JLUA 2H16A 2PL3A 3QVUA 2LCFA 4L9WA 1SVWA 1W36B 4M9ZA 3OAAD 3U3MA 1DAEA 2JCSA 3I8SA 4JBWA 4XH9B 3SYLA 3BE4A 5JSZB 1KDRA 4TL8A 2QUZA 2XJ9A 2KB0A 2PEYA 1ZMXA 4BLOA 5CIQA 1ANKA 2E87A 1KDPA 4P3YA 4TLDA 4L4UA 4R9UC 4XTRA 4XTCS 4O2RA 1GFIA 4EPWA 4YMTA 3SHFA 2EWVA 2F1IA 4EQ6B 4CT5A 4Q4AB 3EASA 4KBGA 1G7TA 5HE8A 1KJWA 1KJZA 2VRWA 3QKSB 1S8FA 4PQRA 3U5ZB 2CVFA 5JWRA 4JKIA 1XEXB 3GLHA 4C0AC 3TQFA 1ZRHA 5CLLA 2H7VA 5JS7A 4O3MA 2ZJBA 4F7WA 1T3HA 4ZKEA 4P33A 2GZDA 5CM9C 3TRFA 1ZM2A 1W1WA 4GOJA 2YHSA 3RAPR 4TWZA 3THOA 5A5GA 2QT0A 2VP6A 5FOVA 3THWB 2XZLA 4NZYA 1E0KA 2RHDA 2CL7X 4HSEA 4TTRA 4BLPA 3BAFA 2UKDA 1A82A 1OSNA 1EFCA 1PUJA 3MWLA 3OEED 2O0JA 2WJIA 3UK6A 5HE9A 2IUTA 3SDZA 3N70A 4F93B 2QN6A 2BKUA 2Z4SA 2XGJA 1N0VC 2NO9A 2C04A 4ABYA 5KYKA 3KQKA 1JR3D 2REXB 5KU1A 3EPJA 5FFMA 5B30A 4BRUA 2O0KA 4DVGA 4LGMA 2ZU6A 4NYIQ 4C4PA 3VR6A 1E2MA 1XJ0A 2IC5A 3CR8A 4PPFA 4RZUA 2QG6A 2YC4C 3CUEF 4MKFA 3B1WA 1UPTA 5CK4A 1L7VC 2ZJ8A 5E4FA 2GJAA 3I32A 421PA 3HU1A 3A37A 4KLNA 721PA 2FN4A 4DWJA 1SVLA 2FH5B 3FPAA 4HUQB 4M1OA 4PAQA 3T34A 1M6NA 2CE2X 3CZQA 1XTRA 3GJ3A 1RJ9A 1NJGA 4A2WA 3GP8A 1U98A 3FHOA 4LCBA 5DI9A 1M7BA 3I4LA 2ODBA 2ZS7A 2OBMA 4HZUA 5G3ZA 4ZCIA 2B7BA 1FL9A 4LJAA 2HV8A 2J7KA 4A8JC 3NBFA 3SZRA 5FPYA 4YMUA 1HQCA 2F55A 1I4TD 1VG1A 4QXAA 4A0HA 2A5DA 4BECA 3W6NA 2B8WA 3KTAB 2AN9A 1CEEA 2WJGA 2QM7A 2JEOA 1YZGA 2RAPA 4Z1MD 3AGPA 1UKVY 2NZ8A 3K0EA 1KNXA 2C95A 3A1WA 3QENA 2QPOA 2R8RA 4ZV4A 4NBSA 1OE0A 1KMHA 2JATA 1ZINA 2A30A 2FEOA 1P5ZB 2ZRKA 1EX6A 2IYXA 3AF1A 3SS8A 4P31A 4XWKA 4NE2A 3OIWA 1CJKC 1QRAA 4MGKR 5EP3A 1AM4D 5ELXA 2H1LA 5FUYA 3UMFA 3GQBA 2FFHA 4NYJR 2REOA 1X3SA 3BK7A 4WW0A 3UMRA 1JJVA 1A2BA 1XD2B 3AVXA 1KK1A 1J99A 1MH1A 2JLRA 2GJ9A 4R7ZA 4C2UA 1DG1G 2H5EA 2OCAA 1YR9A 4QHSA 2AWNA 1CULC 4W5JA 1GRRA 3K0AB 5CDFE 4BFSA 4EFNA 1UADA 5AJZA 3K0FA 3Q3JB 3BS4A 2IYTA 5FBLB 4BLTA 3LH5A 4PQFA 3EPKA 2J0UB 5C1BA 4QG7A 4TLCA 4M9SA 5J4LA 4PC6A 4YXWA 2O8DB 4DUGA 3NH9A 1HUQA 2D7DA 2RGXA 2WSSD 1E9SA 3KXKA 4XIGS 3I3SR 3LW8A 4A8JA 3CRMA 2Z83A 4Q4LA 2A2ZA 4AIIA 1AQUA 2HT6A 2ZI5A 1SKYE 2P6RA 1PUIA 5UKDA 5KSOA 2FNAA 4RFSB 4CEIB 3MJHA 2QORA 3IBGA 3LQQA 1UAAA 4Q18A 5JFGA 4HDCA 4QFMA 2GCOB 4JSYA 3KDSE 1II8B 1Q1QA 4JBYA 1KY2A 2GKSA 1MO4A 2GEVA 1N3BA 1E9CA 2V55B 2ZU0C 1FMLA 5FUVA 3RRNA 1EX7A 3MSXA 1TEXA 2YNMA 3HU2A 3IUYA 2HJGA 2ZRIA 4Q4HB 4AK9A 1FQJA 2OT3B 1T3SA 2O52A 1FZQA 4DLZA 2JLWA 2KE5A 4Z54A 4EPVA 1RRPA 4LWZA 1OXUA 2YKGA 3WYFA 1LNZA 3GEEA 1EXMA 1KSFX 3GJ4A 1XXHB 1TQ2A 2FFAA 3VAAA 1ESNA 5H1YA 3QXJA 2GZAA 2REBA 3CKLA 4LYJA 4AWXA 1T3LA 4KU4A 2R9VA 3HPQA 4MRSA 1E94E 2ZR9A 1OKKA 4YDSA 3ADDA 2BC9A 4OL0A 3QF4B 2J0QA 5L3QA 1Q44A 2VP5A 1KNQA 3IBYA 3LA6A 4HATA 1U81A 4LJYA 1EWRA 3ND9A 2VHCA 3SJCA 1VIAA 4UNSA 5L3RA 4CT4B 4OBEA 3P26A 2KJQA 4JT4A 3QQ5A 5AJWA 2WSMA 4EDHA 2QBYA 1TADA 5EJEA 5BWMA 4EPYA 1JR3E 1RC8A 4HAYA 3QG5A 1UEJA 4BASA 2ZPTX 4FMBB 4FIDA 1LF0A 4QJ3A 1PVOA 1M7HA 1NY5A 1ZCBA 3LW7A 1XTJA 3SEAA 3BFKA 1KO5A 2F3TA 3ECCA 1YR6A 1DEKA 1GZSA 5AUOB 2IYLD 5K8UA 1VMAA 4D80A 2PMDA 3I92A 2GF0A 3L43A 4A9AA 4EJSB 5HPYB 5JI2E 2YWEA 3RVBA 1ZD8A 4C0SA 1P75A 3GLFE 4D4LA 4B33A 2VF8A 4KO8A 4PO8A 1OFHA 4NCHA 3T06B 3L0OA 3OIVA 1DE0A 1GUAA 3ZZ0A 4XD7D 1BO6A 4EFMA 1IJFA 1WF3A 2VHJA 1I2DA 4DCTA 1HY3A 3WMEA 3W34A 1B0UA 3NH6A 3U3JA 1E2JA 2E9SA 3FYHA 3PUZA 1RZ3A 2ONJA 3M4YA 4IXMA 1KI6B 4TQ9A 4ZIRA 5CK5A 4PO9A 1WB9A 4B32A 2EQBA 2VA8A 4IEEA 2ZR7A 3ZS8A 1VCNA 1W0KD 2J45A 2GRJA 2IF2A 1E1QA 2RGNA 1R0ZA 3ND8A 4PANA 5AJVB 1SKYB 3AVUA 1OIXA 2CJWB 2YOFA 1DS6A 1ZAKA 2GVDC 3CWZA 5F98A 3T1TA 2XB4A 1FTNA 1DPFA 1W5TA 2GBLC 1GKIA 4PSKA 5KSPA 4A15A 2IS2A 4DCVA 3SQXA 2EYUA 3QEJA 5FBQB 1LV7A 4LV8B 3W6OA 1PLJA 4QGGA 3GFTA 4II7A 3R8CA 4MKGA 4Q4JA 5JJKA 2ZSAA 3QJYA 4JYBA 2JJ2A 1TQ6A 4NYIR 3F3YA 1JJ7A 1KI3A 2BKEA 2BMJA 1ZIPA 2OZEA 2XZPA 2YOGA 5DYGA 4JVNA 4M0LA 1Z6YA 3EIEA 4LBZA 4Q7KA 2WMNB 2XOKD 5CB6A 4OI2A 3VKGA 4EQ6A 1KK2A 2RGAA 4Q4AA 2W2VA 2AL7A 2J9RA 3HPRA 3W6PA 1G3IA 4GSYA 3EPLA 2VH5R 1JQLB 3CM0A 1P62B 1FP6A 3HR8A 2F3RA 1XEXA 2GXUA 2QP3A 4QGFA 2WWYA 2NZJA 3DZDA 1ZUHA 2BWJA 4KLZA 4F4CA 1KY3A 1O87A 2WWXA 5CYOA 5DLQC 1CBUA 3KJIA 4G0NA 1E69A 1KO8A 1BMFD 4N3NA 1OHHA 1XZQA 2OILA 4RVCA 1RFLA 4I1OA 2OEPA 4OI0A 3U7GA 2OO7A 1R0WA 2G83A 3THWA 1F5NA 1MRNA 5EZ5A 2JJ2D 1JBKA 1G9XA 4DCUA 3B9QA 5BYJA 2V9PA 2RGCA 3IQWA 