3EZ6A

Structure of para-adp complex:tetragonal form
Total Genus 130
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
130
sequence length
394
structure length
388
Chain Sequence
SQLHKVAQRANRMLNVLTEQVQLQKEFYQVYAKAALAKLPLLTRANVDYAVSEMEEKGYVFDKRPAGSSMKYAMSIQNIIDIYEHRGVPKYRDRYSEAYVIFISNLKGGVSKTVSTVSLAHAMRAHPHLLMEDLRILVIDLDPQSSATMFLSHKHSIGIVNATSAQAMLQNVSREELLEEFIVPSVVPGVDVMPASIDDAFIASDWRELCNEHLPGQNIHAVLKENVIDKLKSDYDFILVDSGPHLDAFLKNALASANILFTPLPPATVDFHSSLKYVARLPELVKLISDEGCECQLATNIGFMSKLSNKADHKYCHSLAKEVFGGDMLDVFLPRLDGFERCGESFDTVISANPATYVGSADALKNARIAAEDFAKAVFDRIEFIRSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Plasmid partition protein A
publication title Structural basis for ADP-mediated transcriptional regulation by P1 and P7 ParA.
pubmed doi rcsb
source organism Escherichia coli
total genus 130
structure length 388
sequence length 394
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13614 AAA_31 AAA domain
A PF18607 HTH_54 ParA helix turn helix domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1660.30 Mainly Alpha Orthogonal Bundle Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 Multidrug-efflux Transporter Regulator; Chain: A; Domain 2 3ez6A01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ez6A02
3CPEA 1Z07A 1KIMA 3IILA 4CEJA 5FL7A 2PT5A 5HCIA 2N1BA 2W2TA 1U81A 1NL3A 2IWHA 1XCPA 1OH6A 3N70A 1R0YA 2BBWA 1WF3A 1S1MA 2W83A 2B7CA 3T5GA 4D2IA 4DLZA 1E2PA 1E69A 2E87A 5SZHB 4ZI3A 3QSYA 2O8BA 1W5SA 2CL0X 2IYWA 3MSXA 3Q5EA 1N5LA 1YZNA 3REFA 4DIDA 1T5LA 2GK7A 3Q5DA 1QHGA 1SVWA 3NTUA 2FPKA 1IJEA 5EE0A 1HH4A 4ASUA 3TR5A 5KNCA 4ZO4A 4RVCA 4OK6A 2BIFA 3IHWA 1T6NA 2HEIA 2NOAA 2VP2A 1DS6A 1HE8B 2QMEA 1NP6A 1F3OA 1R0XA 4B74A 1SVSA 1JALA 1HQYE 1RRFA 1MV5A 1AKYA 2YC4C 2ODWA 3DMDA 1BH2A 4K81B 2QM7A 2QORA 3VHXA 4IDQA 1EWQA 4CDGA 4PQRA 4X8MA 5TB5A 1KDRA 2TMKA 2J3EA 4WOPA 4ZIRB 3T15A 3F8TA 3SBDA 4HYYA 1RJ9B 3LA6A 4IKEA 2RGCA 3O8CA 2R65A 2YHSA 4HZUB 1JAHA 2QGZA 3GLFA 1UAAA 2VA8A 3AVPA 3B1XA 3I32A 3IQWA 4NHOA 1UEJA 3FMFA 5DN6D 2VSXA 3SEAA 2OILA 5DO9A 2ZJOA 3EW9A 5C18A 4FCVA 3RHFA 4Q7LA 2CNWD 5UKDA 2J7PD 4M1KA 5A4JA 1Z28A 1OW3B 1ZM2A 4QG7A 3VX3A 5EE3A 2ORVA 4DDVA 2VHQA 4IFEA 3WBKA 4B2PA 2ZI7A 4BWYA 1YZGA 3M0EA 1P6XA 2WTUA 3VR3A 2ZPTX 4LZZA 1KI9A 1M2OB 1R2QA 3MG9A 1A2BA 3HU2A 5JJKA 1FTNA 1N3BA 4RFSB 2RHDA 4NYIQ 2XTMA 3PV0A 3PEYA 5KO2A 2VQSA 5FOUA 2QNRA 3BBPA 2YWHA 4WZ6A 2H18A 4KCGA 4BFYA 2A5FA 1ETUA 4BZQA 2QAGA 3VX4A 2F3RA 1VPLA 3FKQA 4G5RA 4U00A 5JSZA 3OESA 5BQ5A 4RD0A 2O0KA 1X8JA 3K9LA 4HATA 3FHTA 1PJRA 4RZ2A 621PA 5IHPA 1OYYA 4M0LA 3K0AB 2DFTA 4YMUA 2ZRKA 3IIKA 1E9SA 3H2YA 1A82A 3OE7A 4QJ5A 3LO5A 3D31A 2BMFA 2VSOA 1W47A 2XB4A 4US1R 2GJAA 4EIWA 1XX6A 4M1TA 4RSGA 1LNZA 1Z6AA 4W5JA 2VHJA 3SU8A 3AP1A 2O8DA 2F43A 3EWAA 2EWVA 1EFTA 4MRVA 2CVFA 3ZD6A 2BBOA 2Q9AA 4US2R 2ATVA 5JJLA 4A8JC 2CK3A 5JMTA 3O8BA 1E4VA 3EA0A 2JDIA 1OF1A 2AK2A 2JGNA 4E5UA 2JASA 5JEDA 2NO9A 1KI6A 1WB9A 3GLGE 1LFDB 1E1QD 4J0QA 5H8WA 1CRQA 1XNJA 3BS4A 3ZVMA 5FBVB 4JBYA 1XU4A 2Q3FA 3AVQA 5JHHB 2GVZC 4E07A 3TSOA 3SI7A 3GJ8A 1G7CA 2CE2X 4TLCA 4M1OA 1Z6XA 2P0EA 3BFXA 5JFGA 521PA 3X2SA 3SBEA 1GRNA 4ZKDA 1EXMA 1PUIA 2B7BA 4OHXA 5KPDA 3PFIA 2ZRNA 4DT1A 4ACAA 3BXZA 1E2NA 2FF7A 1UKEA 4QGAA 1NN1A 1XEXA 5GADl 3WMFA 2XEXA 5DISB 4A8JA 1GKYA 3QKRA 4TQ9A 3PIRA 2O8FA 3RYTC 4Z1MA 4A2PA 1Z06A 1S2MA 2A5YB 1S9HA 1N6RA 4M9QA 2DWQA 4OJQA 3UANA 4C0KA 3U7HB 4JLNA 2PJRA 2ZI9A 1NBME 4MKGA 2WJHA 1ZAKA 1W0KA 1KO8A 5JHGB 3CPJB 3KB2A 2R6AA 2GJSA 4QOSA 1KMHB 2BOVA 1ZW6A 2D7DA 4AD8A 1NMYA 4LRWA 2FSGA 2G83A 4LV5B 5DI3B 3SZRA 4BFXA 5L3SA 2FFHA 3GQBA 5KYKA 4OQLA 4U5XA 1XTJA 5CK5A 3U3KA 1W7AA 2QE7A 2QP9X 4A0RA 4BFTA 3CR8A 2W6JD 4Q66C 3TIFA 5ANRB 4XVRA 2OXCA 1G20E 2WWIA 2IYTA 1AK2A 1Q57A 2C78A 1E2QA 3I61A 4ILEA 3WNCA 2AR7A 1CRPA 4V03A 2WJIA 2PJZA 4E03A 1K6MA 2B92A 3KTAA 2QA5A 1MT0A 5KSYA 2OFXA 1NKTA 3IBYA 3AVTA 3E1SA 1S9DA 3GCGA 1YVDA 2F6RA 1HURA 3B9QA 1QHYA 3GJ0A 3TMKA 3OAAA 4RKEA 4YXWA 1JPJA 4EJSC 4R7ZA 4EQ6A 2CXXA 2N42A 4URZR 3QXJA 4BFVA 2IS4A 1G8FA 1YQTA 1MABB 3W5JA 4R2IA 1DEKA 5IK2D 4NMMA 3Q3JB 4JVLA 3AVYA 2ZS7A 1BO6A 2QPAA 3DM5A 3AF4A 3P4XA 1TQ6A 3RS0A 5AUPB 5JRJA 3EX7C 1HUQA 1E2IA 2Z5FA 2WSSD 4KFRA 3ZIAD 1BKDR 1EK0A 1OXUA 2AK3A 3A6PC 3TSWA 1W4RA 2QQ0A 1E2DA 1V5WA 2OEPA 1D5CA 3Q8XB 1C1YA 2Z43A 1AS2A 4B3BA 2DCUA 3BK7A 4HLQB 2ODEA 1II8A 4P33A 3VR1A 3WYFA 5IF9A 4PQFA 1R0WA 1VIYA 1RIFA 1TADA 3TUZC 1E79A 3O8RA 3DM9B 1NMZA 5JI3E 4KJZA 2VH5R 4TLBA 3HU1A 1YHNA 4EJSA 1ZIOA 3U3RA 1MRSA 5KSZA 1PUJA 2JIZA 1US8B 1KK3A 4OJKA 4BZPA 1JR3E 3T1QA 2PCJA 5EQTA 2WWFA 1Z6TA 4H9GA 4RJLA 2WMNB 4A36A 2CEAA 2XNDD 5GVSA 4TQUS 1AN0A 1G1MA 2PLFA 2ZEJA 4M22A 4I1VA 4Q01A 4GMXA 4GOKA 3ZD7A 4HB0A 2J5XA 4KBGA 3N2IA 4O0MA 3SNHA 4LJ9A 2ZI6A 4WXRA 5JEEA 2NO1A 2FZLA 4POAA 2GXAA 1KZGB 1IOZA 1XD9A 2ZRFA 3HP1A 4HLDA 3UK6A 3ZQJA 2QG6A 4NCHA 3THXA 4NP6A 1DTSA 4TT3A 4PC6A 1MRNA 2OAP1 2XOKA 2CCKA 1Q3TA 4WXPA 1GSIA 1XMIA 3GD7A 4IJMA 2V6JA 2GDJA 2BDTA 1OSNA 2RGXA 1EWRA 4YMVA 2E9SA 3A1TA 4L8GA 4F4JA 4HUTA 1G3UA 4OL0A 2GETA 1JECA 1KY3A 1CU1A 1Y63A 3FOZA 1VHLA 4W9MC 4Q7JB 4AWXA 2BBSA 3KFXA 4EFNA 2KJQA 3X1YA 5AJWA 4TL6A 