3EZOA

Crystal structure of acyl-carrier-protein s-malonyltransferase from burkholderia pseudomallei 1710b
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
MKFAFVFPGQGSQSVGMLNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNLTTNTQPVMLTAAYACYRAWQQAGGAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVFDPASLDEALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
molecule keywords Malonyl CoA-acyl carrier protein transacylase
molecule tags Transferase
source organism Burkholderia pseudomallei 1710b
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3ezoA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3ezoA01
3TZWA 2CUYA 2QO3A 5DZ6A 3TZXA 2G2YA 4RL1A 3IM8A 1MLAA 2VKZG 2C2NA 5DZ7A 3R97A 1NM2A 3G87A 3EZOA 3SBMA 3IM9A 3R8YA 5CZDA 2HG4A 2UV8G 2G2ZA 2PFFB 2H1YA 3HMJG 3TZYA 2JFKA 3PTWA 3TZZA 4QBUA 2QJ3A 3QATA 4RR5A 3K89A 3RGIA 3TQEA 2G2OA 3HJVA 5CZCA 2VZ9A 2QC3A 3BV8A 3CJ8A 2JFDA 2VZ8A 3H0PA 2G1HA 3HHDA
chains in the Genus database with same CATH superfamily
1NHVA 2Y8WA 1QUPA 3QLHA 1JLAB 3KTQA 5GMDA 3C6TA 2V4QA 3ITHB 4ED8A 2FQQB 1K0TA 2RF2B 3R7SB 4YR0A 2M70A 4Y2AA 1S9FA 1B64A 2MZQA 3KG0A 5DO2A 4DR4F 2EFOA 1HNIB 1T9VA 2IC3A 3B82A 3KLIA 2OD4A 4GO5X 1R8BA 5EDWA 4LSNA 3QT7A 1QLNA 3A12A 2XO7A 3BREA 3ULHA 4B17A 2YX1A 2IRYA 3G82A 1LWFB 1RWWB 3PKMA 3I9ZA 2Y8YA 4NLXA 3IXQA 1KS2A 2AMCB 3CNQP 2K06A 4H4OB 5IZHA 3HVTB 1YRUA 2HAIA 2ZVIA 4NLVA 1KQKA 3OVBA 3MM7B 1UJ5A 2LEPA 1ZM3A 1E6YA 3TVKA 3ISND 2JEFA 1U0HA 4R0EA 3PIPQ 2HHQA 2C2KB 5DDPC 3OTDA 4DR2F 1NK7A 4NLTA 1Y5IB 3OR1B 2JOQA 2GIRA 3W1YC 2XZWA 3BPSP 1K8AT 2HWTA 4KFBA 4DSFA 4RKUC 2XMUA 3ZTRA 2LFVA 2NS1B 2ZFHA 1V3SA 2QT7A 2MY8A 4TYBA 4YR3A 2NCKL 4NYZA 4K4ZA 5KFKA 4B9MA 3IR7B 1URRA 5KFNA 1HMVA 1UEKA 1RP5A 1BC6A 1EJ7L 2UV8G 3EYZA 2QRRA 5JMNA 4CLTA 2J8AA 2QTWA 4O3PA 3KK1B 4LF4F 3R5DA 1JLAA 3HVAA 5DQGA 3ITHA 4CH7A 2RF2A 1HPZB 1VQKS 1U8SA 2PMZD 3D68A 1VQMS 2UXBJ 4RUBA 2QYGA 1ROFA 3TQEA 3G6VA 3ZO7A 2M0GB 3VZIA 1ZTWA 1HNIA 5LMUF 1SJ4P 4DZDA 1N34F 1IQTA 1HWKA 2E44A 2XYPB 4AMPA 1SH0A 5E2QA 2BJ3A 3BSCA 3DM2B 3W65A 4J9SA 4X4QA 3PEJA 2EC2A 1LWFA 3I55S 3OSPA 1WC1A 4E8UA 1KD1T 1UAWA 2NUHA 1S7IA 2HWIA 4H4OA 4NMLA 3GR1A 1IWGA 4NA3A 2RSQA 2JLGA 1H72C 4ILLA 3W63A 1N5YB 4N47A 3G4SS 1F2HA 2F5GA 4F8RA 3AQPA 3ZZZA 1X9SA 2AYEA 3OR1A 3UN2A 3Q89A 4C8OA 4IO9Q 1X0PA 2ZZMA 1RCXB 2P6TA 1H73A 5HVGA 3OJUA 4O3OA 3QMQA 3CCTA 2I6WA 4AE5A 1Q86T 3T1YF 4LBPA 2GZOA 3QYYA 3RRGA 1HD1A 5C25B 2VIHA 4G1IA 2M9KA 2FJBB 1BUXA 2BABA 1N36F 4FYDA 3G86A 3UNGC 4BLGA 5AXKA 1QSYA 1JLGA 1HNZJ 5DM7Q 2ZBIA 3T9NA 5HATA 3TO8A 1JQGA 3H5YA 4KRWA 1ZAWA 3LUYA 2YPZA 3T5KA 3R27A 1U47A 4ELTA 4DV1J 3T3FA 3KK1A 3CJ3A 1N32F 2XG8A 3R7NB 3EGZA 2WVEA 2DB1A 1HPZA 3PKYA 3NNCA 3CULA 1NM2A 2CQIA 8ATCB 1F9FA 3SQOP 2IYGA 2C2EA 4X65J 1FE4A 4OYPA 1L5UA 5ETKA 3RBEA 2FD2A 3GE9A 4DUZJ 2L3MA 3L7OA 2B0GA 2QGFB 1S1VB 2QMWA 3ZZUA 3SMZA 3QATA 1S9GB 3QGPA 2IM2A 3GIMA 1N5YA 3QAEA 5HL7Q 4N76A 4LSZB 3SCIE 1AFJA 2MPUA 5A6WA 2HNYB 2P9GA 2KRRA 2X51A 3FKBA 4TYAA 5KG4A 2VICA 3CDBA 3GV8B 1FDNA 1NLKL 2KHDA 1KWMA 2CJQA 3RU0A 2CYYA 3LO3A 1TELA 2CPZA 2NZCA 3NEKA 1IBMJ 3C46A 5C25A 1OYDA 5GAEU 1WKJA 1X5PA 4OV1A 1VQOS 2P9CA 1OQ3A 2C2RA 1VISA 6AT1B 5KFQA 3OLAA 1ZBTA 3WQPA 1UZDA 4Q0BB 4QZVB 1R27B 1TL7B 5HJXA 1CJKB 4EFAC 1S1TB 4DR5F 2CVEA 2V63A 2F4FA 4QOTA 1BMQB 2QA2A 5IFMA 3NNHA 1N88A 1O5JA 2ZHBA 3D1HA 2H48B 5ETSA 1WACA 2CJXB 4QYRA 3HT0A 1UA0A 2FGCA 3CXCR 4C3MA 4TY8B 1FWPA 2CPXA 4R5PB 1UKUA 5B0FA 3D1QA 1LK7A 3HJVA 1FRKA 1U1KA 2AV5A 3TW0A 1SJRA 1EHWA 3JSYA 4N7TA 4O3QA 5F8NA 3G6ES 3LP1B 5KFDA 1U0SA 1S9GA 2ZH2A 1UEVA 