3EZOA

Crystal structure of acyl-carrier-protein s-malonyltransferase from burkholderia pseudomallei 1710b
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
MKFAFVFPGQGSQSVGMLNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNLTTNTQPVMLTAAYACYRAWQQAGGAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVFDPASLDEALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl CoA-acyl carrier protein transacylase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei 1710b
molecule tags Transferase
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3ezoA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3ezoA01
2VZ8A 2C2NA 2UV8G 3IM8A 3PTWA 3R97A 3TZWA 2PFFB 5CZCA 3TQEA 1NM2A 3CJ8A 2VZ9A 4RR5A 3RGIA 2JFKA 5CZDA 3K89A 2G2ZA 2G1HA 2QC3A 2HG4A 3H0PA 2H1YA 3SBMA 3HMJG 5DZ7A 5DZ6A 3QATA 3HHDA 2G2YA 2G2OA 3R8YA 3IM9A 2QO3A 3TZYA 3HJVA 2CUYA 4RL1A 3TZXA 4QBUA 2VKZG 3BV8A 3G87A 3TZZA 2JFDA 2QJ3A 1MLAA 3EZOA
chains in the Genus database with same CATH superfamily
3AQPA 1NK4A 3BO3A 2VQEJ 4YS2A 4XIUA 1P1TA 2YNGB 1LXJA 2VU5A 4EBDA 4FS1A 4ZJOA 2JLFA 3BKTA 3A12A 4YB7A 2OFGX 1YX2A 3ENWA 2W24A 3AY0A 3TZXA 3QO9B 1C2PA 1CG2A 1ZETA 1TZ0A 5F8NA 2KXHA 4DV2F 2N7YA 3U1NA 1JMTA 3FMBA 5DZ6A 4DR6J 1U47A 2AP6A 1RHKB 2FC8A 2ZKTA 3EXYA 2W9BA 2M3DA 4DL6A 3WQPA 2J9DA 3V81B 3KK2A 2VODA 5RUBA 1LWCA 3CMQA 4Y34A 3MTKA 4CO5A 3TW0A 1NLKL 5C7PA 1RACB 1X4AA 1RWUA 1U25A 3M8QB 4WK3A 1QAYA 5EX3A 1VIOA 2PD1A 2OLWA 3CDEA 1UVMA 3F44A 1LWXA 5L1LA 3M8WA 1DARA 1U0HA 3TZYA 1U6ZA 2J0XA 3GSIA 4P71A 1I6JA 1TAUA 2UU9J 4QIFA 4DV4J 3DRSA 1L3VA 2G0IA 4C98A 4DR2F 1BQNB 2V50A 1C1BB 3FNNA 2AGOA 2ZBRA 3E01A 1VBKA 2WVFA 1RTZA 2POKA 4CQ1A 5KFPA 3ZZYA 5HP1B 1MMDA 2HFVA 2W25A 1FT8A 2BANB 4ZLJA 2DIVA 1A0OB 3M8YA 3MFIA 1T9YA 1UTAA 1YGYA 1FERA 1KFSA 5KFWA 4NLOA 3M9OB 3EGZA 4CLYA 1EKRA 4UY8T 4AMPA 4IDKA 4YR3A 1BHNA 4JI5F 3ISND 4DR7J 2DTJA 1IVZA 3D6TB 2F7VA 3OFGA 5F3TA 5HMWA 2F5GA 3HZGA 5LXRA 3KUHA 2YQ0A 5KG1A 2AJ1A 2P6TA 1T11A 4KO0B 4QPXA 4LR9A 4TU8A 2VQEF 1H2UX 4NEYA 2YNIA 3LOUA 2C3MA 3H5UA 1FNMA 1VDHA 3OXLA 2MLZA 2XWYA 4DQPA 4W92B 2GV1A 2OUGA 4OHWA 3I0SB 4TU7A 3CULA 2BEFA 4J9SA 1A6LA 1RT7A 1FKAF 1E6VB 4QR2A 4MK9A 4PWDB 1T05A 4O3NA 4PG8A 3EZ5A 3KG1A 1UAWA 4Z7CA 3UCUP 3MEGA 4CYUB 4OX6A 5JXSA 2YVSA 1HYSB 2E9RX 1C0UA 1JXVA 2UZAA 1G7CB 2HIYA 2VB6A 3IBFB 2HHPA 2ZBCA 3H5SA 3PRBA 2CNKB 5HSPA 4HDGA 3GR0A 3TVYA 3C66A 5K14A 1N56A 2HQIA 4YMEA 4MTPA 1VQPS 4DU7A 2J8SA 1H2TZ 2F65A 3J7AN 1CSJA 1T95A 1RABB 5LJ5Y 4EFAC 1IKYA 4RNHA 4Q45A 2XSJA 3PO5A 3K5PA 1RTJA 3N5FA 1AW0A 1OJ4A 4OYIA 3T1YF 3IN5A 4QYRA 4NZ0A 4AXJA 3KLIB 3J7ZT 3TWZA 1DTQA 3TVZA 1QSYA 2DBBA 3FQLA 3MEDA 2ALYB 3MCMA 3PCOB 4E2FB 3IWNC 3BO2A 3AOAA 2MKHA 5J2MB 3DMJA 4ECQA 4RLEA 1TK5A 1SQGA 4BCAA 2V8PA 4OV1A 3TNVA 3W2WA 1TKXA 1S9FA 1DRZA 2W9CA 1F3VA 2BQ3A 4F50A 4USHA 2HBQB 4DR7F 2VJUA 1S6PB 5ITHA 1S1XB 2A3JA 3GIMA 1OQ6A 5KFNA 2B8PA 3LP0A 3P96A 3OL7A 3THTA 3DDNA 1UWAA 4PKDB 1UEVA 3TANA 4PEOA 1OPZA 4BLGA 2NXEA 3KLGA 4DR4J 2DNMA 2BM0A 1EKSA 3W1YC 1XBWA 4I2QA 3IGNA 5KFQA 2OHDA 2BW2A 1UVIA 5B0AA 4LSNB 3QIPA 2RSQA 3OLBA 2ZHOA 1C0TA 4C4WA 2HZAA 3F0NA 1RWNB 3V2UC 4ATNA 1J5EJ 3OVAA 4NLUA 4GRSA 4OYMA 1WC4A 3D68A 3KUGA 3TA2A 4JI7F 3K59A 4ZVSB 5KFMA 1KLMA 3GG1A 2YWGA 3RYLA 5CCLA 4NZ6A 3R5DA 4U7UK 2DK2A 1Z1ZA 4ZLLA 1IKVB 1Q0NA 3MEEA 4ES2A 3I4HX 4MKAA 4NE9C 2IFXA 2KL8A 2HLTA 3TJ8A 1SL1A 2XS7A 1FCAA 5LSLA 5LJ3Y 4OYBA 4C7QA 3Q2TC 1F2HA 4R8UB 4DFMA 2Z2MA 2J8AA 1RCOB 2IJNA 3W2VB 2GHVC 3CDWA 3TRGA 3HD2A 3C19A 1T3OA 3QFWA 2HZCA 2KB2A 4B9UA 4ZPTR 5CQGA 3KLEA 3QJJA 4UUXA 1YJRA 2ATLA 1S99A 4FYVB 2IM2A 3GCXP 2HIQA 2XLJA 4AT1B 9ATCB 1JNRB 1JLGA 3N9UC 4RW4B 1U1MA 4DEZA 1IJEB 3PYGA 4USVA 4F02A 2C2NA 5G0RB 5KFXA 2DHXA 3T5HA 4M5GA 1LXNA 1AROP 5IM0A 1U7LA 2OSQA 3V5RA 4IG0B 1VFJA 2YNFB 4ERDA 2ASDA 1X31C 2I5JA 4P2MA 1FFWB 2G1DA 1UPMB 2FHOB 1L3TA 2BJ1A 4PXDA 1EQMA 4ZA1A 3VAIA 1SJRA 2ALZA 2Y1JA 3G71S 1U2FA 3IAM9 4I67A 5H9EK 4DR4F 2C42A 2BQUA 4ZVRB 4LF6F 1FI4A 1N4LA 4A8SA 5CCMA 4TU9A 1PJ6A 2ZBPA 1HWJA 5C25B 2CADA 4CO2A 2ZE2A 4S0MA 1VQ5S 1J5EF 1BY9A 4F4WA 5F9LA 1HA1A 1YRXA 1DBDA 2QZ8A 3UWTA 3N5BA 1HWLA 3IRXA 1QTMA 2MYFA 3DOKA 1HNXF 2D3ZA 1SQEA 2GCFA 1XMBA 3M9NB 1L3KA 4WK1A 2XBPA 1K8AT 2DEJA 2ZH5A 4FS2A 5T14A 2ZUAA 4BHQA 2DEIA 2KT3A 3BKUA 1FESA 3R7BB 1IBLJ 3A8KA 4J9MA 2CPHA 2FJXA 4NXMJ 2VZ9A 1S1UA 2QLBB 3W5YA 1Q8IA 5JVGQ 1LEOA 4FYXB 2RH3A 3DDIA 3DI6A 5LMNF 3HVWA 1GXUA 2CDQA 2V0NA 4OYOA 5AXMA 3H40A 1S48A 5KFYA 2XMUA 2LEAA 2HNZA 1X5OA 1HBUA 1K0TA 3QIDA 5HAOA 2W4PA 4PPZA 1YJVA 3V6KA 2MHNA 4ZPBA 2DGVA 3CD7A 2MSTA 1S79A 4RW8B 4Q0BB 2MKSA 5CZDA 2HHUA 2GVZB 4WP9A 3G6ES 1H74A 4CLKA 3J7Z5 2RUSA 1TUVA 3QQCD 2AV5A 1B70B 3CIMA 2WVEA 1RYRA 1NDCA 1NSPA 2B9WA 1FKOA 4IKAA 5JMNA 4YR0A 2OMOA 3CDAA 2IPOB 4TVAB 3UNYA 3M8PA 2VDIA 3G86A 4PG4A 2HQGA 5K20B 2OD6A 1GAOA 2W2QP 5BYSA 2BBEA 2O66A 1RAHB 2PGCA 4YB5A 4LF8J 5KG3A 3GE9A 2KN4A 1WC0A 1RT3B 4MFBA 3KK3A 4RBTA 1CULB 4W90B 3VGVA 5IZHA 2ZVSA 3KDOA 2RKIB 1WWHA 1WACA 4OZNA 1RTIA 1VR6A 2RRAA 1SV5A 3LW5C 2CWKA 1G6BA 4WFBQ 2MZRA 3OTOJ 2FJAB 3PX6A 2RDIA 4X4NA 2Y0SD 4F3MA 4NOHA 4JBCA 4Y65A 3RAMA 3HMJG 1RI7A 4DX8H 1JJCB 2GIQA 3OXGA 5L9XA 2IMWP 4NA3A 2HHVA 5DJBA 4KV8B 4DLGA 3RR7A 4ZVOB 1DQ8A 5KFVA 4NXMF 5L38A 1WNEA 4X4SA 4B9NA 3A8EA 4KT0C 2YWHA 3JS9A 3HHKA 4URGA 2LQ5A 3OD2A 4PZVA 3RB4A 3NAIA 2ZZNA 4CZCA 3TR5A 1HPZB 1DQAA 1OO0B 1AB8A 3MM6B 1NK0A 2P6SA 3MM8A 2DNYA 3HKZD 1JKHA 2HWIA 3KJQB 4QWEA 4OYWA 1V5VA 1OS5A 3GIKA 1CJKB 2AGQA 3MCNA 2HLUA 1RA6A 2YH0A 3Q2SC 3I6PA 2HHXA 2DJWA 4ECZA 2C2OB 4X4VA 3JSMA 2G0CA 1TUWA 3W8GA 2K8GA 2R7OA 4HI2A 2KXFA 1FRLA 2HHTA 3GZ7A 4ED6A 4WXWA 4L74A 3AFGA 3OL6A 4BWMA 4CO3A 2RT3A 1B3TA 3D3BJ 4PQUA 4V19J 3DXSX 1RK8A 3G8SA 1T8EA 4DJBA 3NGKA 4DXLA 4LT6A 1G1XA 2L9NA 4ILMA 2NXCA 5D15A 4DDFA 1XNQJ 3UI3A 5IFMA 2E1AA 2BJDA 5EHHA 4B3RJ 3H25A 3VCDA 4LF8F 1T9UA 3RB6A 5ETNA 1TL3B 4RUAA 3Q86A 4MK8A 2MMYA 2FJDB 1PYTA 3CJ4A 1WDTA 3GILA 5KFTA 1IBKF 1T03B 3MR6A 2F9JA 2ZOGA 3OTOF 2CPDA 4FF2A 1VRUA 2Y8WA 5CH7B 3DYAA 5J1PA 2CNOB 1KFDA 4DHVA 1AUSL 3JYTB 4RX6A 3OW2R 2JOQA 3PHTA 1VRTB 2DNLA 4KIAA 2NCKL 1Q16B 1FTCA 3MHYA 4KKOA 2FHKA 2XULA 1BGXT 5E33A 3DU6A 4G1PA 5KTQA 4FVCA 1KC8T 4FP9A 3FBFA 1XIQA 2V2VA 4XPEA 3Q8RB 4UUWA 2RU9A 3UNGC 1SJQA 4Q8EA 4C8KA 3M2VA 1M1HA 4HTIA 4YB1P 2KYZA 3FMWA 3QNWB 2V5HG 1HW8A 2MZTA 1PO6A 4KSEB 3HZEA 1ZAVA 2KRBA 1FE4A 3PZPA 3CT9A 2DR6A 2ZVIA 1X4DA 2FB0A 2FD2A 3K0JA 1XMOJ 1R6YA 4ED0A 4WFAQ 3ILJA 1EAYC 5DLGA 2V4QA 2I2YA 2EFPA 2VG6B 3V4MA 4DBQA 5DDQC 3NCQA 3V4IB 1HBNA 4NEZA 1MWQA 3CJ3A 1M1GA 1RT4B 4OJHA 4PYAA 2AEFA 1APSA 4C3KA 1TKZB 5DO2A 1UJ5A 2JHEA 4DPXA 2G4BA 6FD1A 4AMOA 1U2RA 2MKKA 2LXUA 1S6UA 4ZHRA 1V3SA 2VHGA 3K17A 2CQPA 4MKVA 1QLNA 2KRRA 5E3AA 5KFOA 3P5TL 3QGHA 1X9WA 5A8KB 2DGQA 3B4DA 1S97A 3OL8A 3CJ8A 1JLQB 3S7RA 4OIXA 3R1HA 3HSGA 4PG5A 2OPPB 3KJVA 1RAOA 4QR1A 2DY1A 4NCBA 2RU3A 1M5HA 1KTVA 2BM1A 1HHQA 4LF7J 3WIVA 2C2KB 1H7XA 2CQ0A 1R31A 3CUNA 5C42A 2B9XA 4LF2A 5E0OA 4YP3A 4USTA 3RRKA 2QV6A 3DGPA 3G82B 5IV4A 2X1GA 4N76A 2JC0A 1LNQA 1KNZA 3AXMA 1VK8A 1MROA 1RHRB 3DHXA 1RHQB 3GIJA 4LIRA 1HNIA 1Y00A 3J81U 2AX0A 4DUYJ 3L9ZA 4NLQA 1UZHA 4HACB 1LOUA 5LSRA 2DR9A 3EVMA 4U67Q 2UVVA 2M70A 3HFZB 5HO4A 4PWUA 1SH3A 2F3JA 2V34A 3AB2B 2HRUA 2CFXA 2E29A 2OJ3A 3VAHA 1Q8KA 4M94A 2I6WA 2ZH4A 1XMOF 2V67A 2IA6A 4X62J 4ECXA 3CPWR 3V6DB 2LP4A 3ZTRA 2V2ZA 1VS3A 2AU0A 2CQ3A 1TP7A 1Q8LA 4PCQA 2ZM6F 3MDFA 4M5IA 3B78A 4N41A 1RU2A 5KT4A 3A3NB 2BR0A 4WP3A 3W65A 5HVHA 2AJFE 2QYGA 2LVWA 3QPIA 2B7BB 1U1PA 4UZCA 3TA1A 1RAGB 2R7TA 1MLAA 4WFXA 3SMZA 4A8XA 4OX8A 2KO1A 1WSRA 3Q83A 4LQ9A 5KFUA 3VWSA 1D8YA 3H8YA 4P2XA 2V63A 3M32B 3GJSB 9RUBA 1BQXA 4KHPJ 3RBXA 3AODA 2N3LA 3FBCA 2IA0A 4ZN3A 5F0WA 4P52A 1VBYA 2B51A 2UUCJ 2QEXS 3NRBA 1SJ1A 1XERA 4CM0A 3QRRA 1RWWB 2MSSA 1LFWA 4EEYA 2VFUA 3W5XA 3TZZA 2UV8A 3J7YI 2EW9A 1SKWA 1OIAA 1SI9A 4DL5A 5BYQA 3NMRA 3MM7A 4ELUA 4G3IA 3FEYB 2VJVA 1OY9A 2CYYA 2PI5A 1HBMA 3QLHA 3OTBA 3DOLB 5D3GB 4K4YA 1IM4A 2UVWA 2ZH9A 1VMBA 2XZWA 5HBMB 1YBTA 3I0RA 2YKQA 4ZPWR 4Y00A 2Y9HA 2HS3A 3ICLA 3BH7B 3A3PB 3MMJA 4NLTA 1SIZA 1PC5A 1U09A 3OPKA 4X4RA 1DZ5A 3PR4A 1FX4A 1URRA 3KUEA 2JEFA 1Q78A 4NLRA 3IR5B 4DCOB 2PI4A 3VGUA 1NNDA 1ZTWA 2RE1A 1NJWA 4JV5F 1XMQJ 4DOZA 1MNEA 4DL0C 1QAXA 4X62F 2ZFHA 2AZ3A 1J2VA 3ZZOA 2DNKA 3H42A 5C24B 2DNOA 5A8RB 1W25A 5KFIA 3QFHA 3DOMB 3KG4A 1Y11A 3OUYB 3EJMA 4F8RA 4FXWA 4JI3J 3NP5A 4JI2F 2D3O1 4DUZJ 1HIYA 1GT8A 3D1HA 1Q7YT 4QR0A 1QSSA 2XCPA 2CNNB 4KE5A 2AYMA 3KYLA 4OI6A 3QWUA 2XZDB 2BX6A 3MOZA 1JLFB 4PG6A 4LUBA 3MD3A 2DNNA 4ILRA 3VV2B 5K8NA 1WC3A 4KQZA 1UZDA 3DLKA 2HNYA 2GQQA 2UUCF 2AHOB 4IR1A 3POTB 3CCUS 4HT5A 3C14A 3WX4A 1VOMA 1R27B 2GVDB 4C8MA 4LMZA 2C2EA 2DCLA 2MQ8A 1AZSA 4I7FB 3MMBB 1TL1A 1EETB 5EN1A 1SJ4P 2IAJB 2LFVA 2J7KA 2UXDF 1KOOA 1X4HA 2V8HA 4B3MJ 5E5NA 4D3GA 2VBYA 2XMAA 1HWUA 5HLFB 1VI7A 3HHLA 2FIUA 1TL7A 1N5QA 2CNLB 3G4SS 1S5ZA 1ZTTA 5KG2A 1S9GB 4DFKA 1F0XA 1YDLA 1TV6A 2ZEJA 1D9FA 2YX4A 1C1CA 2B6AA 1WI6A 3Q8YA 4FYDA 3BO4A 4CWBA 4MMOA 1URNA 4RO0A 2EKYA 3J80U 4OYZA 3M2RA 2P9CA 3EWGA 3RBEA 3I5AA 2AIRB 4GVBA 3DLHA 1UJ6A 4QPTA 4H4MA 1FKPB 3UN2A 3VTIA 1P6TA 1XMQF 3C3LA 1HNZJ 3P3DA 3CO9A 2YX1A 4RWXA 3NS5A 1Q53A 3AA9A 4NXNJ 4NCGB 4OV6A 2B9EA 4IYQA 3OTDA 3MECB 3NCRA 4UOCA 3BYRA 1N5YA 1KS2A 3CIZA 3H0PA 2DXDA 2CPFA 4QIVA 1CBKA 1IKXA 4DR5F 1B4SA 4C8LA 3FFIB 2CQ2A 2KTQA 3D3CJ 1N5TA 4LF1A 3D9BA 3LGHA 3ILOA 5J2QB 3NWGA 1QD1A 4I2PB 3CGIA 4QBUA 5A8WB 4TQSA 1U45A 1KVKA 2OAUA 1LW0B 4G1QA 3P4UB 2PE8A 1UVLA 3DN9A 1RE1B 4IR9A 3QJLA 5M2UA 2K7KA 3VQSA 3HVRA 2DGSA 4RBUA 2XY6A 2H4YB 4E98A 1IR0A 1RHMB 2HHHJ 3DM2B 1GK8A 2CG8A 3Q89A 3RRHA 2QA1A 1PJ7A 2L9DA 4NMLA 1JLCA 3CSKA 1HNWJ 1CC7A 1FWPA 4NYZA 3H2UB 3RG6A 4TY9A 3V6HA 2CJYB 4B3MF 4ID8A 3BGLA 5J1EB 3LAMA 3C6UB 1GXTA 3L09A 4FNHA 5LSOA 1R0BG 4KGVB 2XHCA 1OPIA 3MPUB 1JJHA 1O8BA 4RW7B 3JTNA 3MMAA 2NS1B 2NSBA 3Q8QB 4H54A 2CJBA 5ETQA 4ZP7A 3THVA 2O67A 1HL6A 4A48A 5KT3A 3ILIA 2UUWA 3NGDA 3NBPA 4ZP9A 2DNPA 4K8RA 3F73A 2COLA 1X4FA 2D9PA 2ZD1B 1NZ8A 4LFCF 1GFWB 5IOLA 5T41A 1TTHB 1FFSB 1TVRA 1QY7A 3BSOA 4E8UA 3HX9A 3K8WA 2WONB 1S4FA 4J90A 3IBCB 4KGKA 4NXNF 6AT1B 3IS9A 2XG8A 4DV0J 1IQTA 2UXBF 