2CNWA 3D6TB 1P2SA 1Z83A 4DZZA 3F5FA 3QEOA 3U2QA 2IXGA 2WWWA 2W6IA 1ZNYA 2PT5A 4IOKA 2AWOA 3WBJA 3D7MA 1D2NA 1E0JA 2BJWA 3QE0A 3P32A 3P20A 1G6OA 2N1BA 2V8OA 1ONBA 3FWYA 4M1WA 1BOFA 4XVUA 3Q72A 2ZAOA 2IS1A 1D9ZA 2X2FA 1NBME 3K9GA 1NKTA 3T1VA 4G1UC 3OESA 1CS4C 3K0CC 1E0AA 1TF2A 1CR4A 1W49A 2QPTA 1KI4A 5DSZA 4I1UA 1BS1A 1YE8A 1GRQA 4F92B 2H8KA 1Z2AA 1E9EA 2XNDA 3CPJB 1XPUA 2J59A 1XNJA 2HXYA 3Q85A 2D4HA 2P5SA 5HCNA 3B8HA 3IEUA 3T1QA 4YMWA 1RRCA 3RSOA 4G3XA 3TVDA 1C9KA 2WPDA 2WV9A 1M8PA 3L2OB 3UANA 3ZD6A 4B6EA 1HT1E 1AZSC 2HEIA 1Q1EA 2JJ8A 1YR8A 3AB3A 5F9HA 3QXSA 1GL6A 3DOEA 3WHKA 2GK6A 4DLXA 1OH7A 1UBEA 3VKHA 5KHOC 4Y0AA 2IYSA 5IK2A 1FP7A 2IXFA 3HYTA 4M22A 4FN5A 1IN5A 1G18A 4B3GA 4R2HA 1MABB 1HV8A 2OCPA 3AQ4A 3U7FB 4D81A 3AKDA 3D8BA 3MUFA 3SJAA 3CRW1 4TLAA 4K8OA 4W5HA 3WHLA 4Q03A 2VBCA 4BPBA 1A4RA 5FI1B 4CEJA 5F9FA 2BMEA 5JLJA 4JLDA 2ZJZA 4X8OA 1LFDB 1KIMA 1XRJA 3FKSA 3LD9A 3CH5A 1AK2A 3U6BA 1XD2A 3C7KA 4Q1BA 2D7CA 4HB3A 2WZQA 3LX8A 3R7WA 3TR5A 2EFCB 3IDQA 1AS0A 2BCJQ 5E7MA 2A5JA 2GXQA 3GD7A 4DEYA 1MOZA 3K0CA 4OQLA 2DYKA 2HCBA 2ZSDA 3EAQA 1MO3A 1Z2CA 1XCMA 1R8SA 4TMXA 3LY5A 3LBIA 4Q66C 2IL1A 3QBTA 2WKPA 4P4SB 3V9PA 4KV9A 1IY1A 4LOAA 1M1YE 3KB1A 4OQXA 1Z22A 3AVYA 3C15C 2J0UA 4UNNA 1T8TA 4M9QA 4MUBA 2OAP1 4B35A 3X1WA 3REGA 5JBQA 1W5SA 1R0YA 3SNHA 2H17A 2QMHA 3H4MA 5SZJA 3VNVA 4V0KA 4A0RA 5JS8A 1KI2A 3BRWD 3KQNA 1GM5A 1E1RD 4RD3A 2R6CA 2ZROA 2ZE5A 3TR0A 3WRXC 3TUZC 1LW7A 1Q3TA 5AK0A 4QGAA 3I5YA 2QAGC 2I4IA 3DVLA 4P4UA 3QKRB 3A1VA 4QBIA 2YWHA 2FGKA 1QVRA 1G64A 1R5BA 5LD2C 1COWD 4DT1A 2R6GA 4PO1A 3THYA 5GADl 2G0NA 2GCOA 3CF0A 1II8A 3BB4A 2ZE8A 2BMFA 2QQ0A 1Z0JA 3KUCA 5K8LA 1NVUQ 3CRRA 5HZHA 3AGQA 3T35A 4WBSA 4W5WA 3LVRE 3GJ7A 4B44A 1T9HA 4C0KA 2YWGA 3KKOA 4DB2A 4V03A 1Z3IX 1RW4A 4TN1A 4MYTA 1AS2A 2WWFA 2FMXA 3FTQA 4G01B 5M04A 2P65A 2VSOA 4CDGA 1J8MF 2RHMA 4HLUC 3IPYA 1GWNA 1LTQA 3RS2A 3D3QA 4OK3A 3EZ9A 4M1YA 4M53A 5BN5A 3GLIA 3ADBA 2J0VA 2ZJ2A 1Z6GA 2FWRA 5J5CA 5JEDA 1S9DA 1SXJD 1LVGA 2W6JD 3ADCA 1TQDA 1X86B 3CPHA 1KTVA 4PSVA 4QNRA 1OXTA 4LJ6A 2HF8A 2OAQ1 4ZKDA 5LB4A 1OXVA 5B57C 1NVVQ 2X8AA 1SGWA 5FBWB 1CR0A 1NG1A 3O8RA 1N0UA 3ASYA 4KBFA 2NO7A 4DC9A 2J5XA 2GILA 1U0LA 1W4AA 1P60A 2ZJAA 4FXPA 2HF9A 1IONA 1UBCA 1NF3A 4LV6A 4KSBA 2OBLA 4M1TA 5FL7A 3MD0A 2OFWA 4IJMA 2BEKA 4PZLA 2N42A 2ZR0A 4UNPA 1AS3A 2O8CA 2Q9AA 3PEYA 1Q20A 4TMVA 1XMIA 5TY0A 2G1KA 2CL0X 4BEJA 3SYNA 1S3GA 1JALA 3GEIA 3FVQA 2BDTA 4DDUA 1AA9A 1P2TA 3IIJA 4KYIB 1KK0A 3AF4A 4QBGB 5CJ2A 1QVAA 3RSLA 3U3OA 1OYWA 4QHYA 1KAOA 2UVQA 4FMCB 3TSZA 4ESHA 2CK3A 1G16A 3EC2A 2OFXA 4E22A 1P6XA 1G41A 4LPKA 2FJUA 4JVSB 2BVNA 1RVDA 4KVGA 2ERXA 3PVSA 1IAQA 4HLUA 1SHZA 2CEAA 4DXAA 1GL9B 3LFUA 4H1UA 1WQ1R 5IF9A 3JVVA 5FTLA 1US8B 1EFUA 4IXNA 4LBWA 3B82A 4DSOA 3FGNA 3KJEA 2FU5C 1D8TA 3X1XA 4DIDA 4N1AA 1TPZA 3PR1A 4DSUA 5D3MA 4PPGA 1JXMA 4EIWA 3BFXA 3LLMA 4JZKA 1R10A 2V54A 4DSNA 3MCAA 1XFAA 4JJZA 1R2QA 1MRSA 1Z6TA 2DFKB 1B23P 3NHAA 5GJCA 1XTSA 3EWAA 2JAQA 3VX3A 1F2TB 5FTKA 1AKYA 2H18A 2R6FA 1U8ZA 1G5TA 1XB2A 2WM9B 3BJIC 1T5IA 1H8ED 3FMPB 3NC0C 5E95A 3UXMA 2ORVA 3ZIAD 3IHWA 2NOAA 5L3VA 4LHXA 4IOMA 3BH7A 3FKQA 4TLBA 3NWJA 1QHSA 1A7JA 3LNCA 4YDHB 1V5WA 1U9IC 4KFSA 5JJLA 3F0TA 2P67A 1II9A 2ZVQX 3W5IA 5KNCA 2HUPA 4IDHA 3TAHA 1SHKA 2BEJA 2BM0A 2QRZA 2PX3A 1MT0A 4WIAA 4KXFB 4AKIA 4L8GA 1QF9A 2KWIA 4GPTA 1PV4A 3PIRA 3SC3A 1WE2A 2R6AA 4B75A 2P6UA 4TSFA 3B5JA 3OZXA 1Q1ZA 4IVRA 2IYRA 4RZ3A 3CIOA 1KHTA 1WDTA 3L0IB 4WAUA 1ZC4A 3SFVA 4IOJA 4V0ME 3J81k 3THXB 2ZYUX 2Q3MA 3TLXA 5B64A 2XSZA 2BBOA 3JZAA 1NY6A 1TUEA 2VHTA 1RYFA 3PENA 3I1FA 3PUYA 4U02A 4CEHB 2WWGA 2ZQ5A 3Q7QA 4NU0A 3H1TA 2BBSA 2ODNA 3OHMA 3QXCA 4D0NA 4PQYA 1L4UA 1IY0A 1YQTA 4NKRA 3PJRA 3NC1C 4C7OB 4TL9A 3QSYA 3AV0B 4LUCA 1IM2A 4MH0R 4UNRA 3AVVA 3VU9B 2ATXA 4TQAA 4GMXA 1VHTA 2P5TB 5EQTA 4RSGA 1G8FA 3H84A 4JL8A 2Z43A 3K9HA 1JEEA 3P1JA 4LJ9A 2YYZA 3GLFA 821PA 1FUKA 2FV8A 3K9NA 1JPJA 4NTZA 4C2TA 2JLVA 5IRCD 2C78A 1GVNB 3ZLJA 2FDCA 2RB4A 4S35A 3PEUA 2HCJB 2GXSA 3BWDD 3F8TA 4KCGA 3SJBA 4D4MA 1U9IA 1FFHA 3IILA 3W90A 5EE9A 4IKEA 4TYPA 1CTQA 1E9RA 4W7SA 2AK2A 1XDBA 3RLFA 4TMWA 3U3KA 4URYR 4C0HA 5KOYA 2AXPA 2BMDA 1K8RA 2ANCA 2AKAB 2W58A 3ETLA 1OT3A 2IS4A 2ZRDA 2XTMA 3MWKA 2V3CC 5KSYA 4B48A 4IDOA 2ZUCA 4L16A 1HT2E 4LJ7A 4TMTA 4US2R 3BERA 4KHZA 4B3BA 2WOOA 