1IBLF 3IC1A 5LXYA 1YJNS 5ETOA 3AOCA 2B5JB 3KYLA 2EKYA 3M2UB 2HNYA 3MURP 4A46A 1U6BA 3M1VA 3BR9A 1ZA2B 2E1PA 2VPXB 3G2XA 2J9EA 1JK9B 2XULA 3DC2A 3OPKA 5EWGA 3P45B 5K20B 1SQFA 4IQMA 1RYRA 1EETB 2VODA 3IWLA 3R5GA 2BJ7A 3SFGA 1CJTB 3LAKA 5LSLA 3JYTB 1QVGR 4KBIA 2QC3A 1KLNA 4Q0BA 1OPIA 1TL7A 1N48A 3FGVA 1OMSA 4U8VA 1CJKA 3QGIA 1NH7A 3OUYB 1PBUA 3UO0A 2YNFB 1BQMB 1RHRB 4DS4A 2M8DB 2LQBA 4LQ3A 3U1MA 2Z0GA 4NLPA 3MEEA 1YJWS 1ELOA 3TZWA 4S0MA 1V9OA 3IN5A 3L9ZA 5IWAF 5DDOC 1BQXA 4NLQA 2XI2A 1H0HB 5A8WB 1BWVA 4TY8A 1FDBA 4R5PA 3VVUA 3A4TA 3BYRA 3M05A 1GXLA 3ILIA 2C2OB 5CD4H 4KY3A 5D6GA 1BWEA 3MTKA 4CTAA 3VGTA 4DOZA 3H5SA 2O66A 4TU8A 1C1BA 4JYAJ 3LP1A 1NK6A 2POKA 2BV3A 4TXSA 2VB6A 3BGLA 5E33A 4LBIA 3FMWA 2VFRA 2B9EA 5IT0A 1IKWB 3DOMB 4DQRA 3RBZA 2KU7A 4G6VB 1V3ZA 3FDSA 3DRSA 1QAXA 2XWXA 3OV7A 1Q4RA 1YRXA 4D3GA 4KE5A 2CZ9A 1UTAA 2DGWA 1WF0A 2UXBF 1EETA 1VYAA 2UXDJ 1WKLA 2FYXA 3D5MA 1CJTA 1KDNA 1VC0A 3OSNA 1R6VA 4K4SA 3JYTA 2MZJA 4X4VA 4EUVA 4M95A 2BJEA 3BDEA 2DGVA 2QFIA 4DDFA 3IAM9 3OUYA 5M2PA 4YHHJ 2YNFA 1BQMA 1SI9A 4ECXA 4WIQA 4K5SA 4MTPA 2FTRA 2R7OA 5DGBA 1N6QA 2LEAA 2IM1A 4B3OB 4LF5J 3DXBA 4QIFA 2MMYA 3MXHP 3HF5A 2QN6B 3CTRA 3J7AN 1IN0A 2L48A 3CJKA 1FI4A 5IS2A 2KJWA 1K1QA 4L75A 1WG5A 1A9NB 4HVZA 1R0AB 1ACMB 3JQKA 1HNZF 4FBUA 1IKWA 3CMQA 3DOMA 1RWUA 1V5VA 1RT1A 2DITA 4K2XA 4L3NA 4D3HA 3J7YI 5CYJA 2CPJA 2V2VA 1DZ5A 4KC5A 1T9UA 2OEJA 4IH5A 2XNRA 4DV1F 1VGYA 2D3ZA 1OY8A 1Q79A 4BS2A 2GJFA 1A6LA 1RAGB 3GG1A 4IG3B 2XI3A 3F73A 1WC6A 2ZBCA 3D54A 1T94A 4CO1A 2XMMA 4I4BA 3T5HA 1LNQA 1LWCB 3RYLA 5D0GA 2RS2A 5DZ7A 4LFAJ 1VCTA 2OHDA 4K0KF 3NGKA 1U7LA 3DLGB 3T9ZA 1N56A 2LQ8A 1UWBB 1YRTA 4NYPA 1G6BA 5KG5A 1H2UX 3CDAA 4P72A 3V81B 4BWMA 3R5JB 2LECA 1PYOB 1X4EA 3PO4A 1FWKA 1JNZB 4YUDA 2CA9A 4O0IA 1Q81T 4B3OA 4ES3A 2QA1A 3TNVA 5L39A 2WRMA 2RILA 4M5HA 4E0DA 3RW7A 2FB0A 4U7UD 4HHHA 2Z2ZA 2J7KA 3TARA 1GMUA 3LGHA 2GMJA 2AJQA 1IBMF 4RUCA 3MCSA 4PRFA 2KT5A 1FKPB 3E51A 1R0AA 4WP3A 3MTJA 1HBOB 2BE7D 3TX0A 1WKKA 1K0VA 1VRUB 1AYEA 5C24B 2E7XA 2KO1A 4U6PA 4V19J 3VAHA 4QIVA 1TK0A 3TVZA 3D2WA 2O3DA 1QTNB 3G9CA 2KXFA 4IG3A 3IMQJ 4M5MA 4OIXA 3K17A 3KDNA 2QO3A 2PC6A 3QJJA 1FTCA 3HT3A 4OI3A 5AXMA 1LWCA 2WB1D 2GAGC 2B4VA 2DKOB 4J9VA 1RWMB 2N4DA 4FS1A 1SBRA 3OHBA 3E8OA 3KK2B 2KTQA 2DH8A 3DLGA 3B78A 1JNRB 3ZZ0A 1UWBA 2HGMA 2IRXA 4MKBA 2F4VJ 2HBRB 1HW9A 2GQ2A 1WC0A 4USVA 2DXFA 1HBNB 2DBBA 3V81A 5J1EB 2K7KA 2FJWA 2WOMB 3I82A 4N8OA 3ZXWA 4PYDA 3MMAB 3MPWA 3HM9A 5K8NA 2E9RX 2BM0A 4FBTA 4K4YA 1QSLA 2K3KA 2QA4S 3V6DB 4M94A 1EKSA 3LPEA 2N7CA 3TJ9A 4QBUA 4NZ6A 2DNNA 4HL9A 2CXEA 4DV5F 1KLMB 2RS8A 4B3SJ 3JAMU 2CQPA 1I51B 1P9YA 3D6TB 4KPCA 1KHWA 2EK1A 5C24A 2H51B 5JVGQ 1XQIA 2WW8A 4KHRA 4ZPVR 4ZLNA 4PXBA 3W2VA 3SFUA 3GJQB 3QPIA 4ZP6A 2YWWA 2J8SA 4Q45A 3TA1A 4YP3A 1VLOA 4CCHA 4QWBA 2UU9J 3EZUA 3WBZA 2SXLA 4KB7A 1GEHA 1U49A 5HN0A 2E5JA 2PFDA 4MMOA 2ILZA 3PZPA 2KDOA 4O44B 4USUA 2DY1A 4J9PA 1OSCA 3KK2A 3K59A 3MZIA 5J2QB 3SQGB 3T6JA 3E2EA 4JYAF 3MWBA 2EKNA 2FZCB 1T9TA 1HBNA 1RSCA 5HQ8A 5J1EA 2GV1A 2WTFA 2WOMA 2EFPA 3EUNA 1PC4A 5ETVA 1SQEA 4IUFA 5AXLA 2OLWA 1MWZA 1TFYA 2XYHB 4IG0A 3MMAA 3SSQA 2GVDB 2V6AA 2PA8D 3IR5B 4AL5A 4DCJB 2E5LJ 4CT8A 1NEEA 1TKZB 1T0TV 1D0EA 2I2YA 5IT4A 2HBYB 3UI3A 3KJQB 3V6DA 2AQ4A 3UVJA 3W5YA 1VFJA 5AT1B 2JSXA 4RW7B 3DLEA 4A8KA 3MMBB 2UXDF 2N3OA 2BKPA 4I67A 3MFIA 5HI7A 4AL7A 1KLMA 1UJ6A 2R2RA 2HYIB 1YWXA 1R8AA 5ADZA 2BE2A 4QWCA 3I87A 2B7CB 2JEGA 3QRRA 3M8YA 5ETMA 4YHHF 2ZH5A 3R5BA 2IRUA 2EFQA 1KHVA 1DRZA 1RT4B 1XR7A 3DLLQ 4IR9A 5IT9U 3FVYA 4C8ZA 2EFGA 4U7UK 2YTCA 1IJEB 3ZZRA 2NREA 5CQGA 2NXEA 