1VC5A 2XY7A 3MPDA 5H9EJ 2G9OA 1YHQS 2ACMA 2W4DA 1JLEA 1NK6A 2K1RB 4HDHA 2FJVA 5KFKA 3DLGA 3ADAC 1YQHA 2G0JA 1HHSA 1IR2A 1HQEB 1NSAA 1OYDA 1OMSA 2GHWA 2JDJA 2HSEB 2OH2A 1ULRA 3HVAA 5L1JA 1RWMB 4Q7AA 2W7PA 3L7OA 4QJVA 4HI1A 2WAQD 2Z30B 5IQ6A 2LA4A 2DRBA 1ZH5A 2C22A 1KQFB 1K0VA 2AYBA 2HBYB 2OKQA 2E7XA 4L75A 3SQGA 2OPRA 4KR0B 2ROGA 3UCGA 3W9JA 1RTHA 1RUSA 2XNQA 2HHHF 3HJVA 3TX8A 1EZZB 3KNAA 4IOBA 1HNWF 5IC6B 2KVIA 4QZVB 3M7VA 3TP2A 2QMWA 3G8TA 3D2WA 2X3GA 4DG1B 4DR1J 4K2JA 2HVZA 4E0DA 2CPZA 3ET6B 4NLYA 1V3RA 3T41A 3CC7S 4WCEQ 2B5JB 1HQUB 2MQNA 1S10A 2XGPA 2HFNA 5BJRA 3BZQA 3PW5A 2L41A 1ZAXA 3EGVA 4YR2A 4ZLPA 5F8GA 4M8LA 3CCRS 2XTJP 3UVJB 2BDPA 3W62A 4LF9F 4C0BA 2W2NP 3UQSA 1HMVA 1YRTA 2U1AA 1SBRA 8AT1B 3T9ZA 1NXIA 1IM6A 4RPFA 2GQ2A 1N5SA 1PG5B 4DV0F 4B02A 3NCPA 1TKTA 2D41A 2UV8G 1CPZA 5AJ3J 3TQEA 1SPBP 2XWXA 4I0WA 1UA1A 2W9BB 4MIBA 4C0OC 2W01A 3KK2B 1B64A 4ZKAA 1LV5A 1LWCB 1S12A 3WBZA 4DN0A 2DY9A 2LDYA 4KH0B 2VC0A 4LVOP 3PFEA 1O51A 1XTZA 4OQJA 4YHHJ 1S6QA 5L46A 1W7WA 2DH8A 1V6HA 1U0HB 3DCAA 1N6QA 2BUNA 2HPUA 3MAHA 2HGNA 1UMJA 4AUKA 2C1EB 3DRSB 1D8ZA 2RQ4A 4L3NA 3SEOA 1VQOS 3M4XA 3E01B 3CD0A 3D1QA 4EWTA 1NB7A 1N5VA 3EICA 2DGXA 1RP5A 2DR8A 3PX0A 1VQ6S 1DTTA 3D6MB 4ID5A 4JI8J 1RKIA 3OHBA 4M95A 4DQSA 2AW0A 2J0QD 2W2MP 2MJNA 2YKAA 5EGYA 4MKBA 4IDKB 2DT9A 2IIHA 4OHXA 3KTQA 2MKCA 4KGMA 1OWXA 2D69A 4OLOA 4M63A 4ZS6A 4K4TA 1YTYA 4OFZA 3NAHA 4QWDA 2AJ0A 1VHFA 3M6VA 3O1LA 2YNIB 3UFCX 1GX6A 1ZS6A 5ETLA 1PSDA 3GSDA 3N6MA 1HI1A 1S1VA 2AEJA 2YY3A 4ZP6A 4WKRA 1RT7B 3MCOA 2XI2A 3RR8A 4NYPA 1NM2A 3E8OA 3LP1A 1T05B 2HMIA 1FVSA 5B0EA 1IUJA 3ZTSA 3MEGB 1FJCA 4ECUA 1FK9A 4P2FA 1YIJS 3DRXA 2CJXB 1C0UB 2BXJA 4OL8A 3BQ0A 4K50A 1CJVA 4RBVA 2HZVA 4J9OA 5K14B 2P2CB 1XC9A 5T7LA 3KFWX 3M05A 2X3DA 1X4CA 1H3DA 2ZBQA 3OQ2A 5C2CA 2BYCA 4Y2IA 1M5OC 5KT2A 4Q8FA 1HQ2A 1IKYB 4H4OA 2XSJB 2J5AA 1RTJB 4F4AA 1PBUA 4YDDB 1RB0A 3E2EA 4H4KA 3AB4B 2A18A 3GONA 4Q43A 4KFBA 4QIWD 1DTQB 1U1RA 2FHMA 1HWIA 3MEDB 5CABA 4DV1J 3DMJB 3HSZA 3B82A 3ZFVA 4JI8F 4K4SA 4IO9Q 2RJZA 3N0VA 3OSPA 4GO5X 3W2WB 1SCJB 1TKXB 5CZXA 1RAAB 1SKRA 2W9CB 2HFSA 1JXLA 2WZ1A 3CCJS 1WHXA 3UCZP 4UW2A 2DRAA 3AOBA 4W98A 5HL7Q 1FF2A 2KFYA 3LP0B 3I5CA 3EGNA 3R5BA 2Z56B 2HWTA 3KLGB 4K2XA 2QGFB 4NI2A 4I2QB 4P7VA 4NRTA 3C2PA 1OSCA 2AGPA 3QIPB 3MMCA 1P9QC 4IQXA 2NZCA 5LL6d 4WFNQ 1C0TB 2NPIA 3IP0A 2OPSA 2WVBA 1KONA 2HS4A 1BMQB 3EE3A 1ZM4A 2QL5B 3TAMA 1KLMB 5IT9Y 3ITHA 4ES3A 3PY8A 4C0HA 2MEWA 4F4YA 4YB6A 2IVYA 3MEEB 1KQGB 4FKYA 3HSDA 4JB8B 2ZKUA 4M5MA 3I5BA 4WU3A 3CD5A 3CMES 3OR2A 5KFLA 1Q7LB 4LIWA 2KM8B 4F67A 7FDRA 4DPTA 5GAHI 5KFJA 4WJBA 4G6VB 3U1LA 1CQNA 2JVRA 4CO1A 3X3UA 1U1NA 5HI7A 3KLEB 3CD6S 3N4WA 2EK6A 4J9QA 3ULHA 4ZVHA 1M5KC 3T5KA 4FYWB 4OLPA 2VKZG 2R7WA 2E1MC 5GAGI 1JLGB 1ZPWX 3B4MA 2BW7A 3FUYA 2ZUGA 3UD3P 1FDBA 3PRDA 4DV1F 3R6GB 3JAMY 4NX9A 2YKPA 2EFOA 4RWWA 3BEGB 2J9EA 5IM0B 2YH1A 4DSEA 1J5OA 2CQ4A 4UTGA 4MYTA 3TUZC 5DM6Q 1FX2A 2DNRA 4PABA 3MWBA 2I5JB 3HO1A 1Y4ZB 4AXIA 1HI8A 2QT7A 1N54B 4YQWA 3KKFA 4BS2A 2L48A 1IJFB 4WF9Q 5BYRA 1WKKA 3QT8A 5HMZA 3LPYA 1Y5NB 1H6KX 4R5PA 2DRDA 4WIQA 2DR7A 2ZE2B 3N6NA 1FRKA 3GV5B 2CQIA 2QTWA 2F63A 3MR5A 2FY8A 2EBEA 5GAEU 4N5SA 1U02A 3CCSS 3BREA 2KT5A 4F36A 2IJFA 4DV2J 2R7UA 3G6XA 2MKJA 2DHSA 3IRXB 2KM8C 1TMMA 3EVOA 2I8EA 2OD4A 4LSZB 2MKYA 4AL6A 4DSJA 3DOKB 3TARA 4FZVA 3CW2C 4NLVA 1DLOA 4J91A 4I6WA 3LANA 2JRSA 3DC2A 4USKA 3BSNA 4LSLA 1X5TA 4OZ5A 3VAMA 2G1HA 4FF4A 1AFJA 7AT1B 3A8JA 3KOAA 4K4VA 5HK4A 3H59A 4K4ZA 3TQ1A 1S1UB 2BA9A 4DSFA 2H5JB 3H98A 4AE5A 1KWMA 3W9IA 4QYZK 2QX0A 3DI6B 1S0NA 2FY1A 2C3OA 2HNZB 4LBIA 2GAHC 1HBUB 2DITA 2ZJQQ 2DPIA 3K5OA 4KPCA 1XEZA 2ZC3A 3IG1A 1U8SA 3M6WA 3CVKA 4K5RA 3R8YA 3M8RA 1BLUA 1NU4A 2AT1B 2A6MA 4RL1A 3QT7A 3CCMS 5LT5A 1MSWD 3UO0A 4KRWA 2W2OP 4ES1A 3FZBA 3Q8PB 5HROA 4QU6A 2H1YA 3MR3A 1TL4A 4P73A 2IRUA 2BRLA 3HF5A 3UR0A 3DLEA 4QU7A 3FRZA 4WZQA 2LU2A 2E7VA 2RRBA 5K8MA 2GAGC 1B0VA 1NSKL 1TL5A 4F4KA 1FKOB 3DGVA 1NO8A 4JI5J 1ZPVA 1MN7A 2D3UA 1V5IB 2CPIA 1VHIA 1HWKA 3M8PB 3IBWA 4NYOA 4DZ6A 3DHWC 2PEBA 2O01C 1YLXA 2VFTA 2E9TA 4O0NA 2DXFA 4B08A 2MJUA 5DDPC 2K3IA 2FVQA 2JFKA 2GO8A 4Y2CA 4MFBB 3KK3B 5EX0A 2V4JA 5SZTA 4PUOA 1RHUB 1FNOA 2VPYB 2VPWB 3OTCA 2HHWA 2J7WA 2AWZA 1RTIB 2VFVA 1SV5B 2X1FA 2BE2A 4KB7A 2JEJA 2HVDA 1WELA 5H1SV 4NMXA 1UEUA 2O1PA 4KHMA 1Y9OA 3BGOP 4JI6F 3GPAA 3R97A 3DLBA 2D9OA 2XGQA 2IBKA 2B4PA 4Q2LA 3OBIA 4J7CA 2B4OA 4OJ1A 4CCHA 3CWJA 4TN2A 5GMDA 2B4UA 1I3OB 3BBBA 2HURA 4M5JA 2VKRA 1KVIA 2D1CA 3H2LA 2ZH6A 2CKWA 4YFUA 2KHDA 3T19A 3JQJA 3PW2A 3MF5A 5GADI 1H73A 4HYKA 3RB3A 1N33J 2VZ8A 5CYQA 1VJQA 1TAQA 2WSEC 3MM8B 3VZIA 4Z2XA 3T1YJ 1JKHB 2Y1LB 5BR8J 3ONQA 4U95A 5FDLA 1JNZB 4CP5A 2IM3A 1PAEX 3SFGA 4NASA 1ZZFA 3QGIA 2V9KA 5KT7A 1FVQA 1WF0A 3NOGA 3CCVS 4IFVA 1PGZA 4USMA 3JSMB 2WOMA 4EBCA 2ZJPQ 1FE0A 2HK3A 1VQ8S 3TVKA 2CDRB 2GJFA 2GJIA 1UVJA 3QSIA 4FVMA 2EG2A 1F60B 3H2VE 5I42A 1JLAA 2UXCF 3IA0A 4PQUB 1MW7A 4DF8A 3U27A 4X64F 1FTRA 4J9NA 4NLPA 1S1WA 4OHYA 2QIFA 4B9TA 3KNGA 1ZYQA 3R5AA 2WCXA 4N77A 4GMKA 1FXLA 1GMUA 2R2TA 4UOGA 2O5DA 4KYZA 5B09A 2V9WA 4ZPAA 3CJSA 1N36F 2YXLA 5M2RA 4WTYA 2KZZA 3I4PA 3K89A 5B0DA 2BQRA 4IH5A 3AT1B 2J6UA 2DNGA 2NR0A 2IM0A 2HAIA 1LW2A 1M1KT 4ICLA 3NXZA 4JI7J 4PQAA 3T1AA 2JFDA 2EXUA 3EZOA 1VRUB 4ZOSA 3DYAB 3DRPA 4PPDA 4MT1A 4HLBA 2IYGA 1MMNA 4RU2A 3NS7B 1O5JA 4KKOB 1PYSB 2V68A 2H9ZA 5J2PA 3GFHA 2H65B 4Y2AA 1H0HB 1WHWA 2OTLS 5EUHA 2YX7A 1AT1B 4DFPA 5KG7A 2A1BA 3KJFB 4K5SA 4ZPVR 3M2VB 3GYNA 3FC9A 1VQYA 5I3UA 1EHWA 1X5SA 2HNDA 2PC6A 1N33F 3BGRA 3KHLA 1REVA 4DSIA 5EWFA 5E3RA 2NYHA 4M5HA 2CQGA 1EB0A 5BR8F 1OYEA 4IOAQ 1W2IA 3HDSA 5A2QU 2M2BA 3GU0A 3PO4A 3RBZA 2VFRA 3MPYA 3I56S 2EFNA 4F3QA 3H90A 4LRDA 2ASJA 1HBNB 2FYXA 2VH7A 5CD4A 4PXEA 1QM9A 5C2GA 2XQCA 1F5CA 5L1IA 3FBBA 2YQ3A 2XLKA 2MGZA 2DO0A 5IS2A 3CTRA 2VBZA 3N28A 1KHWA 3GLJA 1WSVA 5A0YA 4ZHRB 1D0EA 4TQRA 4J9PA 1RADB 3NG8A 4ZDNA 3SSSA 4HH1A 3UD5A 1R8AA 1YJTA 3R2DJ 4LF6J 2EVZA 1N0VC 4KTQA 3L4BC 5CAAA 3KJVB 1A7GE 2BJ9A 3OXFA 3NGUA 1IKWA 4OI2A 2ACYA 3A3OB 3EX7B 4FF3A 4K4XA 3PXGa 5HMYA 1VCTA 3C8YA 5C42B 2MZSA 2EFGA 3MM5A 3NLCA 2GX8A 3DGPB 1QAJA 4ECTA 1IBMJ 2X51A 4GC7A 4JI4J 4NLGA 1UWBA 4Y2KA 2MQLA 1HNXJ 1SJFA 4RU9A 1LQ9A 1MROB 1H2VZ 2MQMA 3D6FB 4DX7A 3SCJE 2ZH3A 1HNIB 2CQBA 4DN9A 4EZ6A 4P6QA 1KR4A 4ZVTB 4LRAA 3TX0A 1HW9A 2MQPA 2RVJA 1A9NB 1CJTA 2Q6CA 3B6BA 3CB4A 2FGOA 2NZ4A 5HJYA 3KLFA 1AFIA 1SUQA 1N52B 3FSYA 5LMNJ 3CO0P 3IWXA 5D6GA 2R8KA 3CF5Q 2CVEA 1U1OA 4UZBA 2XS5A 5DDOC 4PR6A 3GYGA 3Q23A 1KOHA 5MLCV 2VUGA 2MY8A 3W3SA 3UN3A 1EJ7L 1NHKL 1WF2A 1BC6A 1JX4A 3W7BA 1SQFA 3X1LB 2HK2A 5CA5A 1EARA 4LREA 3GFYA 2F4VJ 5F8MA 5I3PA 3VZHA 4F4ZA 4KC5A 5IT9U 4ECRA 1VYAA 1R6VA 2AYEA 1IWAA 2CA9A 3TO8A 3T1HF 5IT4A 4HKQA 1RLDA 2J9CA 1R8HA 1KVJA 1R8BA 2LEBA 1PBAA 3GG0A 2QG9B 3HFKA 5HATA 1WEYA 1WHYA 4M5DA 4P2SA 2PA3A 3MTJA 4TLRA 3BQ1A 2H51B 2F8MA 1HR0J 5LXYA 5THWA 4X4UA 1Z2ZA 5F9NA 3LUYA 2RHSB 1G3OA 3AH6A 3TZWA 3BGUA 1RBLA 3ZZRA 1GTEA 1F9HA 3Q8UA 2PA8D 2JH3A 1D9DA 1IBMF 3R2CJ 2N7CA 4JI4F 2E66A 3MM7B 3HHEA 2N4CA 2RQMA 4ED8A 2LA6A 4FNIA 1DY3A 3CJ2A 2GIRA 1HBMB 1LWFA 1FXDA 3QLHB 2OSRA 4WP8A 2RF2A 4V1Ak 2AX1A 3JAMU 2ZWOA 1K44A 4IOCQ 1M90T 2ZHBA 4RNNA 3I0RB 1FEEA 3GMGA 1NUEA 3C16A 3EPIA 2Z2LA 3TUPA 4J37A 4ZPCA 1AYEA 4O23A 4QIGA 3R9LA 3R5JB 5IWAF 1EIYB 1FRHA 4XTTA 3MEKA 1RWPB 2CJKA 1CQMA 2DH9A 3KLHA 4NPOA 4CNYA 2IC3A 4CH1A 3PJ9A 2DGWA 1RT1A 4J9UE 5F0UA 1RAFB 3M30A 4RUBA 2C3PA 5D4LA 3BKFA 1AXQA 1RWXB 1F1BB 5CYMA 3GFZA 4L73A 2XCAA 1SVDA 1C4AA 3CCQS 2W7AA 3RB0A 3QAEA 3SXLA 2F4VF 3GYXB 2AJQA 1KTQA 3KHHA 4DS4A 3GCWP 2P9GA 3K58A 1XJWB 1K9MT 2ZH8A 1RGVA 2W1BA 3U1MA 3PW4A 5U47A 2J9DE 2HQCA 2B43A 5DQGA 4DFJA 3HHLD 2CQHA 4P72A 4CDIA 2YWKA 1RT2A 5KG6A 1HD0A 4HHJA 4JV2A 1WEZA 2C3UA 1NKCA 2Q6BA 2JLGA 4NZ7A 3VR1A 1NHVA 2HQFA 2XO6A 1SJ3P 1HR0F 4NCAA 1AUDA 2RB7A 4ZVEA 1F5BA 2QSWA 3DLKB 1RTDA 1RT5A 2HNYB 2RNEA 5E3QA 5ETSA 2E5LJ 4NWBA 4OYPA 3C14B 4I64A 1IBKJ 4LBHA 2MQOA 2ADBA 4A8QA 1AZSB 5L8RC 5GMEA 2VBWA 1TL1B 4USWA 1WDDA 3HULA 1ELOA 4CM2A 3BM7A 2CVIA 3KMQA 4DU8A 3C6TA 3LQVA 3HHLB 4N8NA 2HVEA 3D6HB 1TL7B 2MLYA 3FZ2A 1TV6B 3R5GA 1C1CB 5KT6A 2B6AB 2E9ZA 3PIPQ 2LQJA 4CTAA 5FD1A 5B0FA 2FGCA 2OP5A 5L9NA 5HQMA 4HR2A 3O44A 2FQQB 1LWEA 3PDNA 3G6YA 5CHCB 3M2RB 2CJAA 4C3MA 2WBMA 4J9KA 1RT6A 1PYOB 2DH7A 4UQGA 4MYUA 2HYIB 1MU2A 4GVBB 4HHUA 1Y10A 3O8WA 4H4MB 5LMUJ 1TKDA 4KH1B 4U8YA 1RYSA 3P8BB 1X4BA 2X1BA 3HVTA 3W66A 4FYYB 5K9FA 4DPYA 3UR3C 1N5YB 4ZLNA 3OR1A 2XMWA 4O4GA 1IKXB 2HHQA 5DLFA 5DG8A 2E44A 3QSYB 3LAKA 2I0XA 5MAOA 4B3OA 1OY6A 2Z8QA 4QIEA 2VC1A 1Q5YA 4KPYA 5A6WA 4X2BA 2K3KA 2J76E 5D8HB 3RU0A 1VISA 2Z0GA 3MZIA 4G1QB 3P5BP 2HQ3A 4U6PA 1SKUB 3BSAA 1HBOA 5J2NA 1ZOTA 1RWKB 5GMKa 3RW7A 1T02A 4DX6A 5KFCA 2B8QA 2WB1D 2E5LF 2ROPA 2XMTA 4PG7A 4QWAA 2VBXA 3ZNJ1 3HHLC 2CRLA 1ZA1B 4USIA 5CXTA 2ZDPA 4ZCMA 2OMLA 1WOOA 2Q3PA 3LH2S 1WTBA 1NK9A 1JLCB 1WHVA 3I9V9 1XR7A 1TFYA 3ZXWA 2EKNA 4DV5J 4AL7A 2ABYA 2EC2A 1R89A 4C11A 3GIRA 2QA4G 2CWXA 3OVSA 3ZNUA 3PV8A 3KK1A 2CZVC 2R2SA 2BVZA 2WHOA 3MMAB 5AE2A 3UN5A 5ETOA 3QZ8A 3CJRA 2IHR1 4LRCA 2L3MA 3AHPA 2F8HA 2JZ5A 3OHAA 1QVFR 2QLJB 3NBPB 2XYPB 2CPXA 4YY3J 4IQMA 3MGJA 4GKKF 4JYAJ 1KN6A 3VGSA 5LMUF 4WFYA 1Y5IB 2H5IB 4FBUA 5IT0A 4ECYA 1TVRB 3A1YG 3IR6B 2KT2A 4J9LA 4ZITA 3ISZA 5B0CA 3LF0A 5AXNA 2HGLA 3KXDA 3IS9B 2KJVA 2Q66A 3GJTB 1YBUA 2IM1A 2DGTA 3O5TB 3DKDA 2V4RA 2MZJA 5E41A 4C97A 2B4VA 3GR1A 2ZM6J 1JLEB 3BBFA 3I87A 3MUTP 3BYPA 3DFEA 3DLGB 2LQ8A 1HKAA 1NDPA 2HRYA 4BWJA 2BE7D 1WORA 3BDEA 2VPXB 1KRPA 1OSDA 3UDEA 5EWEA 2AD9A 4OMFG 4ED2A 3EMTA 4B3SF 1BQMA 1YJUA 1BWVA 1NB2A 2ZOMA 4O44A 1KP6A 4DV7J 5KG0A 4LR8A 1UETA 2A10A 2Z2ZA 5I4MA 1LKZA 2Z57B 2APOA 1RQ0A 1L5UA 4PXCA 4I6AA 3SQGB 3BN4A 1K73T 4F3OA 3MPVA 2OPRB 3OLAA 4ZVGA 2DPJA 3AAWB 4B9VA 1RTHB 4BDPA 2R3VA 1WG1A 4DR3J 3K5NA 4Y2MA 2IVMA 2PSZA 1D9AA 4OZ1A 4O3PA 2ROEA 4WIIA 3AJ1A 3IMQJ 3WC2A 4HH0A 3L7UA 1K1QA 2R2RA 3OT9A 2WB4A 3CDBA 4QYZJ 3PIOQ 4ELVA 4U8VA 3D28A 4DV5F 2FC9A 1WC5A 2FVSA 1JJ4A 2BE9B 3Q8VA 1UPPA 5D0RA 3FK4A 5FJ4A 3ELHA 4WXOA 4DZDA 3QAUA 3K5LA 2Z58B 4DV3F 2X1AA 4DX5A 2PMZD 2V2QA 1U1QA 1T3NA 3SIPB 1IXKA 1SB6A 3TAPA 1HNVA 5DG7A 2YKNA 