4UNQA 1YZLA 2WAYA 3MAAC 4B71A 2G3YA 4AY2A 2JLZA 2LWIA 4TLAA 1DVRA 1E2KA 1X8KA 3B5JA 4D80A 2QBYB 2L0XA 3ZYCA 2D4HA 1CLUA 2J9RA 3DPUA 1N6LA 4URUR 2KSQA 1G21E 4ZDJA 2G9NA 1JEEA 2YJTD 1KTVA 4X8HA 4TTPA 1GRQA 2B8WA 2OESA 2W6ID 5F9FA 2QL6A 1ZNXA 2GHIA 4ON9A 5FOXA 4KLZA 1E1RA 3GJ3A 1DAIA 2YOGA 4K46A 1CJTC 2DFLA 1J70A 1O3YA 1TQDA 4TTQA 3A58B 4FMCB 5AJVB 4EKDA 1R5BA 5HZKA 3MUFA 3OIVA 2IS1A 3WMEA 4NCNA 3QENA 1E4YA 1G291 2O8EA 5FPKA 3SYKA 4P4UA 4OI2A 2D2EA 2ZSBA 3GJ7A 4XWAA 4HSEA 4DLSA 4JYBA 2VP9A 4RD3A 4A0FA 2ZRHA 1LS6A 2IF0A 2GILA 4TZ0A 2BMJA 3H86A 4KSCA 1G3IA 3LDAA 1YZQA 2IL1A 4KFTA 3ZS9A 1I2DA 4PHFA 2H57A 4B48A 1PVOA 2RHMA 1LTQA 4NZYA 1E2MA 1GTVA 4OI4A 5DYGA 3SE0A 4DVGA 5HR5A 4JLMA 5CYOA 3X1ZA 2NGRA 2RCNA 3EZ2A 2QT0A 3BH0A 4BQSA 3KUCA 4JLAA 1FNNA 3AF0A 2A9KA 5AJXA 1CXZA 2JLRA 1SVOA 2F55A 1SKYE 3M4YA 3D6TB 1VYTA 5GJBA 1N0UA 3W3AA 2VP0A 1LY1A 2O0JA 3DDCA 4RD2A 3VQTA 4DLXA 3KL4A 2D3WA 3CZQA 4BUJA 8OHMA 1Y3AA 1PV4A 3VNVA 2GBLA 4O2RA 3FMOB 4DCVA 4AYWA 1OIWA 2IEZA 3OIYA 3HR8A 3AH8A 5AUNB 3P26A 2QRZA 1UF9A 4CEIA 5FBQB 5A0FA 1F2TA 3EC1A 2HT1A 5KHOC 1KAGA 4GZLA 4LHYA 1OT3A 1YU9A 3W9YA 1EFCA 3F3YA 4OQMA 1IHUA 1NIJA 1XTSA 2IW3A 2YOHA 3IIMA 3NIBA 4LJ8A 4C0LA 2Z4RA 1KI8A 5DHFA 3RAPR 3FPAA 5E7JA 4DHEA 3GLGA 1OKKD 5J4VA 3THYA 2OCBA 5EE1A 3A1SA 2PX0A 4LY6A 3RDPA 5KSOA 4OKSA 2J0SA 2YWFA 3U3JA 5BW8A 1BMFA 1G8PA 3FFBA 5TV2A 1T5IA 3AQ4A 1XXHB 4B3DA 1JXOA 1YZUA 1NY6A 1KI7A 1OFUX 4Q9KA 2C03A 1W49A 5FPYA 3FYHA 4Q1DA 5AUOB 4PAQA 1MKYA 4IFBA 1Q21A 4CZ2A 1R7RA 2C2HA 3QF4B 2MMCA 5JS7A 3K1JA 3B2EA 1J2JA 1GDDA 3C41J 4OK3A 4MYUA 3RSOA 2V3CC 4C7OA 3LV8A 1XCGB 3OEHD 2FH5B 2J45A 1DARA 3BD9A 1WBDA 2WKQA 1NBMA 5EP4A 3IKJA 3QBVA 2ZI4A 4YDHB 1EFRA 5JJIA 2LCFA 3R7WA 2O52A 3I3SR 4I81A 4C9BA 3LXRA 3QPWA 2A7QA 1Z2CA 3RNLA 2FEOA 4PFSA 2HYIC 3GJ5A 4LJYA 1NMXA 2AX4A 2BEJA 2PMDA 3ASYA 2ZJYA 4RD1A 3HJNA 2C9OA 3PXGA 4P32A 2E1RA 2ZR9A 1Q1EA 1P60A 4TYWA 4I1SA 3BC1A 1G8GA 5HE9A 3NC1C 2ZRLA 4DKXA 1NNEA 2GF0A 4EPRA 5JBQA 1X1RA 1L4UA 2W2XA 4JLDA 1X3SA 4A15A 4HI0E 1ZM9A 1G3QA 5DGXA 1ESMA 4M1MA 2IYSA 2AFIE 3Q7PA 1R6BX 2FMXA 4BEJA 3MWJA 2O8CB 1E2EA 2XZLA 5L3QB 1MR3F 5EXSA 2OCPA 3GLIA 2XZPA 2BEKA 3M1IA 3MJRA 2R2AA 1Q3HA 1E2JA 2IUUA 2IYXA 4TMKA 4PSKA 1UBFA 3NBYC 4MGKR 3VR4A 3GEHA 2I1QA 1P73A 2NO6A 1Z0JA 3QPUA 4NYJR 4Q1AA 4QL3A 4LJ4A 3CONA 4GP7A 1ZYUA 2PLRA 1E0JA 2ODBA 2P65A 3SYLA 1XZQA 2V8OA 4HDCA 1AS0A 1NRJB 4P31A 2ZYTX 3CF0A 1J99A 1HA3A 3AF3A 4Q48A 4A92A 3QE0A 1KGDA 3GLHB 4V0ME 4RD4A 3PEWA 1YJ5A 1YRBA 3SJBA 5KUTA 4OHZA 3HWSA 3NWJA 5DI9A 4C2UA 2G77B 3WRXC 3EXAA 2O5VA 4LV8B 5AJYA 1P9RA 2OSBA 2GXUA 2IHBA 5C1BA 1L2TA 4F7WA 1N0VC 2BCGY 2KI5A 5D3MA 4O2LA 2XTZA 2X2EA 3I92A 1ZNZA 1Q22A 2NZJA 1B23P 1SXJB 5JWHA 3U4QA 3CH4B 3GFPA 4CT5A 3U7GA 3CRRA 4XVQA 1AJEA 1JR3A 1ZNWA 2Y8EA 4FWTA 1XJCA 3S1AB 2QQEA 3KJGA 5P21A 2JLVA 1FW6A 1COWA 4XOIA 4D25A 4BFUA 3K0FA 1SXJD 2FSFA 3DOFA 1SKQA 4I4LA 1J7KA 2KE5A 3DZDA 3LBHA 2FA9A 3B82A 4WZAE 3TLXA 2Q0HA 3DL0A 4JL5A 3GJ6A 1IN8A 3NDBB 5F3WB 1VHTA 4TYNA 2IYVA 1UBCA 4CIDA 1NN5A 2H7VA 2HXYA 2GRJA 1NVVR 3FMIA 3KXKA 2ZRBA 1Z0AA 1JQJC 1P5ZB 4Q4HB 3ADBA 1G41A 4KYUA 1E9BA 4V0LA 2JLUA 3TH5A 2YWGA 4AYXA 2QMOA 5BN5A 4V0NA 1JR6A 3AVUA 3NBFA 4BZXA 4Z8YA 2V55B 1IM2A 3B6EA 2QZ4A 1GNQA 1OFIA 1FNMA 1U8ZA 3PR1A 4OQNA 1IXRC 2CCGA 3SS8A 5DIFA 2XNSA 2FV8A 4E09A 4QC2A 1XMVA 4UJ5A 4UKDA 3R8FA 2PH1A 1ZUHA 4KVAA 2WWXA 2XX3A 4BFWA 5KDDA 1OPXA 2WPDA 4QNRA 1EGAA 2AXPA 3QXSA 2FWRA 1IONA 1WXQA 4I1OA 1DBSA 4B34A 2C99A 3PCRB 3VAAA 1X86B 3FKSA 4W5HA 2HXSA 3AVXA 3LBIA 4PHGA 4UXIA 2BM1A 1QG4A 2Z4SA 1CKEA 2BJVA 4BASA 4XD7D 1T91A 4F38A 2C96A 4ABYA 1XEWX 2Z0MA 5SZIA 5EUMA 1G8HA 3FHCB 3V00A 1WQ1R 1UDWA 2WSMA 3E5HA 1LV7A 4KXFB 3C4JA 2F1RA 4LUCA 2IWRA 4LHVA 4X8LA 3VHLB 2VHTA 3BGWA 2FOLA 3AF1A 1DAHA 1F48A 4LK2A 2ZYVX 3U60B 2A5JA 3KJIA 5KNBA 3ADDA 1ESNA 3RANA 1PLKA 1E0AA 1XDBA 4P0TA 5KPJA 3QG1A 2P5SA 1A4RA 5DLQC 5TVKA 3T06B 1GUAA 2NPIA 4MGYR 5K8UA 1NLZA 4BFZA 2ZRIA 2ZYUX 3B78A 2HDNB 4HAXA 2JEOA 3B9PA 4YQFA 4KU4A 4W7SA 3GEEA 3VR2A 2H16A 2J0UB 2ZE8A 4GDFA 2WJJA 1R10A 1II9A 2FX3A 1U90A 4PAOA 2V4ZA 4Q9LA 3B1YA 4A6XA 4AKHA 3EPLA 1WE2A 4UNNA 2EYUA 1OHHD 2HUPA 3SDZA 4FMDB 1UADA 2X19A 3TRFA 3WXMA 3KDSE 4ZCMA 3KFVA 4PC7A 2FZ4A 4NONA 3TVDA 3I5XA 4JVNA 2ZXUA 2X2FA 1E1QA 4Q02A 1S3GA 2MSDB 1NLFA 4RZ3A 4CT4B 4PSVA 4JKYA 3EIQA 1P2SA 1RYFA 2ZI5A 4ESHA 1GKUB 4CGZA 3UPUA 2XJ4A 5KNDA 3FE2A 3SFVA 4CEJB 4MA4A 1XPOA 3PJRA 4LV6A 1GIAA 1HTWA 5L3VA 2Q9CA 3I8SA 2QN6A 3TQFA 4DLTA 1AS3A 3ZZ0A 2OUKA 4II7A 4JS0A 1HE1C 1KHTA 3CF2A 4M8NE 4PAMA 4PTLA 3WP1B 5J4KA 2O8BB 4A2QA 3RRMA 2ZETA 5J5CA 3ZVLA 2DB3A 5HKKA 3TVTA 2WOOA 1NSTA 2YOFA 1N5KA 1NIPA 4DLWA 1ZP6A 2ZAOA 3NEJA 2ZJ8A 5EP3A 4MRNA 5HCNA 1ZU5A 1CS4C 3CNNA 1JQLB 2I4IA 2RH5A 2F1HA 1Z08A 1DG1G 3LNCA 1ZIPA 2ZE7A 1JEDA 1T4GA 5CB6A 3ADCA 5TY0A 1MH1A 3OHMA 4Q9HA 1IN5A 1T0HB 3DEFA 4MYHA 4DUGA 3SOPA 4ASUD 1M7BA 4AIIA 2XJ9A 1EX6A 1H8EA 1YR8A 2ERYA 2W0SA 3TUIC 4JT4A 2JLSA 3X1DA 4QBFA 3TKLA 3TSZA 2C9YA 4DZZA 5GVRA 3V4RA 1GFIA 2CL7X 2D7CA 3GMTA 4IOLA 2ECKA 1N6HA 2ZJBA 3LVRE 3K9GA 5DI3A 2ZJZA 1P3JA 3B1WA 3M6AA 3QEJA 4LGMA 3GLFB 1KO7A 4DSTA 2RGNC 3TK1A 2VEDA 4G5GA 5CM9C 3GFOA 2WIBA 3QOFA 