4F4YA 4I2QB 1C1CB 3V4IB 1IM4A 4PZVA 2DO4A 4LF5F 3K89A 3QO9B 2V8DA 3VF0B 4O44A 1FX2A 4O0NA 3NGTA 2UP1A 5J2QA 4LF6F 3SQGA 2E1RA 5HP1A 2B9WA 1FO1A 4M8LA 3DRPB 2ACMA 3DLJA 4JV1A 1X4GA 4ZP9A 2F8MA 5K5MA 5GAHI 2H3EB 4R0JA 2FZKB 2GVDA 4RX6A 2PI4A 3TA2A 2RDIA 2VG6A 1VLYA 1YHQS 3LW5C 1IBCB 1MWYA 4AXJA 5IT9Y 6FD1A 4ZPBA 5F8LA 4RJVA 3CC2S 3M6VA 4RW7A 3MMBA 2YQ3A 3EXYA 3PG9A 1NB2A 4ZJLA 4GKKJ 3H7HB 3AY0A 4K8RA 2HK2A 2G2ZA 4LFAF 5KFVA 4J9OA 2JFDA 5I3UB 3C14B 4QWAA 3NCPA 1RT4A 4RO0A 3MM9B 1R8CA 3P4UB 1D9FA 1KP6A 3GJTB 2HPUA 2VFUA 2HVHA 2NYHA 3J80U 3ZTQA 2HZVA 4A8XA 2DK2A 4JI3J 2KJVA 4I2QA 1URNA 5D3GA 1C1CA 3V4IA 2WONB 3QO9A 3TJ8A 3KLGB 3Q2SC 3L95X 2YX4A 2WW4A 2VG7A 1AZSB 2AKWB 2L9DA 2DNKA 2GQCA 2D1CA 1K73T 1HYSB 3LWMA 3HP6A 5D8HB 3DRPA 3SV4A 1V6HA 1M5VC 3CCVS 4DV6J 1ZH5A 4A8OA 1EP4A 2YQ0A 5EGYA 2HW3A 2B7BB 1S4EA 4CLKA 3K5MA 3D0IE 3NMRA 3JQJA 1LK5A 1TUGB 1N33J 2ZOMA 3D6FB 4LBHA 3TZYA 3RAMA 3AH6A 2XM3A 4AT1B 4ED6A 3CJSA 2B4OA 4C0OC 4X2BA 1U26A 3W5XA 2YH0A 4LRDA 4UY85 3TUIC 2XB2D 4RNNA 1NH8A 3UN5A 2KYZA 4HR2A 4PG4A 1LV5A 4RPFA 4USKA 1SIZA 5IOLA 5H9FJ 3PM9A 2HVZA 4LR7A 1RABB 1T3NA 2JL9A 4RLEA 4WF9Q 5I3UA 4EZ9A 3C14A 2KM8C 2PFFB 1YK9A 2ZZNA 1O51A 3VAIA 1ZTTA 4YDXA 4F67A 2RB7A 2MYFA 1P27B 4TVAB 1M1GA 1VQPS 1NKBA 5B0AA 1SB6A 1RB0A 2AEFA 4CRJA 2WONA 1DQ8A 1JKHB 3PW7A 4OJ3A 4C8NA 3KLGA 2V4JB 2BKNA 3Q8PB 3JTNA 1Q7LB 2VD3A 4YY3J 2KFZA 3RB0A 1AZSA 4OX9J 4CLZA 4Y34A 3LOUA 2PEHA 1SJFA 1EIYB 1HYSA 2FGOA 4F3OA 2UUAJ 2MJNA 4JB8B 1D1UA 4B3SF 5HMWA 1WDDA 2V5HG 2V9WA 4QPXA 1KSPA 4A8FA 5C7PA 2DEJA 2ZH7A 4K7QA 2NZ4A 2KZZA 2MSTA 2RJZA 2G0CA 3K58A 4GRSA 1S0OA 3MFHA 2ALZA 2VKZG 1NCLA 4ZPAA 3BM7A 1YTYA 4J9NA 4NXNF 4B3RJ 3DHXA 1XJWB 3S1TA 5LSOA 1CS4B 3UD3P 4ED4A 1X4AA 1E6VA 2JZ5A 4KH0B 2R8GA 3FEZA 2UU9F 1RXOB 2D74B 1DAXA 1KKHA 2M4MA 3BGOP 3DOKB 1PYTA 1A7GE 4TQRA 1KQGB 2XTJP 3RGIA 4F50A 1LWXA 4U9RA 3TAPA 1OQ6A 2MZTA 2XLIA 3VAMA 2PDAA 4OZ0A 2CQGA 5CCLA 4OYZA 2XBPA 2FHJD 1CULB 3DLBA 3PW0A 2V9KA 1RT6B 2R3VA 5D77A 3TX8A 2V4JA 1S0MA 4ENOA 3I56S 5A0YB 2VDHA 1HWLA 2C22A 5K8MA 2YWKA 4N5SA 3NS7B 1CEZA 5I3QA 3GV5B 2EW9A 4OYMA 3PW2A 1NNDA 1VQSA 5L38A 4DI6A 5E5NA 2AT1B 2ZJRQ 4DX7A 3CD6S 1CS4A 1IWAA 1VBKA 3CWJA 2RQKA 2IDLA 3K8WA 2ZE2B 3DOKA 1WUUA 3H20A 1JWWA 1VQ8S 4USJC 3AT1B 4YB6A 1QDUB 5KFHA 2DTJA 1KNZA 1FF2A 4PG5A 3SYZA 5HANA 3NGDA 3ZFVA 3KLEA 3PJ9A 1U1LA 4WU2A 4DJBA 1BD6A 1AUDA 2VF3A 1EZZB 3B8HA 3W62A 1WDTA 1W2BR 1FXDA 1CULA 5F8IA 3AD7C 4DL5A 3MGJA 4RNMA 3QT6A 4OFZA 3P49B 5HLFB 1RT6A 4B9SA 1NK9A 2QLWA 4WFXA 4JI4J 4RBVA 1RA7A 7FD1A 5A0YA 5CYMB 3MM5B 3PHEA 4HI2A 4LF1A 2H54B 1HL6A 1FDDA 1U1PA 4OYAA 1WHVA 4NYOA 3H90A 4GKKF 3SSRA 2ZOFA 3ELHA 4C8MA 2KXNB 3L7PA 3VGVA 1NUEA 2CJAA 8RUCA 1PKUA 3TAMA 3UQSA 3M8WA 2LVWA 5E3CA 4RBUA 2BJ9A 2FJAB 1RWPB 4C3LA 2ZJPQ 4AXIA 1RK8A 1WSVA 1JLCB 3BO4A 3R5AA 2HQCA 5T7LB 1FRJA 3HJFA 2BEFA 4OX6A 5CZVA 4JI3F 3AOAA 2GJIA 2ZE2A 2NPFA 2E7VA 2RH3A 4CO3A 2RVJA 1SL1A 1T8EA 4NA2A 1LWEB 5G0RB 2HLUA 3Q86A 1K44A 4LF9J 3R7BB 4ZLPA 2L9WA 1NKCA 1JXLA 1TVRA 1VIOA 3IM9A 1U48A 1SC6A 2FDNA 4LF7J 3C2PA 4ED1A 2R7SA 3H5XA 1T9WA 5HLFA 3ZTPA 4JOUA 3HFVA 2M7SA 4ZVOB 2EI5A 5KFTA 2KVIA 1N33F 1UVNA 2ZNYA 2MY7A 4B3TJ 1UVLA 5GMKa 4JI7J 5D15A 2LEBA 3MM5A 4MFBA 3VR1A 1SVDA 5KFFA 2UUBJ 5BR8F 2R7UA 2ROGA 2Y3YA 4OHXA 4P71A 1HI1A 1HW8A 1HWUA 1Z1ZA 3R6LB 2RUGA 2BANA 2Z2LA 4JI6J 4ES1A 2X3GA 5A8KB 3BEGB 2GFFA 2KT3A 5KFWA 4WFNQ 3W8GA 3PX4A 3NBPB 2GHVC 1JLCA 1T9YA 2WSEC 3DCAA 5DZ6A 5T7LA 1BLUA 5GAGU 4ELVA 3Q8YA 4NCBA 2OO4A 4YQWA 3I6PA 2OMOA 3G71S 5D4LA 4PPDA 2XHWA 3DDKA 1KVJA 4URQU 2VL1A 3MOZA 2LCWA 4U8YA 5KFAA 2R8JA 2IYIA 