4QQBA 5H9FJ 2ZH1A 4YY3F 3H7HB 1U8WA 5CZCA 4CH7A 4IG3A 3VGTA 1X60A 3SDEA 4JYAF 1N34J 2GW8A 1HMVB 2MZQA 1HLWA 4RW9A 2HVHA 3D54A 3MFHA 2BOPA 5B0GA 1VBXA 2YPZA 4JV5J 3OJSA 2H54B 3N79A 1B0TA 1NHUA 3S6EA 4TNOA 3M8ZA 5KFFA 4WKYA 3HK2A 4D3HA 3T3FA 5DGBA 2FPHX 1IWGA 1UJ4A 1TKTB 3CJKA 3E51A 2B0GA 5IXUA 3HHNB 2FUG9 2V69A 2J0SD 3KHRA 3IFEA 1RAJA 4Y3CA 4JI2J 2AZ1A 3J7YU 4TY8A 3NOCA 4DI6A 1TQLA 2KJWA 2VG7A 4A4JA 4ZIVA 2HKEA 3QGGA 2KFNA 2OO4A 1MWYA 4RW6A 4DR6F 2YKMA 1EP4A 1R3NA 1EQ0A 4C8OA 1JLBA 4ZVUB 4EK2A 1S6QB 1NEEA 4ZJLA 4DV7F 2HG4A 2FVCA 2FJWA 5C5JA 3G96A 1FFGB 1N88A 2RHQB 1GEHA 1N6QB 3HKWA 1RCXB 3EPGA 3THPA 4I6YA 3PYDA 3WDOA 2HFOA 2C28A 3VAKA 4FXDA 3IRWP 1QUPA 4DR3F 3R1LA 2QO3A 2E1PA 2LU1A 3LA0A 3RW6A 3GQCA 3ZTPA 1W2BR 2XMJA 2XC9A 2XY5A 2VPZB 1CS4A 1E6YA 1DFDA 1JXEA 2UXDJ 1K1SA 2UU9F 3G6VA 2FZGB 2QA2A 4DV4F 3QMQA 5G4DA 1DTTB 4A8OA 3PR5B 1SC1B 2KKHA 4ID5B 1B99A 4CLFA 4WE1A 1UW4A 3PEJA 4KGXB 2K7JA 4PYDA 4B9SA 3N6LA 2KG0A 2DHAA 3J81Y 4U96A 2E5HA 4B17A 4EO8A 5D78A 1N32J 2XYGB 2N4DA 4X4QA 4IH7A 5M2PA 3FCWA 2MB0B 5KOWA 2R8JA 3SZ2A 1N34F 4OJGA 2V6AA 1RSCA 1SIWB 4NA1A 1G2EA 3LALA 3JQMA 4EO6A 1S1VB 2EFVA 4L76A 5FLXY 2JLEA 3TI0A 5F8IA 4CRJA 1U48A 2RILA 1KD1T 3E3XA 1XNRJ 1Y3KA 3LP1B 4CLWA 2HMIB 3Q8SB 1S59A 3CDUA 1Y3JA 2P8IA 3RJMB 3I96A 1NJXA 2JEIA 4I56A 1FEHA 2AKWB 2DGUA 1GMWA 1S0MA 1FK9B 3ISNC 3M1VA 3NEKA 1NMEB 4GKJJ 1YKWA 4DR5J 3CJQA 1T94A 2RS2A 3LWLA 3M2UA 2CJQA 1SL0A 2ADCA 1CJVB 1FA0A 3DRRA 2XEXA 2P5VA 1S6OA 2UUBJ 2BKOA 4Q2MA 2CQ1A 5T7LB 3LP2A 3MAAA 2GIFA 2E7WA 2IRYA 1OQ3A 3I31A 4JI0J 5DG9A 3IXQA 2KYXA 3NWRA 2K06A 4XO0A 3CCES 5K8OA 4C8NA 2JX2A 4H4OB 3CCZA 3QRPA 4F0HA 3KJNB 3NGRA 2HVIA 3A4TA 1SC6A 4Z7YA 1HD1A 2NSCA 1T9XA 4HTJA 4KFBB 4QWBA 2F1FA 2H5EA 2XB2D 3FSIA 2MQQA 3UDCA 2FVPA 2XSFA 5ETTA 3PTWA 2LYVA 5IV3A 4KY3A 1P27B 4ILLA 3CCTA 1S1TA 2GHPA 2WW4A 1S7IA 3N01A 2KVQE 2RMLA 2R8IA 3QJPA 2QJ3A 3O3LA 3FEXB 3MR7A 5D4NA 2ZNZA 2BV3A 2R7RA 1N32F 2VL1A 2FJEB 3IC1A 3Q22A 2BMBA 4OX7A 3FEZA 4DMZA 2QMUB 4EZ9A 4R0JA 2M0GB 3K2YA 4NI2B 1XR6A 1R0AA 4LFCJ 2KDOA 1U0SA 2QFJA 1VQMS 1S76D 3MMCB 5KG4A 3MR2A 1JWWA 3M6UA 3PG9A 2B3TB 2OPSB 1RA7A 2G13A 4G1IA 4K7QA 2WRMA 1UP1A 1XNRF 2OPQA 2ASLA 2UXBJ 4UY85 5EDWA 2A2DA 1DHMA 3SV3A 1FJGJ 2VF3A 3TAMB 1M0SA 3ITHB 4DLEA 2KU7A 4CT9A 4GKJF 2R2UA 3FJ2A 4JI1J 3CNQP 2D74B 1V9OA 2G2ZA 2I38A 1NKBA 2E5IA 3OR2B 1F9EB 4RNFA 2UUBF 3M6XA 2EG1A 1CLFA 4H4KC 4HT7A 3ZZTA 3QZ7A 1CJUA 3NNHA 4XPCA 3MI7X 4JI0F 1QE1A 2Y1RI 4IH6A 5D77A 4F2SA 4L6V3 4M5KA 3QRQA 3H4DA 3NNCA 3OTEA 1C4CA 2AF6A 1VLYA 3S1TA 3NGSA 3MM9A 3CCLS 2Z4PA 1WOPA 3T9NA 2HBRB 2QLFB 2DO4A 4A46A 4I69A 4MJKA 1FRIA 1KQKA 4AMMA 6FDRA 1GNKA 3CCWA 4YN3B 2R7QA 4DQQA 3C15A 1VQSA 4ZIWA 2GGPA 4C3LA 2K2PA 3AOCA 4IFYA 1IR1A 3KWMA 2YNHA 1J5OB 3BR8A 2QA4S 5D0GA 2VG5A 2BABA 2P9EA 1U1KA 2BJ8A 3CXCR 8RUCA 4I68A 2LQ9A 3Q0AA 1SL2A 3HI9A 1H72C 4LF9J 2IBOA 1CEZA 4F7VA 3J80Y 3NNAA 3TYTA 1S9EA 4A8FA 4R5PB 2OIHA 1SC3B 5HMXA 2VOOA 1YJ7A 5D0EA 4OHVA 2HRTA 3UDLA 4KHRA 2ATCB 1FJGF 1WJ9A 2I1RA 2YNGA 4UOFA 4CLSA 3SSQA 4GO7X 3WC0A 3QO9A 1BWEA 4JI1F 1XK8A 2PIIA 2FHJA 2G2YA 1DLOB 2RDJA 4LSLB 3CE8A 4FBTA 4N56A 3CEDA 1NK5A 1XN9A 3FDSA 1B0PA 5ETVA 3V81A 1VGYA 1VQ9S 2CIMA 2ZJRQ 2UUAJ 3D0GE 1IBLF 4OX9J 4AMNA 1DAXA 3AJ2A 1TK0A 1FJ7A 4YOEA 3SBMA 3D67A 3M8QA 2RAQA 3QBCA 4PRFA 4RNMA 2WK4A 4QWCA 2QE5A 3ZZ0A 3D66A 3IG1B 5B0BA 3G2XA 3G9CA 4M5LA 3I55S 4XDDA 4ZMMA 3FVYA 1SKSA 5HROB 1Y5LB 2IVFB 3HLUA 4CNZA 1BQNA 3AA8A 1C1BA 2YWEA 1N48A 3MUMP 1TUGB 3DLEB 1PC4A 2HFUA 1Q86T 5D4PA 2R8GA 3GJQB 5HP1A 4AL5A 1NZAA 5DQHA 2BANA 2ZC4A 1RWVB 3BS9A 5KFEA 1KHVA 3V6JA 2HHSA 1HARA 1HI0P 3HT0A 4RKUC 1WG5A 3VQTA 4ITSA 2V4JB 2DD8S 4PUOB 4ALZA 3RGIA 2V94A 2FZCB 2M4MA 3NMAA 2KZMA 4KO0A 1R8CA 1X0PA 5IC4B 4FPIA 2LEPA 2BE2B 1YZ6A 3T6JA 2EI5A 1QDUB 3GB0A 3GV8B 1M5SA 3IO1A 2HQDA 3I0SA 5AE3A 2B56A 5AXLA 2MTLA 1GXLA 4EGLA 5IQQA 2IDEA 1BD6A 2RS8A 4DWIA 1U24A 1E6VA 2BKPA 4TYAA 4ETZA 3R27A 4PWDA 2KH9A 4XK8C 4ZCKA 3VALA 5HVFA 4WTOB 1NK8A 8ATCB 1H38A 2CQDA 1T0TV 4CYUA 5L39A 1VQNS 1HYSA 2J0WA 4ANCA 4F4XA 2ZWPA 4OHZA 1B7YB 4J5OA 3P6YC 2UUAF 1UA0A 4OX9F 2R7SA 5CYQB 1D09B 4WYWA 3OJUA 3MCSA 2NPFA 4X66J 1VRQC 1UL3A 1REGX 5E3CA 5FDLB 2M9KA 4CO4A 4RUCA 1F2GA 2MHEA 3KLVA 2YWWA 3FBEA 5F3ZA 4UQTA 4DPOA 4DQIA 3W60A 3PYFA 3DLJA 4IFVB 4DCJB 5SUHA 2WOMB 3LTOA 3KLIA 3P49B 1S57A 4K4UA 3B8HA 2XM3A 4RNOA 3NY0A 3Q24A 2CPJA 2KFZA 2W2PP 5I42B 1JLAB 2NXJA 1VLOA 5ETMA 2GQCA 5DETA 4IRCA 2GFFA 1S1WB 5J2MA 4TLQA 4ED5A 1N8RT 1VQ7S 3FSXA 3ETOA 4NLDA 1D1UA 2WW8A 4QCLA 4DL7A 2B9YA 1S6PA 2I9SA 3EM1A 1S1XA 4CLUA 2AMCB 4X65J 3BF4A 1FWLA 1S72S 3HM9A 1XNQF 3ZZPA 1G4CA 2UVRA 4N47A 3PW0A 4B3RF 1LW2B 1I5OB 4ICLB 4K59A 2Q43A 1ICEB 1MMLA 4ECSA 4F2RA 5KT5A 1FWKA 1PJ5A 4LSNA 3DRPB 1HFEL 4BC7A 4EUVA 4V19X 1S4EA 1MG7A 3BBCA 4QW9A 4XAKA 1UVKA 4P10A 1O0PA 2NYIA 5J2PB 1KQSR 2FDNA 4ZK7M 3BV8A 3QWPA 2EK1A 1IKVA 5HQ8A 4KBIA 2H48B 4XDCA 3PJXA 3CC4S 3EVWA 5DDRC 4ANDA 5I3UB 1KLNA 3TA0A 1MWZA 3OL9A 4PWWA 4K4WA 2HNDB 1IBCB 4KJIA 3HP6A 1TK8A 2W8KA 3BGRB 1REVB 2F9DA 2OI2A 1BUXA 1FD8A 4X66F 1S0OA 4Y28C 2QL7B 4R8UA 1U6BA 2HW3A 3TEGA 3GTYX 1VIXA 2PEHA 3W2VA 3G8QA 1I94J 2FLNA 3BH6B 3GJRB 2W7OA 2H3EB 4DPUA 2D3OR 5FLXU 3D1OA 2CXEA 1QAIA 5LOQA 3VAJA 4RW4A 1FRJA 2MGZB 4URSA 2RD5C 2EBGA 2BJEA 4F04B 2QLWA 1QVGR 2CAJA 3ZC4A 2VOPA 2DISA 3EZUA 5G0RA 5A0YB 3MOJB 2R9LA 3RBDA 4B3TJ 4LFAJ 4ZJQA 2F8EX 4MH8A 1LFPA 1K47A 4WWSA 1NJYA 4IG0A 2VASA 2YNFA 1QSLA 5AT1B 3PX4A 3BSCA 2RUGA 5D0HA 1ZZNA 5JVHQ 2GZOA 2QRRA 3D0HE 2NUUG 2V2KA 5GAHU 4X65F 4YDXA 1IKWB 1R0CB 2Q1LA 2RIJA 2JEGA 3SYZA 4EU0A 2R7VA 4MAKA 1RAIB 1D3WA 3D5MA 2PMHA 1U49A 2KI2A 3NS6A 3MM5B 1P1LA 1YJWS 2A2CA 5C25A 1Q5VA 3H5YA 4CLPA 5GAGU 1UWBB 3PNIA 4WU2A 4LF7F 2VD3A 1WG4A 4DQRA 3K8VA 3DXBA 5EWGA 2PFFB 3FCVA 3MPWA 4JP8A 1NK7A 3RRGA 3T5JA 4DS5A 4LRBA 4AYBD 2NXNA 1CJTB 3KLFB 1SUQB 3I9ZA 3AD8C 2BOAA 4DV6J 2QLXA 3IR7B 3JTPA 1VQLS 1NDLA 1M5VC 1FDAA 3R7SB 3LPEA 4JV1A 1NPPA 4DUYF 1VJWA 2EC0A 2EPIA 4J9RA 1ITPA 2NUHA 2FTRA 3M9MB 4TXSA 1YSJA 1I94F 1WC6A 4OZ2A 2ZH7A 1KDNA 3OFEA 2AQ4A 4IRDA 4B9MA 1NH8A 2EEYA 3PJWA 5DS7A 3PM9A 1H7WA 1MN9A 4I1TA 4GVLA 3IM8A 2JWNA 2BKNA 4F0KA 1BXNA 4ELTA 3L7PA 3D0IE 2PMWA 2R4FA 5KFHA 4RW8A 4Q0BA 4UOHA 1DURA 1TR0A 3SQOP 2YBVA 2GVZA 4B3TF 4LFAF 1U26A 4A8WA 3TJAA 1J27A 5A6PA 3VHQA 1NPKA 5E3PA 4M5DB 4PXBA 4P75A 3A13A 3RAQA 3ZZZA 4LF5J 1SC4B 1Y0HA 1KBRA 3CMAS 2CZ9A 4HVZA 4CH0S 1EX8A 2GC8A 1AA1B 4LFBJ 2WSFC 2ZNYA 1RT3A 4KHPF 1CULA 2WSCC 2X7IA 4JI6J 2RKIA 5L1KA 5E2QA 1VQKS 4HEA9 1VBZA 4WFZA 3R3TA 2OEMA 1LWFB 4DF4A 1UCNA 3VAFA 2DKOB 2VICA 2RF2B 3BJYA 4MK7A 4ZP8A 1NBEB 3C16B 4YEAA 2BACA 4LRFA 3DU5A 3CJ5A 4DV6F 2JC1A 4P7TA 1I51B 3P45B 1YK9A 4KV8A 3KLHB 1UFWA 2ZOFA 1X4GA 2IC3B 2E1CA 2GMHA 4NLSA 2E5JA 3CJ0A 1RT1B 1LK5A 2IYIA 3M30B 3OFFA 3W8PA 1HPZA 5CYMB 5HN0A 3MM6A 3RUBL 1RWOB 4EYHB 1FXRA 5H9FK 1RU1A 1KKHA 2ZZTA 1HHTP 4ETXA 2A0FB 1NAQA 1CJKA 1FO1A 3PKMA 3JSBA 2UXCJ 2BJ3A 5CD4H 1UFKA 5BXIA 2JVOA 4MIWA 3BQ2A 2J6TA 5KAKA 3HJFA 3TAQA 4U9RA 4X64J 1S49A 4JI3F 3HCXA 1RT2B 4R0EA 1DJ0A 4Z37A 4ECVA 1FRXA 2W9AA 4DUZF 4LF5F 2OGUA 4Q5VA 4O4RA 2MPUA 1RTDB 1RT5B 3JSYA 1N36J 2YWFA 3QYYA 2MY7A 3MXHP 3RZAA 4LFBF 5GADU 4NLWA 1Q1KA 3CJTA 2V8DA 4ZN1A 1TL3A 4QOTA 3IM9A 4LVNP 1RZMA 2H4WB 3HXMA 1CC8A 5AE1A 4LBPA 2OEJA 3C6TB 4RR5A 1YWXA 1GX5A 2CPYA 1T03A 4A8MP 2IJRA 2QC3A 3US5A 3HHDA 2VIHA 3S01A 5J1NA 1W26A 4C48A 2M88A 3VVUA 4CTAB 2EFQA 2LDIA 4O3SA 4GC6A 3F56A 4C8YA 3JYTA 1RBAA 1VRTA 1BE4A 4IO1A 2XO7A 1FDDA 1LWEB 4AFFA 4TYBA 1WF1A 3JXOA 3QGPA 1RT6B 1X7VA 2Q79A 3ENQA 5HJXA 2HBZB 3D7SB 1MU2B 4BBYA 3EDRB 4DPWA 2JJ4D 2D7SA 4Y6IA 3PEHA 5CZVA 3W63A 1F9FA 3UD4P 3ENAA 3EXCX 3UPFA 3JQKA 4L72B 3OVBA 3GV7B 2QL9B 4LF4J 2QFIA 5JJBA 3HVTB 4JOUA 4Q44A 1X9MA 4FN5A 2ILZA 1TMJA 5A76A 1SH2A 1GQEA 3NL0A 2Y8YA 2C2RA 2F4FA 3OR1B 1YRUA 3JB9k 1TFWA 2R42A 4O4GB 1HNZF 3FKBA 4OZ3A 1WUUA 4UF4A 4ECWA 3AXKA 4DSLA 3KDNA 2M5YA 2Y0BB 2RQKA 1P9YA 5KFSA 4B3OB 2VG6A 1WOSA 3PYEA 2JSXA 3V4IA 4HL9A 2WTFA 4DUTA 1O6XA 1ZM3A 3WHIA 1RT4A 1S77D 2VONA 2XMVA 2FVRA 5B7WA 1ROFA 1WC1A 1TKZA 2ZBIA 4I4BA 5DZ7A 1WKLA 1L3UA 3BGFA 1HBOB 5J2NB 1NDKA 2HAFA 3AD7C 1FNXH 1VC0A 3I82A 4AD6A 5A8KA 5KFZA 1VC6A 1JLQA 4OZLA 4F26A 1YBAA 3MAQA 4CO0A 2OELA 2CJ9A 2OPPA 5DQIA 1ZA2B 3FRYA 4NRUA 1RLCL 1M5PC 2ERRA 1JIHA 4DL2A 3PACA 2LXFA 4C8ZA 2DXEA 4OZJA 2KG1A 4C11B 1WEXA 1ZAWA 1XWLA 3KK1B 3G82A 3C46A 3IGVA 2C2DA 3R6LB 3SCKE 1NJZA 1NJIT 3QATA 5K8PA 2AYGA 4EMDA 1P8GA 4ED7A 4K0KJ 2DYAA 2LLZA 4JV0A 3SV4A 3ZO7A 2VA2A 5AXKA 3R7NB 1NKEA 1UEKA 1UFLA 3M8SA 2VV5A 5K5MA 3PFOA 1H98A 3FQKA 4HACA 1Q8BA 1JB0C 1X5PA 5GVQA 2XMKA 3J81j 3GWCA 1UVNA 4RUHA 4LF4F 5B08A 3LGNA 3BR9A 2PT0A 4EYIB 1YJNS 1TU0B 5KFDA 1S7HA 4CIOA 4QW8A 3W61A 1Q4RA 1NCLA 3LO3A 4ANEA 3OFHA 3V6DA 4O3OA 1RJJA 3SFUA 3CC2S 3T1HJ 1Q95G 2BRKA 4F0MA 3PHEA 3ZTQA 2QYCA 5HQLA 2ASYA 2CPEA 4O3RA 2U2FA 3KHGA 1RAEB 3TJ9A 1BQMB 1WD6A 1N0UA 4O44B 2HEKA 3DLLQ 1X8DA 4OI0A 3SCLE 4DCPB 4X4PA 2C2ZB 2JNJA 3UE2A 1NSQA 4UT4A 2UUTA 4Y0FA 1YJ9S 1NH7A 5D4OA 4FPRA 4W4MA 4DL4A 1RBOB 3W9HA 3TOQA 2M8HA 1Q81T 1F5AA 2V8GA 1FDNA 2LKZA 3M32A 3H5XA 4ZCLA 2O3DA 4M5NA 1GTHA 1T9WA 2OEKA 2G2OA 3GFXA 1KEKA 4U7UD 5JUMA 3FGVA 4USUA 2XHWA 3OSNA 2BZ2A 5HANA 2ZH2A 2W8LA 4KGZB 2YKOA 2CQCA 3NGTA 2DHGA 1U6FA 2B7CB 3QT5A 4K0KF 4DR1F 5IWAJ 1HNVB 3DOLA 5D3GA 2YKNB 1YZ7A 5HBMA 5KFGA 4IG3B 1QTNB 3BPDA 3SDEB 3HSJA 3R5CA 2R8HA 4RW9B 1RDRA 2NLWA 2M8DB 1PAUB 1R7IA 3A8IA 4TKTA 2M52A 3EYZA 2UP1A 2GNKA 1S0VA 1ZM2A 4U7CA 5A2QY 1SXLA 3DDKA 1QUVA 3VF0B 3CJKB 4P9SA 3PRVA 1TELA 2MKIA 2MXYA 5KFRA 1T9TA 2DIUA 5F8HA 3SSRA 1Z4UA 4FF1A 4TY8B 3BB5A 4ED3A 3G87A 2L08A 5C24A 5A8RA 2HWHA 2VG7B 2XLIA 3DOMA 4RJVA 5AJ3F 4RW6B 2LECA 1YI2S 2YKMB 3OUYA 1EP4B 2HGMA 2RQCA 1KSPA 5E7OB 1JLBB 1WTFA 4N8OA 1X0FA 4LJMA 2QN6B 2FLPA 1PCAA 4WYLA 2LMIA 2E5GA 2MDAA 5ETPA 3QT6A 2NREA 3K7RA 4J9VA 4G65A 1Q82T 4NLXA 1X9SA 2NQPA 4YHHF 2DHHA 4C2MA 1GMVA 1JLFA 1GH8A 1ZM9A 4O3QA 2AJ4A 1CS4B 4CLZA 1E6YB 2DNZA 3IWLA 3VVTA 3POTA 4X84A 2DR5A 1WI8A 1I1GA 3UDVA 2GVDA 3JTOA 1U4BA 4A8KA 2PN6A 3LGMA 3EGWB 4I7FA 3MMBA 3FCHA 4JUZA 4WE1B 5F41A 1EETA 3U7JA 2SXLA 2ZZMA 3KMSA 2IAJA 1NPRA 2C3YA 4AQYJ 1GMWD 1Q79A 2F40A 1Y7PA 