2WAXA 1XXHE 3I61A 4YMSA 4DCSA 1HA3A 2GK7A 2PZGA 4Q00A 3VR2A 3H86A 1JAHA 1QHYA 3QF7A 4AYWA 1DAFA 5TV2A 3CF6R 3R9WA 2ASEA 1QHHA 4ACBA 3QPUA 1VG8A 4UXIA 2CHQA 1J90A 4AD8A 4A2QA 1P72A 4PX9A 4DB4A 4EUNA 1U94A 3K70C 3W5JA 1E32A 1TQ4A 4BFZA 3RS3A 2EFGA 2GXAA 1RE0A 1T4GA 5FOWA 2IYYA 3RWOA 2F1JA 4G5GA 3WNDA 2XZOA 1E2FA 3RS5A 5SZKB 1UFQA 4M21A 1IXZA 4DLYA 2NGRA 3AVTA 2KSQA 3MJRA 4NHOA 1S1MA 1RKBA 4TL7A 3PV0A 2IX3A 3TMKA 1P7CA 1ZD1A 4MYHA 3SU8A 2ODWA 2ZREA 4ZDWA 1E9DA 2ZRBA 1A1VA 4GL2A 3L8YA 1U90A 1G4AE 3PEVA 2WAYA 5AUQA 2IXEA 4RCZA 1Z07A 3GPLA 2QP9X 1U99A 3B1ZA 1G19A 2EVWX 2QTHA 1W4BA 2J3EA 4E07A 2IHYA 3LV8A 1KZGB 1YHNA 8OHMA 5FPTA 4Q1EA 4XVRA 4C0JA 2VHQA 4OQMA 3VR1A 3CX6A 1GNPA 4M2LA 4C0LA 4B76A 1TF5A 3EZ2A 1NVVR 1G291 2OBNA 3TW8B 1E96A 3SOPA 1XEWX 2O8EA 4KYUA 1H8HA 3BB1A 1QHGA 1N6PA 1D6JA 2ZRFA 3L0PA 3AP1A 5FBRB 5JRZA 3HR7A 1BKDR 1MV5A 2WJYA 3OFNA 4NCJA 4UJ5A 1NIPA 1UBGA 3A1SA 4JLNA 1N5JA 4FMCF 2ZM5A 2YWFA 1R6BX 4DDVA 1Z0IA 3H0KA 3NEYA 1KSHA 3U44B 5J4YA 1XPOA 5IHPA 1XMJA 2W2TA 1GIAA 4XWOA 4B3XA 2BIFA 2W00A 1Z29A 3O8DA 4QKQA 1DO2A 2JLYA 5KUTA 1SXJB 4CW7A 2RMKA 4B74A 1PJRA 5J4KA 1NMYA 4DLTA 3QIAA 3RS0A 2NO0A 2OM2A 3FFAA 3TUIC 4YXWD 4V0LA 5F2EA 4DUGD 3R8FA 1KO1A 2R6DA 1D2MA 3BGWA 3NDBB 2GWHA 1PLLA 1ZC3A 3HYRA 2Q21A 5EP1A 2QI9C 3UG7A 4IVPA 4IDNA 3EZFA 2Q3HA 1CKEA 2RGNC 4RKFA 4CYMA 3P27A 2V6JA 5DYIA 4TLEA 1GITA 4IVQA 2BBWA 4AC9A 4AI6A 1N5KA 2LKCA 4Q9KA 5JEEA 4FMDB 1XJCA 1ZNWA 2A5YB 3PXGA 4E09A 6Q21A 2ONKA 4GT1A 4RD0A 5EUMA 3B85A 5BYKA 3KQHA 1KAGA 2YVUA 3FOZA 4P32A 1ZD9A 3EWSA 2V6IA 1KI8A 1OLOA 3AF3A 4LHZA 2ZXUA 4UKDA 1W36C 1D9XA 1VCIA 2QTVB 3DKVA 3AP2A 4JLBA 2P0EA 3AF2A 1BIFA 1VG9B 2ERYA 2B21A 2D74A 4KI0A 4Q9HA 4A82A 1R7RA 2SHKA 2GESA 2ZRMA 1XCGB 2Z0MA 4PXAA 2CCKA 2OSBA 3LO5A 3V00A 2QT1A 3R9XA 1ZIOA 2AFHE 2QSZA 1KKMA 1TL7C 4L5BA 5C4MA 1TF7A 1NSTA 4JYCA 4PHFA 4US0R 4U7DA 3I72A 2VP0A 5CLQA 1OKKD 1AIPA 1OFIA 2B6HA 2FOLA 1JR6A 5GJWC 2CCGA 2A3RA 3X1DA 4C9BA 1ZM3A 3S1AB 2A9KA 3BBPA 1W7AA 2A5FA 1XWIA 1S3SA 3HU3A 4PHGA 3QPVA 5EP2A 2O8FB 3BORA 1FOEB 4AURA 1P9RA 3IHLA 2HT1A 1O3YA 3DM5A 1N5LA 4PHTA 1YRBA 2EFEB 1PZNA 4DSTA 3MMPA 2B8TA 2JA1A 1CU1A 2UZ3A 3TQCA 1GOTA 2PLRA 2ZRPA 1E79A 2JDIA 4JKYA 3BC1A 3PQCA 1XD9A 4ARZB 1Z47A 4B3DA 3X1ZA 2BOVA 4MKHA 4BEBA 2JJ1A 2O5VA 1CF4A 2TMKA 4URVR 1YKSA 3WY9A 1F2UB 1SZPA 4QJ4A 1ZNXA 1YZTA 4OI4A 1NLZA 4EAQA 3C5HA 4JLJA 4ZDJA 5JMTA 3FFBA 4Q7LA 4TMKA 1W44A 4MA4A 4D0GA 2VO1A 2NO6A 3QVVA 3SJZA 3A36A 1M34E 5JSZA 2JIZA 1NN5A 1GP2A 1ZUNB 1KMQA 1A5TA 1S96A 2XITA 3K8YA 1QG2A 2G88A 1SVOA 4D25A 2C8VA 3LBNA 4C3ZA 5L3SB 1RPZA 3B1YA 4HAZA 5CJPA 1OB2A 3RYTC 2BM1A 3EW9A 5AJXA 1E2DA 1E1QD 1XX6A 3UIEA 2C9YA 3W3ZB 3K0SA 3FHTA 3U60B 4M1SA 4WXPA 3QKSA 4LJ8A 5TXGA 3PFIA 4MYUA 2G6BA 2ZYTX 4R2IA 3CRVA 4JVLA 2J7PA 2D62A 3UPUA 1AZTA 1W46A 1YZLA 4NCNA 1VYTA 1KI9A 3B13B 2ZJ5A 2IEYA 4XJXA 1T6NA 3LBHA 3ZJYA 4W9MC 2EFDB 4PZZA 3AUXA 3TAUA 3RHFA 4A92A 4CVNA 4GDFA 1U2RA 3K09A 1W36D 2AR7A 1XD8A 2ANBA 2F1HA 3LLUA 5AJYA 2F43B 4HDQB 1II0A 2GNOA 2PLFA 3KUDA 4KAXA 1UDXA 1SVMA 4OHVA 3V4RA 5KNBA 4BWYA 3AKYA 3GLHB 1AQYA 5KPDA 1X1SA 2PCLA 1GILA 3DDCA 3ADKA 2OHFA 1GDDA 4LYAA 1K5DA 2HXSA 3NTUA 4TQUS 3OF5A 5JZVA 3BH6A 5K8TA 4PC1A 1E2KA 3UWKA 1TU4A 1ZM9A 2IW3A 3GJXC 1R5OA 5DN6A 2IYVA 4LY6A 3RNLA 1ZVQA 1N6HA 4IDPA 3QG1A 1NG9A 1S2MA 5C46F 1QHNA 4PC7A 1GNRA 1W2HA 3QUSA 2IT1A 4JLOA 2HYIC 1JXOA 2JGNA 1EESA 3B78A 2HLDA 2PCJA 4DIEA 2DHRA 1OHHD 3G5UA 2ZEJA 1TX4B 4WVFA 5FPKA 3RDPA 2VP9A 2QM8A 2WHXA 4HUQA 4Q5IA 4HB4A 2QQEA 3LXXA 1YZNA 1P9WA 4FCTA 5KO2A 1Q3HA 2VSFA 2CNWD 2ZI9A 4MQBA 1VIYA 2DFLA 1K6MA 1VKJA 5KDDA 1NRJB 1DADA 2W6ID 2GVZC 1FUUA 1H65A 2WJJA 1A2KC 3V4FA 5JCZA 5HKKA 3OEHA 2ORWA 3LX5A 1Y3AA 4DJTA 4POAA 5DN6D 2WTUA 4EPRA 4DLUA 2ORIA 4DDWA 3SBEA 3KXLA 1Q57A 1WCV1 2X1VA 1RJ9B 2ZSEA 3KTAA 4LHVA 1HTWA 4H9GA 2G9NA 3U7EB 4TYWA 2WIBA 1XTIA 2WMOB 3KB2A 1KOFA 2ZS8A 1S9HA 3O8BA 1QHIA 4IHQA 4BLRA 3W8RA 2MMCA 4A2PA 3ZYCA 3U7HB 1XEWY 1EGAA 3KZ1E 3CBQA 3UATA 2QPAA 3HJNA 2XNDD 4U00A 4RD1A 5FPSA 4KSCA 4A36A 4GNKA 1N6KA 1MKYA 2R2AA 1G7SA 4GZLA 3E2IA 2OE2A 5F3WB 2RGBA 4DLWA 4LJ4A 1C4OA 1J8YF 2QGZA 3BXZA 2DWPA 2MSDB 2WPDD 2XTNA 3MG9A 4ZI2A 4BFWA 1BH2A 4KITB 5H70A 2GJSA 3KKNA 2ATVA 2F9MA 5H8WA 5AR1A 3K0AA 4AG6A 4JVMA 4TT3A 2A7QA 2ZS9A 4V0MA 2QE7A 1TMKA 4F38A 2ZIAA 1KI7A 2AD1A 4RD4A 