5G3YA 1ZCAA 2XITA 3SC3A 5L8VA 3UMFA 4EPTA 2WBLC 4KFSA 1LW7A 2WJVA 4B47A 5ELXA 1JNYA 5GJVC 3AP2A 3AUXA 4QKQA 3SJAA 1G5TA 2Q9BA 2UKDA 2XSZA 4PO1A 1CTQA 4NTZA 3UXMA 4TMXA 2NIPA 3AUYA 3PEVA 1UBEA 1E9DA 4PC1A 1KI2A 3WNBA 2YVUA 3CLVA 4AYTA 2RGGA 1IN4A 1J8YF 3LRPA 2ZVQX 4QNMA 2ZJ2A 4DBLC 4R9UC 1ZM3A 2ZAMA 3KXLA 4L5BA 4DCTA 1MO4A 1QHSA 3TAHA 4DLRA 5DH9A 4Q1BA 1MABA 3PUXA 4JL6A 4GRAA 5FOVA 2WHXA 2WSSA 3T35A 4TYYA 2WWYA 1QHHB 2QAGB 3X1XA 4ARZA 4QJ4A 4IXMA 2QENA 3W5IA 4D6PA 5TDHA 5JSZB 4HUQA 2WWGA 2OV2A 2XGJA 1U9IC 4UNRA 1U8AA 1E2FA 2WV9A 2IEYA 1Q12A 4PO8A 1UPTA 4EPVA 3W6PA 3GLHE 6Q21A 4HB2A 4GT1A 3BE4A 4KAXA 4TSFA 3U2QA 3I8XA 1CEEA 5J4YA 1XTIA 4V0MA 1VG8A 3SHFA 3QY0A 3VNUA 3RVBA 1DAKA 2O8DB 2F43B 2GCOB 4Q7MB 4B73A 3CKLA 3A4LA 1Z5ZA 1KO1A 2ZRCA 3OE7D 2VF7A 2HJVA 3RC8A 3MD0A 3CRVA 5FPHA 5KDLA 4G5OA 2ZR7A 4C4PA 1US8A 3ZS8A 1BOFA 2BCJQ 2D06A 1KI6B 4GSYA 2WWWA 2YKGA 1S96A 4B35A 4URYR 5FPTA 1OJLA 2CK3D 1K5GA 1YR6A 5FBRB 2GXQA 1M6NA 4MGIR 3AVWA 1UJ2A 1RVDA 2JJ1D 1RRGA 1TAGA 1U9IA 3AB3A 3L82B 1G19A 1GOTA 1VCIA 4DDWA 3VU9B 4B3CA 5JECA 4FXPA 3E2IA 4JVMA 3PEUA 1VG1A 4QRHA 2QM8A 3DKVA 3HYRA 4Z54A 3A8TA 4DSUA 2HYDA 2QROA 2ZS8A 3LX8A 5EXPA 1GNRA 4C3ZA 3AGPA 1XEXB 4FCTA 3U6KA 4RKFA 5M04A 1E3MA 1QHXA 3QKRB 1F2UA 3E70C 2O8FB 3AEZA 4Q9JA 4ACBA 2NG1A 1VCMA 2P6RA 2YINC 2ZUDA 3Q72A 2NPFA 2J0QA 4P4SA 2R44A 2V54A 2FGJA 3QXHA 4D0NA 4Z1MD 4V0KA 4F4IA 1D9XA 3ECCA 2Q3MA 4LOAA 5C4MA 1FX0A 1GP2A 1D2EA 2ZSEA 2OM2A 1NVXQ 2DPXA 4TLDA 5IDVA 3THWA 3NDPA 1OH5A 2WKRA 3MWKA 3MMPA 3K70B 1Z3IX 4TYPA 1HEIA 2DYKA 1W0KD 4W5WA 1QVRA 2W6IA 3NBXX 2FPLA 3QUSA 4R2HA 1FMJA 2PX3A 2CBZA 2VPPA 4NCJA 4CF7A 4IEEA 4Z8XA 2GA8A 5CJ2A 3K70D 3EA5A 2QE7D 1KI1A 4JIMA 1HT2E 4ZDWA 4JBXA 4EPWA 1M8PA 1L4YA 2PMKA 3DHWC 4LBVA 4GMDA 1RE0A 3G5UA 2GJ8A 5FI1B 2ZTSA 3SJZA 2IC5A 4M9ZA 3A36A 4GPTA 4PSAA 3ICEA 1PLLA 4QM7A 2XB2A 1A2KC 1E0KA 2A2ZA 2OLKA 3A1VA 4EQ6B 2ZRJA 1Z8FA 4WA7A 1XF9A 4PPGA 3KX2A 4FMCF 4YONB 3U44A 2C5LA 2ATXA 3ASZA 3EIHA 3B85A 1CJVC 1KNQA 5EXXA 4IVPA 2XXAA 3OAAD 1P72A 2JJ8A 2QP4A 4Q4LA 4KI0A 2W00A 2AD1A 2IBMA 4KSBA 5FTKA 1R8SA 3EPKA 3LH5A 1KK0A 1WA5A 5GJWC 4IOMA 4C2TA 4B6EA 3P20A 3CO5A 1TMKA 1TPZA 5LD2B 4ESVA 2VRWA 1II8B 2J1LA 3HDTA 2FN4A 2VF8A 1NI3A 3SQWA 5FI0B 1FL9A 1T3SA 3WYGA 2FFAA 1N0WA 2GZDA 3QF7A 1G6OA 1WDTA 2F9LA 1H65A 1W4AA 2IT1A 1HT1E 3CZPA 1AZTA 1EFUA 1PZNA 4BE7B 1P62B 3LWNA 2EYQA 1E79D 3QKSA 4KYIB 2A5DA 1T8TA 3L43A 2ZANA 1SVMA 4B3XA 3BB1A 2WJGA 2OG2A 3NH9A 2JIZD 1OXSC 2BMDA 1I4LD 2JJ2A 421PA 1FTSA 4BLPA 2ZJ5A 4CEHA 1N5IA 1YZKA 1XRJA 4DC9A 1KDPA 5E4FA 2PEZA 1CR2A 1OXVA 1WBBA 3W90A 4MYCA 4D4KA 4JKIA 4AG5A 1T8UA 1CBUA 2IHYA 5TMPA 2QTHA 1TUIA 1VCOA 2OAQ1 1F5NA 3U5ZB 1RPZA 1GKIA 4FMBB 1OFHA 5CLLA 3K0EA 1DAMA 1SVKA 3MCAA 4AC9A 1DELA 1KDTA 4JL8A 4B76A 5KTYA 5J4HA 1RZ3A 1FP7A 3NC0C 4PC3A 4DEXA 2AFHE 4KHZA 4G0NA 1W0JD 1CR4A 4LBZA 1E32A 4UJ3A 3TUJC 3OEED 1TF5A 4KLNA 4TT3D 2KBEA 3WRYC 3R9XA 4L9WA 2XOKD 4G1UC 4DLYA 2EWWA 1LB1B 1ZC4A 1DAEA 2FFQA 2W2VA 3C5HA 3U3OA 1RRPA 3UMSA 2C95A 3W6NA 5JWRA 1IY0A 2NO7A 3SYNA 4EDHA 1DOAA 1YKSA 4ZI2A 1E2GA 3QF4A 4JLBA 3OEHA 2HLDD 3KQKA 4MRSA 1W2GA 2OCYC 4B2LA 1NG9A 1GZSA 3A1WA 4RZXA 3A1UA 3LW7A 1Z6YA 2J46A 4B32A 1CJKC 3H84A 4RFVA 1FPMA 2DHRA 5SZJA 721PA 3VMFA 4LBWA 4AKIA 4TYQA 1GWNA 2ASEA 1ONBA 3I4LA 1MO6A 4Q4JA 3V4FA 4OBEA 4URXR 3TGPA 2XAUA 4A4DA 2I1VB 3GLFE 5F9HA 4IRUB 4BPBA 2GNOA 4Q47A 4C0AC 4O3MA 3ZVNA 1G9XA 1W46A 1KI3A 4M1YA 1FMLA 3UG6A 2K5UA 5AK0A 2QTVB 4QBIA 1Q1QA 2JLXA 3I72A 3GPLA 1R5NA 4M1WA 4G01B 2O8EB 1XEFA 4TMWA 4DCNA 3LQQA 3LVQE 5FBLB 3I62A 2DWPA 3AKEA 2GWHA 5G3ZA 1KI4A 2ZU6A 3ZZTA 2R6FA 1VYVA 4M4SA 4NYIR 4Q4AA 4A82A 2V7QD 2ZSDA 4HAYA 1I4DD 2W0MA 4ZCLA 3I1FA 3NBZC 3BFVA 1SHZA 1SQ5A 3CRW1 3FMPB 1SXJC 1ZC3A 5FUWA 2J0VA 4IVRA 3VKGA 2QTFA 2ORWA 3CWQA 1AM4D 5H68A 2C9CA 5CLQA 3K9HA 1XD2A 2A78A 1W48A 4RCZA 2VL7A 4IDOA 4D26A 1G7TA 5SZKB 2IUSA 3SR0A 2C8VA 4WBSA 4TMZA 5BN3A 1DO2A 2AKAB 1P9NA 3WHKA 4MH0R 4V0OA 4GZMA 1XBTA 4JSYA 1BS1A 2BJWA 4Y0AA 4QHTA 2VHUA 3SHWA 5JWOA 4BEBA 4DDUA 1QVAA 1IN7A 3A4NA 3F5FA 3BFKA 3Q7QA 4TTRA 3P1JA 4FW9A 3AKCA 5B64A 2EW1A 3UIEA 1NJGA 4CEIB 2QI9C 3FVQA 1F2TB 1TNDA 2CJWA 2WKPA 4TQAA 3IPYA 1M7GA 5B2ZA 4Z51A 2ZUBA 1FQJA 1Z83A 4MKHA 2DWOA 2ZS9A 4M2LA 1W4BA 4L16A 2PZEA 3K9NA 1M34E 4MITA 4L15A 5DHAA 1KKLA 5K8TA 3A4MA 5EZ6B 2CLDX 3OIWA 2YNMA 3WBJA 1N6KA 3NHBA 4Q9IA 3L0IB 4LDJA 4S35A 2EFEB 1UBGA 1G4UR 1R4AA 1KK2A 2CLCX 3QIAA 5C46F 2C04A 4TMVA 4A9AA 3QG5A 1ZJ6A 2BHRA 4MGZR 1NJFA 3IO3A 2FFBA 3VTKA 4BLRA 5K8IA 5DSZA 4DB2A 2R62A 3H1TA 3CBQA 4HAZA 2R6CA 1OIXA 5AUQA 5FTJA 3RC3A 4DIEA 4PPQA 1NVUQ 3AM1A 1HYQA 1QHNA 3NVAA 4HAVA 3OFNA 3HU3A 4Q1CA 5DNYB 3I73A 3U3MA 1UDXA 2F3TA 1OFTA 2GTPA 4JMPA 1H8HD 2AWOA 4NE2A 3KQLA 1RRCA 3CM0A 2IYZA 4NL4H 2VP6A 2V6IA 1FQKA 4JYCA 4OI1A 2D62A 2D74A 4MKIA 1GVNB 2R6DA 3AGQA 4QGHA 1U0LA 4FI3C 4MYTA 4UXJA 4PPNA 1Q1BA 2BMEA 3BJIC 3FFAA 1EFRD 4RD6A 4BECA 1AGRA 3BORA 3VKHA 4JLJA 3K0CC 1XEWY 1Q44A 4LWZA 5CJPA 3RABA 3L8YA 4PHTA 2F9MA 4AG6A 4KVGA 5F98A 1LF5A 3D3QA 4OYHA 1TEXA 3ZZUA 1U0HC 4FIDA 3F0TA 5FL3A 2EVWX 3T34A 2ODNA 2BBTA 3CRQA 4LYAA 3H0KA 4JVSB 1U98A 2H5EA 1TL7C 2QAJA 3B60A 3A37A 4QXAA 2HJGA 3LX5A 