2YQ1A 3H4BA 3HD1A 4OYAA 5HLFA 3D4JA 1F3FA 2GS8A 2HFZA 1S9GA 3GP9A 4CLLA 2A6OA 2PFDA 2IY5B 1IQZA 3TEHB 3I32A 3T6BA 4A8YA 4OJ3A 3O6QA 4A47A 4ZCIA 4CI0B 1RHJB 3LWMA 2CZ4A 2E1RA 5KFAA 2VQFJ 2IDLA 7FD1A 3MURP 4LQ3A 1YVFA 1QJHA 4X4OA 1VQ4S 4R25A 2UVUA 2YTCA 4FXVA 1JJ2R 1FKPA 2PO4A 4ENOA 3NKYA 3M1VB 4FDFA 4C9DA 4MKYA 3ETMA 5FIIA 4PAAA 4NCGA 1FJEB 4M1KA 3M2UB 4C6AA 3PKYA 4LR7A 2XS2A 2EWHA 3MECA 3DRRB 4URQU 3SCIE 3J7A1 1FD2A 4X4TA 3MUVP 1CVJA 1PKUA 2FLLA 4N7TA 5ADZA 3LP2B 3MAAB 2RDDA 2CG4A 3FFIA 2VDHA 4F25A 2GJ2A 4OI1A 4HHHA 4CT8A 2WVCA 5I3QA 4O0IA 3L3CA 3TUIC 5KFBA 5J2QA 4ED4A 2WBRA 3ENVA 2Y1IA 3PVXA 3AQOA 4I2PA 4OI3A 2ZITA 2DNHA 3HT3A 5A8WA 1FRMA 1PIEA 1LW0A 3MD1A 2DVIA 2WVDA 4OYXA 1JK9B 4KAIA 2KXNB 3O2IA 4ER8A 1V3ZA 2KHCA 4WZMA 2AJ2A 2LQBA 2DCUB 2RRNA 5KG5A 5CYJA 1FHTA 2IMOA 2N82B 1UW9A 1PILA 3OV7A 4IUFA 2ILYA 3DM2A 4ZVQB 1S1TB 1JQGA 1R43A 2VFSA 5LM7E 4ZVPB 1RXOB 1Z2LA 4OI4A 4AQYF 2DB1A 2M7SA 3TUJC 2IRXA 5J1EA 3C6UA 2LXIA 3HPOA 2GA7A 2JL9A 3DRYA 3VAGA 2XMMA 3IAS9 3RTVA 2XNRA 1YG0A 4GKKJ 1R0AB 3AD9C 3F41A 4RW7A 1UKUA 1XR5A 1YITS 2XI3A 3BN7A 4ED1A 2Z2YB 4MIAA 4NA2A 2J6SA 3JSRA 1RISA 2VQFF 1X4EA 2XZTB 2ZD1A 3WIUA 2GO9A 2OPQB 2N3OA 1LK7A 3K57A 3UW1A 5DGAA 3ZTOA 2XYHB 3W5ZA 4WPAA 2WONA 4YUDA 3W64A 2DGOA 1L3SA 2YPYA 2L9WA 3RAXA 1ACMB 5ETKA 2QMXA 4RZRA 1F6TA 2C2MB 4NL5A 3K5MA 5DM7Q 4B3SJ 2NXUA 2OTJS 5ETRA 4EBEA 2LCWA 2BJ7A 3HFVA 1CJUB 2K1RA 3GIIA 1QE1B 4USJC 3AJDA 3ZZUA 1HQEA 1OY8A 1SH0A 2OFHX 4FKXA 2VA3A 3U02A 2J7UA 1DQ9A 1NRKA 4P74A 1XQIA 2Y3YA 2ZDOA 3ILLA 1R8PA 2W4CA 3EDQB 4DL3A 2V8VA 2CUYA 2AEMA 3MM9B 1RKJA 2GMJA 4L3KA 2MZ1A 5DRKA 3WZ0A 3WX8A 3T5LA 5GAEI 2R7XA 3S8SA 2FLOA 2DNQA 3C15B 4ZPDA 2GGPB 5HVGA 2GMLA 4IFYB 4DR2J 4WBFA 3BPSP 2YNHB 1U2CA 2VG5B 1IN0A 3KG0A 1B7FA 2PDAA 4BC9A 2FZKB 5F8JA 4DV3J 5KOXA 4DG1A 3SI8A 2HS0A 3H20A 2FHJD 3EUNA 3ET6A 1U1LA 4ZVFA 5F8LA 1ZBTA 2B5JA 1HQUA 3BDPA 3B54A 4IRKA 2QSFA 1VK3A 4CLTA 3L95X 4EI2A 1T9VA 2FJBB 1S9EB 1T7PA 4DSKA 2MLXA 4B9LA 3UVJA 4OZ0A 3DNCA 1WKJA 2ZHAA 3PW7A
chains in the Genus database with same CATH topology
2VZ8A 2C2NA 2UV8G 3IM8A 3PTWA 3R97A 3TZWA 2PFFB 5CZCA 3TQEA 1NM2A 3CJ8A 2VZ9A 4RR5A 3RGIA 2JFKA 5CZDA 3K89A 2G2ZA 2G1HA 2QC3A 2HG4A 3H0PA 2H1YA 3SBMA 3HMJG 5DZ7A 5DZ6A 3QATA 3HHDA 2G2YA 2G2OA 3R8YA 3IM9A 2QO3A 3TZYA 3HJVA 2CUYA 4RL1A 3TZXA 4QBUA 2VKZG 3BV8A 3G87A 3TZZA 2JFDA 2QJ3A 1MLAA 3EZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZ8 A;  2C2N A;  2UV8 G;  3IM8 A;  3PTW A;  3R97 A;  3TZW A;  2PFF B;  5CZC A;  3TQE A;  1NM2 A;  3CJ8 A;  2VZ9 A;  4RR5 A;  3RGI A;  2JFK A;  5CZD A;  3K89 A;  2G2Z A;  2G1H A;  2QC3 A;  2HG4 A;  3H0P A;  2H1Y A;  3SBM A;  3HMJ G;  5DZ7 A;  5DZ6 A;  3QAT A;  3HHD A;  2G2Y A;  2G2O A;  3R8Y A;  3IM9 A;  2QO3 A;  3TZY A;  3HJV A;  2CUY A;  4RL1 A;  3TZX A;  4QBU A;  2VKZ G;  3BV8 A;  3G87 A;  3TZZ A;  2JFD A;  2QJ3 A;  1MLA A;  3EZO A; 
#chains in the Genus database with same CATH topology
 3AQP A;  1NK4 A;  3BO3 A;  2VQE J;  4YS2 A;  4XIU A;  1P1T A;  2YNG B;  1LXJ A;  2VU5 A;  4EBD A;  4FS1 A;  4ZJO A;  2JLF A;  3BKT A;  3A12 A;  4YB7 A;  2OFG X;  1YX2 A;  3ENW A;  2W24 A;  3AY0 A;  3TZX A;  3QO9 B;  1C2P A;  1CG2 A;  1ZET A;  1TZ0 A;  5F8N A;  2KXH A;  4DV2 F;  2N7Y A;  3U1N A;  1JMT A;  3FMB A;  5DZ6 A;  4DR6 J;  1U47 A;  2AP6 A;  1RHK B;  2FC8 A;  2ZKT A;  3EXY A;  2W9B A;  2M3D A;  4DL6 A;  3WQP A;  2J9D A;  3V81 B;  3KK2 A;  2VOD A;  5RUB A;  1LWC A;  3CMQ A;  4Y34 A;  3MTK A;  4CO5 A;  3TW0 A;  1NLK L;  5C7P A;  1RAC B;  1X4A A;  1RWU A;  1U25 A;  3M8Q B;  4WK3 A;  1QAY A;  5EX3 A;  1VIO A;  2PD1 A;  2OLW A;  3CDE A;  1UVM A;  3F44 A;  1LWX A;  5L1L A;  3M8W A;  1DAR A;  1U0H A;  3TZY A;  1U6Z A;  2J0X A;  3GSI A;  4P71 A;  1I6J A;  1TAU A;  2UU9 J;  4QIF A;  4DV4 J;  3DRS A;  1L3V A;  2G0I A;  4C98 A;  4DR2 F;  1BQN B;  2V50 A;  1C1B B;  3FNN A;  2AGO A;  2ZBR A;  3E01 A;  1VBK A;  2WVF A;  1RTZ A;  2POK A;  4CQ1 A;  5KFP A;  3ZZY A;  5HP1 B;  1MMD A;  2HFV A;  2W25 A;  1FT8 A;  2BAN B;  4ZLJ A;  2DIV A;  1A0O B;  3M8Y A;  3MFI A;  1T9Y A;  1UTA A;  1YGY A;  1FER A;  1KFS A;  5KFW A;  4NLO A;  3M9O B;  3EGZ A;  4CLY A;  1EKR A;  4UY8 T;  4AMP A;  4IDK A;  4YR3 A;  1BHN A;  4JI5 F;  3ISN D;  4DR7 J;  2DTJ A;  1IVZ A;  3D6T B;  2F7V A;  3OFG A;  5F3T A;  5HMW A;  2F5G A;  3HZG A;  5LXR A;  3KUH A;  2YQ0 A;  5KG1 A;  2AJ1 A;  2P6T A;  1T11 A;  4KO0 B;  4QPX A;  4LR9 A;  4TU8 A;  2VQE F;  1H2U X;  4NEY A;  2YNI A;  3LOU A;  2C3M A;  3H5U A;  1FNM A;  1VDH A;  3OXL A;  2MLZ A;  2XWY A;  4DQP A;  4W92 B;  2GV1 A;  2OUG A;  4OHW A;  3I0S B;  4TU7 A;  3CUL A;  2BEF A;  4J9S A;  1A6L A;  1RT7 A;  1FKA F;  1E6V B;  4QR2 A;  4MK9 A;  4PWD B;  1T05 A;  4O3N A;  4PG8 A;  3EZ5 A;  3KG1 A;  1UAW A;  4Z7C A;  3UCU P;  3MEG A;  4CYU B;  4OX6 A;  5JXS A;  2YVS A;  1HYS B;  2E9R X;  1C0U A;  1JXV A;  2UZA A;  1G7C B;  2HIY A;  2VB6 A;  3IBF B;  2HHP A;  2ZBC A;  3H5S A;  3PRB A;  2CNK B;  5HSP A;  4HDG A;  3GR0 A;  3TVY A;  3C66 A;  5K14 A;  1N56 A;  2HQI A;  4YME A;  4MTP A;  1VQP S;  4DU7 A;  2J8S A;  1H2T Z;  2F65 A;  3J7A N;  1CSJ A;  1T95 A;  1RAB B;  5LJ5 Y;  4EFA C;  1IKY A;  4RNH A;  4Q45 A;  2XSJ A;  3PO5 A;  3K5P A;  1RTJ A;  3N5F A;  1AW0 A;  1OJ4 A;  4OYI A;  3T1Y F;  3IN5 A;  4QYR A;  4NZ0 A;  4AXJ A;  3KLI B;  3J7Z T;  3TWZ A;  1DTQ A;  3TVZ A;  1QSY A;  2DBB A;  3FQL A;  3MED A;  2ALY B;  3MCM A;  3PCO B;  4E2F B;  3IWN C;  3BO2 A;  3AOA A;  2MKH A;  5J2M B;  3DMJ A;  4ECQ A;  4RLE A;  1TK5 A;  1SQG A;  4BCA A;  2V8P A;  4OV1 A;  3TNV A;  3W2W A;  1TKX A;  1S9F A;  1DRZ A;  2W9C A;  1F3V A;  2BQ3 A;  4F50 A;  4USH A;  2HBQ B;  4DR7 F;  2VJU A;  1S6P B;  5ITH A;  1S1X B;  2A3J A;  3GIM A;  1OQ6 A;  5KFN A;  2B8P A;  3LP0 A;  3P96 A;  3OL7 A;  3THT A;  3DDN A;  1UWA A;  4PKD B;  1UEV A;  3TAN A;  4PEO A;  1OPZ A;  4BLG A;  2NXE A;  3KLG A;  4DR4 J;  2DNM A;  2BM0 A;  1EKS A;  3W1Y C;  1XBW A;  4I2Q A;  3IGN A;  5KFQ A;  2OHD A;  2BW2 A;  1UVI A;  5B0A A;  4LSN B;  3QIP A;  2RSQ A;  3OLB A;  2ZHO A;  1C0T A;  4C4W A;  2HZA A;  3F0N A;  1RWN B;  3V2U C;  4ATN A;  1J5E J;  3OVA A;  4NLU A;  4GRS A;  4OYM A;  1WC4 A;  3D68 A;  3KUG A;  3TA2 A;  4JI7 F;  3K59 A;  4ZVS B;  5KFM A;  1KLM A;  3GG1 A;  2YWG A;  3RYL A;  5CCL A;  4NZ6 A;  3R5D A;  4U7U K;  2DK2 A;  1Z1Z A;  4ZLL A;  1IKV B;  1Q0N A;  3MEE A;  4ES2 A;  3I4H X;  4MKA A;  4NE9 C;  2IFX A;  2KL8 A;  2HLT A;  3TJ8 A;  1SL1 A;  2XS7 A;  1FCA A;  5LSL A;  5LJ3 Y;  4OYB A;  4C7Q A;  3Q2T C;  1F2H A;  4R8U B;  4DFM A;  2Z2M A;  2J8A A;  1RCO B;  2IJN A;  3W2V B;  2GHV C;  3CDW A;  3TRG A;  3HD2 A;  3C19 A;  1T3O A;  3QFW A;  2HZC A;  2KB2 A;  4B9U A;  4ZPT R;  5CQG A;  3KLE A;  3QJJ A;  4UUX A;  1YJR A;  2ATL A;  1S99 A;  4FYV B;  2IM2 A;  3GCX P;  2HIQ A;  2XLJ A;  4AT1 B;  9ATC B;  1JNR B;  1JLG A;  3N9U C;  4RW4 B;  1U1M A;  4DEZ A;  1IJE B;  3PYG A;  4USV A;  4F02 A;  2C2N A;  5G0R B;  5KFX A;  2DHX A;  3T5H A;  4M5G A;  1LXN A;  1ARO P;  5IM0 A;  1U7L A;  2OSQ A;  3V5R A;  4IG0 B;  1VFJ A;  2YNF B;  4ERD A;  2ASD A;  1X31 C;  2I5J A;  4P2M A;  1FFW B;  2G1D A;  1UPM B;  2FHO B;  1L3T A;  2BJ1 A;  4PXD A;  1EQM A;  4ZA1 A;  3VAI A;  1SJR A;  2ALZ A;  2Y1J A;  3G71 S;  1U2F A;  3IAM 9;  4I67 A;  5H9E K;  4DR4 F;  2C42 A;  2BQU A;  4ZVR B;  4LF6 F;  1FI4 A;  1N4L A;  4A8S A;  5CCM A;  4TU9 A;  1PJ6 A;  2ZBP A;  1HWJ A;  5C25 B;  2CAD A;  4CO2 A;  2ZE2 A;  4S0M A;  1VQ5 S;  1J5E F;  1BY9 A;  4F4W A;  5F9L A;  1HA1 A;  1YRX A;  1DBD A;  2QZ8 A;  3UWT A;  3N5B A;  1HWL A;  3IRX A;  1QTM A;  2MYF A;  3DOK A;  1HNX F;  2D3Z A;  1SQE A;  2GCF A;  1XMB A;  3M9N B;  1L3K A;  4WK1 A;  2XBP A;  1K8A T;  2DEJ A;  2ZH5 A;  4FS2 A;  5T14 A;  2ZUA A;  4BHQ A;  2DEI A;  2KT3 A;  3BKU A;  1FES A;  3R7B B;  1IBL J;  3A8K A;  4J9M A;  2CPH A;  2FJX A;  4NXM J;  2VZ9 A;  1S1U A;  2QLB B;  3W5Y A;  1Q8I A;  5JVG Q;  1LEO A;  4FYX B;  2RH3 A;  3DDI A;  3DI6 A;  5LMN F;  3HVW A;  1GXU A;  2CDQ A;  2V0N A;  4OYO A;  5AXM A;  3H40 A;  1S48 A;  5KFY A;  2XMU A;  2LEA A;  2HNZ A;  1X5O A;  1HBU A;  1K0T A;  3QID A;  5HAO A;  2W4P A;  4PPZ A;  1YJV A;  3V6K A;  2MHN A;  4ZPB A;  2DGV A;  3CD7 A;  2MST A;  1S79 A;  4RW8 B;  4Q0B B;  2MKS A;  5CZD A;  2HHU A;  2GVZ B;  4WP9 A;  3G6E S;  1H74 A;  4CLK A;  3J7Z 5;  2RUS A;  1TUV A;  3QQC D;  2AV5 A;  1B70 B;  3CIM A;  2WVE A;  1RYR A;  1NDC A;  1NSP A;  2B9W A;  1FKO A;  4IKA A;  5JMN A;  4YR0 A;  2OMO A;  3CDA A;  2IPO B;  4TVA B;  3UNY A;  3M8P A;  2VDI A;  3G86 A;  4PG4 A;  2HQG A;  5K20 B;  2OD6 A;  1GAO A;  2W2Q P;  5BYS A;  2BBE A;  2O66 A;  1RAH B;  2PGC A;  4YB5 A;  4LF8 J;  5KG3 A;  3GE9 A;  2KN4 A;  1WC0 A;  1RT3 B;  4MFB A;  3KK3 A;  4RBT A;  1CUL B;  4W90 B;  3VGV A;  5IZH A;  2ZVS A;  3KDO A;  2RKI B;  1WWH A;  1WAC A;  4OZN A;  1RTI A;  1VR6 A;  2RRA A;  1SV5 A;  3LW5 C;  2CWK A;  1G6B A;  4WFB Q;  2MZR A;  3OTO J;  2FJA B;  3PX6 A;  2RDI A;  4X4N A;  2Y0S D;  4F3M A;  4NOH A;  4JBC A;  4Y65 A;  3RAM A;  3HMJ G;  1RI7 A;  4DX8 H;  1JJC B;  2GIQ A;  3OXG A;  5L9X A;  2IMW P;  4NA3 A;  2HHV A;  5DJB A;  4KV8 B;  4DLG A;  3RR7 A;  4ZVO B;  1DQ8 A;  5KFV A;  4NXM F;  5L38 A;  1WNE A;  4X4S A;  4B9N A;  3A8E A;  4KT0 C;  2YWH A;  3JS9 A;  3HHK A;  4URG A;  2LQ5 A;  3OD2 A;  4PZV A;  3RB4 A;  3NAI A;  2ZZN A;  4CZC A;  3TR5 A;  1HPZ B;  1DQA A;  1OO0 B;  1AB8 A;  3MM6 B;  1NK0 A;  2P6S A;  3MM8 A;  2DNY A;  3HKZ D;  1JKH A;  2HWI A;  3KJQ B;  4QWE A;  4OYW A;  1V5V A;  1OS5 A;  3GIK A;  1CJK B;  2AGQ A;  3MCN A;  2HLU A;  1RA6 A;  2YH0 A;  3Q2S C;  3I6P A;  2HHX A;  2DJW A;  4ECZ A;  2C2O B;  4X4V A;  3JSM A;  2G0C A;  1TUW A;  3W8G A;  2K8G A;  2R7O A;  4HI2 A;  2KXF A;  1FRL A;  2HHT A;  3GZ7 A;  4ED6 A;  4WXW A;  4L74 A;  3AFG A;  3OL6 A;  4BWM A;  4CO3 A;  2RT3 A;  1B3T A;  3D3B J;  4PQU A;  4V19 J;  3DXS X;  1RK8 A;  3G8S A;  1T8E A;  4DJB A;  3NGK A;  4DXL A;  4LT6 A;  1G1X A;  2L9N A;  4ILM A;  2NXC A;  5D15 A;  4DDF A;  1XNQ J;  3UI3 A;  5IFM A;  