4US1R 1NLFA 5IK2D 2EFHB 1OH5A 3GLGE 3QKUA 2O8DA 3AUYA 4JLPA 3DL0A 1ZU4A 1OIVA 2OXCA 3L0SA 4UQOA 4V0NA 5AWFC 2V4ZA 4WOPA 5H68A 3U4QB 1ZNZA 1Q12A 4K81B 4WZAE 4CGZA 1LS1A 1NL3A 4GRAA 3LQRA 2DB3A 4JMPA 4MGYR 4LHWA 2VP4A 3E70C 1M7GA 4CEIA 3FKSD 4RFSA 4RJLA 2VHUA 1SVKA 2XJ4A 4YONB 4KODA 2XTZA 1Z06A 5J47A 4CIDA 3TGPA 5HTKA 3QXHA 1G7CA 2NMVA 2WIAA 1NP6A 2IK8A 4JS0A 4URZR 3ZDQA 3U6KA 4EJSC 4FI3C 1FNNA 2PEZA 2WJVA 4A8JB 1XMSA 2ZUBA 2YV5A 3CWQA 1E2IA 2PMKA 2X19A 1G5RA 4Q4HA 2J0SA 2QMUA 4GP6A 5G3YA 1WBBA 3W3AA 1HURA 1JQJC 4HLCA 3P4YA 1XXHA 3A1UA 2CE7A 1EFRA 1I4LD 1NSFA 3E5HA 2LKDA 2WBLC 2XB2A 3B60A 3ZQJA 1DAIA 2Z6VA 3BH0A 1ZM7A 2Q0HA 2DWOA 5SZIA 3VHLB 2EYQA 5CM8B 4PPNA 4B47A 4B73A 3QF4A 3PITA 3M0EA 2N46A 4NYJQ 2RGEA 3KKMA 5D3QA 3RWMB 2HYDA 2ZRCA 3DKPA 1FW6A 4BFXA 3CNNA 2PH1A 4MGZR 3X2SA 5G41A 5JECA 1ZW6A 1NN0A 1T8UA 3Q7PA 5DH9A 4IRUB 3ZZUA 5EE1A 4G5RA 2OESA 4B3FX 5CB8A 3PEWA 1I4DD 3A6PC 4LX0A 2O0HA 2Q3FA 1Z0DA 4NPHA 3IQXA 1UM8A 4LC0A 3R9IA 1NI3A 2CHVA 5FUXA 5E3HA 2DFNA 5L3QB 1G8YA 1VYVA 1ZBDA 2JASA 4I99A 1CJMA 3N5CA 1J7KA 5LBIA 3DOFA 4Y0VA 3L82B 1QHXA 4BZPA 4EJSA 1KGDA 3IPXA 1YRAA 1NVWQ 1ZCAA 3LVQE 1VG0B 1YVDA 1I2MA 4OYHA 2QBYB 2QA5A 4MUAA 2ZE6A 3MLEA 3OE7A 5EZ6B 5CDFA 3A4LA 5EUQB 1ZU5A 1OFTA 4GOXA 4RFVA 3DMDA 2HJVA 2NPFA 3S1AA 2IYWA 4Z8XA 1EWQA 2C5LA 1MR3F 4Q7JB 3GLGB 1GAJA 5C2JB 3C41J 1KI6A 1CJTC 2LWIA 2Q9CA 2O8FA 3EARA 3SI7A 4KVAA 4NCKA 1E99A 2AX4A 5FL7D 5KDLA 4PFSA 5TB5A 1MO5A 4AKHA 3GJ5A 4JJKA 1R0XA 3OAAA 5FOUA 4QNMA 2CJWA 5B2ZA 2OUKA 3CONA 3T15A 2BBTA 2GEDA 2I1QA 4ARZA 2DY1A 4MITA 1N25A 3FDIA 1JECA 1G3UA 2K5UA 3EIQA 3Q5DA 2VEDA 1HE1C 2PJRA 3FB4A 3LWNA 1RRFA 4ZIRB 4B3CA 1G5PA 2CK3D 4MRRA 1E2PA 1F2UA 1S0UA 2NO1A 4AYTA 4AKEA 2W0SA 3KKQA 2IYZA 2PZFA 5JCPA 1Q21A 1VCOA 2PJZA 2MSCB 4NCIA 3CF2A 1Z0AA 3B1XA 2FX3A 3RANA 3WRYC 5L3SA 4V02A 3VFDA 2F7SA 621PA 2FPLA 1KSGA 5FH9A 1R4AA 2XXAB 1YR7A 4BLQA 4MRVA 3ZZTA 1AN0A 1UDWA 2FA9A 2WJHA 5FUWA 2ZUDA 1G7RA 4OJQA 4BFYA 4DEXA 5G40A 1HEIA 3IIKA 1GTVA 3EZ6A 2OFOA 2ZI7A 1SVSA 3ASZA 4Q4JB 2IS6A 4RY2A 3EG5A 3UMSA 5J40A 2A5GA 1CP2A 1IJEA 3IKJA 1FMJA 3CNLA 4G5QA 1T0HB 2YZ2A 4DCNA 1YU9A 3OEEA 1W48A 1UKYA 2QL6A 3KKPA 4Q48A 2QGNA 1ZUIA 3QI2A 1IHUA 4PAOA 1UKEA 2AXNA 2O8BB 2F43A 1JR3A 3RC3A 1E9BA 5C4GB 3P4XA 3UG6A 3DMNA 1P4SA 4DLSA 4MDEA 1XZPA 4JLVA 1OJLA 1T5LA 3BD9A 5DHAA 5TMPA 1G1MA 2WICA 5JHHB 2UZIR 2I1VB 1E6CA 5JWHA 3H2YA 5FPHA 3MWJA 1QDEA 4OK5A 4ZDIA 1Z0KA 4KJZA 2W83A 1Q0UA 3MWYW 5FOSA 2WKQA 2ZSBA 1OIWA 2QMOA 2W0MA 2OCYC 1ELOA 2P3SA 2FPMA 2ZI6A 4J0QA 4TSFD 1EK0A 4QHTA 2OV2A 1G6HA 2FZLA 3DZ8A 3EA0A 4HUTA 1OH8A 4BZXA 3TJZA 4HLQB 4RD2A 4GZMA 1WP9A 5GVRA 2RH5A 1X8KA 4TTPA 4YQFA 5KDOA 3TSOA 5TVKA 1SXJE 2XSZD 4AYXA 1DAKA 3K53A 3C14C 1TEVA 2BCGY 4HI0E 3CX8A 4WZBE 5EXPA 1NN1A 4JT2A 2PBRA 3NKVA 1N2CE 3AVQA 2X2EA 4U5XA 2PZEA 4LSGA 2QENA 3BIFA 2P6NA 5TARA 4D82A 3RRYA 2QAJA 5BQ5A 4D0LB 4Z1MA 3ZVRA 2Z5FA 1W0JA 3T61A 4OHWA 1WA5A 4M4SA 3DEFA 1AKEA 1DTSA 2ZI4A 3REFA 2GCPA 4AY2A 3TE6A 2JLQA 1DAHA 1NNEA 2QRNA 4OK6A 3ZS9A 1EG7A 1KDTA 1SULA 3B9PA 3WP0A 1LY1A 1NIJA 1KI1A 5GVSA 1NN3A 3SHWA 1BYUA 3MGCA 3MRSA 3GLIE 1MABA 1E98A 1E2EA 4QRHA 5BN4A 5LPNA 4PC3A 1YZUA 1HQYE 2CDNA 4HZIA 4PZYA 3W9YA 5BN3A 3NHBA 4LRWA 2GETA 2BHRA 3A4MA 4CF7A 4PPQA 2IUSA 4X8HA 4JL6A 5FOTA 4FCWA 4Q02A 3WMFA 2NG1A 2GAOA 3NBYC 1XTQA 3QNUA 1TTTA 3TNFA 1IXRC 3EXAA 4QJ5A 3AH8A 4YC7A 3WMGA 4YLGA 2ZTSA 2JLZA 4QBFA 4JL5A 1G8GA 1P3JA 4MGIR 5E7JA 1TUIA 3VQTA 2FSFA 1W0JD 3MFYA 2WSSA 5DI3B 4LV5B 1DAMA 3GMTA 1CLUA 1Z8FA 1KYIA 3AVOA 3TK1A 4ZCMA 2VSXA 5AUNB 1RRGA 4P4SA 4CEJB 1L8QA 4B2IA 3CB4A 4F4JA 3KJHA 5K8IA 3C4JA 3VTKA 4XSHA 2IWRA 1VPLA 4DKXA 2C03A 2D2EA 4ZCLA 1UJ2A 3R7WB 4G5OA 1KZ7B 4JLMA 2WVJA 5B58C 1P73A 1Z63A 1X1RA 2IEZA 2QZ4A 121PA 1Z28A 3CZPA 3GCGA 3U4QA 3OIUA 4HAWA 4EPXA 4LBVA
chains in the Genus database with same CATH superfamily