5FUYA 3KKNA 3LLUA 3EIEA 4FWIB 4LYHA 3GLIB 2EFHB 1KDOA 3GJ4A 4AI6A 2C77A 3EC2A 1Z6GA 2YC2C 4D81A 821PA 3T1VA 4XTCS 1U99A 1QZXA 2C98A 1DO0A 3ZLJA 2GAOA 2GESA 1ODFA 5D3QA 4ITRC 4F4CA 5JI2E 4MRRA 4TL8A 4TN1A 4OHYA 2ZIAA 4AURA 4AK9A 2ZRPA 3FGNA 1KMQA 2AD5A 5FPSA 3CR7A 4IOJA 2RMKA 3QJYA 4DWJA 3CF6R 1TTTA 5EP2A 3B1VA 4OHVA 2DFKB 1JBKA 5AJZA 4B43A 4ZIRA 4D82A 1CJUC 5D3MB 1TEVA 5DN6A 3WHLA 5EJEA 2PZGA 5JCPA 1OB5A 1RJ9A 2F7SA 1OIVA 4D4LA 1XJ0A 2CNWA 1TU3A 4HZUA 2J7PA 1VIAA 1PLJA 2MSEB 2AL7A 1I2MA 1C9KA 1CR1A 4FMDF 4C0HA 1ZVQA 3BAFA 3VR5A 2ZREA 5IT5A 3K0FB 4D0GA 3U7EB 3W8NA 1RW4A 2P2LA 3CRMA 4MUAA 1EG7A 2WZQA 1XJQA 3RS4A 3R8CA 4CW7A 3B8HA 2WAXA 4NH0A 1COWD 2GCPA 2ZSFA 1JPNA 5J47A 4EPXA 4G3XA 4TZ6A 3TQCA 3IEVA 2REBA 1P9WA 3WNDA 3TJZA 4RFSA 2JAQA 3CW2A 3G82C 3ZVRA 3K53A 4FCWA 1W5TA 4YC7A 2QMHA 3EG5A 1XPRA 1ZU4A 4MUBA 5EE5B 2HF8A 4B75A 1NF3A 3UMRA 4P3YA 3T1TA 2ORIA 4CVNA 2MSCB 3T5DA 1E9FA 3C15C 2ZE5A 2QSZA 3KUDA 1LVGA 2GZAA 2FJUA 2B6HA 4HLUC 1AIPA 3K0AA 1NKSA 1Q0UA 1U2RA 4YMSA 1OH8A 4PZLA 4NDZA 1KSGA 1E98A 2ONKA 3KJHA 4NYMR 2JLQA 1ZBDA 2HV8A 1N6OA 2CLSA 1FP6A 1KKMA 2ZRGA 2DY1A 2DR3A 1KY2A 1QDEA 2FGKA 1X6VA 5FOTA 3GEIA 2KBFA 4B3FX 2VLIA 2WPDD 2QAGC 3P32A 4PX9A 2PL3A 4M53A 1K8RA 2KB0A 5FUXA 3FKSD 3UKDA 2GCNA 3TW4A 4JJZA 4HLUA 3T61A 1EX7A 3UWKA 1YRAA 1ZRHA 1P61B 1XXHE 2H1LA 3RWOA 1ZINA 1T3HA 5FL7D 3SQXA 5KOYA 3L2OB 1QBKC 3I5YA 2QPOA 1G5RA 3MWYW 2D2FA 3BIFA 3R20A 3V9PA 2VO1A 3CIOA 1E9EA 5FFMA 1T0JB 2F1IA 3J81k 4NKRA 1G3RA 4QHYA 4XH9B 1IY2A 4Q5IA 2ZROA 1DG3A 2W58A 1NY5A 2IXFA 4MKFA 3PG5A 2YZ2A 3HPQA 3SN6A 5JS8A 3IDQA 1FUKA 5CB8A 3IIJA 4LI0A 4F93B 3LY5A 1IBRA 3NXSA 3AP3A 1W36B 1QHHA 3BERA 3RRNA 2BKEA 2CL6X 1SULA 2QGNA 1GL9B 1S0UA 2V1XA 3CPHA 3GP8A 4PPFA 1LF0A 3K0SA 3C16C 2W6JA 4DEYA 1KMHA 2PEYA 2EFCB 4M9XA 1KYIA 1W36D 1MOZA 5JRZA 2OZEA 2GZHA 2MMGA 1SKYB 3KJEA 221PA 4M1SA 1NVWQ 1IJFA 1DAFA 4L9SA 5B30A 2REOA 5JLJA 3P4YA 3EZ9A 1LS1A 5JCZA 3ETLA 2VP4A 3LQRA 2GCOA 1V43A 2JA1A 1IAQA 4IOKA 3IEUA 4XWOA 1XMSA 4X8OA 1G3MA 4HAUA 4PQYA 2WIAA 4DCUA 1VCNA 4IDPA 4DLVA 2RB4A 3CNOA 1Z0IA 2JJ1A 4LHWA 1SHKA 2CHVA 2ZQ5A 3PUYA 5EE9A 1F60A 5IK2A 3TNFA 3W8RA 5E7MA 2QRNA 3IHLA 3LBNA 2HT6A 2BC9A 1FZQA 4TLEA 1G4AE 1GNPA 4XWKA 3RSLA 3QKTA 3FHOA 4QBHA 5E7IA 1AGPA 1CR0A 4UNSA 3VU9A 3ZIAA 5H70A 5CIWA 1G17A 1KJYA 4G5QA 4QGGA 1E9AA 2AN9A 3MWLA 3K70C 3R9IA 2RGNA 3VKWA 4HEJA 5DYIA 2NMVA 3KKQA 2BM0A 2IK8A 4XSGA 4C0QC 3IQXA 4NYJQ 2QSYA 1R5OA 1E9RA 1TU4A 3W6OA 5E3HA 2RKOA 2WWHA 2G0NA 3L8ZA 3O47A 4IHQA 4M21A 4QBGB 1BIFA 1RKBA 1EESA 4PZYA 5HKKD 4JLPA 1XWIA 3WMGA 2WMOB 1N25A 2OXRA 4PHHA 121PA 2P5TB 1G64A 3KQHA 2OBLA 3T1OA 1KJZA 3NH6A 3LXXA 2BVNA 1O87A 1P2TA 3PUVA 3QI2A 1S1CA 2XNDA 1TQ2A 1SXJE 5IRCD 1DADA 4DUGD 1WMSA 3EZFA 1ZD8A 2F1JA 5TARA 4BFSA 2ANBA 1TF2A 1H8ED 1E99A 2BKUA 4D0LB 2QPTA 2IF2A 1VYUA 1ZM7A 3AKYA 1XZPA 4NCKA 2A3RA 5FH9A 2JCSA 4Q18A 4LHZA 5CYPA 1F6BA 2JDID 4LCBA 4LYFA 1Z47A 4A0HA 4H1VA 4IW3B 4V02A 4LYJA 2N46A 1W4CA 2OE2A 2BWJA 2EQBA 3FDIA 5LB4A 1P4SA 1VG9B 2QP3A 1XPUA 1ZNYA 3RS2A 4JT2A 4XJXA 1IN6A 1UKZA 2LKDA 4US0R 1HV8A 3D7MA 1TUEA 3K09C 4ZDIA 4DT1B 4HDOB 5LD2C 2J7KA 2ZUCA 1KSFX 2OFOA 2JLWA 3KZ1E 1E9CA 4JLVA 5FTNA 2AWNA 1NVVQ 2VYFA 2ZI3A 2XSZD 4A8JB 2CHQA 2YV5A 2GK6A 3GLIE 5CDFE 1CP2A 1N6PA 3UWOA 4GP6A 5CM8B 4C30A 1A5TA 3B7GA 4ARZB 4BLSA 4R98A 4HUQB 1ZUNB 1E2HA 3BB3A 2JLYA 4YLGA 1KSHA 5C4GB 3PQCA 3CX8A 3MGCA 5LDDC 5L3SB 1OV4A 2ZE6A 4O25A 2ZYWX 3NHAA 2QMUA 2R8RA 4DXAA 3CUEF 4N3NA 4DSOA 3K09A 2QUZA 4TMTA 5JZVA 1XTRA 1BYUA 4IXNA 1WCV1 1YR7A 2OFWA 5LPNA 2QBYA 2P3SA 2NQ2C 2ZU0C 4B33A 5AR1A 2AKYA 4ZV4A 4ZPXA 3OZXA 5FR2A 3VR6A 2OHFA 4A0GA 2J87A 4TSFD 5HE8A 3K8YA 3KTAB 4FINA 1N5JA 3L0SA 2ZVPX 3C7KA 2FSIA 1AKEA 1AA9A 4JLKA 2PZFA 3KKMA 2AHOA 5FOSA 2H17A 3EAQA 2OBNA 4EFMA 4ERNA 1G7RA 1YR9A 3EPHA 3EWSA 2G0TA 2P67A 1W1WA 1L8QA 4EPYA 1NN3A 3IO5A 1HQCA 2X8AA 1II0A 3WY9A 3RWMB 4YXWD 4WW0A 1D8TA 5FOWA 2HCJB 1N2CE 4DLUA 5C2JB 3IBGA 4IEIA 4WAUA 2WJYA 4XIGS 1W0JA 3EARA 2VBCA 3U6BA 4I99A 3AF2A 5HTKA 3OEEA 3LW8A 3DOEA 2NO0A 2PBRA 1JI0A 4TWZA 2NTYC 5FTMA 1Q20A 2R6GA 4OQXA 1IY1A 1F2UB 4XVUA 5J4LA 2VP5A 1ZD9A 1AZSC 1KK1A 4BLTA 2ZRDA 5B57C 5E95A 4PO9A 1UKYA 4P4SB 3OIUA 2HLDA 4OQFA 3KKOA 4Q1EA 1VG0B 4UXHA 2OT3B 4EJSB 4TL9A 3QKUA 4HB3A 1FX0B 3THWB 3ZH9B 4QJ3A 3PVSA 1GM5A 3ADKA 4GL2A 2PCLA 5G40A 3TAUA 1R8QA 5CIQA 2J41A 3QNUA 1U94A 2GJKA 5B58C 2ZRMA 4OI0A 2ZITA 1XFAA 2IYLD 3L0PA 2IX3A 4LJ6A 4NYMQ 2ZM5A 3B13B 4AKGA 3BB4A 1OKKA 2SHKA 5FBWB 3JVVA 3LD9A 4LSGA 1N6NA 2P6NA 4U02A 3ZJYA 1U0JA 4MDEA 2DFNA 1E6CA 1ZD1A 5J40A 1Q1ZA 1JJVA 2OCAA 3QBTA 3REGA 4WZBE 3THXB 2XZOA 2EFGA 1A1VA 3P27A 4GOXA 1S3SA 2G88A 3PENA 2V1UA 3UATA 4CYMA 2CE7A 4Q00A 4GBMA 3KKPA 2DBYA 1FOEB 2GKSA 2X1VA 4D4MA 4B3GA 4K8OA 3U44B 3ND9A 2QU8A 1ZUIA 4D4JA 2IYYA 1XXHA 2XXAB 2V7QA 3ZGXA 1CF4A 3LFUA 2QY9A 3AVOA 2GBLC 4LPSA 3BH7A 1VTKA 4KV9A 1IXSB 3IPXA 1GITA 3LAWA 5HZHA 3W34A 4MQBA 1G7SA 1Z0DA 2GXSA 1R0ZA 1D6JA 2R9VA 1DAGA 1RYHA 2OLJA 4M9SA 4WVFA 1ZMXA 3W3ZB 4N0EA 2QEQA 3SJCA 3U7FB 1JB1A 2CCJA 4GI7A 4LPKA 4ZDKA 2IXGA 4C0JA 2FPMA 2OO7A 3DZ8A 3BH6A 3C14C 3X1WA 5KDOA 3U61B 2IUTA 2EU8A 2VTKA 2AXNA 3FTQA 3EZ7A 3L0OA 3THOA 3QKSB 