2E1A A;  2BJD A;  5EHH A;  4B3R J;  3H25 A;  3VCD A;  4LF8 F;  1T9U A;  3RB6 A;  5ETN A;  1TL3 B;  4RUA A;  3Q86 A;  4MK8 A;  2MMY A;  2FJD B;  1PYT A;  3CJ4 A;  1WDT A;  3GIL A;  5KFT A;  1IBK F;  1T03 B;  3MR6 A;  2F9J A;  2ZOG A;  3OTO F;  2CPD A;  4FF2 A;  1VRU A;  2Y8W A;  5CH7 B;  3DYA A;  5J1P A;  2CNO B;  1KFD A;  4DHV A;  1AUS L;  3JYT B;  4RX6 A;  3OW2 R;  2JOQ A;  3PHT A;  1VRT B;  2DNL A;  4KIA A;  2NCK L;  1Q16 B;  1FTC A;  3MHY A;  4KKO A;  2FHK A;  2XUL A;  1BGX T;  5E33 A;  3DU6 A;  4G1P A;  5KTQ A;  4FVC A;  1KC8 T;  4FP9 A;  3FBF A;  1XIQ A;  2V2V A;  4XPE A;  3Q8R B;  4UUW A;  2RU9 A;  3UNG C;  1SJQ A;  4Q8E A;  4C8K A;  3M2V A;  1M1H A;  4HTI A;  4YB1 P;  2KYZ A;  3FMW A;  3QNW B;  2V5H G;  1HW8 A;  2MZT A;  1PO6 A;  4KSE B;  3HZE A;  1ZAV A;  2KRB A;  1FE4 A;  3PZP A;  3CT9 A;  2DR6 A;  2ZVI A;  1X4D A;  2FB0 A;  2FD2 A;  3K0J A;  1XMO J;  1R6Y A;  4ED0 A;  4WFA Q;  3ILJ A;  1EAY C;  5DLG A;  2V4Q A;  2I2Y A;  2EFP A;  2VG6 B;  3V4M A;  4DBQ A;  5DDQ C;  3NCQ A;  3V4I B;  1HBN A;  4NEZ A;  1MWQ A;  3CJ3 A;  1M1G A;  1RT4 B;  4OJH A;  4PYA A;  2AEF A;  1APS A;  4C3K A;  1TKZ B;  5DO2 A;  1UJ5 A;  2JHE A;  4DPX A;  2G4B A;  6FD1 A;  4AMO A;  1U2R A;  2MKK A;  2LXU A;  1S6U A;  4ZHR A;  1V3S A;  2VHG A;  3K17 A;  2CQP A;  4MKV A;  1QLN A;  2KRR A;  5E3A A;  5KFO A;  3P5T L;  3QGH A;  1X9W A;  5A8K B;  2DGQ A;  3B4D A;  1S97 A;  3OL8 A;  3CJ8 A;  1JLQ B;  3S7R A;  4OIX A;  3R1H A;  3HSG A;  4PG5 A;  2OPP B;  3KJV A;  1RAO A;  4QR1 A;  2DY1 A;  4NCB A;  2RU3 A;  1M5H A;  1KTV A;  2BM1 A;  1HHQ A;  4LF7 J;  3WIV A;  2C2K B;  1H7X A;  2CQ0 A;  1R31 A;  3CUN A;  5C42 A;  2B9X A;  4LF2 A;  5E0O A;  4YP3 A;  4UST A;  3RRK A;  2QV6 A;  3DGP A;  3G82 B;  5IV4 A;  2X1G A;  4N76 A;  2JC0 A;  1LNQ A;  1KNZ A;  3AXM A;  1VK8 A;  1MRO A;  1RHR B;  3DHX A;  1RHQ B;  3GIJ A;  4LIR A;  1HNI A;  1Y00 A;  3J81 U;  2AX0 A;  4DUY J;  3L9Z A;  4NLQ A;  1UZH A;  4HAC B;  1LOU A;  5LSR A;  2DR9 A;  3EVM A;  4U67 Q;  2UVV A;  2M70 A;  3HFZ B;  5HO4 A;  4PWU A;  1SH3 A;  2F3J A;  2V34 A;  3AB2 B;  2HRU A;  2CFX A;  2E29 A;  2OJ3 A;  3VAH A;  1Q8K A;  4M94 A;  2I6W A;  2ZH4 A;  1XMO F;  2V67 A;  2IA6 A;  4X62 J;  4ECX A;  3CPW R;  3V6D B;  2LP4 A;  3ZTR A;  2V2Z A;  1VS3 A;  2AU0 A;  2CQ3 A;  1TP7 A;  1Q8L A;  4PCQ A;  2ZM6 F;  3MDF A;  4M5I A;  3B78 A;  4N41 A;  1RU2 A;  5KT4 A;  3A3N B;  2BR0 A;  4WP3 A;  3W65 A;  5HVH A;  2AJF E;  2QYG A;  2LVW A;  3QPI A;  2B7B B;  1U1P A;  4UZC A;  3TA1 A;  1RAG B;  2R7T A;  1MLA A;  4WFX A;  3SMZ A;  4A8X A;  4OX8 A;  2KO1 A;  1WSR A;  3Q83 A;  4LQ9 A;  5KFU A;  3VWS A;  1D8Y A;  3H8Y A;  4P2X A;  2V63 A;  3M32 B;  3GJS B;  9RUB A;  1BQX A;  4KHP J;  3RBX A;  3AOD A;  2N3L A;  3FBC A;  2IA0 A;  4ZN3 A;  5F0W A;  4P52 A;  1VBY A;  2B51 A;  2UUC J;  2QEX S;  3NRB A;  1SJ1 A;  1XER A;  4CM0 A;  3QRR A;  1RWW B;  2MSS A;  1LFW A;  4EEY A;  2VFU A;  3W5X A;  3TZZ A;  2UV8 A;  3J7Y I;  2EW9 A;  1SKW A;  1OIA A;  1SI9 A;  4DL5 A;  5BYQ A;  3NMR A;  3MM7 A;  4ELU A;  4G3I A;  3FEY B;  2VJV A;  1OY9 A;  2CYY A;  2PI5 A;  1HBM A;  3QLH A;  3OTB A;  3DOL B;  5D3G B;  4K4Y A;  1IM4 A;  2UVW A;  2ZH9 A;  1VMB A;  2XZW A;  5HBM B;  1YBT A;  3I0R A;  2YKQ A;  4ZPW R;  4Y00 A;  2Y9H A;  2HS3 A;  3ICL A;  3BH7 B;  3A3P B;  3MMJ A;  4NLT A;  1SIZ A;  1PC5 A;  1U09 A;  3OPK A;  4X4R A;  1DZ5 A;  3PR4 A;  1FX4 A;  1URR A;  3KUE A;  2JEF A;  1Q78 A;  4NLR A;  3IR5 B;  4DCO B;  2PI4 A;  3VGU A;  1NND A;  1ZTW A;  2RE1 A;  1NJW A;  4JV5 F;  1XMQ J;  4DOZ A;  1MNE A;  4DL0 C;  1QAX A;  4X62 F;  2ZFH A;  2AZ3 A;  1J2V A;  3ZZO A;  2DNK A;  3H42 A;  5C24 B;  2DNO A;  5A8R B;  1W25 A;  5KFI A;  3QFH A;  3DOM B;  3KG4 A;  1Y11 A;  3OUY B;  3EJM A;  4F8R A;  4FXW A;  4JI3 J;  3NP5 A;  4JI2 F;  2D3O 1;  4DUZ J;  1HIY A;  1GT8 A;  3D1H A;  1Q7Y T;  4QR0 A;  1QSS A;  2XCP A;  2CNN B;  4KE5 A;  2AYM A;  3KYL A;  4OI6 A;  3QWU A;  2XZD B;  2BX6 A;  3MOZ A;  1JLF B;  4PG6 A;  4LUB A;  3MD3 A;  2DNN A;  4ILR A;  3VV2 B;  5K8N A;  1WC3 A;  4KQZ A;  1UZD A;  3DLK A;  2HNY A;  2GQQ A;  2UUC F;  2AHO B;  4IR1 A;  3POT B;  3CCU S;  4HT5 A;  3C14 A;  3WX4 A;  1VOM A;  1R27 B;  2GVD B;  4C8M A;  4LMZ A;  2C2E A;  2DCL A;  2MQ8 A;  1AZS A;  4I7F B;  3MMB B;  1TL1 A;  1EET B;  5EN1 A;  1SJ4 P;  2IAJ B;  2LFV A;  2J7K A;  2UXD F;  1KOO A;  1X4H A;  2V8H A;  4B3M J;  5E5N A;  4D3G A;  2VBY A;  2XMA A;  1HWU A;  5HLF B;  1VI7 A;  3HHL A;  2FIU A;  1TL7 A;  1N5Q A;  2CNL B;  3G4S S;  1S5Z A;  1ZTT A;  5KG2 A;  1S9G B;  4DFK A;  1F0X A;  1YDL A;  1TV6 A;  2ZEJ A;  1D9F A;  2YX4 A;  1C1C A;  2B6A A;  1WI6 A;  3Q8Y A;  4FYD A;  3BO4 A;  4CWB A;  4MMO A;  1URN A;  4RO0 A;  2EKY A;  3J80 U;  4OYZ A;  3M2R A;  2P9C A;  3EWG A;  3RBE A;  3I5A A;  2AIR B;  4GVB A;  3DLH A;  1UJ6 A;  4QPT A;  4H4M A;  1FKP B;  3UN2 A;  3VTI A;  1P6T A;  1XMQ F;  3C3L A;  1HNZ J;  3P3D A;  3CO9 A;  2YX1 A;  4RWX A;  3NS5 A;  1Q53 A;  3AA9 A;  4NXN J;  4NCG B;  4OV6 A;  2B9E A;  4IYQ A;  3OTD A;  3MEC B;  3NCR A;  4UOC A;  3BYR A;  1N5Y A;  1KS2 A;  3CIZ A;  3H0P A;  2DXD A;  2CPF A;  4QIV A;  1CBK A;  1IKX A;  4DR5 F;  1B4S A;  4C8L A;  3FFI B;  2CQ2 A;  2KTQ A;  3D3C J;  1N5T A;  4LF1 A;  3D9B A;  3LGH A;  3ILO A;  5J2Q B;  3NWG A;  1QD1 A;  4I2P B;  3CGI A;  4QBU A;  5A8W B;  4TQS A;  1U45 A;  1KVK A;  2OAU A;  1LW0 B;  4G1Q A;  3P4U B;  2PE8 A;  1UVL A;  3DN9 A;  1RE1 B;  4IR9 A;  3QJL A;  5M2U A;  2K7K A;  3VQS A;  3HVR A;  2DGS A;  4RBU A;  2XY6 A;  2H4Y B;  4E98 A;  1IR0 A;  1RHM B;  2HHH J;  3DM2 B;  1GK8 A;  2CG8 A;  3Q89 A;  3RRH A;  2QA1 A;  1PJ7 A;  2L9D A;  4NML A;  1JLC A;  3CSK A;  1HNW J;  1CC7 A;  1FWP A;  4NYZ A;  3H2U B;  3RG6 A;  4TY9 A;  3V6H A;  2CJY B;  4B3M F;  4ID8 A;  3BGL A;  5J1E B;  3LAM A;  3C6U B;  1GXT A;  3L09 A;  4FNH A;  5LSO A;  1R0B G;  4KGV B;  2XHC A;  1OPI A;  3MPU B;  1JJH A;  1O8B A;  4RW7 B;  3JTN A;  3MMA A;  2NS1 B;  2NSB A;  3Q8Q B;  4H54 A;  2CJB A;  5ETQ A;  4ZP7 A;  3THV A;  2O67 A;  1HL6 A;  4A48 A;  5KT3 A;  3ILI A;  2UUW A;  3NGD A;  3NBP A;  4ZP9 A;  2DNP A;  4K8R A;  3F73 A;  2COL A;  1X4F A;  2D9P A;  2ZD1 B;  1NZ8 A;  4LFC F;  1GFW B;  5IOL A;  5T41 A;  1TTH B;  1FFS B;  1TVR A;  1QY7 A;  3BSO A;  4E8U A;  3HX9 A;  3K8W A;  2WON B;  1S4F A;  4J90 A;  3IBC B;  4KGK A;  4NXN F;  6AT1 B;  3IS9 A;  2XG8 A;  4DV0 J;  1IQT A;  2UXB F;  1VC5 A;  2XY7 A;  3MPD A;  5H9E J;  2G9O A;  1YHQ S;  2ACM A;  2W4D A;  1JLE A;  1NK6 A;  2K1R B;  4HDH A;  2FJV A;  5KFK A;  3DLG A;  3ADA C;  1YQH A;  2G0J A;  1HHS A;  1IR2 A;  1HQE B;  1NSA A;  1OYD A;  1OMS A;  2GHW A;  2JDJ A;  2HSE B;  2OH2 A;  1ULR A;  3HVA A;  5L1J A;  1RWM B;  4Q7A A;  2W7P A;  3L7O A;  4QJV A;  4HI1 A;  2WAQ D;  2Z30 B;  5IQ6 A;  2LA4 A;  2DRB A;  1ZH5 A;  2C22 A;  1KQF B;  1K0V A;  2AYB A;  2HBY B;  2OKQ A;  2E7X A;  4L75 A;  3SQG A;  2OPR A;  4KR0 B;  2ROG A;  3UCG A;  3W9J A;  1RTH A;  1RUS A;  2XNQ A;  2HHH F;  3HJV A;  3TX8 A;  1EZZ B;  3KNA A;  4IOB A;  1HNW F;  5IC6 B;  2KVI A;  4QZV B;  3M7V A;  3TP2 A;  2QMW A;  3G8T A;  3D2W A;  2X3G A;  4DG1 B;  4DR1 J;  4K2J A;  2HVZ A;  4E0D A;  2CPZ A;  3ET6 B;  4NLY A;  1V3R A;  3T41 A;  3CC7 S;  4WCE Q;  2B5J B;  1HQU B;  2MQN A;  1S10 A;  2XGP A;  2HFN A;  5BJR A;  3BZQ A;  3PW5 A;  2L41 A;  1ZAX A;  3EGV A;  4YR2 A;  4ZLP A;  5F8G A;  4M8L A;  3CCR S;  2XTJ P;  3UVJ B;  2BDP A;  3W62 A;  4LF9 F;  4C0B A;  2W2N P;  3UQS A;  1HMV A;  1YRT A;  2U1A A;  1SBR A;  8AT1 B;  3T9Z A;  1NXI A;  1IM6 A;  4RPF A;  2GQ2 A;  1N5S A;  1PG5 B;  4DV0 F;  4B02 A;  3NCP A;  1TKT A;  2D41 A;  2UV8 G;  1CPZ A;  5AJ3 J;  3TQE A;  1SPB P;  2XWX A;  4I0W A;  1UA1 A;  2W9B B;  4MIB A;  4C0O C;  2W01 A;  3KK2 B;  1B64 A;  4ZKA A;  1LV5 A;  1LWC B;  1S12 A;  3WBZ A;  4DN0 A;  2DY9 A;  2LDY A;  4KH0 B;  2VC0 A;  4LVO P;  3PFE A;  1O51 A;  1XTZ A;  4OQJ A;  4YHH J;  1S6Q A;  5L46 A;  1W7W A;  2DH8 A;  1V6H A;  1U0H B;  3DCA A;  1N6Q A;  2BUN A;  2HPU A;  3MAH A;  2HGN A;  1UMJ A;  4AUK A;  2C1E B;  3DRS B;  1D8Z A;  2RQ4 A;  4L3N A;  3SEO A;  1VQO S;  3M4X A;  3E01 B;  3CD0 A;  3D1Q A;  4EWT A;  1NB7 A;  1N5V A;  3EIC A;  2DGX A;  1RP5 A;  2DR8 A;  3PX0 A;  1VQ6 S;  1DTT A;  3D6M B;  4ID5 A;  4JI8 J;  1RKI A;  3OHB A;  4M95 A;  4DQS A;  2AW0 A;  2J0Q D;  2W2M P;  2MJN A;  2YKA A;  5EGY A;  4MKB A;  4IDK B;  2DT9 A;  2IIH A;  4OHX A;  3KTQ A;  2MKC A;  4KGM A;  1OWX A;  2D69 A;  4OLO A;  4M63 A;  4ZS6 A;  4K4T A;  1YTY A;  4OFZ A;  3NAH A;  4QWD A;  2AJ0 A;  1VHF A;  3M6V A;  3O1L A;  2YNI B;  3UFC X;  1GX6 A;  1ZS6 A;  5ETL A;  1PSD A;  3GSD A;  3N6M A;  1HI1 A;  1S1V A;  2AEJ A;  2YY3 A;  4ZP6 A;  4WKR A;  1RT7 B;  3MCO A;  2XI2 A;  3RR8 A;  4NYP A;  1NM2 A;  3E8O A;  3LP1 A;  1T05 B;  2HMI A;  1FVS A;  5B0E A;  1IUJ A;  3ZTS A;  3MEG B;  1FJC A;  4ECU A;  1FK9 A;  4P2F A;  1YIJ S;  3DRX A;  2CJX B;  1C0U B;  2BXJ A;  4OL8 A;  3BQ0 A;  4K50 A;  1CJV A;  4RBV A;  2HZV A;  4J9O A;  5K14 B;  2P2C B;  1XC9 A;  5T7L A;  3KFW X;  3M05 A;  2X3D A;  1X4C A;  1H3D A;  2ZBQ A;  3OQ2 A;  5C2C A;  2BYC A;  4Y2I A;  1M5O C;  5KT2 A;  4Q8F A;  1HQ2 A;  1IKY B;  4H4O A;  2XSJ B;  2J5A A;  1RTJ B;  4F4A A;  1PBU A;  4YDD B;  1RB0 A;  3E2E A;  4H4K A;  3AB4 B;  2A18 A;  3GON A;  4Q43 A;  4KFB A;  4QIW D;  1DTQ B;  1U1R A;  2FHM A;  1HWI A;  3MED B;  5CAB A;  4DV1 J;  3DMJ B;  3HSZ A;  3B82 A;  3ZFV A;  4JI8 F;  4K4S A;  4IO9 Q;  2RJZ A;  3N0V A;  3OSP A;  4GO5 X;  3W2W B;  1SCJ B;  1TKX B;  5CZX A;  1RAA B;  1SKR A;  2W9C B;  2HFS A;  1JXL A;  2WZ1 A;  3CCJ S;  1WHX A;  3UCZ P;  4UW2 A;  2DRA A;  3AOB A;  4W98 A;  5HL7 Q;  1FF2 A;  2KFY A;  3LP0 B;  3I5C A;  3EGN A;  3R5B A;  2Z56 B;  2HWT A;  3KLG B;  4K2X A;  2QGF B;  4NI2 A;  4I2Q B;  4P7V A;  4NRT A;  3C2P A;  1OSC A;  2AGP A;  3QIP B;  3MMC A;  1P9Q C;  4IQX A;  2NZC A;  5LL6 d;  4WFN Q;  1C0T B;  2NPI A;  3IP0 A;  2OPS A;  2WVB A;  1KON A;  2HS4 A;  1BMQ B;  3EE3 A;  1ZM4 A;  2QL5 B;  