3CH4B 3H0CA 2VRNA 3L41A 3OLXA 5IX8A 2RKOA 1SQ5A 5BVGB 5EMKA 4X8MA 2FY8A 5KHLB 1PGPA 2I76A 2OLKA 3AR5A 1MMFB 3PYMA 4L57A 3UQYS 3AJAA 4P7KA 2HJRA 1GPBA 5H16A 4JP8A 2XE4A 5D5HA 1ZI6A 2W7TA 3G5TA 1V8OA 1ZA2A 1PNVA 4ZOLA 4ZQHA 4ZTZB 2V1UA 4TTJA 5A4IS 1KVSA 1QV9A 2XA9A 3J81A 2G25A 2IOYA 3TMAA 1U0SY 3CSDA 1HFKA 3PSAA 2P2GA 2IZ6A 4TL6A 5I4IA 3ZI0A 2FG5A 4LZAA 4ESOA 2XUHA 4IHAA 1Z0FA 1C2TA 2HLHA 3LQFA 4AG5A 1U5CA 5I8WA 1PYGA 5ADVA 2GYUA 1K6XA 4OYRA 1ZD4A 1XF9A 5A5DA 1UC8A 3OPQA 2VXBA 4E3WA 2ZIZA 3FPCA 1IL0A 5DO9A 2X6RA 1BJTA 4Z8YA 3K9LA 1LSOA 2WWIA 1GAWA 3FDZB 4HNQA 2OC4A 5DTIA 1B6RA 4LHEA 5ALWA 3U61B 2OSVA 3KZVA 3CR7A 1WQ4A 1YDWA 5CBPB 1CY2A 1W94A 2NW6A 5IXJA 2Q50A 1CIPA 3KFXA 4IQGA 4Y8VA 3OZBA 3OZVA 4I4LA 2HQRA 5D8DA 2H8GA 3M2PA 4ALLA 3BB3A 1LK0A 2BSAA 4P0QB 2OHVA 1UINA 5LP6F 5FAXA 4V0SA 2GEUA 1NBMD 1IULA 4MEAA 1Y7IA 1MUUA 2H3EA 1BNCA 5FBVB 2PD3A 3P94A 2JA2A 4WACA 5EJFA 4MDHA 3MM4A 1JTEA 4B7XA 1YS4A 2ZBDA 2ZITA 3GJ8A 3PQFA 2IF0A 3MB8A 1JS1X 3GGSA 2HCFA 4XD7A 2Q1YA 2P9TA 3AU9A 2GZMA 3QPWA 3PTZA 4H18A 3UUWA 3K9FC 4YO7A 2GI4A 3IGFA 5C18A 3IAOA 3I5AA 3QVXA 4AXXA 1I2BA 1UOQA 2JGRA 3R3SA 3GUYA 3BXOA 3ZLUA 4B6FA 3P9RA 1F20A 2B0JA 4L28A 4Z4GA 2CHUA 4QSMA 4DPLA 4FYHA 4R84A 5CRIA 2QAGB 2FE1A 1XDSA 3P2YA 3LDAA 4FFNA 4EFLA 5EWLB 3D3WB 4IIEA 5B1SA 4MW5A 4DHEA 1CQWA 1JU3A 4Y0NA 5AUPB 2XEXA 3FKJA 4EG3A 4G8CA 1GR1A 1DV1A 4LYEA 2Q5IA 3OPYB 4ZEVA 2D2FA 4OFWA 4FGZA 2JPDA 5DB4A 3UJ7A 1J1IA 3G2PA 2QZJA 1YZKA 2OZPA 4S1WA 1RQ7A 2Y3IA 4GBGA 2FLWA 4WA7A 4PRZA 1BW9A 5EVJA 1A5SB 1OYYA 2CVQA 2DBZA 2L18A 1ZJYA 3D2CA 1LV8A 5DWDA 3VR4A 1YVRA 1RJDA 2VHXA 4HB0A 1SURA 1US8A 1ZJJA 2C77A 2TECE 2WUGA 4X6XA 5H02A 5FQNA 4BQSA 3NI2A 3ZTYA 4Y2UA 2YYYA 4RTKA 2JFYA 4OQNA 1YUMA 2FZ4A 3VBCA 2RGGA 5K3FA 1V5IA 5CCXA 3HBAA 1XI2A 2I2FA 4B79A 2NUPB 5K2OA 1JG6A 1LS6A 3FR8A 1TTPB 4YAJA 1RDFA 4L0CA 3NRJA 4M46A 5JUWA 1QIHA 1I51A 1GA6A 4P2BA 2GJ8A 1T8RA 1ZXBA 3NWOA 4CZ2A 4AMZA 1F2TA 3CCBA 1FRVA 3MS7A 3NAZA 4FB5A 1PZGA 4IFIA 4OV6B 2XKJE 4UVEA 1DBIA 4DDTA 2PX0A 1P4RA 2C5BA 1CDOA 3PQ8A 5B3KA 5WRFA 4HPJB 4N01A 1KDOA 4HDNB 2FGJA 1AMOA 2OCXA 1JDBB 1VJTA 1Z35A 2EU8A 2I71A 4K87A 1VSUA 3RIMA 4A03A 4CTJA 1AMNA 2JRCA 4UCWA 3TYXA 4LRSB 1EHIA 3DAGA 4GO1A 4EPTA 5EJ8A 2NNLD 5H7XA 1CS0B 2BLNA 4YJHA 3WZ2A 4HAUA 5LSAA 3KQTA 4DM3A 3ZBTA 2O8VA 2XXAA 4IYJA 1F6BA 4M1KA 4RGYA 4CQMB 2UUAB 1U1GA 1TT7A 2PHZA 3IKMB 5JQGF 5J2TA 2P6OA 4O4LA 5GJBA 1EEHA 2A78A 3P2EA 5KYGA 2B36A 4ALMA 3V8BA 3V1NA 5CFRA 4B2LA 2IYFA 4DUPA 2Q8PA 1EE9A 2OP0A 1QVVA 2HDNB 2K4MA 4D43A 1M74A 2DFTA 1NM5C 2I4OA 2O2IA 3E3MA 3GFPA 5DE3A 1QC5B 1IQPA 2H52A 4LSZA 4HJXA 4ZO7A 1FDVA 3VZDA 1JLRA 1Z45A 4I8IA 4YHBA 5D3KA 5EC8A 3RARA 4X1KA 4CBVA 1K92A 4E4TA 5IKPA 1DHTA 4GSLA 2XE7A 3ZPXA 3HCFA 4HFRA 3GJTA 4IIUA 2W6MA 3GRKA 1U63A 1GSIA 1MJHA 1DHRA 4MVJH 2NVUB 2H65A 1W2WB 3CXRA 4DBLC 2JIZD 4FHFA 2AG5A 3AIKA 4K9KA 4NBLA 4R7TA 2AF4C 3GFVA 3H0EA 5BO5A 3BHMA 2ZVPX 2UAGA 1JAZA 3SFZA 1X74A 2G0TA 3ZJ4A 1ND6A 1Z5ZA 4IDCA 4NL4H 1J00A 4CG2A 2FMIA 2XQFA 2VHEA 4G5SA 3LRPA 3VU9A 1SKUA 1DT3A 1W8DA 4P58A 2J3MA 1GFWA 1TXGA 1P2VA 4QBHA 4TVBA 4BVLA 3EGDB 3GJ0A 3GRYA 3INRA 5CITA 5CA1A 3IIMA 2ZT6A 4U5QA 2SCUA 3SVTA 4O2AF 3BWMA 1DAGA 1NMQA 4CRWB 1GKUB 3Q7SA 3WKBA 2IHBA 2J7PD 1ESMA 1SU7A 4BO8A 1X8LA 4LDAA 1RYBA 5DEIA 1KWKA 1QG6A 3Q2KA 1QP7A 3BD8A 4NP6A 3O47A 2GBLA 1V3TA 1K5GA 3COZA 4LI0A 1G8AA 1FS4A 2C3YA 2C4WA 4GEKA 5EXSA 3CNBA 3PQ2A 5JAOA 5EE0A 4FDAA 1XLVA 3UJCA 3PR2B 5AXBA 5A05A 1XGKA 2XX3A 2I4TA 2NTVA 1FMCA 1ISHA 2ECFA 4DR5B 1UEIA 1H5UA 1ZK4A 2EX0A 4FBGA 1YR2A 1PEDA 4V0OA 1JIKA 1IOZA 5CXXA 4MS1B 4KRFA 2AMJA 1T0JB 2PGOA 2F9LA 1T15A 3SR4A 3RVDA 3DBLB 4OQYA 4LSWA 4V0QA 5AYVA 4OOEA 3RU9A 4I0WB 2XBLA 2QX6A 2EF0A 4CM1A 1DKMA 4O0MA 2H57A 4PVCA 5A4JA 3E9MA 1MB2A 5COQA 1T5OA 2AFIE 4IDDA 1WPQA 4GS5A 4MS4A 3WL6A 3UAOA 1LWNA 3VU8A 1ZJ6A 2FYTA 4OXRA 4B7AA 1CUCA 3MAAC 2P40A 4JSTA 4D4GA 4CTNA 1V45E 3N2IA 2EARA 4YV2A 1EDBA 5AK3A 4YACA 3AUSA 3F7NA 4XWAA 5FHQA 2C96A 2BKXA 3DTVD 2QHXA 2AOUA 2IYQA 3PQ5A 1AHPA 2AE1A 4HZUB 1S8OA 3HBFA 4JELA 1QORA 4KGVA 2B35A 4BLSA 1L5RA 2QW0X 1QMPA 4A7PA 5J2UA 4ZGWA 1H3NA 2PGJA 1R5JA 1QFSA 5IYZB 1A9TA 4Q1AA 1Q0RA 4FWIB 2ZZNA 2Z9BA 3HDYA 1NMZA 2MSNA 3KQLA 1JI3A 1D4ZA 2AXEA 2HUNA 4WLOA 4XSGA 5FI3A 2GF9A 2VXCA 4BC0A 4B3IA 4RSMA 4TMZA 1RI3A 1J4AA 1U0JA 1TZKA 1YVUA 1DSSG 4JJ7A 4XD2A 3LF2A 3GFGA 3RSSA 1ZL2A 2C8KA 4CMIB 5HKKD 2KS6A 4UBMA 1KMHB 2LBPA 5JWOA 1IC6A 4B43A 4D4KA 3UXHA 1XRPA 1EMDA 1QHEA 3FGOA 1U02A 3LO8A 2AH5A 2FZWA 3DE0X 3P2IA 2RJNA 3PCRB 1GG2A 3I5XA 3C6MA 4ID3A 3ANTA 4DA7A 5CXUA 4B81A 1TYBE 4LDJA 2DCMA 2OMKA 3A2NA 3NTVA 2V7UA 3S55A 4D26A 4WBXC 2C2GA 1MVLA 4KB5A 4HAXA 4W82A 3ZCSA 3FF4A 2X9VA 5IANA 1JLMA 2J41A 3DL4A 3GIWA 2P4SA 3L8CA 1QB7A 1TTHA 4INPA 4KK3A 2RCNA 5JS6A 