1W44A 1TQ4A 4A1FA 2FNAA 4URVR 5FTLA 1FFHA 4HZIA 2HCBA 1IQPA 1CULC 1OLOA 3AKDA 5K8LA 1I4TD 1KZ7B 1E1RD 1OXXK 4FN5A 4CEHB 3VFDA 4YMTA 4RCYA 5BYJA 4P4TA 1E96A 2Q21A 3PITA 5DE3A 1XP8A 1X8LA 3EASA 4JZKA 4R71A 2GEVA 1QF9A 1JXMA 1XB2A 2JJ2D 4LBYA 2KWIA 4NCIA 2Z83A 1K5DA 3CX7A 2O8CA 3QPVA 3QXXA 5L3QA 3EPJA 4CRWB 1AQYA 5F2EA 1P2UA 2CMKA 4FD2A 4S2EA 1D2NA 2IYUA 4PC2A 2GEDA 4BGDA 3TBKA 3IUYA 3G0HA 1MO3A 1T3LA 4PR0A 3HYTA 3C5CA 2JATA 1U8YA 5KSPA 1BYIA 3QVUA 3TE6A 2H8KA 2Q6TA 1H8HA 2ZSAA 1Z22A 4GOJA 4BRUA 5H1YA 3JVUA 4PXAA 4Q03A 4LJAA 5FR1A 3GLHA 1TF7A 2ONJA 3CX6A 3PUWA 2ZJAA 4RY2A 3C8UA 2V9PA 3BRWD 3MLEA 4QM6A 1QHIA 3NG1A 1M1YE 1SVIA 1TX4B 3N5CA 1OB2A 4EFLA 2QT1A 1UM8A 4H1UA 4AKEA 1GRRA 1NLYA 1KOFA 1M7HA 3O8DA 1XTQA 2RGBA 5GJCA 3H4MA 4Q4JB 1CJMA 1SXJA 1W2HA 2FE4A 4MDFA 4BRWA 2UZ3A 2Z6VA 1NN0A 1Z0KA 5CITA 4U7DA 3DMNA 3GLGB 4UQOA 1DPFA 1T9HA 2GEUA 2O0HA 1OE0A 3MJHA 2A30A 2WOJA 3RS7A 5BN4A 3S1AA 3THYB 1VKJA 1E94E 2EFDB 4NBSA 3WYAA 1S8FA 4I1UA 1C4OA 3CH5A 1XD8A 4XSHA 4YMWA 2WM9B 1Z2AA 2IXEA 4F92B 4KITB 1X1SA 5AWFC 3D8BA 3HPRA 4NU0A 4F91B 1KO5A 4GNKA 4Q7KA 1ANKA 4Q1FA 5G53C 2B8TA 1G18A 1XCMA 4HLCA 3R9WA 1BMFD 1G6HA 4KO8A 4Q4AB 1D9ZA 3T12A 4LJ5A 2OBMA 1NG1A 2YWEA 1SGWA 4PZZA 4Q4HA 1YZTA 4URWR 1CIPA 2IYQA 5TXGA 3FB4A 3NKVA 3N2EA 2H92A 2VIIA 1ZM4A 1Z29A 2RGDA 3JZAA 5CDFA 1IXZA 1ZCBA 3TW8B 3QEOA 4C7OB 2I3BA 1KNXA 4Q19A 4B2IA 4IDHA 3RRYA 3ZDQA 5BWMA 2P6UA 4C0BA 5EZ5A 1GG2A 1XD2B 1FUUA 4KFUA 3PUZA 3LLMA 2REXB 4NPHA 4QGFA 1UFQA 1JJ7A 2FEMA 1L7VC 5FUVA 5G41A 3R7WB 1OH7A 2HF9A 1G8YA 2CHGA 1OYWA 4N1AA 4EAQA 5EP1A 3KXIA 3NEYA 1UEIA 2G1KA 1G5PA 2FSHA 1NBMD 3RS3A 2J59A 2NZ8A 1JAIA 4Y0VA 2ERXA 1VMAA 4A6PA 4QHSA 3CB4A 4DRZA 3AV0B 3KQUA 4E22A 1DE0A 4XD7A 1WRBA 2PT7A 2CJWB 5BYKA 5BXQC 1QG2A 1AQUA 3RRZA 2GAAA 4B6FA 3IGFA 2CDNA 3ICQB 5EXTA 3UG7A 3KB1A 4BLQA 2RGEA 4JSTA 1KAOA 4DB4A 5EUQB 3Q85A 5LBIA 4BLOA 3QXCA 3HR7A 4LC1A 2B21A 4IDNA 4OHWA 4YDSA 2IS2A 1OXTA 2FDCA 4Q21A 2ZRAA 3MFYA 1KJWA 2VHCA 4LC0A 4ZCIA 4WIAA 1J8MF 2G6BA 3ND8A 4TL7A 1P2VA 3FWYA 4XTRA 1HY3A 2RAPA 5L3RA 4GFDA 4A2WA 1GAJA 5LB2A 2BV3A 4JLOA 4L4UA 1RFLA 1S4QA 4B44A 1XTKA 1B0UA 4DDTA 4OK5A 4G5SA 5KU1A 2UVQA 2FG5A 3K0CA 4N0DA 1ELOA 2X77A 4HAWA 4C0SA 3BOSA 2IYRA 2A5GA 3SFZA 2Q3HA 3DO6A 2FU5C 4KODA 1J90A 3CWZA 4PANA 1Z0FA 3OF5A 1RC8A 1P75A 2J0UA 1D2MA 1GL7A 2G1JA 1OHHA 2UZIR 3OFND 3ONWA 3MRSA 4LX0A 4LJ7A 4ZKEA 4JBWA 3CNLA 3RLFA 1GILA 3KQNA 3TR0A 4JJKA 4RZUA 4DSNA 1E2LA 3U4QB 1KSJA 1VDZA 2CVHA 2RGAA 4EUNA 3AVVA 3EZ6A 1G16A 2IA5A 1P7CA 4HB4A 1EFHA 1QRAA 4HDQB 4LHXA 2ANCA 2VSFA 1Z63A 1E0SA 1KO4A 2XTNA 3QVVA 2IS6A 1YE8A 3Q9LA 2WICA 2WVJA 3WP0A 4KBFA 1WP9A 5HPYB 5A5GA 1M74A 3GJXC 4QFMA 1SVLA 1XMJA 3DKPA 1JR3D 3JZMA 1SZPA 2GJ9A 3BWDD 4UNPA 2LKCA 2GVDC 2GF9A 1N6IA 1A7JA 4DCSA 3DVLA 2ZR0A 4MRPA 5CK4A 3GFTA 1NSFA 1GL6A 3RS5A 1VECA 1MO5A 3QQ5A 4DJTA 2YYZA 3B1ZA 3ZQ6A 1UKVY 1W36C 4IVQA
chains in the Genus database with same CATH superfamily
1KIAA 3F71A 3H5VA 4E15A 3UJ3X 3L0DA 1QIIA 1VJCA 4WZBA 4L4XA 1QIHA 2B0JA 2GO7A 3DBLB 2N1BA 1RHJA 3ZHZA 1OH6A 1DQZA 1PQ4A 2DOKA 5FULA 2ZP1A 3EVCA 1A3CA 4IO1A 3WI7A 2AFHA 3T5GA 4QYSA 4UQPA 1E2PA 1VLVA 5I7AA 4DLZA 5AW7A 3O8QA 2W37A 1P6UA 4PWZA 3SFTA 3MSXA 3TW6A 1EJ2A 4C7XA 3KLNA 3G1TA 4UMDA 2Q3JA 4DIDA 3TLGA 1T5LA 1TYZA 2ESRA 2E7ZA 3OM8A 5F1KA 1HH4A 3K2EA 4ZOCA 3A9VA 3FDJA 3TR5A 3ZWKA 4RVCA 4OK6A 4LWPA 3IHWA 4CMEC 2NUTB 4YRRA 2D4AA 1N2HA 5T8KA 3SIXA 1K6JA 1F8FA 2O2JA 3AILA 3MJEA 3TB4A 1DS6A 1JA0A 2ZBUA 3X44A 4C43A 1RRFA 5JXWA 4K81B 2Q4DA 1SIUA 1RRKA 1MVNA 2P9FA 4EJ0A 4YCDA 1OFUA 2ID9A 1A9QA 1F9AA 2VKTA 3DH0A 4CDGA 2QR5A 2V7XA 1Q6ZA 2HM7A 1KDRA 1X70A 2B35A 4G86A 4M9CA 4Y9RA 2CVQA 3VC3A 5BSUA 2PLNA 4XX0A 1RJ9B 3LA6A 1EDBA 1FSSA 4ETNA 2AQIA 4EA6A 2YHSA 1UKAA 3RSSA 4D56A 1JAHA 1NW3A 3GLFA 4ZALA 1G5FA 2VA8A 3BHMA 4RU1A 5BURA 1PR3A 1XK7A 3AVPA 4OAOA 2X1MA 2V03A 3I32A 5I4KA 1U0SY 2KW5A 4MW6A 3TIVA 2QT9A 2ZJOA 1HE4A 4IZ6A 5C18A 3NX4A 2LZ0A 4Q7LA 2QN8A 1OLSA 3BSYA 5UKDA 1JQKA 1PWEA 3DBVO 2GD2A 5FIUA 1OW3B 4HD8A 4CMEA 2GLUA 5FA6A 4Z7OB 3FWPA 1QF7A 5IUKC 2O9JA 1LA2A 3DZCA 4IFEA 3K05A 4BWYA 4DDVA 3A4IA 1ZDMA 3C7AA 1E7MA 4UVIA 5C0OE 1NBIA 1ABBA 3V2HA 2VHEA 3MAGA 4LZZA 1AHHA 4RETA 2JLUA 1U3FA 3IBCA 3LVBA 3MG9A 1NYTA 3IV7A 5EUBA 2RAFA 1PG0A 5J2UA 3PRHA 2OHHA 2JHPA 3HKEA 4K9KA 5KO2A 1N7GA 2VQSA 1NUAA 3E7PA 5FOUA 4EA8A 3BBPA 2ZIWB 4YX9A 4B17A 2EQ5A 1B8VA 1NW4A 2O2EA 3N2LA 3OURA 4KCGA 4BZQA 2AC4A 2F3RA 4F9EA 6REQB 4J0JA 3FKQA 4O33A 5DEOA 1EI9A 3P9ZA 3R6DA 4I2NA 4MUGA 3ACBA 2EDCA 3IOYA 2A92A 3K9LA 4HATA 4ER3A 1L5MA 1PJRA 4RZ2A 4RY9A 1OYYA 3LY9A 3T7EA 1P0CA 2DFTA 3OETA 1E9SA 1VCHA 3OE7A 1ENPA 3LO5A 3UB4A 4BQIA 5JDIA 3PC2A 1UP7A 2VSOA 2XB4A 3WIUA 4EIWA 2AMVA 1LNZA 3KXPA 1LPAB 1XA0A 2YR0A 2HA5A 2PX8A 3AP1A 1QF6A 3EWAA 1M1YA 1B1AA 4MRVA 2CVFA 3LUKA 1L5HB 3FCSB 1A4UA 4US2R 5JJLA 2CK3A 1QWSA 1R27A 2CUTA 1P0MA 1W4LA 2MINA 3BFJA 3GYBA 4OREX 1E4VA 2GKOA 3F97A 3ZU2A 1T3ZA 3WTCA 1TW3A 2NO9A 4MMXB 4UEKA 3DDHA 3RK4A 1MQAA 4J0QA 5H8WA 4QUBA 4CIAA 1CRQA 5KJ1A 3LYLA 5C35A 1HDYA 3GG9A 5A3QA 1XKXA 5I9MA 2QDXA 1FSPA 5JHHB 2GVZC 4NAUA 2H1RA 3KVOA 3GJ8A 1APBA 1QR2A 4TLCA 3C1TA 3C8ZA 2HI0A 2IYNA 3UUFA 3RU2A 