3TAM A;  1KLM B;  5IT9 Y;  3ITH A;  4ES3 A;  3PY8 A;  4C0H A;  2MEW A;  4F4Y A;  4YB6 A;  2IVY A;  3MEE B;  1KQG B;  4FKY A;  3HSD A;  4JB8 B;  2ZKU A;  4M5M A;  3I5B A;  4WU3 A;  3CD5 A;  3CME S;  3OR2 A;  5KFL A;  1Q7L B;  4LIW A;  2KM8 B;  4F67 A;  7FDR A;  4DPT A;  5GAH I;  5KFJ A;  4WJB A;  4G6V B;  3U1L A;  1CQN A;  2JVR A;  4CO1 A;  3X3U A;  1U1N A;  5HI7 A;  3KLE B;  3CD6 S;  3N4W A;  2EK6 A;  4J9Q A;  3ULH A;  4ZVH A;  1M5K C;  3T5K A;  4FYW B;  4OLP A;  2VKZ G;  2R7W A;  2E1M C;  5GAG I;  1JLG B;  1ZPW X;  3B4M A;  2BW7 A;  3FUY A;  2ZUG A;  3UD3 P;  1FDB A;  3PRD A;  4DV1 F;  3R6G B;  3JAM Y;  4NX9 A;  2YKP A;  2EFO A;  4RWW A;  3BEG B;  2J9E A;  5IM0 B;  2YH1 A;  4DSE A;  1J5O A;  2CQ4 A;  4UTG A;  4MYT A;  3TUZ C;  5DM6 Q;  1FX2 A;  2DNR A;  4PAB A;  3MWB A;  2I5J B;  3HO1 A;  1Y4Z B;  4AXI A;  1HI8 A;  2QT7 A;  1N54 B;  4YQW A;  3KKF A;  4BS2 A;  2L48 A;  1IJF B;  4WF9 Q;  5BYR A;  1WKK A;  3QT8 A;  5HMZ A;  3LPY A;  1Y5N B;  1H6K X;  4R5P A;  2DRD A;  4WIQ A;  2DR7 A;  2ZE2 B;  3N6N A;  1FRK A;  3GV5 B;  2CQI A;  2QTW A;  2F63 A;  3MR5 A;  2FY8 A;  2EBE A;  5GAE U;  4N5S A;  1U02 A;  3CCS S;  3BRE A;  2KT5 A;  4F36 A;  2IJF A;  4DV2 J;  2R7U A;  3G6X A;  2MKJ A;  2DHS A;  3IRX B;  2KM8 C;  1TMM A;  3EVO A;  2I8E A;  2OD4 A;  4LSZ B;  2MKY A;  4AL6 A;  4DSJ A;  3DOK B;  3TAR A;  4FZV A;  3CW2 C;  4NLV A;  1DLO A;  4J91 A;  4I6W A;  3LAN A;  2JRS A;  3DC2 A;  4USK A;  3BSN A;  4LSL A;  1X5T A;  4OZ5 A;  3VAM A;  2G1H A;  4FF4 A;  1AFJ A;  7AT1 B;  3A8J A;  3KOA A;  4K4V A;  5HK4 A;  3H59 A;  4K4Z A;  3TQ1 A;  1S1U B;  2BA9 A;  4DSF A;  2H5J B;  3H98 A;  4AE5 A;  1KWM A;  3W9I A;  4QYZ K;  2QX0 A;  3DI6 B;  1S0N A;  2FY1 A;  2C3O A;  2HNZ B;  4LBI A;  2GAH C;  1HBU B;  2DIT A;  2ZJQ Q;  2DPI A;  3K5O A;  4KPC A;  1XEZ A;  2ZC3 A;  3IG1 A;  1U8S A;  3M6W A;  3CVK A;  4K5R A;  3R8Y A;  3M8R A;  1BLU A;  1NU4 A;  2AT1 B;  2A6M A;  4RL1 A;  3QT7 A;  3CCM S;  5LT5 A;  1MSW D;  3UO0 A;  4KRW A;  2W2O P;  4ES1 A;  3FZB A;  3Q8P B;  5HRO A;  4QU6 A;  2H1Y A;  3MR3 A;  1TL4 A;  4P73 A;  2IRU A;  2BRL A;  3HF5 A;  3UR0 A;  3DLE A;  4QU7 A;  3FRZ A;  4WZQ A;  2LU2 A;  2E7V A;  2RRB A;  5K8M A;  2GAG C;  1B0V A;  1NSK L;  1TL5 A;  4F4K A;  1FKO B;  3DGV A;  1NO8 A;  4JI5 J;  1ZPV A;  1MN7 A;  2D3U A;  1V5I B;  2CPI A;  1VHI A;  1HWK A;  3M8P B;  3IBW A;  4NYO A;  4DZ6 A;  3DHW C;  2PEB A;  2O01 C;  1YLX A;  2VFT A;  2E9T A;  4O0N A;  2DXF A;  4B08 A;  2MJU A;  5DDP C;  2K3I A;  2FVQ A;  2JFK A;  2GO8 A;  4Y2C A;  4MFB B;  3KK3 B;  5EX0 A;  2V4J A;  5SZT A;  4PUO A;  1RHU B;  1FNO A;  2VPY B;  2VPW B;  3OTC A;  2HHW A;  2J7W A;  2AWZ A;  1RTI B;  2VFV A;  1SV5 B;  2X1F A;  2BE2 A;  4KB7 A;  2JEJ A;  2HVD A;  1WEL A;  5H1S V;  4NMX A;  1UEU A;  2O1P A;  4KHM A;  1Y9O A;  3BGO P;  4JI6 F;  3GPA A;  3R97 A;  3DLB A;  2D9O A;  2XGQ A;  2IBK A;  2B4P A;  4Q2L A;  3OBI A;  4J7C A;  2B4O A;  4OJ1 A;  4CCH A;  3CWJ A;  4TN2 A;  5GMD A;  2B4U A;  1I3O B;  3BBB A;  2HUR A;  4M5J A;  2VKR A;  1KVI A;  2D1C A;  3H2L A;  2ZH6 A;  2CKW A;  4YFU A;  2KHD A;  3T19 A;  3JQJ A;  3PW2 A;  3MF5 A;  5GAD I;  1H73 A;  4HYK A;  3RB3 A;  1N33 J;  2VZ8 A;  5CYQ A;  1VJQ A;  1TAQ A;  2WSE C;  3MM8 B;  3VZI A;  4Z2X A;  3T1Y J;  1JKH B;  2Y1L B;  5BR8 J;  3ONQ A;  4U95 A;  5FDL A;  1JNZ B;  4CP5 A;  2IM3 A;  1PAE X;  3SFG A;  4NAS A;  1ZZF A;  3QGI A;  2V9K A;  5KT7 A;  1FVQ A;  1WF0 A;  3NOG A;  3CCV S;  4IFV A;  1PGZ A;  4USM A;  3JSM B;  2WOM A;  4EBC A;  2ZJP Q;  1FE0 A;  2HK3 A;  1VQ8 S;  3TVK A;  2CDR B;  2GJF A;  2GJI A;  1UVJ A;  3QSI A;  4FVM A;  2EG2 A;  1F60 B;  3H2V E;  5I42 A;  1JLA A;  2UXC F;  3IA0 A;  4PQU B;  1MW7 A;  4DF8 A;  3U27 A;  4X64 F;  1FTR A;  4J9N A;  4NLP A;  1S1W A;  4OHY A;  2QIF A;  4B9T A;  3KNG A;  1ZYQ A;  3R5A A;  2WCX A;  4N77 A;  4GMK A;  1FXL A;  1GMU A;  2R2T A;  4UOG A;  2O5D A;  4KYZ A;  5B09 A;  2V9W A;  4ZPA A;  3CJS A;  1N36 F;  2YXL A;  5M2R A;  4WTY A;  2KZZ A;  3I4P A;  3K89 A;  5B0D A;  2BQR A;  4IH5 A;  3AT1 B;  2J6U A;  2DNG A;  2NR0 A;  2IM0 A;  2HAI A;  1LW2 A;  1M1K T;  4ICL A;  3NXZ A;  4JI7 J;  4PQA A;  3T1A A;  2JFD A;  2EXU A;  3EZO A;  1VRU B;  4ZOS A;  3DYA B;  3DRP A;  4PPD A;  4MT1 A;  4HLB A;  2IYG A;  1MMN A;  4RU2 A;  3NS7 B;  1O5J A;  4KKO B;  1PYS B;  2V68 A;  2H9Z A;  5J2P A;  3GFH A;  2H65 B;  4Y2A A;  1H0H B;  1WHW A;  2OTL S;  5EUH A;  2YX7 A;  1AT1 B;  4DFP A;  5KG7 A;  2A1B A;  3KJF B;  4K5S A;  4ZPV R;  3M2V B;  3GYN A;  3FC9 A;  1VQY A;  5I3U A;  1EHW A;  1X5S A;  2HND A;  2PC6 A;  1N33 F;  3BGR A;  3KHL A;  1REV A;  4DSI A;  5EWF A;  5E3R A;  2NYH A;  4M5H A;  2CQG A;  1EB0 A;  5BR8 F;  1OYE A;  4IOA Q;  1W2I A;  3HDS A;  5A2Q U;  2M2B A;  3GU0 A;  3PO4 A;  3RBZ A;  2VFR A;  3MPY A;  3I56 S;  2EFN A;  4F3Q A;  3H90 A;  4LRD A;  2ASJ A;  1HBN B;  2FYX A;  2VH7 A;  5CD4 A;  4PXE A;  1QM9 A;  5C2G A;  2XQC A;  1F5C A;  5L1I A;  3FBB A;  2YQ3 A;  2XLK A;  2MGZ A;  2DO0 A;  5IS2 A;  3CTR A;  2VBZ A;  3N28 A;  1KHW A;  3GLJ A;  1WSV A;  5A0Y A;  4ZHR B;  1D0E A;  4TQR A;  4J9P A;  1RAD B;  3NG8 A;  4ZDN A;  3SSS A;  4HH1 A;  3UD5 A;  1R8A A;  1YJT A;  3R2D J;  4LF6 J;  2EVZ A;  1N0V C;  4KTQ A;  3L4B C;  5CAA A;  3KJV B;  1A7G E;  2BJ9 A;  3OXF A;  3NGU A;  1IKW A;  4OI2 A;  2ACY A;  3A3O B;  3EX7 B;  4FF3 A;  4K4X A;  3PXG a;  5HMY A;  1VCT A;  3C8Y A;  5C42 B;  2MZS A;  2EFG A;  3MM5 A;  3NLC A;  2GX8 A;  3DGP B;  1QAJ A;  4ECT A;  1IBM J;  2X51 A;  4GC7 A;  4JI4 J;  4NLG A;  1UWB A;  4Y2K A;  2MQL A;  1HNX J;  1SJF A;  4RU9 A;  1LQ9 A;  1MRO B;  1H2V Z;  2MQM A;  3D6F B;  4DX7 A;  3SCJ E;  2ZH3 A;  1HNI B;  2CQB A;  4DN9 A;  4EZ6 A;  4P6Q A;  1KR4 A;  4ZVT B;  4LRA A;  3TX0 A;  1HW9 A;  2MQP A;  2RVJ A;  1A9N B;  1CJT A;  2Q6C A;  3B6B A;  3CB4 A;  2FGO A;  2NZ4 A;  5HJY A;  3KLF A;  1AFI A;  1SUQ A;  1N52 B;  3FSY A;  5LMN J;  3CO0 P;  3IWX A;  5D6G A;  2R8K A;  3CF5 Q;  2CVE A;  1U1O A;  4UZB A;  2XS5 A;  5DDO C;  4PR6 A;  3GYG A;  3Q23 A;  1KOH A;  5MLC V;  2VUG A;  2MY8 A;  3W3S A;  3UN3 A;  1EJ7 L;  1NHK L;  1WF2 A;  1BC6 A;  1JX4 A;  3W7B A;  1SQF A;  3X1L B;  2HK2 A;  5CA5 A;  1EAR A;  4LRE A;  3GFY A;  2F4V J;  5F8M A;  5I3P A;  3VZH A;  4F4Z A;  4KC5 A;  5IT9 U;  4ECR A;  1VYA A;  1R6V A;  2AYE A;  1IWA A;  2CA9 A;  3TO8 A;  3T1H F;  5IT4 A;  4HKQ A;  1RLD A;  2J9C A;  1R8H A;  1KVJ A;  1R8B A;  2LEB A;  1PBA A;  3GG0 A;  2QG9 B;  3HFK A;  5HAT A;  1WEY A;  1WHY A;  4M5D A;  4P2S A;  2PA3 A;  3MTJ A;  4TLR A;  3BQ1 A;  2H51 B;  2F8M A;  1HR0 J;  5LXY A;  5THW A;  4X4U A;  1Z2Z A;  5F9N A;  3LUY A;  2RHS B;  1G3O A;  3AH6 A;  3TZW A;  3BGU A;  1RBL A;  3ZZR A;  1GTE A;  1F9H A;  3Q8U A;  2PA8 D;  2JH3 A;  1D9D A;  1IBM F;  3R2C J;  2N7C A;  4JI4 F;  2E66 A;  3MM7 B;  3HHE A;  2N4C A;  2RQM A;  4ED8 A;  2LA6 A;  4FNI A;  1DY3 A;  3CJ2 A;  2GIR A;  1HBM B;  1LWF A;  1FXD A;  3QLH B;  2OSR A;  4WP8 A;  2RF2 A;  4V1A k;  2AX1 A;  3JAM U;  2ZWO A;  1K44 A;  4IOC Q;  1M90 T;  2ZHB A;  4RNN A;  3I0R B;  1FEE A;  3GMG A;  1NUE A;  3C16 A;  3EPI A;  2Z2L A;  3TUP A;  4J37 A;  4ZPC A;  1AYE A;  4O23 A;  4QIG A;  3R9L A;  3R5J B;  5IWA F;  1EIY B;  1FRH A;  4XTT A;  3MEK A;  1RWP B;  2CJK A;  1CQM A;  2DH9 A;  3KLH A;  4NPO A;  4CNY A;  2IC3 A;  4CH1 A;  3PJ9 A;  2DGW A;  1RT1 A;  4J9U E;  5F0U A;  1RAF B;  3M30 A;  4RUB A;  2C3P A;  5D4L A;  3BKF A;  1AXQ A;  1RWX B;  1F1B B;  5CYM A;  3GFZ A;  4L73 A;  2XCA A;  1SVD A;  1C4A A;  3CCQ S;  2W7A A;  3RB0 A;  3QAE A;  3SXL A;  2F4V F;  3GYX B;  2AJQ A;  1KTQ A;  3KHH A;  4DS4 A;  3GCW P;  2P9G A;  3K58 A;  1XJW B;  1K9M T;  2ZH8 A;  1RGV A;  2W1B A;  3U1M A;  3PW4 A;  5U47 A;  2J9D E;  2HQC A;  2B43 A;  5DQG A;  4DFJ A;  3HHL D;  2CQH A;  4P72 A;  4CDI A;  2YWK A;  1RT2 A;  5KG6 A;  1HD0 A;  4HHJ A;  4JV2 A;  1WEZ A;  2C3U A;  1NKC A;  2Q6B A;  2JLG A;  4NZ7 A;  3VR1 A;  1NHV A;  2HQF A;  2XO6 A;  1SJ3 P;  1HR0 F;  4NCA A;  1AUD A;  2RB7 A;  4ZVE A;  1F5B A;  2QSW A;  3DLK B;  1RTD A;  1RT5 A;  2HNY B;  2RNE A;  5E3Q A;  5ETS A;  2E5L J;  4NWB A;  4OYP A;  3C14 B;  4I64 A;  1IBK J;  4LBH A;  2MQO A;  2ADB A;  4A8Q A;  1AZS B;  5L8R C;  5GME A;  2VBW A;  1TL1 B;  4USW A;  1WDD A;  3HUL A;  1ELO A;  4CM2 A;  3BM7 A;  2CVI A;  3KMQ A;  4DU8 A;  3C6T A;  3LQV A;  3HHL B;  4N8N A;  2HVE A;  3D6H B;  1TL7 B;  2MLY A;  3FZ2 A;  1TV6 B;  3R5G A;  1C1C B;  5KT6 A;  2B6A B;  2E9Z A;  3PIP Q;  2LQJ A;  4CTA A;  5FD1 A;  5B0F A;  2FGC A;  2OP5 A;  5L9N A;  5HQM A;  4HR2 A;  3O44 A;  2FQQ B;  1LWE A;  3PDN A;  3G6Y A;  5CHC B;  3M2R B;  2CJA A;  4C3M A;  2WBM A;  4J9K A;  1RT6 A;  1PYO B;  2DH7 A;  4UQG A;  4MYU A;  2HYI B;  1MU2 A;  4GVB B;  4HHU A;  1Y10 A;  3O8W A;  4H4M B;  5LMU J;  1TKD A;  4KH1 B;  4U8Y A;  1RYS A;  3P8B B;  1X4B A;  2X1B A;  3HVT A;  3W66 A;  4FYY B;  5K9F A;  4DPY A;  3UR3 C;  1N5Y B;  4ZLN A;  3OR1 A;  2XMW A;  4O4G A;  1IKX B;  2HHQ A;  5DLF A;  5DG8 A;  2E44 A;  3QSY B;  3LAK A;  2I0X A;  5MAO A;  4B3O A;  1OY6 A;  2Z8Q A;  4QIE A;  2VC1 A;  1Q5Y A;  4KPY A;  5A6W A;  4X2B A;  2K3K A;  2J76 E;  5D8H B;  3RU0 A;  1VIS A;  2Z0G A;  3MZI A;  4G1Q B;  3P5B P;  2HQ3 A;  4U6P A;  1SKU B;  3BSA A;  1HBO A;  5J2N A;  1ZOT A;  1RWK B;  5GMK a;  3RW7 A;  1T02 A;  4DX6 A;  5KFC A;  2B8Q A;  2WB1 D;  2E5L F;  2ROP A;  2XMT A;  4PG7 A;  4QWA A;  2VBX A;  3ZNJ 1;  3HHL C;  2CRL A;  1ZA1 B;  4USI A;  5CXT A;  2ZDP A;  4ZCM A;  2OML A;  1WOO A;  2Q3P A;  3LH2 S;  1WTB A;  1NK9 A;  1JLC B;  1WHV A;  3I9V 9;  1XR7 A;  1TFY A;  3ZXW A;  2EKN A;  4DV5 J;  4AL7 A;  2ABY A;  2EC2 A;  1R89 A;  4C11 A;  3GIR A;  2QA4 G;  2CWX A;  3OVS A;  3ZNU A;  3PV8 A;  3KK1 A;  2CZV C;  2R2S A;  2BVZ A;  2WHO A;  3MMA B;  5AE2 A;  3UN5 A;  5ETO A;  3QZ8 A;  3CJR A;  2IHR 1;  4LRC A;  2L3M A;  3AHP A;  2F8H A;  2JZ5 A;  3OHA A;  1QVF R;  2QLJ B;  3NBP B;  2XYP B;  2CPX A;  4YY3 J;  4IQM A;  3MGJ A;  4GKK F;  4JYA J;  1KN6 A;  3VGS A;  5LMU F;  4WFY