2IJRA 3R5CA 5G0RA 3DRRB 2FVSA 2F1FA 4OX9F 2FHKA 4XDDA 3PYDA 2HRTA 5CHCB 1J2VA 1RWNB 3KXDA 3TVYA 2GJ2A 4PABA 3OL6A 5SZTA 4JUZA 2UUAF 3EZOA 2R7XA 2OEMA 4O4GB 4RUAA 4TY9A 1PJ7A 2VC0A 1C0TB 1T3OA 1RE1B 2BX6A 2EEYA 2E66A 2KG0A 4PWDB 3MPVA 1ZOTA 3FMBA 2ZC4A 2DNOA 3PO5A 2EK6A 5EX3A 4B3RF 3KJFB 2HHVA 2XMKA 2DHXA 3M2VB 5HMXA 2G1HA 4P2SA 4EU0A 2GC8A 4CO4A 4I64A 1HQ2A 1IBKJ 1W2IA 2YNGB 1U1MA 4JV2A 2DY9A 3EDQB 3MHYA 4PUOB 1D09B 5A8KA 3J7Z5 2RQMA 1F2GA 3DLKA 5G4DA 4RW9B 4LSLB 4P2FA 2IJNA 4WZMA 2GA7A 1AB8A 3J81U 4DR7J 2GIQA 4ZVGA 5U47A 4DX6A 4F4XA 1JIHA 5KFGA 1YITS 3P5TL 2LYVA 2QIFA 2VA2A 1VRQC 5E3RA 3AA8A 3DRRA 3PNIA 4IRDA 2ZC3A 4CO0A 4C8YA 4HTIA 4DWIA 1NSKL 3THTA 3D3CJ 2VH7A 1Z2ZA 2DISA 4LFBJ 1YG0A 4O4GA 4OX7A 4KH1B 4OI6A 1B7YB 1RT2A 3NS6A 4UW2A 3H5UA 1C0TA 3GB0A 1HFEL 3BDPA 4M1KA 4ECSA 4WE1B 3VVTA 3TYTA 5B08A 1DTQB 4WBFA 5HBMB 5EWFA 4BWJA 1NO8A 2FVQA 1WWHA 1YJTA 2AJ4A 4PPZA 4LRFA 3M2VA 2F40A 1HNXJ 2J7WA 2V0NA 4ZVPB 4E2FB 3PV8A 4ANEA 5EUHA 5KFXA 2MLZA 3OFHA 2HZCA 2YNGA 5K9FA 1YJRA 5LJ3Y 3VQSA 4OZ3A 4PUOA 2HQGA 3MCNA 2HBZB 1MROB 3GJRB 2C2ZB 1Y5NB 1FA0A 5GAEI 4RW9A 4CLUA 4LSLA 4NEZA 5B09A 3US5A 4Y2CA 4HYKA 2A2CA 2AYBA 3C6UB 4OZ1A 4PXEA 4IQXA 5L9XA 3H4DA 2LQ5A 9RUBA 3TQ1A 3LQVA 4J90A 4RW6B 4RR5A 5BYSA 4MIWA 1RQ0A 2JH3A 5JUMA 1YJ7A 2L9NA 3ZZYA 4DUYJ 1FWLA 2RIJA 4LVOP 4JI4F 2XO6A 4DPUA 1OS5A 3CC4S 4Y65A 4DL0C 3BKTA 2GCFA 1B99A 3HCXA 3EGNA 1VQ6S 3CMES 1B7FA 5GVQA 4JV0A 4C8LA 3SCLE 4BBYA 1KTVA 4HT7A 2ZM6F 4ALZA 4DSEA 2QSWA 1RWKB 2FIUA 1VJQA 1RKJA 1K9MT 3Q83A 1F3VA 3MUMP 3DNCA 3OBIA 2HFSA 4LVNP 4IO1A 4YB5A 2IJFA 1I6JA 1VBZA 1GAOA 4KGMA 3GIKA 4KGKA 1DTQA 3V6HA 5HBMA 1UW4A 4O3RA 3UN3A 1IVZA 5J1NA 4FF4A 3HHLB 4UQTA 3LGNA 2LLZA 4GVBB 2HHTA 4UUWA 2KH9A 2CRLA 3IBCB 4QW8A 4DV3J 2M3DA 5F8JA 2KVQE 4Q43A 3BF4A 2LKZA 2RHQB 3GQCA 2ZH3A 1HQEA 2GO8A 4KKOB 1REVB 2IVMA 3KWMA 4EGLA 3H2VE 1MROA 3HX9A 2ASJA 2HHSA 5CZXA 2R2TA 3UR0A 1XR6A 2VPYB 2DRAA 2Y0BB 2JWNA 3LPYA 2ACYA 4ERDA 1C4CA 4DR3J 2MJUA 5B7WA 4LF7F 5CCMA 4F4WA 4A8SA 4RW6A 5F9LA 3ISZA 2FY8A 3ENVA 2JC1A 3NG8A 3P3DA 1RDRA 5L1KA 3VAFA 1IUJA 4J9MA 3O44A 4B3TF 2LDYA 4FXVA 3OTBA 4ETZA 2Y0SD 5KT7A 4JI7F 4ZVHA 4URSA 3TRGA 2OAUA 3N6LA 4G3IA 2UVVA 1SIWB 1H2TZ 2UUBF 1F1BB 2UV8A 4DG1B 1I3OB 3DOLB 4WKYA 1DQAA 2A1BA 2NYIA 3Q23A 2DHAA 3CVKA 4C3KA 3OVSA 3BKUA 4KGXB 1M0SA 4JI6F 3D0GE 3W9JA 2RAQA 4LJMA 1GQEA 1QTMA 1Y00A 4L73A 3CPWR 4X4SA 2XMAA 5KFMA 1TL1B 1H2VZ 3HHLA 4YMEA 2CPDA 4GVBA 2OJ3A 3HZGA 1QE1B 2AYGA 4ZVTB 4KGVB 2C28A 1NPRA 4C98A 3LAMA 4U96A 2AD9A 3MDFA 4KKOA 1REVA 4I68A 1YBUA 1KQSR 4CI0B 2JFKA 3DYAB 1U02A 2AZ3A 3MEDB 1PILA 2VZ8A 3O5TB 3OLBA 3GP9A 2JLFA 4YDDB 4OHWA 1CSJA 2BW7A 2OMLA 2DXEA 3QIDA 2D9PA 2GMHA 1APSA 2M5YA 4NZ0A 2DCLA 2VZ9A 5F8HA 5RUBA 1A0OB 4ID5B 4BCAA 1VQ4S 1FNMA 3ZC4A 2DIVA 2MHEA 4CLLA 2AJFE 1JB0C 2XCPA 4Y00A 1XNRJ 2QG9B 2W1BA 2VOPA 4CLWA 2C2DA 2VUGA 3T6BA 2MQ8A 3RR7A 4ILMA 4B3MF 1NPKA 4I7FB 6FDRA 4J7CA 1F3FA 1EARA 3KHRA 2QLBB 3HVWA 2CADA 3HHLD 3CW2C 2K1RB 2GS8A 4IOBA 3A3NB 2ROPA 4PKDB 2FVRA 5KFSA 3QSYB 3KHLA 1D8ZA 5E7OB 4EBDA 1UJ4A 1X5TA 4ZCLA 3AXMA 3FCHA 1TL1A 2OSRA 5KAKA 2DGSA 3EVWA 4OHVA 3J7A1 4ZVFA 3HK2A 1QE1A 1D9DA 2BZ2A 2LU1A 4P2XA 1LW2B 5KT4A 1RZMA 4QR0A 2ZHAA 4KAIA 1T95A 3KDOA 3QJPA 3IWNC 3BGUA 5DG8A 3DYAA 4U67Q 1KOOA 3MEDA 4DX5A 2VQFJ 2R8IA 4DS5A 4LRBA 1CC8A 1NB7A 1XC9A 2J9CA 1XMQJ 2UUTA 2BQ3A 2NXJA 4LFBF 2QLFB 2HWHA 2CIMA 4FZVA 4Z7YA 3W8PA 4KQZA 1Y5LB 4ID5A 4J37A 1RAAB 2DR8A 3MPUB 2W2QP 1ZPWX 4CZCA 3KNGA 4EYHB 3R97A 5IM0B 3L3CA 2WVBA 2BR0A 5DDQC 1VK8A 2VONA 1HNXF 4RW4B 1KBRA 4TN2A 4I7FA 4W92B 3IRWP 4WFYA 4YEAA 4X4PA 3F0NA 