4ZVVA 3BFXA 4ZWNA 4DJJA 4K2HA 1JIJA 4UU0A 5DMHA 521PA 3X2SA 5FLKA 2W5UA 2UAGA 3LQFA 1EXMA 1PUIA 4BOYA 5KPDA 1XZKA 4U2KA 4FUQA 3IT0A 4NS4A 3G88A 3ZHRA 2C5GA 1E2NA 1BMDA 1UKEA 3N5KA 1NN1A 5BWNA 3WMFA 2D5LA 2H1HA 4BNIA 3PYXA 1GKYA 4TQ9A 3PIRA 4LDZA 4O59O 3NJ4A 2JHAA 3G0DA 1RYEA 3ZE0B 2W2QA 4OGGA 1B16A 3VVMA 5LBTA 3V48A 1ISFA 1S9HA 3WWDA 4YMLA 5I7HA 5IUNC 5KS2A 3V5NA 3ITDA 3CN7A 4C0KA 4F3RA 1GZ6A 2OC4A 3UNXA 2PJRA 1P18A 4LXQA 4MVJP 2OGTA 1W0KA 1IC6A 1NZDA 3KB2A 2HTFA 5E8RA 1UJ4A 3BWYA 2HQRA 4QE3A 1KMHB 2BOVA 4H3SA 4HTAA 3ZI7A 2D7DA 4AD8A 5JHGB 1Z68A 4LRWA 3FGZA 2G83A 4K9QA 3ZXSA 3EZNA 5KYKA 4RA9A 4U5XA 4L8VA 5CGZA 1I2AA 3EXIA 3WSWA 2GGSA 3CR8A 3L6EA 4ZOAA 1BQEA 5ANRB 3R5JA 5AKKA 4JB0A 2FN9A 4ZT6A 1Q57A 2W93A 3BWMA 4RBNA 3I61A 4L6CA 2NVUB 3WNCA 4MWBA 5CD1A 3EDYA 2X0EA 4V03A 4E03A 2VZ9A 3KTAA 1G98A 4AWAA 3VZRA 4KFCA 2OFXA 3KYDB 1JQEA 2QD1A 4QYIB 1I0LA 4D57A 2P35A 2Q29A 1S9DA 5AI5A 1D2AA 4W6ZA 3BX1A 3C3EA 2I55A 4Y1FA 1QHYA 1XXLA 1GRCA 4PQGA 3OAAA 4RXUA 1X38A 4D4IA 4EJSC 3C3JA 1IIRA 5CCDA 5EEGA 2IP4A 3QXJA 4R22B 1DRVA 4ISBA 4QAQA 3PGKA 4AJNA 4BFVA 2OO3A 3L1JA 3WK5A 5LXTF 2AXEA 4NMMA 3OWOA 1JNXX 4XYGA 4RGYA 3AVYA 1IE3A 1MAHA 3BHJA 3DCJA 1PT8A 3AF4A 3P4XA 4IDFA 4AM8A 4R1NA 1XZDA 1UC8A 3RSCA 3ED1A 3EX7C 1BE1A 3R7AA 3PDUA 4FW8A 4PNHA 4R1SA 1V45E 2DRIA 1ZRMA 4LOLA 5SV2A 4KQCA 5AK4A 5G2OA 1NVDA 1OXUA 3VXKA 2QQ0A 2FPWA 3KQTA 3JWHA 4G4GA 1D5CA 2OPBA 3Q8XB 3WZ2A 3CYFA 3AZQA 5IT4A 2DCUA 4BRSA 3ISVA 3OD5A 4NBRA 4RVSA 1QCYA 3ODGA 1I2ZA 4HLQB 3BHIA 1II8A 4P33A 4RH3A 5EWLB 4PQFA 4O2AF 4JI2B 1VIYA 2FUCA 1CVLA 1RIFA 5D90A 3W7VA 4IVNA 3GT7A 2VDOB 2YBDA 4WX2B 3SXUA 2B5WA 4J6EA 3IS3A 4KJZA 4TLBA 4IQ8A 3EEYA 1PR0A 1OWMA 2X42A 3EIXA 1ECCA 4XM2A 1IK6A 4G0YA 4IJKA 4MUEA 1MRSA 1NX9A 3U3RA 4EJSA 4F5WA 3P2KA 3EQ8A 4ICIA 5KSZA 4GE3A 1ILEA 1FBNA 2AG8A 3CNBA 3NWEA 5LOVF 4KXUA 1X80B 2PLWA 5IABA 2CEAA 1FVFA 2FZWA 4IX9A 2HMUA 4ZTZB 3I30X 3KKLA 3FUXA 4E1BA 1W88A 4AUMA 4DF3A 3OTOB 1SD2A 1J8DA 4GQIA 4I1VA 4M8LA 1DKLA 4Q01A 3CVWA 2E5WA 2C8KA 2VQ3A 3MWGA 1AMUA 2J5XA 3HP7A 1QNLA 2HCTA 2RHHA 4KBGA 5JZ9A 3GZJA 3I01A 4M88A 4WZAB 4CQLA 5KC8A 1NF8A 2XKAA 4RYLA 1Z7WA 5JEEA 5ITZA 2XB6A 2B78A 4Y6OA 1KZGB 1IOZA 1N8TA 3HP1A 1F1BA 4LHEA 5TIIA 1UPCA 1ZOLA 4W8OA 1LK5A 2QG6A 2YHBA 4ZQEA 3T3DA 4B45A 3CR3C 4TS1A 1ORHA 3QVOA 4PC6A 2OAP1 3DMPA 4N9QA 2B6NA 1RBQA 1GSIA 1PW5A 1XMIA 1OQAA 1SWWA 3GD7A 3H3FA 2PM8A 2V6JA 4CKCA 4JODA 4AMYA 1DV1A 5HNKA 1OSNA 2ZAGA 3DYIA 3UC5A 2MSWA 3WNZA 4YMVA 3UM9A 2IYOA 4Q82A 4F4JA 3EMKA 4R69A 1WSWA 3ND6A 5IAJA 2I4LA 3OLQA 3MZ0A 2DKOA 1G3UA 3QQPA 1YS6A 3DVAB 1X42A 4OL0A 1XZCA 2D5AA 3TX6A 5JS1A 1X7DA 3EC7A 1DQYA 1D4FA 5JXIA 3AEKA 5DM4A 5M7EA 4AWXA 2NXJA 3OOWA 3KOMA 5AJWA 4YUXA 1ZKDA 2R25B 4UNQA 2UZ1A 4N9WA 1ZUWA 3MAAC 3VH1A 3TEJA 2LWIA 4XYMA 1E2KA 2AZ4A 4KXMA 2ON6A 1COZA 1ZGHA 4GAEA 3ZYCA 2PGDA 1SKAA 5BSTA 5U1PA 4M0CA 5FWYB 1NBOA 2ONZA 4ZDJA 2G9NA 2J0EA 2Y1XA 4MJLA 2OESA 2VLBA 1SPXA 2WT9A 3SF8A 3FJOA 2ZJ3A 2C00A 1ZG3A 3R0IA 3O4RA 2FZVA 4U2FA 5A9SB 1DAIA 1TZMA 2YOGA 1PWZA 2E4AA 1TLFA 2M1ZA 3H2ZA 1CC1S 3IC5A 4HX2A 5K09A 4QLAA 3NJRA 5H82A 3THRA 4P54A 2JGDB 4CTJA 5KVAA 3PUKA 1XVIA 2B61A 4TTQA 4LGYA 1M5TA 1H9BA 2GN8A 4IG9A 1NJSA 3A32A 4P38A 2KX7A 4Q6BA 2AN1A 1AV7A 5BSHA 3A58B 1IBKB 2Q3BA 5AJVB 4B6OA 4H08A 2IS1A 1QZTA 4YRPA 4MPTA 4O1HA 1XQ6A 4G0OA 5FPKA 3EDCA 1ZVJA 2VJLA 4HEHA 3WLMA 4P4UA 4ALMA 3VYVA 2ZSBA 4INOA 4JBNA 2EL7A 3LO8A 5KJCA 1CG6A 4AMVA 1AKNA 1O9BA 2PO7A 3H5OA 4RD3A 1LS6A 5K3AA 2PRJA 5LLSA 3ZQKA 2I3GA 2VEOA 1I14A 3H86A 3HN7A 4L6AA 1O8CA 3GRUA 4YACA 3ICWA 1MDFA 3LDAA 2DFPA 5DZSA 4YUYA 3RJMA 4UD2A 1PVOA 1MJGM 3ESXA 4OXIA 1V35A 4YP7A 5ADWA 4E13A 3AFGA 1E2MA 3IIEA 3OTGA 3KLMX 4JLMA 3X1ZA 4I46A 4KPUB 3AF5A 3NNDA 3EZ2A 1UK6A 1W5EA 3ZWPA 1GUDA 3KUCA 4HDMB 2E4UA 2F55A 1SVOA 2JLRA 3V3TA 4OH7A 3B6KA 4S12A 1VYTA 1P19A 3LHKA 4GBED 2P78A 2O0JA 1QTRA 3CZQA 3WVNA 5D87A 4ZCTA 3FMOB 1QH0A 2JEYA 3M5DA 2IEZA 4AYWA 4CQMD 1CQJB 4YYZA 2XUIA 2Y1FA 1MJNA 3DKKA 3PVZA 4FFNA 5DBIA 5D84A 5ALSA 3HSSA 1AKUA 1WHSA 4B7ZA 4F84A 1DHRA 2QTCA 4AVYA 3IXQA 2WNIA 2Z5VA 3ZNQA 4EB0A 1H2EA 4GSLA 2YOHA 3IIMA 1DJPA 1K7CA 4C6RA 1UZLA 3EZYA 3RAPR 2RK3A 2B4QA 3GXBA 4HYTA 5J4VA 5EE1A 4ZQBA 3P9SA 4ZEMA 5EIXA 1SCIA 3NHUA 1J2YA 1PD1A 4LC9A 3RDPA 3V7NA 1FUEA 1RQRA 1YASA 4OKSA 5KSOA 2ZSUA 2YWFA 5IAGA 1OBFO 2IHNA 3CU5A 2VDVE 1BMFA 1JEQA 4BQFA 2VTBB 5TV2A 1T5IA 2E4VA 3DDOA 1V2HE 3IAM6 1DZ3A 1GG5A 1YS2X 2XF2A 1OFUX 4IIBA 1I32A 1NW8A 4OQQA 4AMUA 4R01A 4H4DA 5AUOB 4FFRA 1Q21A 5ILQA 4CZ2A 1Z4PX 1R7RA 1VPVA 4IV5A 3UGQA 4ZZ0A 1J2JA 2C5FA 2C2OA 2NU9A 1IEVA 2CD7A 4BNHA 1ODKA 3RSOA 5CEEA 3PNLA 5JPIA 3UVEA 1UEXC 2B25A 4DR6B 5E1BA 4C7OA 1ZN9A 4I5IA 3D02A 2GZ1A 4GC5A 4ODIA 4FU0A 3ZY6A 5FKJA 2FH5B 3NU1A 4LTNA 1CNMA 3K15A 4TROA 2WKQA 2BLNA 2IXDA 3JATB 4OMUA 1EFRA 5KQPA 4CF4A 3PCXA 3R7WA 1GN9A 1UAYA 4I81A 4W82A 5EHQA 1V48A 3D1LA 5FPQA 3L7IA 3QPWA 1UWKA 2ZB7A 1Z2CA 3NCTA 5YASA 3G9QA 3V4LA 5EJ7A 3FMVA 4PFSA 1WXEA 2GLXA 1DU4A 1AK1A 1YDEA 3JD0A 4I19A 1WSDA 2BEJA 1G60A 2DPYA 2F1KA 1WW3A 4MMZB 2ZJYA 2EF1A 3PGA1 1ILWA 3BE8A 1CZNA 2RG7A 3HJNA 4CUJA 3G2NA 4DQXA 4YRIA 3KAQA 1CDZA 3KXDA 5K05A 1MAWA 4ZYTA 1PR1A 5IJ9B 