1VKZA 5I44A 1UH5A 2HJWA 4LHYA 1RJEA 2EFYA 1DG3A 2XQVA 4P35A 2OZLA 4KPUA 2BSXA 1QGZA 4E5SA 3PKIA 4N0MA 1K6EA 1U2SA 4AJLA 5KVSA 3CEMA 2JRLA 2P2CA 3Q8KA 2A94A 4C6RA 4EARA 4EO7A 1JKMA 3VH1A 1MH9A 2BAGA 2WZBA 3EXFA 2X5JO 3MINA 1GNQA 1DUSA 4AS1A 2OLJA 3AK4A 3NXSA 3RU2A 4BNGA 2R44A 3SSNA 3U44A 4I9NA 3BGOS 4WPGA 1E5XA 1QIJA 2RGDA 1P9LA 4HAOA 3D5EA 3FZYA 3PJDA 3HA3A 2O8EB 1NE7A 5H81A 4N0EA 2A5LA 2MSEB 1I1OA 2VQSA 2XDQB 1ZO8A 1JKXA 1SXJA 2DH6A 2GBFA 3GZTB 3H87A 2OAEA 4RIIA 2C2HA 3OEWA 1U1EA 2EERA 4MHTA 4YCJA 3K70B 4WZBA 2COEA 1WMFA 5CNKA 4W5RA 1AQLA 1WLSA 5IEBA 5BXQC 3G0CA 4L8FA 3S44A 2NU6A 1E9FA 3ADOA 3ENNA 4H6VA 4D8TA 4A4DA 2IIQA 1G21E 4D4HA 4UTXA 1UJNA 4NBRA 4EFKA 3LFTA 2IYOA 1SQ0A 2NYRA 3GMIA 4IR7A 1C7IA 3VPXA 4CHTA 1SEPA 3E1GA 1TCUA 5ALYA 5A0VA 2NQ8A 3JYQA 1E2GA 4TS4A 1MEEA 1ZGAA 3HKBA 5E2AA 4Z49A 2Y1WA 1U4SA 2H4ZA 1YACA 3DHYA 1O58A 2XGGA 3W7BA 1L9KA 4ZI7B 4BV3A 1H22A 5DNYB 3FBWA 2ZJYA 3C16C 3HQ4O 2HHLA 4CIAA 2DQ4A 2X76A 4XX1A 4IEIA 4LCEA 1P17A 2VPYA 1AXEA 5FTJA 4EB6A 1I3LA 4ND7A 3H3JA 1HE8B 3LAWA 1T0PA 1D4OA 2IEBA 3CISA 5A0FA 3FWKA 1T0BA 1HBJA 2CV0A 3WWEA 2C4KA 2XD4A 3NHWA 2XB8A 3SI7A 1G20E 3CZAA 1XQ1A 2O0LA 3NOOA 2QN2A 3S2EA 2CFCA 3W3AD 4BU0A 5I51A 3WKCA 4K9RA 3EQ6A 2HAEA 2GHIA 5K0GA 3D71A 1DARA 4QLOA 1P2UA 5HMMA 1CJVC 1U04A 3HXLA 4HP8A 4PCVA 5FF9A 5HF5A 2QUHA 4RF3A 3WXMA 4BNNA 5HQ3B 2JLXA 2VBIA 5ER9A 4A0GA 1C3OB 4ASUD 1N0WA 2CLDX 2C99A 3NHSA 4L5YA 1PS8A 3AVPA 3AHFA 4MOWA 5EMHA 1EWVA 3GEHA 5J4HA 2HNBA 4E4YA 5KPJA 1N5MA 2QV0A 3GNQA 1GN9A 2RAFA 5C4IA 3VZQA 3LNTA 1CUVA 4JIMA 1TT5A 1JAIA 5IT9A 1ESDA 2FSIA 2FFRA 4CDRA 1M6WA 1VE7A 3NV7A 4NBVA 4MYCA 3KV3O 1NLMA 1M6VA 2XRFA 4AJOA 4DV0B 2I55A 4BLWA 1OFUX 1VDZA 1ZZGA 4RTSA 3A4YA 2NLOA 5ALLA 3IO5A 1ADGA 2OXRA 1D6SA 2CLEB 4B71A 1P61B 1ZJ5A 2YDYA 3BE5A 3QMVA 3KX2A 1L5SA 5CXQA 4CLDA 3KPYA 1YZVA 1UT8A 3A9VA 5JHGB 3G9XA 1DEXA 3JYNA 3QMPA 1XPRA 1H8EA 1R0CA 3E03A 3EF3A 4D9HA 3IV9A 3OH8A 3HMQA 3N39C 1NXWA 3FMFA 4X20A 4EGCB 2LW7A 3TR6A 5IULC 2ERCA 3BF7A 3UPDA 2ZI3A 4R3NA 5KSZA 3AETA 5I5GA 2HN9A 2J67A 3QLUC 3OQIB 1BE6A 2ZUTA 2H1FA 3EIHA 3AXTA 1R4MB 4N7MA 2JL1A 1FPMA 3NJRA 1E2QA 4DNQA 5LJLA 4C1BA 3LIPA 3AKCA 4H3SA 4K9MA 2QYSA 4RKQA 2Z3VA 3UAGA 1FX0A 3EQ8A 3TW0A 5HIAA 2QGFA 4ILEA 5HUQA 5JD4A 1NX9A 1XQXA 1QM5A 3C1TA 4D96A 1JHPA 4GP7A 2B92A 3CLUD 2C82A 3WNBA 3D3NA 4U8GA 2KMLA 1XJQA 4L7VA 3BKWA 1V7PC 4IJ5A 1FP4A 5HG0A 4XDHA 4OJKA 3ZE2B 4EVQA 4DUZB 1Q1BA 3ILYA 3QVJA 2DPXA 3KAQA 3TFQA 4JEHA 3HUUA 1R50A 1TFUA 1MO6A 4MCAA 4RQAA 2XBMA 2VPWA 1BDHA 3I62A 3F49S 1D7AA 2JLUA 1RQNA 1NYQA 2GMWA 3T9CA 2LCFA 3V5NA 2QL7A 5JT1A 1SVWA 4G36A 3VZBA 1JF8A 3OAAD 5DTJA 2JCSA 4JBWA 4XH9B 4E88A 2AMFA 1DJOA 3OVMA 3SYLA 1H0HA 1P77A 2A0YA 4OJNA 1KDRA 4ZC8A 2OYRA 4EYGA 1V8ZA 2GFIA 2IY7A 3G2HA 3DMRA 4QSHA 4TKVA 4BLOA 3QEMA 5CIQA 2E87A 1MA3A 1H3FA 2BFBB 2HWWA 4L4UA 1LDMA 2VQ6A 4GX1A 4R9UC 4XTRA 4PSCA 2EX1A 2MHCA 4MWGA 4OQ4A 5E6SB 3WJAA 5JDCA 2P77A 3OZDA 3T0IA 3V1MA 3DW3X 2IOHA 1ODCA 1L9XA 1KJWA 1KJZA 1M6EX 2VRWA 1Q5PA 3D0KA 3FCUB 4I8DA 5EHNA 2VQFB 5LMNB 3EWNA 3FRJA 2GHQA 3AWIA 4RJKA 5EIXA 2BH2A 3KHSA 1RABA 3RIEA 1XEXB 1YRYE 1EJBA 2A4MA 3EOBI 3PJRA 4N12A 1ZRHA 3RB8A 4DEVA 2XNHA 4EEXA 5LZ4A 3DEIA 2YMMA 3W9SA 3AI7A 5BWOA 5JS7A 2I91A 2FTKE 1WUJS 2R7LA 3HDHA 4R1LA 1T3HA 4ZKEA 3GVPA 2AG8A 3TSCA 2Q5CA 4MCIA 3BUSA 1I1NA 1LLCA 3BTOA 4F3TA 1W1WA 3WLLA 3ISVA 1RZUA 3P9NA 5A5GA 2PKXA 1VB5A 1WMAA 4N7JA 4KH0A 1UAGA 1DRWA 3EGIA 2Q7DA 4WKBA 4UULA 1MFZA 2V6MA 1YQQA 2CL7X 4O5AA 5IABA 1H5QA 4OB6A 3R09A 4BLPA 3TX2A 3Q1MA 4MICA 1OSNA 1K75A 4FX5A 1DAOA 1EFCA 1TK3A 2Q5FA 1PUJA 3V1LA 5KWIA 4B3MB 3K1AA 1BFUA 4QTZA 4NABA 1NW8A 2WJIA 2XNCA 4OHOA 2F48A 5KBYA 1UBHS 4MAMA 3HBNA 5K3EA 3TN7A 3O9MA 3TOVA 2Z4SA 1MORA 1N0VC 4KZKA 3DSRA 5K8JB 3AESA 4LZNA 1JR3D 3WGLA 2REXB 1XK6A 1TYAE 2QDXA 4BRUA 1PJ3A 2O0KA 1L5HB 2VJPA 1LEHA 2XH8A 4NYIQ 3F6PA 4W4TA 1L5ZA 4M76B 4PSUA 2IC5A 3AEQB 4EHFA 3NOQA 1FFWA 3CUEF 1N34B 2VNHA 4C2BA 2YZ7A 1NXPA 1OYOA 1UPTA 4B5KA 5CK4A 2WSBA 4YNBA 3JWPA 5FUMA 4D4IA 4G6ZA 4LZWA 2HRDA 4JJ4A 5C1IA 2E4WA 3ZDXB 1DCTA 3KVRA 2OHHA 4JI4B 2LCIA 721PA 4OREX 2YTZA 2PPVA 4CDMA 1SVLA 1GLVA 1RWXA 2FH5B 4HAIA 4ND3A 3D8HA 2CZGA 4I08A 1QTQA 3FUCA 2PL5A 1OFGA 4PRLA 5ITSA 3PNOA 5C3UA 3U4QA 3GJ3A 1X9GA 1NJGA 4P98A 3GP8A 1U98A 3FHOA 1W73A 4LCBA 3I4LA 4QM6A 4F1WA 1FDIA 