A;  1Y5I B;  2H5I B;  4FBU A;  5IT0 A;  4ECY A;  1TVR B;  3A1Y G;  3IR6 B;  2KT2 A;  4J9L A;  4ZIT A;  3ISZ A;  5B0C A;  3LF0 A;  5AXN A;  2HGL A;  3KXD A;  3IS9 B;  2KJV A;  2Q66 A;  3GJT B;  1YBU A;  2IM1 A;  2DGT A;  3O5T B;  3DKD A;  2V4R A;  2MZJ A;  5E41 A;  4C97 A;  2B4V A;  3GR1 A;  2ZM6 J;  1JLE B;  3BBF A;  3I87 A;  3MUT P;  3BYP A;  3DFE A;  3DLG B;  2LQ8 A;  1HKA A;  1NDP A;  2HRY A;  4BWJ A;  2BE7 D;  1WOR A;  3BDE A;  2VPX B;  1KRP A;  1OSD A;  3UDE A;  5EWE A;  2AD9 A;  4OMF G;  4ED2 A;  3EMT A;  4B3S F;  1BQM A;  1YJU A;  1BWV A;  1NB2 A;  2ZOM A;  4O44 A;  1KP6 A;  4DV7 J;  5KG0 A;  4LR8 A;  1UET A;  2A10 A;  2Z2Z A;  5I4M A;  1LKZ A;  2Z57 B;  2APO A;  1RQ0 A;  1L5U A;  4PXC A;  4I6A A;  3SQG B;  3BN4 A;  1K73 T;  4F3O A;  3MPV A;  2OPR B;  3OLA A;  4ZVG A;  2DPJ A;  3AAW B;  4B9V A;  1RTH B;  4BDP A;  2R3V A;  1WG1 A;  4DR3 J;  3K5N A;  4Y2M A;  2IVM A;  2PSZ A;  1D9A A;  4OZ1 A;  4O3P A;  2ROE A;  4WII A;  3AJ1 A;  3IMQ J;  3WC2 A;  4HH0 A;  3L7U A;  1K1Q A;  2R2R A;  3OT9 A;  2WB4 A;  3CDB A;  4QYZ J;  3PIO Q;  4ELV A;  4U8V A;  3D28 A;  4DV5 F;  2FC9 A;  1WC5 A;  2FVS A;  1JJ4 A;  2BE9 B;  3Q8V A;  1UPP A;  5D0R A;  3FK4 A;  5FJ4 A;  3ELH A;  4WXO A;  4DZD A;  3QAU A;  3K5L A;  2Z58 B;  4DV3 F;  2X1A A;  4DX5 A;  2PMZ D;  2V2Q A;  1U1Q A;  1T3N A;  3SIP B;  1IXK A;  1SB6 A;  3TAP A;  1HNV A;  5DG7 A;  2YKN A;  4QQB A;  5H9F J;  2ZH1 A;  4YY3 F;  3H7H B;  1U8W A;  5CZC A;  4CH7 A;  4IG3 A;  3VGT A;  1X60 A;  3SDE A;  4JYA F;  1N34 J;  2GW8 A;  1HMV B;  2MZQ A;  1HLW A;  4RW9 A;  2HVH A;  3D54 A;  3MFH A;  2BOP A;  5B0G A;  1VBX A;  2YPZ A;  4JV5 J;  3OJS A;  2H54 B;  3N79 A;  1B0T A;  1NHU A;  3S6E A;  4TNO A;  3M8Z A;  5KFF A;  4WKY A;  3HK2 A;  4D3H A;  3T3F A;  5DGB A;  2FPH X;  1IWG A;  1UJ4 A;  1TKT B;  3CJK A;  3E51 A;  2B0G A;  5IXU A;  3HHN B;  2FUG 9;  2V69 A;  2J0S D;  3KHR A;  3IFE A;  1RAJ A;  4Y3C A;  4JI2 J;  2AZ1 A;  3J7Y U;  4TY8 A;  3NOC A;  4DI6 A;  1TQL A;  2KJW A;  2VG7 A;  4A4J A;  4ZIV A;  2HKE A;  3QGG A;  2KFN A;  2OO4 A;  1MWY A;  4RW6 A;  4DR6 F;  2YKM A;  1EP4 A;  1R3N A;  1EQ0 A;  4C8O A;  1JLB A;  4ZVU B;  4EK2 A;  1S6Q B;  1NEE A;  4ZJL A;  4DV7 F;  2HG4 A;  2FVC A;  2FJW A;  5C5J A;  3G96 A;  1FFG B;  1N88 A;  2RHQ B;  1GEH A;  1N6Q B;  3HKW A;  1RCX B;  3EPG A;  3THP A;  4I6Y A;  3PYD A;  3WDO A;  2HFO A;  2C28 A;  3VAK A;  4FXD A;  3IRW P;  1QUP A;  4DR3 F;  3R1L A;  2QO3 A;  2E1P A;  2LU1 A;  3LA0 A;  3RW6 A;  3GQC A;  3ZTP A;  1W2B R;  2XMJ A;  2XC9 A;  2XY5 A;  2VPZ B;  1CS4 A;  1E6Y A;  1DFD A;  1JXE A;  2UXD J;  1K1S A;  2UU9 F;  3G6V A;  2FZG B;  2QA2 A;  4DV4 F;  3QMQ A;  5G4D A;  1DTT B;  4A8O A;  3PR5 B;  1SC1 B;  2KKH A;  4ID5 B;  1B99 A;  4CLF A;  4WE1 A;  1UW4 A;  3PEJ A;  4KGX B;  2K7J A;  4PYD A;  4B9S A;  3N6L A;  2KG0 A;  2DHA A;  3J81 Y;  4U96 A;  2E5H A;  4B17 A;  4EO8 A;  5D78 A;  1N32 J;  2XYG B;  2N4D A;  4X4Q A;  4IH7 A;  5M2P A;  3FCW A;  2MB0 B;  5KOW A;  2R8J A;  3SZ2 A;  1N34 F;  4OJG A;  2V6A A;  1RSC A;  1SIW B;  4NA1 A;  1G2E A;  3LAL A;  3JQM A;  4EO6 A;  1S1V B;  2EFV A;  4L76 A;  5FLX Y;  2JLE A;  3TI0 A;  5F8I A;  4CRJ A;  1U48 A;  2RIL A;  1KD1 T;  3E3X A;  1XNR J;  1Y3K A;  3LP1 B;  4CLW A;  2HMI B;  3Q8S B;  1S59 A;  3CDU A;  1Y3J A;  2P8I A;  3RJM B;  3I96 A;  1NJX A;  2JEI A;  4I56 A;  1FEH A;  2AKW B;  2DGU A;  1GMW A;  1S0M A;  1FK9 B;  3ISN C;  3M1V A;  3NEK A;  1NME B;  4GKJ J;  1YKW A;  4DR5 J;  3CJQ A;  1T94 A;  2RS2 A;  3LWL A;  3M2U A;  2CJQ A;  1SL0 A;  2ADC A;  1CJV B;  1FA0 A;  3DRR A;  2XEX A;  2P5V A;  1S6O A;  2UUB J;  2BKO A;  4Q2M A;  2CQ1 A;  5T7L B;  3LP2 A;  3MAA A;  2GIF A;  2E7W A;  2IRY A;  1OQ3 A;  3I31 A;  4JI0 J;  5DG9 A;  3IXQ A;  2KYX A;  3NWR A;  2K06 A;  4XO0 A;  3CCE S;  5K8O A;  4C8N A;  2JX2 A;  4H4O B;  3CCZ A;  3QRP A;  4F0H A;  3KJN B;  3NGR A;  2HVI A;  3A4T A;  1SC6 A;  4Z7Y A;  1HD1 A;  2NSC A;  1T9X A;  4HTJ A;  4KFB B;  4QWB A;  2F1F A;  2H5E A;  2XB2 D;  3FSI A;  2MQQ A;  3UDC A;  2FVP A;  2XSF A;  5ETT A;  3PTW A;  2LYV A;  5IV3 A;  4KY3 A;  1P27 B;  4ILL A;  3CCT A;  1S1T A;  2GHP A;  2WW4 A;  1S7I A;  3N01 A;  2KVQ E;  2RML A;  2R8I A;  3QJP A;  2QJ3 A;  3O3L A;  3FEX B;  3MR7 A;  5D4N A;  2ZNZ A;  2BV3 A;  2R7R A;  1N32 F;  2VL1 A;  2FJE B;  3IC1 A;  3Q22 A;  2BMB A;  4OX7 A;  3FEZ A;  4DMZ A;  2QMU B;  4EZ9 A;  4R0J A;  2M0G B;  3K2Y A;  4NI2 B;  1XR6 A;  1R0A A;  4LFC J;  2KDO A;  1U0S A;  2QFJ A;  1VQM S;  1S76 D;  3MMC B;  5KG4 A;  3MR2 A;  1JWW A;  3M6U A;  3PG9 A;  2B3T B;  2OPS B;  1RA7 A;  2G13 A;  4G1I A;  4K7Q A;  2WRM A;  1UP1 A;  1XNR F;  2OPQ A;  2ASL A;  2UXB J;  4UY8 5;  5EDW A;  2A2D A;  1DHM A;  3SV3 A;  1FJG J;  2VF3 A;  3TAM B;  1M0S A;  3ITH B;  4DLE A;  2KU7 A;  4CT9 A;  4GKJ F;  2R2U A;  3FJ2 A;  4JI1 J;  3CNQ P;  2D74 B;  1V9O A;  2G2Z A;  2I38 A;  1NKB A;  2E5I A;  3OR2 B;  1F9E B;  4RNF A;  2UUB F;  3M6X A;  2EG1 A;  1CLF A;  4H4K C;  4HT7 A;  3ZZT A;  3QZ7 A;  1CJU A;  3NNH A;  4XPC A;  3MI7 X;  4JI0 F;  1QE1 A;  2Y1R I;  4IH6 A;  5D77 A;  4F2S A;  4L6V 3;  4M5K A;  3QRQ A;  3H4D A;  3NNC A;  3OTE A;  1C4C A;  2AF6 A;  1VLY A;  3S1T A;  3NGS A;  3MM9 A;  3CCL S;  2Z4P A;  1WOP A;  3T9N A;  2HBR B;  2QLF B;  2DO4 A;  4A46 A;  4I69 A;  4MJK A;  1FRI A;  1KQK A;  4AMM A;  6FDR A;  1GNK A;  3CCW A;  4YN3 B;  2R7Q A;  4DQQ A;  3C15 A;  1VQS A;  4ZIW A;  2GGP A;  4C3L A;  2K2P A;  3AOC A;  4IFY A;  1IR1 A;  3KWM A;  2YNH A;  1J5O B;  3BR8 A;  2QA4 S;  5D0G A;  2VG5 A;  2BAB A;  2P9E A;  1U1K A;  2BJ8 A;  3CXC R;  8RUC A;  4I68 A;  2LQ9 A;  3Q0A A;  1SL2 A;  3HI9 A;  1H72 C;  4LF9 J;  2IBO A;  1CEZ A;  4F7V A;  3J80 Y;  3NNA A;  3TYT A;  1S9E A;  4A8F A;  4R5P B;  2OIH A;  1SC3 B;  5HMX A;  2VOO A;  1YJ7 A;  5D0E A;  4OHV A;  2HRT A;  3UDL A;  4KHR A;  2ATC B;  1FJG F;  1WJ9 A;  2I1R A;  2YNG A;  4UOF A;  4CLS A;  3SSQ A;  4GO7 X;  3WC0 A;  3QO9 A;  1BWE A;  4JI1 F;  1XK8 A;  2PII A;  2FHJ A;  2G2Y A;  1DLO B;  2RDJ A;  4LSL B;  3CE8 A;  4FBT A;  4N56 A;  3CED A;  1NK5 A;  1XN9 A;  3FDS A;  1B0P A;  5ETV A;  3V81 A;  1VGY A;  1VQ9 S;  2CIM A;  2ZJR Q;  2UUA J;  3D0G E;  1IBL F;  4OX9 J;  4AMN A;  1DAX A;  3AJ2 A;  1TK0 A;  1FJ7 A;  4YOE A;  3SBM A;  3D67 A;  3M8Q A;  2RAQ A;  3QBC A;  4PRF A;  4RNM A;  2WK4 A;  4QWC A;  2QE5 A;  3ZZ0 A;  3D66 A;  3IG1 B;  5B0B A;  3G2X A;  3G9C A;  4M5L A;  3I55 S;  4XDD A;  4ZMM A;  3FVY A;  1SKS A;  5HRO B;  1Y5L B;  2IVF B;  3HLU A;  4CNZ A;  1BQN A;  3AA8 A;  1C1B A;  2YWE A;  1N48 A;  3MUM P;  1TUG B;  3DLE B;  1PC4 A;  2HFU A;  1Q86 T;  5D4P A;  2R8G A;  3GJQ B;  5HP1 A;  4AL5 A;  1NZA A;  5DQH A;  2BAN A;  2ZC4 A;  1RWV B;  3BS9 A;  5KFE A;  1KHV A;  3V6J A;  2HHS A;  1HAR A;  1HI0 P;  3HT0 A;  4RKU C;  1WG5 A;  3VQT A;  4ITS A;  2V4J B;  2DD8 S;  4PUO B;  4ALZ A;  3RGI A;  2V94 A;  2FZC B;  2M4M A;  3NMA A;  2KZM A;  4KO0 A;  1R8C A;  1X0P A;  5IC4 B;  4FPI A;  2LEP A;  2BE2 B;  1YZ6 A;  3T6J A;  2EI5 A;  1QDU B;  3GB0 A;  3GV8 B;  1M5S A;  3IO1 A;  2HQD A;  3I0S A;  5AE3 A;  2B56 A;  5AXL A;  2MTL A;  1GXL A;  4EGL A;  5IQQ A;  2IDE A;  1BD6 A;  2RS8 A;  4DWI A;  1U24 A;  1E6V A;  2BKP A;  4TYA A;  4ETZ A;  3R27 A;  4PWD A;  2KH9 A;  4XK8 C;  4ZCK A;  3VAL A;  5HVF A;  4WTO B;  1NK8 A;  8ATC B;  1H38 A;  2CQD A;  1T0T V;  4CYU A;  5L39 A;  1VQN S;  1HYS A;  2J0W A;  4ANC A;  4F4X A;  2ZWP A;  4OHZ A;  1B7Y B;  4J5O A;  3P6Y C;  2UUA F;  1UA0 A;  4OX9 F;  2R7S A;  5CYQ B;  1D09 B;  4WYW A;  3OJU A;  3MCS A;  2NPF A;  4X66 J;  1VRQ C;  1UL3 A;  1REG X;  5E3C A;  5FDL B;  2M9K A;  4CO4 A;  4RUC A;  1F2G A;  2MHE A;  3KLV A;  2YWW A;  3FBE A;  5F3Z A;  4UQT A;  4DPO A;  4DQI A;  3W60 A;  3PYF A;  3DLJ A;  4IFV B;  4DCJ B;  5SUH A;  2WOM B;  3LTO A;  3KLI A;  3P49 B;  1S57 A;  4K4U A;  3B8H A;  2XM3 A;  4RNO A;  3NY0 A;  3Q24 A;  2CPJ A;  2KFZ A;  2W2P P;  5I42 B;  1JLA B;  2NXJ A;  1VLO A;  5ETM A;  2GQC A;  5DET A;  4IRC A;  2GFF A;  1S1W B;  5J2M A;  4TLQ A;  4ED5 A;  1N8R T;  1VQ7 S;  3FSX A;  3ETO A;  4NLD A;  1D1U A;  2WW8 A;  4QCL A;  4DL7 A;  2B9Y A;  1S6P A;  2I9S A;  3EM1 A;  1S1X A;  4CLU A;  2AMC B;  4X65 J;  3BF4 A;  1FWL A;  1S72 S;  3HM9 A;  1XNQ F;  3ZZP A;  1G4C A;  2UVR A;  4N47 A;  3PW0 A;  4B3R F;  1LW2 B;  1I5O B;  4ICL B;  4K59 A;  2Q43 A;  1ICE B;  1MML A;  4ECS A;  4F2R A;  5KT5 A;  1FWK A;  1PJ5 A;  4LSN A;  3DRP B;  1HFE L;  4BC7 A;  4EUV A;  4V19 X;  1S4E A;  1MG7 A;  3BBC A;  4QW9 A;  4XAK A;  1UVK A;  4P10 A;  1O0P A;  2NYI A;  5J2P B;  1KQS R;  2FDN A;  4ZK7 M;  3BV8 A;  3QWP A;  2EK1 A;  1IKV A;  5HQ8 A;  4KBI A;  2H48 B;  4XDC A;  3PJX A;  3CC4 S;  3EVW A;  5DDR C;  4AND A;  5I3U B;  1KLN A;  3TA0 A;  1MWZ A;  3OL9 A;  4PWW A;  4K4W A;  2HND B;  1IBC B;  4KJI A;  3HP6 A;  1TK8 A;  2W8K A;  3BGR B;  1REV B;  2F9D A;  2OI2 A;  1BUX A;  1FD8 A;  4X66 F;  1S0O A;  4Y28 C;  2QL7 B;  4R8U A;  1U6B A;  2HW3 A;  3TEG A;  3GTY X;  1VIX A;  2PEH A;  3W2V A;  3G8Q A;  1I94 J;  2FLN A;  3BH6 B;  3GJR B;  2W7O A;  2H3E B;  4DPU A;  2D3O R;  5FLX U;  3D1O A;  2CXE A;  1QAI A;  5LOQ A;  3VAJ A;  4RW4 A;  1FRJ A;  2MGZ B;  4URS A;  2RD5 C;  2EBG A;  2BJE A;  4F04 B;  2QLW A;  1QVG R;  2CAJ A;  3ZC4 A;  2VOP A;  2DIS A;  3EZU A;  5G0R A;  5A0Y B;  3MOJ B;  2R9L A;  3RBD A;  4B3T J;  4LFA J;  4ZJQ A;  2F8E X;  4MH8 A;  1LFP A;  1K47 A;  4WWS A;  1NJY A;  4IG0 A;  2VAS A;  2YNF A;  1QSL A;  5AT1 B;  3PX4 A;  3BSC A;  2RUG A;  5D0H A;  1ZZN A;  5JVH Q;  2GZO A;  2QRR A;  3D0H E;  2NUU G;  2V2K A;  5GAH U;  4X65 F;  4YDX A;  1IKW B;  1R0C B;  2Q1L A;  2RIJ A;  2JEG A;  3SYZ A;  4EU0 A;  2R7V A;  4MAK A;  1RAI B;  1D3W A;  3D5M A;  2PMH A;  1U49 A;  2KI2 A;  3NS6 A;  3MM5 B;  1P1L A;  1YJW S;  2A2C A;  5C25 A;  1Q5V A;  3H5Y A;  4CLP A;  5GAG U;  1UWB B;  3PNI A;  4WU2 A;  4LF7 F;  2VD3 A;  1WG4 A;  4DQR A;  3K8V A;  3DXB A;  5EWG A;  2PFF B;  3FCV A;  3MPW A;  4JP8 A;  1NK7 A;  3RRG A;  3T5J A;  4DS5 A;  4LRB