3SJ7A 4YAGA 1B6SA 3L7MA 4BO8A 5FO0A 4N7RA 2ZRLA 3VZCA 2WC1A 4XD2A 4JUDX 3CCCA 2GF0A 3O3OB 4TS3A 5DTEA 4R8KA 2Z98A 1Q5PA 1Q16A 5AW4A 4UW9A 1ZM9A 2FJ0A 2O1XA 2R5NA 2FTKE 3NIFB 4JJIA 1V8FA 5AKIA 2R97A 4M37A 3S2SA 5I4BA 5LVAA 5I9LA 4H6VA 4BEJA 4DCGA 3DBRB 3C7CB 2O8CB 2PX2A 5L3QB 1MR3F 1F17A 4J16A 4Y6PA 4UUMA 1NI4B 1VJTA 3UOAB 1DC4A 5JNWA 1N2EA 2GN9A 1Z35A 2AC7A 3VHRA 3GEHA 3P9PA 3JQGA 1NURA 4L8FA 4QJ4A 4ARAA 3W5DA 2C2GA 1E6WA 2VRCA 4GP7A 1K5HA 2DR0A 2P65A 3OT5A 5BR7A 4QVIA 4N82A 4WLFA 2V8OA 3HUTA 1SBHA 2XQFA 1Z2NX 4HDCA 1XNHA 5HKAA 2HADA 1SCQA 2JFBA 1REQA 4WD3A 5A5VA 3TSAA 1YK0A 2I2FA 3R40A 1E4EB 8ABPA 3NETA 4V0ME 4RD4A 3PEWA 3MJ4A 3RVMA 3L4EA 5MDHA 2I6SA 4M7RA 5LM3A 1FDWA 2O0LA 1OZFA 2SKCA 3EXAA 4Q9AA 3LLSA 5DHTA 5E9AA 1O6GA 4B6RA 1V8DA 2PS1A 4IDGA 2D5BA 4OSOA 5AJYA 4BVBA 2WWTA 4BKRA 4GE0A 4F7WA 1PYDA 3DDWA 3TNYA 3O74A 4DBLE 1N5OX 1JZQA 2BCGY 5ITVA 1MFPA 2EGUA 2QVBA 1NQWA 1LBHA 3TOCA 4BMDA 5I01A 1E5DA 1Q22A 1X1TA 2JGMA 2WHPA 2X5XA 3K96A 5I7VA 1Q2XA 3TXYA 2GZ3A 3WA6A 4XASA 3BXXA 1YCFA 1ZMTA 3TDMA 4YP0A 3AO0B 1RZRD 2Y8EA 4FWTA 1RAFA 4UM7A 3EVZA 2Z3ZA 2HGSA 3KJGA 5KMGB 1ORWA 3KSMA 1B2RA 1EVQA 1JKFA 2CL5A 4MQ4A 5LBUA 3D3EA 3PKIA 4DUYB 3IRVA 1FU4A 1SKQA 3VZSA 1Z36A 5IVPA 4JSRA 2HA2A 4JUBA 3B82A 4WY5A 1WUIS 4WZAE 3TLXA 1Y48E 2PVSA 1M6YA 3R8XA 3DL0A 4F97A 5EEHA 3GJ6A 2YNMD 1IN8A 3A26A 1LVUA 3L84A 4HH1A 4QYMA 3GG2A 3SD7A 1LDYA 2HXYA 2PGIA 4IQ0A 5ESWA 2NADA 2A0XA 5TQVA 2ZRBA 1H22A 4LW8A 4DYDA 4WKGA 2J3DA 3VR0A 4QO7A 4GC9A 3DBLA 3UGJA 3W9SA 2CKDA 1A9TA 1BC5A 2H0RA 2MU1A 3FPJA 3GB9A 3LJKA 4FSHA 4OHOA 3TH5A 5KI6A 4AYXA 5AM3A 1L9XA 1L7RA 4J8PA 4V0NA 1K0UA 1JR6A 1SBNE 2H52A 3TX2A 2XTJA 2J9FB 2YJNA 3SC6A 3AVUA 3NBFA 1SG6A 4L5JA 1J42A 2DSTA 1T35A 3KSDO 3H2IA 3G2KA 5IDYA 2VJMB 4I55B 4CTOA 1LBQA 2DWUA 4FQ7A 2AC2A 1U8ZA 3WIOA 1YSCA 1WQ4A 1ZHHA 4OQNA 1IXRC 4X84A 3K6JA 3T3OA 2NUTA 2WUEA 4TTAA 1L4EA 5LSAA 2RE8A 1BH6A 1PNQA 4GI5A 4UKDA 4KAJA 2PKYX 1Y6UA 2BN4A 3RVKA 2A9VA 2HWKA 3O8LA 5AXAA 2XRFA 4KLAA 2Y0DA 2B98A 3ZHQA 4YNBA 1QRUA 4BFWA 4MS3B 5TRTA 4F9GA 2COUA 5FI3A 2AXPA 2IV2X 5LP6B 1QGYA 3HRKA 3MCUA 4B34A 3PCRB 3FKSA 1HEYA 2ZYIA 4NOMA 4R1LA 2H7YA 2GD1O 2WJZB 1LU9A 1ZH2A 3O4JA 5JNSA 5KCZA 3ZWOA 3KE9A 4BASA 2GN2A 4XD7D 3UA3A 3RSHA 4YWHA 4EKGA 3FCXA 4WESB 1XEWX 2Z0MA 3A1NA 4ZQFA 5SZIA 1R6AA 5KTMA 2P8JA 3L5KA 5JMOA 3LX6A 3GCXA 8LDHA 2WSMA 1M66A 1SCUB 3UW3A 4PNPA 1LV7A 4WL0A 5LQSA 2F1RA 1VL6A 4LHVA 4U7JA 4X8LA 4RM3A 1U2ZA 4FBMA 3BGWA 5EIAA 1DAHA 1ECGA 1VMEA 3GP3A 2ZIZA 3MD9A 4ZYLA 2YTZA 4HXEB 3D6UA 2MTBA 2PPVA 3KJIA 5KNBA 1EAMA 4BWGA 1PLKA 3MWDB 1Z25A 3QEMA 4RGVA 5KPJA 1E0AA 2X5JO 3QG1A 5TVKA 3W8DA 5U4QA 1FLVA 5GGXA 3FPCA 1ZK2A 1PK9A 1Y98A 2G07A 2ZRIA 2ZYUX 3KP1A 4Y2SA 4IIGA 2HDNB 3B5EA 3SMQA 5SYAA 1XZBA 2FRXA 4KU4A 3U7QA 3FUUA 2AZTA 2WJJA 6REQA 1GL3A 4QATA 4C6TB 3SHQA 5LYJB 4DJAA 2Z6UA 2RD2A 4IDAA 1II9A 1Z4IA 2FX3A 3K9CA 3AOGA 1U90A 1R66A 4FR5A 4HNVA 3UJ7A 4A6XA 2ZVJA 2GBFA 4HQRA 5K3CA 4JI0B 3COWA 3D8RA 4JEIA 1YR2A 1PT5A 3UYKA 2ACEA 4UNNA 2XT6A 1OHHD 2HUPA 4M36A 5BSFA 3MERA 3SDZA 4FMDB 4QLOA 2X19A 1OR8A 3QELA 1W8IA 3KDSE 3PXAA 3CN9A 4TUYB 3KFVA 3RRJA 2AUMA 2FZ4A 3HV0A 1XU9A 3MOSA 2IYAA 3NJ8A 3PUHA 4RTOA 3BFPA 4FQ8A 3RUHA 4KN5A 3I5XA 2EW2A 2Q1XA 3QLUC 1ND6A 2GI4A 2ZR8A 3HYSA 1Y4AE 5C31A 1GQSA 4NU6A 4Y6RA 3UT0A 1S3GA 3WYDA 5KYNA 3WRVA 5E01A 1KP2A 4FB5A 2QTZA 2AF4C 4FHZA 1P2SA 1SZCA 1GKUB 1P4JA 3UPUA 2XT0A 3CRZA 4LDRA 1ODJA 4A6DA 5KNDA 1BWRA 2N9UA 4FKBA 3N2KB 1VB5A 3ZJ4A 4WZZA 5CVUA 4CEJB 1XPOA 3PWTA 3HFGA 1LZKA 1QQ7A 5DN9A 5L3VA 1DWUA 1T1IA 1V9SA 3RS8A 4BQPA 3TQFA 4DLTA 2D1TA 4F8EA 3SX2A 3EIOA 5ALMA 1HE1C 4X6XA 4QVGA 3SQOA 3FBGA 5T4BA 3ELBA 2E37A 3K8QA 4A2QA 1O95D 2A3NA 4U7PB 5J5CA 1Z37A 4GOND 3I42A 3PBKA 2WOOA 1DG9A 4ZODA 5EP3A 2O5CA 1EYZA 13PKA 1ZU5A 1K2WA 2Q45A 3CNNA 1FRFS 3VPDA 3OKAA 3HBNA 2XNKA 3FXAA 2F1HA 4RVNA 3I2FA 1ZIPA 1KYTA 4LNAA 5B1SA 5TY0A 4E4YA 3A6HA 3P0HA 4ND8A 3I3OA 3OOSA 4FYIA 4J1QA 1ABFA 4ASUD 3W1VA 4UOZA 4LZAA 2A9JA 2EX0A 4DMKA 3AT1A 1H8EA 4YBRA 5BRJA 4NZOA 2EZ8A 2X5NA 2ENUA 4JT4A 3X1DA 2AMFA 4OQPA 4D9EA 5K99A 1KYWA 4QBFA 4DZZA 2WILA 4MAMA 3TSZA 9LDBA 5IJ9A 5GVRA 2R7AA 5HQTA 1GFIA 1YE5A 2D7CA 3ESDA 4RYDA 3WIDA 3V8NA 2CJPA 1OI7A 1P3JA 3LP5A 1MNQA 3IKVA 1G2PA 3CZRA 1YA6A 1OBHA 1TE2A 1A0OA 3CUKA 3P52A 6YASA 3E9QA 3OCXA 1QQTA 3RVLA 4G5GA 3BL8A 2GPAA 2WIBA 1SC1A 1RPTA 3GZNA 3QOFA 5G3YA 5L51A 3JQRA 3SC3A 5K0EA 2JJYA 4RKQA 4DV2B 1U1EA 1GA4A 4A03A 1LW7A 4CMJA 2WP0A 3WLRA 3GA0A 4FFPA 3PQ5A 1M6VB 3DEIA 4LRSB 1C4XA 2Y9PB 3AUXA 4QKQA 3HXMA 2Q9BA 5JCOC 3UXMA 2K2WA 1CTQA 3O75A 4L5AA 3ZV4A 4I50B 3KYDA 1YS7A 3FMGA 4WXMA 4QYIA 5LQMA 1PD0A 1VGRA 3DE6X 1QQAA 2YVUA 3GRRA 4AYTA 3ANLA 4D8TA 4LFBB 2RGGA 1IN4A 1R50A 1J8YF 3AYZB 1XVLA 1NXWA 5HUHA 4QNMA 3WK4A 3AEYA 4DBLC 4R9UC 1RJGA 4BU1A 4WH0A 4MZXA 1FCJA 1STOA 2Y1DA 3NC4A 4HS9A 3IAAA 3I0NA 1DQNA 2ICAA 3L4BC 2PRZA 3I8OA 3MHTA 3W5IA 2QENA 5BV1A 2EGGA 3H11A 3GO4A 5TDHA 3T5MA 1JUDA 1SXGA 2WWGA 3D7KA 3DUFB 2OV2A 3SVZA 3TLBA 4EJ6A 5AVVA 2QLFA 4CDRA 3AINA 4ZVTA 3ZGZA 3LMKA 2I65A 3FFXA 3CMCO 1GPYA 3K92A 1UPTA 3D6VA 2O4UX 3NASA 1V6CA 4MP8A 1V37A 1E4OA 3U1VA 3W6PA 3JTMA 1QJCA 3S68A 4HQNA 2DH5A 1ISSA 2DQYA 