2Y1RI 4C2MA 5HQLA 2XSFA 5I42B 4EBEA 4DBQA 2K1RA 3B4DA 3BSNA 4JI0J 1RBAA 4YB1P 3D66A 1U6FA 1U2RA 4DU7A 2XCAA 3C15A 1FKAF 2MKKA 2CUYA 2GHPA 1F5CA 2FLOA 5AE2A 4DR1J 3HD2A 3TEGA 2O5DA 3RRHA 4FNHA 2YKNA 2QJ3A 4LMZA 3KUEA 2DHSA 1F9HA 2YWFA 2CJYB 4EYIB 3HZEA 1LW2A 1GT8A 1JLGB 1MW7A 1I1GA 4DUYF 2JVRA 2AF6A 4CM2A 1KTQA 2ZBQA 2R2SA 4DR6J 4ZMMA 1RLCL 4DFKA 1MN9A 1HWJA 3FEYB 2J6SA 1TAQA 4F0MA 3DKDA 3NXZA 3M32B 3QGGA 1P1LA 1XMOJ 3W7BA 1TL5A 4L74A 4AMNA 3CJTA 1HA1A 2OEKA 2HG4A 2CNKB 3MECB 3WHIA 3N28A 1J5OA 2EBEA 1Q78A 4BC7A 4DQPA 4DLEA 1FXLA 1XN9A 4CO5A 1LOUA 2MEWA 2VPWB 1RT3B 5D0EA 2BJDA 4ID8A 1VS3A 3HSZA 4F4KA 5IM0A 2LXUA 3D28A 1MMLA 4G1QB 3O3LA 2OKQA 5KG2A 5AE1A 4ECUA 4DPWA 2J7UA 2OPPB 1TTHB 1VQ5S 4YFUA 3G87A 2PEBA 4RW4A 2ZBRA 4CO2A 1RAIB 4NLUA 4DV3F 4EEYA 3J7ZT 3HHDA 3DLHA 3SXLA 5I42A 2G1DA 5IQQA 4DPTA 1SL0A 2AGPA 1SJ3P 1M5OC 2W7OA 3MMCB 4JI8F 3G6YA 2DNHA 1OSDA 5L46A 1R8PA 4C97A 4QPTA 3CIMA 3V5RA 4DR3F 3BBFA 5FJ4A 4ER8A 3D6MB 1R0BG 3FQKA 2VJVA 2CZ4A 2COLA 2AIRB 1S48A 2DNYA 1S4FA 4MKAA 3PHTA 3RBXA 2HS3A 3U1LA 3T1AA 1JLFB 1VOMA 4MH8A 3RW6A 3D0HE 3EVMA 5JJBA 2MKHA 4OJHA 2HQDA 4GKJJ 4DN9A 4DZ6A 2ZH8A 1WD6A 3TAQA 3M32A 1NJXA 5KFZA 1UL3A 5F9NA 2JHEA 1D3WA 4IR1A 3OTCA 4DU8A 3FQLA 3MECA 3BGFA 4IH7A 5HVFA 2RU9A 5M2UA 2GX8A 2AU0A 1RLDA 2DEIA 2E1CA 3ZZPA 2XY7A 1RT3A 3RAQA 2YQ1A 3MD1A 5C2CA 4X62J 2Q6BA 3IO1A 1OO0B 3D4JA 4EO6A 1HR0J 2JJ4D 4G1QA 2Q79A 2DGOA 3FEXB 2F7VA 4B02A 1TFWA 2OPPA 2FHMA 1TUWA 2I9SA 1N4LA 3W5ZA 2JEJA 4ILRA 1R89A 3UDVA 4F26A 1RAOA 3PR5B 2MZSA 1Q5YA 2O1PA 4NLOA 2CAJA 3IA0A 1OY9A 1S77D 3M1VB 3X1LB 4DV7J 3MR7A 4LF8J 2BE9B 1Q0NA 1SV5B 3UNYA 3MMCA 4AMMA 3R6GB 4FF2A 4M5IA 3R2CJ 3JTOA 2HHUA 4DL3A 1N5QA 2R7TA 4CQ1A 1PGZA 3CT9A 1IQZA 2IHR1 4ELUA 1GTHA 1DTTB 2XY6A 2FLNA 2MKIA 3IRXA 3FZ2A 3PW4A 4HHJA 1JLFA 1RHQB 1ZM4A 1DBDA 4NLWA 1U2FA 1KN6A 5D4OA 4X4NA 3D6HB 1XEZA 4B08A 4H4MB 2CJ9A 1XNRF 1NSPA 2HQ3A 3N79A 1L3KA 3QGHA 1LFPA 1AUSL 2CPHA 1OPZA 3MEEB 2PMWA 3AJ2A 1X9WA 1VIXA 1NPPA 3ADAC 3CCMS 1KFDA 3OXFA 3GR0A 4WFZA 3P6YC 5I4MA 1Q1KA 4C0BA 1AXQA 1FD8A 2BKOA 3PYEA 2MSSA 2DGXA 5K8PA 3PIOQ 3RB6A 2XY5A 4KPYA 3GYXB 3MR5A 2H9ZA 4CTAB 3GFYA 4DSIA 1C1BB 4JBCA 4ZLJA 1RU1A 5FD1A 4JI5J 4OL8A 1JX4A 3I31A 4AQYJ 3HHEA 3H2UB 3V4MA 4P9SA 3P8BB 3CCJS 4WFBQ 2RDDA 4WK3A 3DRSB 5JVHQ 1SV5A 2F9DA 1Q53A 1UWAA 3M9MB 3KMQA 4I1TA 2VQFF 1WHYA 1WHWA 3QBCA 2OFGX 1VQYA 4Z2XA 1TKDA 3KUGA 2HS4A 3JTPA 4DFMA 3G8SA 1XMQF 1FEEA 2OPQB 3D3BJ 2A2DA 1UMJA 1FJEB 1C4AA 4CYUB 3ZZOA 3W9IA 3DDNA 3ZNJ1 1C0UA 4ZP7A 4USMA 5T41A 2XHCA 1SCJB 1DTTA 3W64A 3N0VA 3ZNUA 2BYCA 2IMOA 3I9V9 3VALA 5HAOA 4HDHA 4Q8FA 4Z7CA 4H4MA 3ISNC 4JI1J 4WYWA 4WTYA 2R4FA 1PIEA 1RHMB 5A76A 4M5GA 4WCEQ 4KO0B 1HIYA 3WC0A 4NL5A 2A6MA 3RB3A 4RW8B 1N6QB 1WEXA 1YJ9S 4OX8A 3RZAA 1PO6A 4WXWA 4DHVA 1S6OA 1RWXB 1LXNA 1DQ9A 5GMEA 2YKAA 1M5KC 4JI0F 4FKXA 4DSKA 4P2MA 3SBMA 4DR1F 5E3PA 3KNAA 1NZ8A 4HLBA 3CJKB 2WVFA 1L3VA 5KT6A 2XGQA 1RAFB 2N7YA 3SV3A 1Y4ZB 2CG4A 4A47A 2MTLA 1LW0B 1FERA 5DETA 3C16B 4U7CA 3M2RB 1G1XA 1RT1B 4MKYA 5C2GA 3WIVA 4DR6F 2WHOA 2FZGB 2YXLA 2MKYA 4DN0A 1KFSA 3K0JA 4NRTA 2FY1A 3FC9A 2RRAA 3CD5A 3GPAA 1XMOF 2LA6A 3K2YA 2HNZB 3HHKA 3EPIA 1U4BA 2OPQA 4G65A 3HFZB 4CYUA 3R3TA 4RUHA 1VMBA 1XNQJ 3CD7A 3H40A 4IRKA 3PXGa 3KMSA 4LF4J 4ECYA 4DPYA 4M5DB 2GHWA 3C19A 3F41A 1F0XA 1R31A 3BGRB 3M8SA 3D1OA 2O01C 4KO0A 4OZNA 1F5AA 4KIAA 3M9NB 4RW8A 1WG4A 1RAHB 4TLRA 3HKWA 5LMUJ 1DHMA 2WBRA 3O2IA 2OGUA 2C3PA 2XZTB 4ANDA 4CLPA 3DHWC 2ZITA 2HFVA 1FRHA 1FD2A 3TR5A 5KOXA 4QJVA 4ANCA 4ECZA 5F41A 3I5CA 4W4MA 4QYZK 1TP7A 2ZH4A 4DV4J 2HFUA 3EM1A 1EX8A 4I69A 2OH2A 2XMVA 