A;  4AYB D;  2NXN A;  1CJT B;  3KLF B;  1SUQ B;  3I9Z A;  3AD8 C;  2BOA A;  4DV6 J;  2QLX A;  3IR7 B;  3JTP A;  1VQL S;  1NDL A;  1M5V C;  1FDA A;  3R7S B;  3LPE A;  4JV1 A;  1NPP A;  4DUY F;  1VJW A;  2EC0 A;  2EPI A;  4J9R A;  1ITP A;  2NUH A;  2FTR A;  3M9M B;  4TXS A;  1YSJ A;  1I94 F;  1WC6 A;  4OZ2 A;  2ZH7 A;  1KDN A;  3OFE A;  2AQ4 A;  4IRD A;  4B9M A;  1NH8 A;  2EEY A;  3PJW A;  5DS7 A;  3PM9 A;  1H7W A;  1MN9 A;  4I1T A;  4GVL A;  3IM8 A;  2JWN A;  2BKN A;  4F0K A;  1BXN A;  4ELT A;  3L7P A;  3D0I E;  2PMW A;  2R4F A;  5KFH A;  4RW8 A;  4Q0B A;  4UOH A;  1DUR A;  1TR0 A;  3SQO P;  2YBV A;  2GVZ A;  4B3T F;  4LFA F;  1U26 A;  4A8W A;  3TJA A;  1J27 A;  5A6P A;  3VHQ A;  1NPK A;  5E3P A;  4M5D B;  4PXB A;  4P75 A;  3A13 A;  3RAQ A;  3ZZZ A;  4LF5 J;  1SC4 B;  1Y0H A;  1KBR A;  3CMA S;  2CZ9 A;  4HVZ A;  4CH0 S;  1EX8 A;  2GC8 A;  1AA1 B;  4LFB J;  2WSF C;  2ZNY A;  1RT3 A;  4KHP F;  1CUL A;  2WSC C;  2X7I A;  4JI6 J;  2RKI A;  5L1K A;  5E2Q A;  1VQK S;  4HEA 9;  1VBZ A;  4WFZ A;  3R3T A;  2OEM A;  1LWF B;  4DF4 A;  1UCN A;  3VAF A;  2DKO B;  2VIC A;  2RF2 B;  3BJY A;  4MK7 A;  4ZP8 A;  1NBE B;  3C16 B;  4YEA A;  2BAC A;  4LRF A;  3DU5 A;  3CJ5 A;  4DV6 F;  2JC1 A;  4P7T A;  1I51 B;  3P45 B;  1YK9 A;  4KV8 A;  3KLH B;  1UFW A;  2ZOF A;  1X4G A;  2IC3 B;  2E1C A;  2GMH A;  4NLS A;  2E5J A;  3CJ0 A;  1RT1 B;  1LK5 A;  2IYI A;  3M30 B;  3OFF A;  3W8P A;  1HPZ A;  5CYM B;  5HN0 A;  3MM6 A;  3RUB L;  1RWO B;  4EYH B;  1FXR A;  5H9F K;  1RU1 A;  1KKH A;  2ZZT A;  1HHT P;  4ETX A;  2A0F B;  1NAQ A;  1CJK A;  1FO1 A;  3PKM A;  3JSB A;  2UXC J;  2BJ3 A;  5CD4 H;  1UFK A;  5BXI A;  2JVO A;  4MIW A;  3BQ2 A;  2J6T A;  5KAK A;  3HJF A;  3TAQ A;  4U9R A;  4X64 J;  1S49 A;  4JI3 F;  3HCX A;  1RT2 B;  4R0E A;  1DJ0 A;  4Z37 A;  4ECV A;  1FRX A;  2W9A A;  4DUZ F;  4LF5 F;  2OGU A;  4Q5V A;  4O4R A;  2MPU A;  1RTD B;  1RT5 B;  3JSY A;  1N36 J;  2YWF A;  3QYY A;  2MY7 A;  3MXH P;  3RZA A;  4LFB F;  5GAD U;  4NLW A;  1Q1K A;  3CJT A;  2V8D A;  4ZN1 A;  1TL3 A;  4QOT A;  3IM9 A;  4LVN P;  1RZM A;  2H4W B;  3HXM A;  1CC8 A;  5AE1 A;  4LBP A;  2OEJ A;  3C6T B;  4RR5 A;  1YWX A;  1GX5 A;  2CPY A;  1T03 A;  4A8M P;  2IJR A;  2QC3 A;  3US5 A;  3HHD A;  2VIH A;  3S01 A;  5J1N A;  1W26 A;  4C48 A;  2M88 A;  3VVU A;  4CTA B;  2EFQ A;  2LDI A;  4O3S A;  4GC6 A;  3F56 A;  4C8Y A;  3JYT A;  1RBA A;  1VRT A;  1BE4 A;  4IO1 A;  2XO7 A;  1FDD A;  1LWE B;  4AFF A;  4TYB A;  1WF1 A;  3JXO A;  3QGP A;  1RT6 B;  1X7V A;  2Q79 A;  3ENQ A;  5HJX A;  2HBZ B;  3D7S B;  1MU2 B;  4BBY A;  3EDR B;  4DPW A;  2JJ4 D;  2D7S A;  4Y6I A;  3PEH A;  5CZV A;  3W63 A;  1F9F A;  3UD4 P;  3ENA A;  3EXC X;  3UPF A;  3JQK A;  4L72 B;  3OVB A;  3GV7 B;  2QL9 B;  4LF4 J;  2QFI A;  5JJB A;  3HVT B;  4JOU A;  4Q44 A;  1X9M A;  4FN5 A;  2ILZ A;  1TMJ A;  5A76 A;  1SH2 A;  1GQE A;  3NL0 A;  2Y8Y A;  2C2R A;  2F4F A;  3OR1 B;  1YRU A;  3JB9 k;  1TFW A;  2R42 A;  4O4G B;  1HNZ F;  3FKB A;  4OZ3 A;  1WUU A;  4UF4 A;  4ECW A;  3AXK A;  4DSL A;  3KDN A;  2M5Y A;  2Y0B B;  2RQK A;  1P9Y A;  5KFS A;  4B3O B;  2VG6 A;  1WOS A;  3PYE A;  2JSX A;  3V4I A;  4HL9 A;  2WTF A;  4DUT A;  1O6X A;  1ZM3 A;  3WHI A;  1RT4 A;  1S77 D;  2VON A;  2XMV A;  2FVR A;  5B7W A;  1ROF A;  1WC1 A;  1TKZ A;  2ZBI A;  4I4B A;  5DZ7 A;  1WKL A;  1L3U A;  3BGF A;  1HBO B;  5J2N B;  1NDK A;  2HAF A;  3AD7 C;  1FNX H;  1VC0 A;  3I82 A;  4AD6 A;  5A8K A;  5KFZ A;  1VC6 A;  1JLQ A;  4OZL A;  4F26 A;  1YBA A;  3MAQ A;  4CO0 A;  2OEL A;  2CJ9 A;  2OPP A;  5DQI A;  1ZA2 B;  3FRY A;  4NRU A;  1RLC L;  1M5P C;  2ERR A;  1JIH A;  4DL2 A;  3PAC A;  2LXF A;  4C8Z A;  2DXE A;  4OZJ A;  2KG1 A;  4C11 B;  1WEX A;  1ZAW A;  1XWL A;  3KK1 B;  3G82 A;  3C46 A;  3IGV A;  2C2D A;  3R6L B;  3SCK E;  1NJZ A;  1NJI T;  3QAT A;  5K8P A;  2AYG A;  4EMD A;  1P8G A;  4ED7 A;  4K0K J;  2DYA A;  2LLZ A;  4JV0 A;  3SV4 A;  3ZO7 A;  2VA2 A;  5AXK A;  3R7N B;  1NKE A;  1UEK A;  1UFL A;  3M8S A;  2VV5 A;  5K5M A;  3PFO A;  1H98 A;  3FQK A;  4HAC A;  1Q8B A;  1JB0 C;  1X5P A;  5GVQ A;  2XMK A;  3J81 j;  3GWC A;  1UVN A;  4RUH A;  4LF4 F;  5B08 A;  3LGN A;  3BR9 A;  2PT0 A;  4EYI B;  1YJN S;  1TU0 B;  5KFD A;  1S7H A;  4CIO A;  4QW8 A;  3W61 A;  1Q4R A;  1NCL A;  3LO3 A;  4ANE A;  3OFH A;  3V6D A;  4O3O A;  1RJJ A;  3SFU A;  3CC2 S;  3T1H J;  1Q95 G;  2BRK A;  4F0M A;  3PHE A;  3ZTQ A;  2QYC A;  5HQL A;  2ASY A;  2CPE A;  4O3R A;  2U2F A;  3KHG A;  1RAE B;  3TJ9 A;  1BQM B;  1WD6 A;  1N0U A;  4O44 B;  2HEK A;  3DLL Q;  1X8D A;  4OI0 A;  3SCL E;  4DCP B;  4X4P A;  2C2Z B;  2JNJ A;  3UE2 A;  1NSQ A;  4UT4 A;  2UUT A;  4Y0F A;  1YJ9 S;  1NH7 A;  5D4O A;  4FPR A;  4W4M A;  4DL4 A;  1RBO B;  3W9H A;  3TOQ A;  2M8H A;  1Q81 T;  1F5A A;  2V8G A;  1FDN A;  2LKZ A;  3M32 A;  3H5X A;  4ZCL A;  2O3D A;  4M5N A;  1GTH A;  1T9W A;  2OEK A;  2G2O A;  3GFX A;  1KEK A;  4U7U D;  5JUM A;  3FGV A;  4USU A;  2XHW A;  3OSN A;  2BZ2 A;  5HAN A;  2ZH2 A;  2W8L A;  4KGZ B;  2YKO A;  2CQC A;  3NGT A;  2DHG A;  1U6F A;  2B7C B;  3QT5 A;  4K0K F;  4DR1 F;  5IWA J;  1HNV B;  3DOL A;  5D3G A;  2YKN B;  1YZ7 A;  5HBM A;  5KFG A;  4IG3 B;  1QTN B;  3BPD A;  3SDE B;  3HSJ A;  3R5C A;  2R8H A;  4RW9 B;  1RDR A;  2NLW A;  2M8D B;  1PAU B;  1R7I A;  3A8I A;  4TKT A;  2M52 A;  3EYZ A;  2UP1 A;  2GNK A;  1S0V A;  1ZM2 A;  4U7C A;  5A2Q Y;  1SXL A;  3DDK A;  1QUV A;  3VF0 B;  3CJK B;  4P9S A;  3PRV A;  1TEL A;  2MKI A;  2MXY A;  5KFR A;  1T9T A;  2DIU A;  5F8H A;  3SSR A;  1Z4U A;  4FF1 A;  4TY8 B;  3BB5 A;  4ED3 A;  3G87 A;  2L08 A;  5C24 A;  5A8R A;  2HWH A;  2VG7 B;  2XLI A;  3DOM A;  4RJV A;  5AJ3 F;  4RW6 B;  2LEC A;  1YI2 S;  2YKM B;  3OUY A;  1EP4 B;  2HGM A;  2RQC A;  1KSP A;  5E7O B;  1JLB B;  1WTF A;  4N8O A;  1X0F A;  4LJM A;  2QN6 B;  2FLP A;  1PCA A;  4WYL A;  2LMI A;  2E5G A;  2MDA A;  5ETP A;  3QT6 A;  2NRE A;  3K7R A;  4J9V A;  4G65 A;  1Q82 T;  4NLX A;  1X9S A;  2NQP A;  4YHH F;  2DHH A;  4C2M A;  1GMV A;  1JLF A;  1GH8 A;  1ZM9 A;  4O3Q A;  2AJ4 A;  1CS4 B;  4CLZ A;  1E6Y B;  2DNZ A;  3IWL A;  3VVT A;  3POT A;  4X84 A;  2DR5 A;  1WI8 A;  1I1G A;  3UDV A;  2GVD A;  3JTO A;  1U4B A;  4A8K A;  2PN6 A;  3LGM A;  3EGW B;  4I7F A;  3MMB A;  3FCH A;  4JUZ A;  4WE1 B;  5F41 A;  1EET A;  3U7J A;  2SXL A;  2ZZM A;  3KMS A;  2IAJ A;  1NPR A;  2C3Y A;  4AQY J;  1GMW D;  1Q79 A;  2F40 A;  1Y7P A;  2YQ1 A;  3H4B A;  3HD1 A;  4OYA A;  5HLF A;  3D4J A;  1F3F A;  2GS8 A;  2HFZ A;  1S9G A;  3GP9 A;  4CLL A;  2A6O A;  2PFD A;  2IY5 B;  1IQZ A;  3TEH B;  3I32 A;  3T6B A;  4A8Y A;  4OJ3 A;  3O6Q A;  4A47 A;  4ZCI A;  4CI0 B;  1RHJ B;  3LWM A;  2CZ4 A;  2E1R A;  5KFA A;  2VQF J;  2IDL A;  7FD1 A;  3MUR P;  4LQ3 A;  1YVF A;  1QJH A;  4X4O A;  1VQ4 S;  4R25 A;  2UVU A;  2YTC A;  4FXV A;  1JJ2 R;  1FKP A;  2PO4 A;  4ENO A;  3NKY A;  3M1V B;  4FDF A;  4C9D A;  4MKY A;  3ETM A;  5FII A;  4PAA A;  4NCG A;  1FJE B;  4M1K A;  3M2U B;  4C6A A;  3PKY A;  4LR7 A;  2XS2 A;  2EWH A;  3MEC A;  3DRR B;  4URQ U;  3SCI E;  3J7A 1;  1FD2 A;  4X4T A;  3MUV P;  1CVJ A;  1PKU A;  2FLL A;  4N7T A;  5ADZ A;  3LP2 B;  3MAA B;  2RDD A;  2CG4 A;  3FFI A;  2VDH A;  4F25 A;  2GJ2 A;  4OI1 A;  4HHH A;  4CT8 A;  2WVC A;  5I3Q A;  4O0I A;  3L3C A;  3TUI C;  5KFB A;  5J2Q A;  4ED4 A;  2WBR A;  3ENV A;  2Y1I A;  3PVX A;  3AQO A;  4I2P A;  4OI3 A;  2ZIT A;  2DNH A;  3HT3 A;  5A8W A;  1FRM A;  1PIE A;  1LW0 A;  3MD1 A;  2DVI A;  2WVD A;  4OYX A;  1JK9 B;  4KAI A;  2KXN B;  3O2I A;  4ER8 A;  1V3Z A;  2KHC A;  4WZM A;  2AJ2 A;  2LQB A;  2DCU B;  2RRN A;  5KG5 A;  5CYJ A;  1FHT A;  2IMO A;  2N82 B;  1UW9 A;  1PIL A;  3OV7 A;  4IUF A;  2ILY A;  3DM2 A;  4ZVQ B;  1S1T B;  1JQG A;  1R43 A;  2VFS A;  5LM7 E;  4ZVP B;  1RXO B;  1Z2L A;  4OI4 A;  4AQY F;  2DB1 A;  2M7S A;  3TUJ C;  2IRX A;  5J1E A;  3C6U A;  2LXI A;  3HPO A;  2GA7 A;  2JL9 A;  3DRY A;  3VAG A;  2XMM A;  3IAS 9;  3RTV A;  2XNR A;  1YG0 A;  4GKK J;  1R0A B;  3AD9 C;  3F41 A;  4RW7 A;  1UKU A;  1XR5 A;  1YIT S;  2XI3 A;  3BN7 A;  4ED1 A;  2Z2Y B;  4MIA A;  4NA2 A;  2J6S A;  3JSR A;  1RIS A;  2VQF F;  1X4E A;  2XZT B;  2ZD1 A;  3WIU A;  2GO9 A;  2OPQ B;  2N3O A;  1LK7 A;  3K57 A;  3UW1 A;  5DGA A;  3ZTO A;  2XYH B;  3W5Z A;  4WPA A;  2WON A;  4YUD A;  3W64 A;  2DGO A;  1L3S A;  2YPY A;  2L9W A;  3RAX A;  1ACM B;  5ETK A;  2QMX A;  4RZR A;  1F6T A;  2C2M B;  4NL5 A;  3K5M A;  5DM7 Q;  4B3S J;  2NXU A;  2OTJ S;  5ETR A;  4EBE A;  2LCW A;  2BJ7 A;  3HFV A;  1CJU B;  2K1R A;  3GII A;  1QE1 B;  4USJ C;  3AJD A;  3ZZU A;  1HQE A;  1OY8 A;  1SH0 A;  2OFH X;  4FKX A;  2VA3 A;  3U02 A;  2J7U A;  1DQ9 A;  1NRK A;  4P74 A;  1XQI A;  2Y3Y A;  2ZDO A;  3ILL A;  1R8P A;  2W4C A;  3EDQ B;  4DL3 A;  2V8V A;  2CUY A;  2AEM A;  3MM9 B;  1RKJ A;  2GMJ A;  4L3K A;  2MZ1 A;  5DRK A;  3WZ0 A;  3WX8 A;  3T5L A;  5GAE I;  2R7X A;  3S8S A;  2FLO A;  2DNQ A;  3C15 B;  4ZPD A;  2GGP B;  5HVG A;  2GML A;  4IFY B;  4DR2 J;  4WBF A;  3BPS P;  2YNH B;  1U2C A;  2VG5 B;  1IN0 A;  3KG0 A;  1B7F A;  2PDA A;  4BC9 A;  2FZK B;  5F8J A;  4DV3 J;  5KOX A;  4DG1 A;  3SI8 A;  2HS0 A;  3H20 A;  2FHJ D;  3EUN A;  3ET6 A;  1U1L A;  4ZVF A;  5F8L A;  1ZBT A;  2B5J A;  1HQU A;  3BDP A;  3B54 A;  4IRK A;  2QSF A;  1VK3 A;  4CLT A;  3L95 X;  4EI2 A;  1T9V A;  2FJB B;  1S9E B;  1T7P A;  4DSK A;  2MLX A;  4B9L A;  3UVJ A;  4OZ0 A;  3DNC A;  1WKJ A;  2ZHA A;  3PW7 A; 
#chains in the Genus database with same CATH homology
 2VZ8 A;  2C2N A;  2UV8 G;  3IM8 A;  3PTW A;  3R97 A;  3TZW A;  2PFF B;  5CZC A;  3TQE A;  1NM2 A;  3CJ8 A;  2VZ9 A;  4RR5 A;  3RGI A;  2JFK A;  5CZD A;  3K89 A;  2G2Z A;  2G1H A;  2QC3 A;  2HG4 A;  3H0P A;  2H1Y A;  3SBM A;  3HMJ G;  5DZ7 A;  5DZ6 A;  3QAT A;  3HHD A;  2G2Y A;  2G2O A;  3R8Y A;  3IM9 A;  2QO3 A;  3TZY A;  3HJV A;  2CUY A;  4RL1 A;  3TZX A;  4QBU A;  2VKZ G;  3BV8 A;  3G87 A;  3TZZ A;  2JFD A;  2QJ3 A;  1MLA A;  3EZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...