3BE4A 2YV4A 4TM8A 5F78A 1P0PA 3HM2A 4I08A 4MSUA 3I8XA 5HFJA 5KX5F 1QK5A 1Y7LA 1VG8A 3HCRA 3QY0A 1MQ9A 4V0MA 5WRFA 1QB8A 4N3BA 4DTCA 2F43B 2LPMA 3A4LA 1P7YA 4QPZA 2SBTA 3CGWA 1KEVA 3LC0A 2WTBA 3RC8A 1U4OA 3CRVA 4OO3A 5KDLA 4DWOA 2ZR7A 1C0IA 2ZQYA 1U3WA 3SGLA 3RJTA 2G25A 2ISQA 3DAFA 5ENDA 3LX4A 1BOFA 2BFEB 1KI6B 2D6FA 3FETA 4IP0A 1S96A 3HCPA 3L4BA 3IELA 3TTUA 4JB3A 3DZFA 5GINE 1K5GA 1YR6A 2UXDB 2GXQA 2OBYA 4ROSA 2RGYA 5ALRA 1JFSA 3D7RA 4V0SA 4MQ5A 4BRZA 1UJ2A 2FSUA 3IJ5A 3AB3A 1HLFA 4LNUB 2ECFA 1VCIA 1GOTA 4DDWA 5C7OO 1EPUA 2O7SA 2R3SA 3MYRA 1DO8A 5JECA 1G8MA 1KQ3A 2CBXA 4WZAA 4JJ8A 4DJFC 1TKBA 3F9RA 4RV5A 3WJ2A 3PKJA 1Q1GA 4HWSA 3DKVA 1PV2A 4MJ7A 1BGVA 4GVPA 2EJTA 4NVRA 1WU7A 1GNRA 2IDJA 1S5PA 4WJKB 5C8ZA 3GMIA 2HMAA 1O9GA 1VI5A 1XEXB 1QNFA 3AWDA 3GEPA 4FCTA 1R9GA 1L5RA 2AQKA 3QKRB 4FS3A 4MMYB 5TMEA 1FRVA 4ACBA 3DEZA 4XE5A 3WDMA 3WC4A 1L5YA 4MICA 3WX0A 2MSKA 3KUXA 1PJ8A 4L8WB 3SBXA 5KTRA 3RVOA 3D2BA 4EQZA 1HLPA 4FE7A 3GVHA 1ZLXA 4AY4A 1B26A 2ZUFA 3L77A 3LKVA 1Y82A 4L28A 4RIHA 2VXOA 4O63O 5EZYF 4GL2A 3KQYA 3ECCA 1QE3A 3PXXA 1GGKA 4FN4A 3WYNA 1GP2A 5I5EA 2ZSEA 3DJYA 4DG5A 2OM2A 1YC2A 2DPXA 2UYGA 1MW8X 3NDPA 1HEIA 2Q5QA 1K3UB 3C3KA 2AQHA 2DYKA 4O5OA 1RTKA 1QVRA 3IT2A 4EB8A 1JE1A 1SC9A 2COEA 5IFKA 4PGAA 4CJXA 2FPLA 3QUSA 5LWQA 5A3RA 2CBZA 4N01A 4CF7A 1RMTA 1ABEA 5AOBA 3WGOA 5ALVA 3T5PA 2QE7D 3H18A 3PFGA 2AXQA 1H0RA 1Q7EA 3GLSA 2BEWA 1LH0A 3TIIA 5ITSA 1LBSA 2PMKA 3JWEA 1UPFA 4NESA 3G5UA 4TX1A 2HBRA 1EBBA 3D6FA 3KV3O 1QS0A 5FI1B 4XWWA 3G2JA 5PGMA 1DJOA 1VBNA 2REQA 1WXXA 4M9ZA 4PSAA 4QM7A 2XB2A 5AKLA 2GX6A 2BAGA 3RC1A 4X6UA 5D85A 2YY7A 4Y8VA 1KJNA 1T6XA 4PPGA 3KX2A 3U44A 3ASZA 3EIHA 3JTEA 5FQOA 3B85A 4N41A 2XRZA 3MXOA 4C7VA 5CHEA 3S4YA 3SJUA 4ZK6A 2RONA 2CLHB 3BXFA 3DOJA 4MS1A 4ZRMA 2I9PA 4YVFA 4Q4LA 1L7OA 4CMAA 3T3GA 3DVRX 4Z6KA 2O3TA 4KSBA 1O1YA 5FTKA 1BG6A 4IOMA 1CZHA 4QXPA 2HF7A 3N2YA 3L18A 3P20A 2Z04A 1PJBA 3ZGLA 1B41A 3NHJA 1PFQA 2GFQA 4AG3A 4WY8A 5TS2A 4V0RA 2I9KA 3HO8A 1JDVA 1AG9A 1M83A 3GD5A 3HDTA 3HKDB 1FL9A 1JJIA 1T3SA 3DMTC 2VPWA 3PGJA 4WA8A 4CQJA 1G6OA 2F9LA 2IT1A 1H65A 3WGGA 4JY7A 4WNAA 2O3UA 4E2FA 1XVTA 3CZPA 4FOLA 1U5BB 1TAUA 4B0PA 4XPZA 4CQMA 1IHDA 4A5OA 2YICA 3FF1A 4J3NA 1TQHA 4MARA 1E79D 2P2NA 1TMOA 5D51S 5DXFA 5JSYA 1SVMA 2Q8PA 3M5WA 4MIYA 4DXHA 2Z6AA 2UYYA 5FO1A 4EB3A 1DIRA 4ZZ1A 3DR5A 3D1VA 3VC7A 421PA 3IEXA 1FTSA 2OAEA 4F8YA 1OZGA 1SO8A 3N8KA 1XRJA 4DC9A 2IBSA 1SUAA 1CR2A 1PDWA 1YZ3A 3IP9A 4FTWA 1A9OA 4U3JB 3GVXA 3A4TA 3NANA 1NC3A 4KDFA 5DF1A 5DTMA 5T5QA 1NMSA 1A8HA 3ZLBA 1GARA 5JAHA 5E1DA 1VCOA 1F5NA 1XLVA 1B8OA 4LEIA 1DT5A 1DAMA 4AC9A 1DELA 1KDTA 1BE8A 4JL8A 2AEEA 3CEHA 1YA8A 1BRTA 3P8ZA 3S7TA 4LF7B 1IZ8A 3U1BA 1SHLA 3OKCA 3L7AA 2CT8A 1W0JD 9MHTA 3BWXA 4LBZA 4PSDA 4CM4A 2BGWA 2JI8A 1E32A 4KRFA 3E9ZA 4AULA 2IUEA 3B1KA 2KBEA 4MVJM 3U09A 1QU3A 3Q1KA 1GGMA 4G1UC 4JK3A 4N49A 1X0XA 1HNNA 4DA0A 5KU7A 3JPWA 3W6NA 2PGAA 3PA8A 2XWJI 4UE3S 3GFSA 4QU0A 3SYNA 3K6SB 4EDHA 2I3DA 1EFVB 1DOAA 1YKSA 3RUIA 4DQDA 2BKAA 2CXOA 1W2GA 3DCYA 3EXFA 2VUHB 2YN4A 4MRSA 4P2GA 5FV4A 3H4TA 5JVDA 4JYAB 2VZ0A 3FAZA 3IKTA 3A1WA 1BJRE 2DM6A 3E18A 1GYPA 3LW7A 2J46A 4OM8A 4C0XA 3QVJA 3DEAA 1JHXA 5A7FA 3AEUA 4RFVA 1YJAA 1ISHA 1XT6A 2WT8A 2LDBA 3T1HB 2O1WA 1LI5A 2O2CA 3A05A 4B83A 3SSMA 1ONBA 1Q19A 1MO6A 2C9BA 3EXG1 3EZGA 3T7DA 1FYVA 3A70A 2CBGA 4YHBA 3TF5A 4H7FA 4K26A 4EGQA 1EJBA 4PX3A 3UHFA 1DXHA 1PJLA 4CUKA 3NT4A 2J3KA 5F52A 1LPBB 1TIKA 4LECA 3T95A 2K5UA 4AAYA 2X0IA 3R6TA 2I6QA 3PJEA 1W2WB 4Y2UA 2W6MA 4O08A 3OX1A 1Q1QA 4QFDA 3I6IA 2R48A 5EIBD 4S1OA 2AV6A 3I09A 3GPLA 1R5NA 2WU1A 2N0SA 1E7QA 2VDJA 4DV1B 3ZUGA 2O8EB 4KIUA 3NPAA 3LQQA 4QXMA 4EVSA 4IG4A 3LCMA 3HVUA 4S04A 4HPXB 1WV0A 4DCZA 1T6YA 2W6PA 3M9LA 1IB6A 2GWHA 4R9NA 5F77A 4WJLA 2VVTA 3AR6A 2VBGA 3P2IA 3ZZTA 3QI7A 2LVBA 4J1TA 1EK2A 1VLQA 2VUIB 2GWRA 3JZIA 4R8RA 4YJ2A 1QTNA 4HAYA 4I6JA 1AXGA 3I1FA 2NAPA 2QYOA 3KQSA 3L6DA 4KC0A 1SQ5A 1C0EA 2J9XB 1Y4DE 4JR2A 4P58A 4FDTA 3FLAA 2QTFA 3VV2A 2AE2A 2ORWA 3CWQA 2P6PA 3V80A 3ENQA 2MDTA 4AS1A 2YV2A 1SK9A 4ZA2A 2NT3A 5H68A 1B6TA 1S89A 1TK3A 3OJEA 4J7CA 4TZKA 2YNMC 4QA9A 2XQGA 1W48A 5DCWA 1B3BA 1YGPA 2VTEA 1YT5A 3LHIA 3R44A 2F3PA 4RSRA 4F46A 4LYYA 1JEYB 4WBSA 3OFKA 4TMZA 2R1TA 5J1SB 4UU7A 4RE6A 3BZBA 2RHCA 1E4EA 3G2QA 3NHPA 1B4DA 1BS1A 2BJWA 4P81A 4RSHA 3ROTA 4QHTA 3IDFA 5K0NA 2V9ZA 1OLUB 2WR8A 3SHWA 5JWOA 1MOPA 1M2HA 4BEBA 1QVAA 3F5FA 1AUPA 3D6MA 3BEDA 2QDKA 3Q7QA 1D2HA 2BE9A 3V42A 3AKCA 2XVZA 3AI7A 4MPRA 5G4KA 1R64A 1O94A 1LTKA 1VRCA 4EG8A 1ICEA 1TNDA 2CJWA 1JQ3A 2OTCA 2WKPA 5GWXA 3SM9A 5EHZA 4KDRA 4Z51A 3GK3A 2WZBA 2VDWB 1F7UA 1T36B 1Z83A 1POXA 4UHEA 4MQFB 1G9TA 1PGOA 4B9AA 1E1KA 2XXBA 2RHTA 3K9NA 4MITA 1JN0A 1LXCA 3HA2A 3W9BA 1A04A 4E4TA 3DBIA 5ARDA 4TN5A 5EMKA 1CF9A 4FGUA 1HKUA 2YNMA 2CLKB 4WXYB 3WBJA 4RKYA 4KOEC 2ZTLA 3FTNA 2QMYA 4EUFA 4MV3A 3OBIA 3IPCA 3NHBA 2I54A 4Q9IA 1Z34A 3L0IB 3TZLA 2B4TO 2EFEB 3I83A 4BJ6A 3T7IA 3GRKA 5ARBA 4GPAA 1RQ7A 1MIOA 3RFCA 1Q06A 5ADHA 2E21A 1EIWA 2HLHA 5COAA 3LF1A 1H69A 3FOAA 2QUBA 3VTKA 3S5JA 3IVXA 3V7FA 2GBPA 2BFNA 3KEFA 1N32B 3QEBZ 2FLVA 2X0NA 5JQGF 1XTTA 3AR5A 1NR7A 4WADA 1V3VA 1HYQA 3L49A 1IOWA 1QHNA