1VHIA 1S79A 4DV0J 1LW0A 2K8GA 1RHJB 3C16A 3ILLA 2QX0A 4FF3A 3M2RA 4WK1A 3VAJA 1QVFR 2G4BA 5KFEA 4ZLLA 1IR1A 4FNIA 2AYMA 2AJ1A 3LP0B 4ZOSA 3P96A 4GKJF 3H8YA 2H5JB 4LIRA 1QD1A 1P6TA 2HNZA 4WXOA 4CT9A 1N36J 3EX7B 2VG5B 2K3IA 3HD1A 2V2QA 3OFGA 2NR0A 4EMDA 3Q8SB 1EAYC 1X5SA 4X65F 4O4RA 4ZJOA 3CJ5A 1MN7A 4DUZF 5CXTA 2MLYA 1T05B 1BE4A 5F8MA 1N32J 1NJZA 2DXDA 4M5DA 4E98A 4MIBA 4X62F 4LQ9A 4I6AA 1HR0F 1CVJA 3C66A 3GCWP 4KYZA 1OWXA 3BGRA 1XWLA 2X3DA 1U09A 2ZNZA 4OQJA 4FYVB 4L6V3 2ZHOA 3HVRA 3HSGA 1IXKA 3TUZC 1H98A 4UTGA 2NXNA 5C42B 5HROB 1RT5B 3TZZA 2EG2A 1O8BA 2W2PP 1SUQB 2MXYA 4WWSA 4F2SA 3UCZP 1NK0A 1S7HA 3QT8A 4LF8F 3IGNA 3A8JA 3BJYA 3UDCA 3A8KA 2KB2A 5D4PA 5DGAA 4P74A 1Q5VA 2P5VA 3FUYA 1TKXA 4ICLA 2HHXA 2DPIA 4PCQA 4MYTA 3W60A 2BUNA 2LDIA 3PYFA 4LR9A 1WC5A 1WELA 3F44A 4OYWA 3K8VA 3OVAA 4L72B 2FJVA 3UCGA 1GFWB 4USIA 4NMXA 3LA0A 2BQRA 2HHWA 4ED0A 4Y2MA 1ZETA 2V2ZA 2Z2MA 3LP0A 1YBAA 5LJ5Y 5F3TA 4RWXA 3BH6B 1ITPA 2I8EA 2R42A 2XQCA 2JEIA 3W2VB 3IFEA 1WOPA 4RNFA 2VG5A 3M4XA 1JXVA 3JSRA 1JXEA 3GYNA 4QQBA 1KRPA 2BVZA 1TK5A 3JSBA 2MZ1A 1GX5A 2A18A 1FJGJ 5GADU 2R7WA 4HI1A 3UW1A 4DLGA 2XC9A 1T05A 5EWEA 2MQNA 1FESA 2CDRB 4PWUA 2RNEA 5ETQA 2CFXA 4ZS6A 5LOQA 3OL8A 2W24A 2RMLA 2OD6A 3DU5A 3NWRA 4FXDA 4P75A 4ZDNA 4O23A 1RTZA 2OUGA 2E9ZA 2J9DA 4JI5F 1TR0A 2IM0A 5C42A 5HROA 1HQUB 5H9FK 2N3LA 1RT5A 2DT9A 4USTA 4AQYF 2ZH6A 4OLOA 1SUQA 2LU2A 4IG0B 1UVJA 3NGSA 1FXRA 1RHUB 3NKYA 2I5JA 2YNHB 3M8PA 4OJGA 2MQMA 4ZIVA 3T19A 1S9EB 3UVJB 5LSRA 2QYCA 3DLEB 1RAJA 1QJHA 1HHTP 2FPHX 2U2FA 2HS0A 2WVDA 4R8UB 1MU2A 3AHPA 2L41A 2NSCA 2BE2B 1TAUA 3QAUA 2D3O1 2YX7A 5SUHA 4NOHA 3BO2A 4I6YA 1VDHA 3UDLA 1QAIA 3EMTA 1WTFA 4JI1F 1O6XA 3LF0A 3I5BA 1YSJA 3POTB 1WG1A 4ZPTR 4ED7A 4JP8A 3FBBA 3RAXA 5HO4A 3LTOA 4ZCKA 3KLFA 4Q2LA 9ATCB 3FNNA 3H42A 4RNOA 4J9LA 4MK8A 1ZYQA 2R2UA 3EDRB 1RUSA 1S0NA 4ZPWR 3S7RA 2BOPA 3LP2B 3RBDA 4Z37A 1NBEB 2W25A 3GIJA 1YLXA 3BKFA 3D7SB 1T9XA 1H7XA 1ZM9A 5HP1B 4DL2A 4H4KC 3OW2R 1VK3A 4MKVA 2IY5B 2AZ1A 4DV2J 5IWAJ 4A8MP 3PFOA 4FPRA 2QMXA 4K4TA 2V50A 3JAMY 4PR6A 1HQUA 1ZPVA 2Y1IA 2LXIA 3S01A 1IR2A 4QU6A 1RA6A 3JS9A 5ETTA 1TQLA 2VG6B 4C4WA 4YR2A 4OJ1A 2YNHA 1R0CB 2LQJA 4Q2MA 1FNOA 3EWGA 4WTOB 2ZD1B 1S9EA 3GTYX 1U45A 1KEKA 1T02A 1RTDB 3MCOA 4HTJA 5JXSA 3GZ7A 4ZCIA 3KUHA 2PO4A 2Z2YB 3RRKA 1Z4UA 1F60B 1CBKA 4R8UA 1F5BA 5H9EK 1EB0A 1W25A 2VU5A 3DDIA 1S6QB 2N4CA 3CO0P 1XNQF 1U1OA 3AB4B 1B0PA 4DSLA 3CCLS 1DFDA 3KLVA 1WHXA 5GAGI 2X1GA 3POTA 3DGVA 4P7TA 1FX4A 2WCXA 4NPOA 3R1HA 3W2WB 2XMWA 2ROEA 3A13A 2C42A 2MDAA 1WC3A 2QMUB 3HSJA 3SDEB 5D3GB 1RHKB 3K5OA 3OFFA 1SPBP 3R9LA 1X9MA 3SCKE 3SZ2A 2HEKA 1ZZFA 4XK8C 4YS2A 5AE3A 1YIJS 3LP2A 3DU6A 4PG8A 3BSOA 4UZCA 1RTJB 2VG7B 2HHHJ 4XIUA 3HVTA 4HKQA 4K4WA 3MM7A 4DV4F 2W01A 4PEOA 3TJAA 2Z57B 1KQFB 1S49A 3NY0A 2QL7B 1U1RA 2R7RA 5KFBA 2G0IA 2XEXA 4HACB 2H4WB 4DV0F 1NZAA 1R6YA 2WZ1A 2D7SA 4HH0A 1EP4B 4FS2A 5IC4B 3K5NA 1T03B 2J0QD 1Q8KA 4DUTA 2HSEB 1MSWD 2EVZA 1WJ9A 2UUWA 2V69A 3KOAA 1YQHA 2QZ8A 3Q8VA 3KJVB 2RRNA 4NX9A 2D9OA 3FCWA 2RRBA 2ZD1A 2QLXA 3NLCA 3HI9A 1RTDA 3NL0A 2DHGA 4DF4A 5B0EA 1T7PA 4EK2A 2J0SD 4PG6A 3BS9A 5HJYA 1NJYA 3E01B 2EPIA 5CYQB 2KFNA 3TANA 4NXMJ 1S6QA 3Q8QB 1M5SA 3KG4A 2WB4A 1JJCB 4OYOA 2ALYB 5A2QU 4OV6A 3PVXA 3HULA 2R8KA 3AD8C 1X4DA 3M6UA 2AX1A 3MEGB 5D0RA 2HVEA 4KTQA 4N41A 5IXUA 2WK4A 2HIQA 4C11B 5J2PB 3MPYA 1QAJA 3W2WA 2KFYA 1S0VA 3ONQA 4F3QA 1VQ9S 2DNRA 2ILYA 2PD1A 3DM2A 1WORA 1KR4A 3OQ2A 2BJ8A 3SDEA 4QCLA 1QAYA 3SI8A 1S1UB 2YVSA 3BBBA 4RWWA 1SQGA 4K0KJ 1MNEA 3X3UA 2W2OP 1RTJA 2OFHX 4ED3A 3VV2B 2W7AA 1EKRA 1NDLA 5KT3A 4PG7A 3OTEA 