2VT6A 1B14A 2OBMA 1W96A 3HSKA 5G3ZA 3TPZA 1H85A 2PH7A 2VWQA 3UAZA 4AQDA 1L8AA 3AI2A 3LSYA 1DINA 1FL9A 4LJAA 1MC1A 1W85B 5KOJB 3JQFA 1AF4A 2J7KA 3GAAA 1ZJZA 4A8JC 3NBFA 4D3YA 2R84A 3SZRA 1YSCA 5FV7A 5TB5A 1D1TA 2V4UA 3IAS6 3KFLA 1JRLA 4KXMA 4RVFA 1VE3A 1OX4A 1F5SA 1JFFA 2RHLA 2BR5A 1XHFA 3SZUA 5BMVF 1KHHA 5LYJA 3IYLW 2WJGA 3F6EX 4IXTA 4LRYA 1QP4A 2JEOA 4E7OA 2FG7C 3C3EA 4EENA 1PNTA 5EWMB 3QENA 5IH3A 4BN0A 1DJPA 4Z9AA 2QPOA 4XWYA 4ZV4A 2EIXA 1ZIXA 2XMGA 1LQUA 2G1UA 1RMYA 1ULAA 3AF1A 4JQOA 1OJ7A 1JYEA 5DLDA 4XWKA 2HDOA 4NE2A 3CR3C 2FRXA 2YNMC 3QVLA 4Q4JB 5ELXA 4UBIA 1C1DB 4RETA 5FUYA 2R97A 4NYJR 3PVCA 1X3SA 1PK9A 3L07A 4WW0A 4AY6A 1KK1A 1WQ3A 3BULA 1DXYA 5AM0A 4V1CB 2H5EA 2IVFA 2Y0PA 5JAIA 4YBZA 1RR6A 3K0AB 3ZHVA 1UMDA 3S2FA 2VZ0A 4BFSA 1GU7A 1MEJA 2ACWA 3OE5A 5CLHA 4AG3A 2VQDA 3A6FA 2NVWA 4KRGA 3BS4A 2IYTA 3PI6A 5G0UA 3SP1A 4CF3A 5EEHA 1XE3A 1EUDB 5C1BA 1UR5A 3I9JA 3L7CA 4TLCA 3AERA 3JW8A 4PC6A 4F6RA 2UXDB 4J0EA 5JRJA 3MBIA 4JC5A 2Q62A 3LU1A 4DC1A 2D7DA 1P19A 1NU8A 4UMFA 2Q0QA 4I1IA 1E9SA 4XIGS 3CVWA 2ZYHA 3K0HA 3QYPA 4RZIA 1YQGA 4MK4A 4PW0A 1OA0A 1Z5VA 3K5HA 1PAUA 3OZAA 4BQRA 3JQBC 1H1LB 5TPZD 4ZZ3A 2J6CA 1V47A 4OHPA 1X1CA 3B6MA 2VAXA 2ZBVA 4H6WA 5EZSA 3ETNA 2QORA 1A7UA 4Y6QA 4F9EA 1CVLA 5BSWA 3DF7A 2NZUG 1ZOOA 2BD0A 2RK6A 4IH4A 4U9HS 1SWWA 2ZIGA 3T7SA 1FFXA 1Q1QA 4ETNA 4ZT3A 2G0AA 1KY2A 2GKSA 4RIFA 2GEVA 4QYTA 3ITNA 4GPIB 3T3PB 6ABPA 4KXQA 2LE0A 4S2UA 3OOJA 2Y1KA 3OTGA 1EX7A 1MG0A 1TEXA 3IAAA 1E2UA 3WB2A 4H60A 3EIXA 4Q4HB 2NTJA 2OT3B 3ZHZA 1HTBA 4MIYA 2QI9F 3S2SA 1MT3A 1FZQA 2Z95A 4B80A 5LA6F 2IDZA 4G8DA 1PT9A 1QCCA 2R1VB 3QSGA 4UEKA 1NNSA 1RRMA 3MNFA 2ZBRA 1Q7GA 1EXMA 4UQLA 2C7RA 2IYAA 2A1IA 1T1GA 1TQ2A 2FFAA 2WZCA 3D6AA 5BN5B 2ZRQA 2BEVA 2OV3A 1AQJA 2NU7B 4O4IA 2A92A 2X5OA 5ADHA 4BIIA 4PAWA 4LYJA 2R9VA 3HPQA 1SELA 3OQHA 4YCDA 2KX7A 5FCDA 4KPYA 2D2IA 4MRSA 3D54D 4BB6A 1VL2A 2CMFA 4YDSA 3ADDA 1FLAA 5L3QA 1UZNA 4MW1A 2H5IA 3MYRA 3G9UA 3VVCA 1KNQA 4Z9BA 3WGHA 4WXYB 4HATA 4TX1A 1O6BA 1SG0A 1GV1A 4FSDA 2B8EA 3IQDB 2Z6QA 4Q3OA 3RJZA 3IRVA 3O1HB 4WRRA 5L3RA 2GLTA 3E9CA 1DKQA 1V71A 2KJQA 2YFYA 2QBYA 1FXWA 5EJEA 1GCIA 5DF1A 1ZIDA 2G67A 1L4FA 1JR3E 5BW4A 1RC8A 2ZM6B 3IVGA 2ADOA 2VUTA 1UEJA 3QQPA 4KXNA 4M54A 4TKZA 2ZPTX 1C1XA 3HFJA 4FMBB 1U31A 4ND8A 2ALJA 1TFRA 1M7HA 1NY5A 3LW7A 1IBLB 3RPEA 3FOBA 3SEAA 5KNDD 3GT4A 4LJKA 3ECCA 3DYVA 2J48A 1M0SA 2PXHA 1KQFA 2X9LA 4KE8A 4EH1A 4RH1A 4AKSA 3WAKA 5JI2E 3T1HB 1NUSA 2YWEA 1H0SA 4LE2A 3RVBA 1P75A 4ZT5A 3EULA 4WZAA 2VF8A 3ML1A 1YI8A 4EG7A 1RXCA 3O6VA 3L0OA 3NPAA 1AQ6A 3OIVA 4Q05A 4MWBA 3TE7A 3ZZ0A 1BO6A 5KMGA 3RS9A 3DMFA 3PGLA 2BFEA 1I2DA 3OLQA 3JQ6A 4IAOA 3RYFA 3N2NA 3W34A 1H2WA 3NH6A 5IJ0B 3BVPA 1MIOA 4I46A 4ZVRA 1JDSA 2ONJA 1N33B 1LCIA 4MV6A 2AQHA 4PO9A 3RKRA 1N7HA 4FYIA 3ZHRA 3ICVA 1JH9A 2VPXA 2FB9A 2FUNB 1XYGA 2UXCB 4OP2A 3H18A 1VL0A 2FF5A 2IF2A 2YJ3A 3PF8A 4OY3A 3ND8A 4JB0A 4MTCA 1KEEB 3E3LA 4YAWA 5H82A 1PR4A 3PD1A 2VZ8A 3TBHA 5B36A 5ITZB 4BS9A 3AONB 4N5HX 3HM9A 3IPRA 3GAZA 1E3JA 1R3DA 3HWRA 1H2HA 2HA3A 3ZK7A 1JQEA 2Q2WA 3PX3A 3PFCA 4RL6A 4WNIA 4OEHA 4QT0A 5DTEA 1ORRA 3HWWA 5E6RA 5AVJA 1KIAA 5ES4B 4A15A 2IS2A 1FCJA 16PKA 3G6WA 3HRKA 3W2TA 2EYUA 1AN9A 4IQ8A 5DU2A 1D8AA 5FBQB 1G21A 3OM1A 1KOLA 4CV1A 4I5IA 4QGGA 4ZEOA 2V0GA 3QFHA 3R8CA 4RPHA 2VH1A 2YBDA 3C7AA 4HVCA 4OSEA 4MWTA 4N03A 4NYIR 2ATEA 3F3YA 3LYLA 3TD9A 4WA8A 1OI3A 4DQKA 2B9VA 1WUTA 2AR9A 1ADCA 5FUQA 4QODA 3V48A 2XZPA 3L7JA 4YYZA 1AUPA 1SN7A 3EGEA 3TM5A 3VJLA 5C1DA 2XOKD 2XGOA 5ITWA 1RTKA 1B8NA 1KK2A 4FZ5A 2J9RA 1T8SA 4LRUA 4U9UA 4KQFA 3UENA 3ZLTA 3G2NA 3A7DA 3LKVA 3NR2A 1YA4A 3ABQB 3HR8A 4G1BA 2GXUA 3CG4A 1XEAA 2WJWA 4F4CA 3NM6B 1JJAA 3VR5H 4G0UA 1O87A 1A9SA 1WXWA 2ONYA 4G0NA 4DCMA 1YB2A 2QK4A 1NBAA 1KO8A 3AM5A 3S40A 4N3NA 4TS9A 1ZH0A 1XZQA 4WHMA 1E7QA 3PXCX 1BE1A 4JMLA 4I1OA 4I6EA 4RVCA 4BKUA 1YBHA 2IVZA 3M1AA 2PA0A 4WFQA 1NP7A 2PN1A 3I6MA 2WFLA 4I8XA 3VTFA 1EKXA 1F5NA 2PQ2A 1O6CA 1PL8A 1MRNA 1E9VA 3IA2A 5EZ5A 5HP4A 1T5DX 4G2TA 4BGEA 1T1EA 2V9PA 1PJZA 3EBOA 3SXPA 1A69A 3W4KA 2RGCA 3IQWA 3R6WA 3D6TB 1SRRA 2GM5A 3LCCA 5E0KB 1GPDG 5IM4F 4UMVA 3SY8A 2B3TA 1V5FA 2X86A 3QEOA 4MQ5A 4X0EA 5ICFA 4IIFA 4DQUA 5K0EA 1IY8A 2AKEA 2ZB8A 3VVMA 4AUKA 3NIWA 1ZNYA 3KR9A 4FN4A 4BP8A 4IOKA 1CFZA 4MW4A 5D3ZA 4CKCA 2AWOA 3FPBA 2Z3ZA 1YA8A 4EHKA 