4HACA 3QJLA 4KHPJ 2KL8A 4WZQA 2OELA 4FYWB 2CPIA 1L3SA 2VBYA 3R1LA 4K50A 1T03A 3CDWA 5A2QY 3WZ0A 2XWYA 4NLSA 5L1JA 3TI0A 4PXDA 5IV4A 3FCVA 3MI7X 1R8HA 4AMOA 3BH7B 5DJBA 3KJVA 1ZZNA 1W26A 3J81j 2JVOA 3J80Y 2X1AA 4LUBA 4FKYA 8AT1B 1E6VB 4JI2J 4K59A 3E01A 5CYQA 3TEHB 4TLQA 1FJGF 1SL2A 2XS7A 1EQMA 1FDAA 3MEGA 5LXRA 4FP9A 4ZN3A 2AP6A 2F4VF 3RR8A 3W3SA 2MQLA 1U2CA 4C11A 4AYBD 5J2PA 4LRCA 4K4UA 3CE8A 4FPIA 3IGVA 1WEYA 2P8IA 4EWTA 3M6WA 4F0KA 2V34A 1S1UA 3EPGA 2CQ4A 3IBFB 1S1VA 2BOAA 5AJ3J 2FHJA 3V6JA 3CSKA 2A6OA 4QW9A 1NDPA 2IA0A 4DFPA 1XBWA 4IYQA 2W2NP 1DLOB 5F0WA 1TL4A 3EVOA 4F0HA 1RCOB 3UCUP 3HSDA 4ECWA 3VGSA 1SC1B 3CCSS 1KC8T 2V8PA 3DRXA 2Q66A 4LIWA 2YH1A 4P52A 1OIAA 1GX6A 4H4KA 4CP5A 2DRDA 4X4RA 4HT5A 2CQDA 3ZZTA 2FVCA 2JRSA 4C48A 1S12A 5ITHA 4DV5J 2W4PA 2VASA 4TU9A 1G7CB 5E3AA 1NSAA 3FRYA 3AXKA 1R43A 4XAKA 2Z4PA 1WOOA 4AL6A 4W90B 2F65A 3G8QA 1S1TA 2H1YA 1CPZA 1RBLA 3AD9C 5ETLA 3CDUA 3ETOA 3LH2S 3D9BA 1FJCA 3KLEB 4DV2F 3OR2B 3QQCD 5L8RC 3HFKA 1QY7A 5K14B 5B0CA 4IOAQ 2NSBA 1TKTB 2AX0A 2DR6A 3ZTOA 3H4BA 2ASLA 2G9OA 4LREA 2ZVSA 5CD4A 4XTTA 3VGUA 4OI4A 3EGVA 1FKOB 2E5LF 1SKSA 2HVIA 4P7VA 3PRBA 2HRUA 2HLTA 4IOCQ 2MHNA 1NU4A 3M30B 2CQBA 2QE5A 5KG0A 3CMAS 3TZXA 1S6PB 5LM7E 4ECRA 4J9UE 4ZVRB 3NOCA 4K4VA 3HO1A 1DLOA 5HQMA 4MYUA 2IPOB 5KFUA 1TK8A 1PSDA 2B5JA 3M2UA 2APOA 1PG5B 3DGPB 3I4PA 4QIGA 4TU7A 1Q7YT 4PAAA 1WNEA 1VC6A 3SCJE 2DRBA 3CJ2A 2G0JA 1Y9OA 3TAMB 3A8EA 3QZ8A 2HNDB 5ETNA 2ATCB 2ASYA 1RYSA 2DGUA 2G2OA 1S1XB 2ZDOA 3GONA 5KG1A 1YBTA 1GTEA 3IBWA 2V67A 2KRBA 1UFKA 4DSJA 3GFXA 3OXLA 3CCUS 1WC4A 2PA3A 4OLPA 3EICA 2H5IB 4DX8H 3NP5A 2ZBPA 2H65B 2HHHF 4HHUA 3PX0A 1TVRB 3QFWA 4WFAQ 2VFTA 3OR2A 3WDOA 3IP0A 3QSIA 5K14A 3FZBA 5DRKA 5A8WA 1YI2S 1TKTA 3QWUA 2RQ4A 1KONA 4O3SA 4ZPDA 4L76A 1OY6A 5THWA 4IRCA 3CB4A 5KG3A 1FKOA 1Y3JA 2YY3A 4LF6J 4TKTA 2KM8B 2FLPA 3KKFA 5M2RA 2M8HA 3M30A 3QNWB 2C3MA 4MFBB 2YKQA 1JJ2R 3OL7A 5CAAA 1S6PA 2CQCA 1D9AA 1NK8A 2PIIA 2X1FA 4BC9A 2ZWPA 3FFIB 3DGPA 4K5RA 3ET6B 4NXMF 5IQ6A 1L3TA 2BANB 2B9XA 3BPDA 2AJ2A 3B4MA 1FNXH 1GMWA 2HNDA 2V8GA 2H5EA 1VI7A 4ITSA 4DPOA 3CUNA 1S1XA 2FC8A 3BZQA 3PJXA 2GGPB 2C3OA 4J5OA 4ECVA 2ZKUA 2I38A 1HARA 5KFCA 1WSRA 2Z30B 1SC4B 1GXTA 3FSYA 5DLGA 4Y3CA 3CO9A 3AAWB 1YJVA 1X8DA 5D4NA 4W98A 2ERRA 2HVDA 4Y28C 5H1SV 3M7VA 2ADBA 4QIEA 2HQFA 2RUSA 1N5VA 4KHPF 2IBKA 4DV6F 1G3OA 4P10A 5FIIA 3BQ1A 2J0XA 2F8EX 3LANA 1NKEA 2ZOGA 2E5IA 3EXCX 1XMBA 3TOQA 4DL6A 1VR6A 2CDQA 2EWHA 3AJ1A 1HNVB 4LFCJ 2YKPA 1KOHA 1FVQA 5KFPA 4OHZA 3A3PB 2PGCA 2IM3A 3T5LA 1GMWD 4UT4A 3GCXP 1K1SA 4JI2F 4GC6A 1UZHA 3I0RB 5L9NA 4QR2A 1ZAVA 3FFIA 3CCRS 1JLQB 4CM0A 3GWCA 3ET6A 2PE8A 3KLHB 3QWPA 1N8RT 1VBYA 2FVPA 3UE2A 3NCQA 2ZKTA 2B43A 2ZWOA 1Z2LA 3DLKB 4AD6A 4ZITA 1SKWA 2HGNA 1HI0P 2GGPA 4NASA 4QIWD 4ATNA 2VQEJ 1GH8A 4F25A 4ZHRB 1UPMB 5F3ZA 4OZLA 1I5OB 1M5HA 1PYSB 5HVHA 3MMJA 3Q8RB 2RKIB 1X5OA 2MZRA 4YY3F 5AJ3F 2ATLA 3DXSX 4RNHA 1UVMA 3WX4A 3B6BA 4OYIA 4M5NA 3V2UC 1QSSA 4MJKA 2ASDA 3FSXA 3GILA 4ZVUB 2Z8QA 4USWA 2XNQA 2QFJA 4EI2A 1RT2B 3IWXA 2M52A 3UDEA 1RTIB 4B9TA 3PW5A 2CKWA 2B4PA 5T14A 3G6XA 1T11A 3CIZA 2VJUA 2VFSA 4B9UA 3CCWA 3GFHA 1HNVA 5L1IA 4UZBA 4HDGA 2V68A 2DH9A 1I94J 1IKYB 4WYLA 3MAHA 1ZM2A 2GO9A 1FKPA 1WOSA 3QFHA 4UUXA 2P9EA 5F0UA 3I0RA 4PYAA 4K2JA 1HBOA 1JLQA 2VBWA 1VRUA 3KLHA 5LT5A 4OHYA 4ZP8A 3O1LA 2VDIA 1HD0A 1S59A 3MPDA 1REGX 1SXLA 3BR8A 1NXIA 1LEOA 5E0OA 3DI6B 4M5KA 4NXNJ 1B70B 1X31C 5DM6Q 2Q43A 4V19X 3HMJG 1FFGB 3QRPA 2A0FB 3FBCA 3H98A 1GMVA 2XYGB 3N4WA 2MKJA 3GV7B 2CNNB 2YBVA 2HBQB 4ZHRA 3KFWX 2K2PA 1N0VC 1N52B 4IFVB 2E1AA 4ZVSB 2RKIA 2DR5A 1QUVA 