2RI6A 3P32A 4AULA 4BNFA 4QEDA 1ONBA 3BG5A 3FWYA 1BOFA 2AEEA 3QGMA 1YBMA 5MHTA 1RYMA 2Y0DA 2B69A 2X2FA 3E9EA 2J5BA 2P69A 3NGMA 5ALEA 4G1UC 4UU7A 1MZPA 4HWGA 1O96B 4OMFG 3K0CC 1E0AA 1Y6GA 3LECA 1YXMA 3MYYA 3RFUA 2QPTA 1KI4A 3JRXA 3CPJB 4S04A 1XLTA 3R5KA 3H1BA 1L8OA 4M0DA 1DU4A 2D3TA 1B3BA 2HXYA 1O03A 2HU8A 3P0HA 1D2GA 1HOXA 5FA6A 2IH5A 1YI1A 2GBIA 2Q4EA 1KAQA 1HRDA 4FDVA 4JUIA 1N4AA 3W5CA 4G3XA 3B6KA 1U6JA 3HLKA 3LI2A 4DIMA 3FCSB 3TVDA 3DULA 2ZDGA 1GUZA 3V4ZA 3ZD6A 2G6TA 2GB4A 1GT6A 4LXHA 1SG9A 2HEIA 5IWAB 5DGIA 5GV7A 1YR8A 1DFGA 2B4RO 2C5GA 2HJ9A 3KLNA 2JKZA 3VM6A 5F9HA 1EFPB 1YJQA 1L0BA 1RADA 2GK6A 2O7VA 4EA9A 1OH7A 4EHHA 2VA9A 1CE8A 3N6VA 4QOHA 2BH9A 1IZYA 1X1QA 4B8WA 3LDFA 4ETIA 1D2AA 2VJLA 2IOFA 2XYPA 2YYAA 3HYTA 4R3UC 3ZWKA 2XMZA 5IBRA 2WF8A 1MABB 4D81A 1IQRA 1NVDA 3AKDA 1RP1A 1UP6A 2DHDA 1FDSA 2CB0A 3AJ8A 4ICIA 3PBKA 4IP0A 4TLAA 4NMLA 4XYMA 4R7GA 3SHQA 3FTCA 3D8SA 2REQA 3IDOA 3MERA 4BPBA 2BRUA 2PL1A 2CJPA 1V96A 2BMEA 1SD5A 2HJSA 5FWYA 5KAPA 4CM7A 4OU5A 4S1TA 4EEZA 3L0YA 3LD9A 2WY2D 4IHKA 5E4JA 1UT5A 3ACCA 3FBGA 3O0DA 1JVNA 4HRAA 5F7OA 4R2XA 7MHTA 1XD2A 2WVGA 4FD3A 4K0RA 3SDSA 4A16A 2D7CA 2WZQA 3LX8A 3R7WA 1MJFA 2K87A 5DM60 4N6NA 3IVMA 2ACVA 1IU9A 3IMKA 2A5JA 2GXQA 3GD7A 4LNHA 2CVZA 3AL0C 1XDUA 1U1CA 1M3SA 2DYKA 2WIJA 2FSVC 2ZSDA 3EAQA 1YQUA 4AAYA 1H1TA 2V0NA 4Q66C 3NDIA 4L85A 4QGBA 2P5UA 2WKPA 4YP0A 2EHJA 3V9PA 4EEKA 2H63A 4D0RA 2G9ZA 5BVGA 4W5NA 1T29A 1PE0A 3JZFA 1L4GA 1YB7A 3PUKA 5D01A 4ONEA 1PL7A 4OQXA 1ODIA 2UUOA 2J0UA 4I9FA 1T8TA 2VEOA 5JBQA 3F67A 1UK9A 2QM3A 3HVKA 3REGA 3X1WA 3SNHA 2QMHA 4WNAB 4Q93A 4W63A 1KI2A 2G5CA 3BRWD 3GDFA 3PNSA 4BVGA 4GUAA 3TNDA 1E1RD 4RD3A 2R6CA 5IW8A 4XQCA 3TR0A 3TUZC 3UGJA 2RHCA 1LW7A 3L4JA 4CV2A 3CFYA 3EIWA 2GVNA 1P5FA 4C87A 3DF9A 2ZYSA 2YWHA 2IKQA 4G1CA 4GRDA 3SX2A 4Z4CA 1G64A 1ZGJA 2X22A 3G1UA 4CIBA 1COWD 2KPOA 4EJMA 4M98A 3D1VA 4EBFA 4PO1A 3INGA 4LYDA 2C31A 5GADl 2G0NA 3CF0A 1PK8A 3BCRA 1II8A 4Y2VA 3VKVA 4BV9A 3AWDA 4CM6A 2QQ0A 1UM9B 1Z0JA 4E5DA 5K8LA 5FI5A 2LGJA 5E1DA 1IM8A 5HZHA 4NFHA 1BN7A 1E1KA 2XOXA 4WBSA 4W5WA 5BV7A 1QIMA 2VT7A 3HWX1 1R6TA 1ZISA 2BFNA 3O3NB 2O2YA 3F6CA 4CLOB 2FVXA 1RYYA 1Z3IX 3NHFA 3R3XA 7AT1A 1TMGE 1DCFA 3FTQA 1H4SA 3WA6A 2VC2B 3ES9A 5CVTA 3OQMA 2OB2A 3G89A 2RHMA 3DJFA 4MGHA 4QXPA 4HLUC 4L4SA 1RI5A 1GUYA 1O97C 1ADYA 2QD5A 1F7UA 4PS1A 4OK3A 2O2HA 1I2CA 2X5KO 3ZLVA 3HLTA 2LR0A 2ZIXB 3ZDYB 4H1HA 4AZWA 1CZKA 3M49A 1S9DA 4HUJA 4DWWA 7GPBA 5E6UB 1GKKA 2IQIA 3GJQA 1U0NA 3MBKA 2NV2B 2GH1A 3URMA 1TQDA 1OC4A 3EUFA 3CPHA 2RHJA 2ID9A 1TK9A 5EZYB 1EGHA 1ZITA 5M34A 1XRSB 4D9NA 2OOKA 4ZKDA 5DBEX 4DQXA 1NVVQ 4Q1VA 1SGWA 4BWGA 5LOVB 1SBCA 1E5TA 3IP3A 2NO7A 3JU3A 5AKEA 5E38A 1JDPA 2HM7A 1P60A 1U8EA 2ZJAA 2Z2KA 1OD6A 4C6HA 5HUJA 2C1XA 2NTNA 1Y5LA 4M1TA 3ONNA 5K09A 3H42B 3P7MA 3D3WA 5EWLA 4PZLA 2BEKA 4I1RA 2BHSA 3LPCA 1AK9A 2Q9AA 1E8NA 3PEYA 2R7MA 2FRDC 3OPYA 2EKZA 5INTA 3ONDA 1Z88A 1FDTA 2CL0X 3ABOB 3I45A 4BEJA 5ABPA 1S3GA 2RONA 5DM1A 4TRRA 3FVQA 2XMQA 4BATA 3DEAA 3I2HA 2R5WA 3K2QA 3FLBA 4DDUA 5IS2A 2A4KA 1JDVA 5ILQA 3RSLA 4R2KA 4M55A 4O59O 2GSWA 1KAOA 3EVEA 3JALB 3USES 4EUHA 1Z8DA 2AXQA 2VRCA 1G16A 4P3PA 4D41A 4DJ5X 4EWLA 2NYUA 4B85A 2OFXA 3G1WA 3ERCA 2UVPA 4N49A 4M0PA 4DIUA 2FJUA 1PEAA 3Q3HA 3BSWA 3DTTA 4JVSB 3U16A 4L76A 1PF7E 5E2IA 5I9TA 3DV0A 4LK3A 4RTMA 3HO6A 1IAQA 3X2FA 5JD3A 1DPGA 1X7ZB 2ZIVB 4UE3S 3GZNB 4U4AA 4F2DA 4P3XA 1EP3B 1WQ1R 2F17A 5B55A 5D90A 2F3SA 1K4MA 5JDIC 3K16A 1NVAA 2CNKA 5ALDA 4ER0A 3DKRA 4UCXA 3EC7A 2XCSB 4WASA 3FGNA 3KD3A 3UCEA 5JTUA 3OFKA 1FMFA 1U65A 3UM9A 2YN0A 1Y4ZA 3QY9A 1MDFA 3WL3A 5L95A 4XCXA 5CA0B 3H99A 1JXMA 2CB9A 4L75A 3PL5A 5ENZA 4CTKA 2V54A 2WU1A 4XWWA 2YICA 1CS0A 1MRSA 2PANA 1XTSA 3EWAA 4CQMA 1V7ZA 4DBLE 4YAUA 1XB2A 1G5TA 5E95A 4EGFA 1C5KA 1PFGA 1VZ2A 2W6PA 1C8LA 1N7JA 3LLVA 4PLWA 3VNBA 2RJOA 2XADA 3IHWA 4OH7A 1I9CA 3DEYX 1QO9A 2PH5A 3BH7A 3U4HA 3FKQA 3K4HA 4MHOA 1KVRA 3KIPA 4I5FA 5HWSA 1QHSA 4IVNA 5DDIP 3FY4A 1JU4A 4QUIA 4RPLA 1MV8A 2R8BA 5KWJA 1U9IC 4DN6A 2PSEA 1QC5A 4CNBA 1JYFA 3V6MA 5F2KA 2ZVQX 5LVAA 2YJGA 3B48A 2IITA 4L0MA 4AJNA 3TAHA 2EKPA 4M86A 2OD7A 3W79A 1E62A 4YXFA 4ZIRA 5CT9A 4OUKX 4RDCA 5KQMA 2X8JB 1EHCA 3OQ6A 1HX7A 1IZ8A 1ZLXA 2VPQA 2SNIE 2NVUA 2YWRA 4L8GA 3AR8A 3VGJA 3SMQA 2OG0A 4BX9A 4GPTA 1Y6JA 1MN6A 3SC3A 2R6AA 3GFRA