1UVKA 3HXMA 4CH1A 5CZCA 2BRLA 1TUVA 2RDJA 2YKMB 5D0HA 3NNAA 3PR4A 2EFNA 3ENQA 3W9HA 1IJFB 4ETXA 3PTWA 1TMMA 2HAFA 4ZVEA 1RT7B 2HFNA 2HFOA 4OYXA 5E41A 2KKHA 3UFCX 3NWGA 3RJMB 1RTIA 2IA6A 1S1WB 3I0SB 4HH1A 2AWZA 5C5JA 4Q7AA 3B54A 1X4FA 5CABA 3J81Y 1IKYA 3PEHA 4UY8T 4XO0A 1F6TA 2E5HA 2HKEA 2XMJA 2E5GA 2MGZB 3RG6A 3MF5A 3UD4P 2HHPA 5J2NB 5KT2A 1UP1A 1LQ9A 2DPJA 2W7PA 1HQEB 2P6SA 3AJDA 4GVLA 1HLWA 3R8YA 7AT1B 3DI6A 2XLJA 3T41A 2D3OR 5DQIA 4BDPA 4KGZB 1HKAA 4QYZJ 3DMJB 1JMTA 3QZ7A 1UETA 3ILJA 1DJ0A 4B9LA 2CPEA 2NLWA 2VPZB 2BM1A 3MM8B 2ZZTA 1BGXT 3PRDA 1BHNA 1O0PA 5DQHA 3Q0AA 1UFWA 3D67A 5HK4A 4IFVA 1FFWB 2DHHA 3MAQA 5ETRA 1NDKA 1CC7A 3M9OB 3OTOJ 5K8OA 3TUJC 1R3NA 5A8RB 3MEKA 2PI5A 1ZS6A 2YKMA 2VKRA 5BJRA 1AA1B 2Z58B 1UEUA 2JNJA 1CG2A 2Q6CA 2OIHA 2J76E 1CQNA 1Y7PA 5E3QA 4AUKA 1RT7A 2FC9A 3BQ0A 2DNPA 1G2EA 2CPYA 1SH2A 2GIFA 1TKZA 3UR3C 1S1WA 3I0SA 2LQ9A 3AA9A 1RACB 2UXCJ 2PT0A 3RB4A 3OL9A 4OI2A 1S10A 4CLFA 2FUG9 3GIIA 1S57A 4ZIWA 2MGZA 1HNWJ 1YDLA 1LKZA 5ETPA 5J2NA 2D3UA 2H4YB 2HURA 3MUVP 3BO3A 2NPIA 1ULRA 4XPCA 3CF5Q 1TV6B 2FJXA 3A3OB 4LF9F 4KV8B 1SC3B 5BYRA 3BN7A 4KSEB 2RQCA 1KVIA 3CJ0A 5FDLB 5I3PA 3DMJA 2OPSB 2B6AB 1IM6A 2C3YA 1Q82T 3MM8A 3AB2B 3U1NA 4C0HA 5KFJA 2ZDPA 2DD8S 1HBMB 4F04B 2A3JA 1N5SA 4ZPCA 3KK3B 3GFZA 1VJWA 5A8RA 3L7UA 2W4DA 4LFCF 2VC1A 4P73A 3O6QA 1YZ7A 3BYPA 1UCNA 1XTZA 4M5JA 2CJBA 2DNMA 3NGUA 1SH3A 2PN6A 1WF1A 2BDPA 1VHFA 2LXFA 4MK7A 2GMLA 2Y9HA 3GMGA 3DRYA 2AEJA 4DEZA 1YVFA 2EG1A 3PJWA 1F9EB 4CDIA 3NAIA 3QIPB 5BR8J 1B0VA 4DQIA 4X84A 3SIPB 1RU2A 1H38A 2VQEF 1RGVA 5IV3A 4UOGA 1U1QA 3Q24A 5D78A 1EQ0A 4NWBA 2YKOA 3QT5A 2AGOA 5B0BA 3E3XA 1U25A 5KFIA 4Y2IA 2R9LA 4UOCA 1NJIT 3CGIA 1TV6A 2D41A 2HMIB 4CLSA 4GO7X 3K57A 1GNKA 2IFXA 4B9NA 1Q8LA 3MM9A 4KV8A 2V94A 3H0PA 4DFJA 1IR0A 5FDLA 2C1EB 2IBOA 2OPSA 2B6AA 1AROP 2ZH9A 3Q8UA 3N6NA 4QWDA 1Y11A 1NHUA 3N5BA 1HBMA 4ZN1A 4H54A 4KT0C 4RU9A 2N82B 3KK3A 1UVIA 4PQUB 4XPEA 3CD0A 4X66J 4Y6IA 2AHOB 1I94F 3UD5A 2OPRB 2ABYA 4DL7A 1S76D 4JV5J 2DGQA 1IBKF 1CLFA 2LMIA 1PJ6A 3K5PA 3F56A 3DFEA 2YWHA 2WSFC 3J7YU 1OYEA 5DS7A 2XSJB 2MQPA 4GC7A 3C15B 1V5IB 2R8HA 3G96A 2BW2A 5LMNJ 4F4ZA 1U1NA 3A1YG 3QIPA 4DCOB 2M88A 2Q3PA 4DCPB 3FBEA 2BXJA 2YKNB 4X4UA 4DR7F 3PX6A 4YN3B 3I96A 1NJWA 4MIAA 2NUUG 3GYGA 4O3NA 5HSPA 1IKXB 3W61A 2WAQD 2HMIA 4WP8A 4QU7A 2DVIA 3PCOB 3IS9B 2X1BA 2PMHA 2ZUAA 2K7JA 2R7VA 2IDEA 3GU0A 4Y0FA 2YWEA 4URGA 5IC6B 1NK5A 3CJ8A 3THPA 3N01A 1OJ4A 4F7VA 3SEOA 2XZDB 1J5OB 1JKHA 1VQLS 4YOEA 4N77A 2B8QA 4TNOA 1ZAXA 5H9EJ 2MKSA 4NZ7A 5EX0A 3N5FA 4PQUA 2GVZB 1M1HA 2DNLA 3C3LA 2OPRA 4FDFA 5KOWA 3MAAB 3GG0A 1WEZA 3H2LA 7FDRA 4ED2A 3FJ2A 4IKAA 4ZKAA 1S5ZA 4NI2B 4RBTA 1CJVB 2BJ1A 3OFEA 4Q5VA 4OI1A 4A8YA 1RADB 5FLXU 2XSJA 4CNZA 4MT1A 4ZCMA 2J6UA 1LFWA 4EO8A 4F2RA 4XDCA 3KG1A 1LXJA 2C2NA 4UOHA 4NLYA 3PACA 4GMKA 2OP5A 3MR3A 2Q1LA 5J1PA 2W9AA 3U02A 4V1Ak 5HMYA 3MCMA 4AFFA 2ZUGA 1SJ1A 3GIRA 3VQTA 2ZH1A 2OI2A 1HHQA 1B0TA 1S72S 4A8WA 1IKXA 5KG6A 3OTOF 5DLFA 2CNLB 2B51A 1WI6A 1V3RA 3IS9A 3R2DJ 1BY9A 2Z56B 3HLUA 4ED5A 1RTHB 2B3TB 5GADI 2HRYA 3I4HX 2HGLA 2KN4A 2KT2A 2DO0A 2J0WA 1UPPA 3VZHA 4UF4A 5FLXY 1FVSA 1IKVB 4OZ5A 3VAKA 5F8GA 2UXCF 1MMDA 2DGTA 2GVZA 2P2CB 1FRIA 5J2MB 2VBXA 3MR6A 2E7WA 2MKCA 2F63A 1HNWF 3MAAA 4PQAA 1PJ5A 2ZM6J 1Y0HA 5MAOA 2E9TA 4PWWA 3N9UC 3A8IA 4NI2A 1CJVA 4DPXA 4DF8A 4EZ6A 1Y10A 2UVUA 2JLEA 2W9BB 4QR1A 3PYGA 2W8KA 2W8LA 1J5EJ 5KFOA 1U6ZA 3UPFA 5A6PA 2MB0B 3BQ2A 3T1HJ 1FRLA 1X4CA 4NLDA 2HK3A 4A48A 1JLBB 2RE1A 1ICEB 3IRXB 1X60A 1W7WA 1TZ0A 4OI0A 1HHSA 2ZJQQ 1N5TA 2U1AA 1K47A 1N54B 2MLXA 2VHGA 3SSSA 2WVCA 3LWLA 1RBOB 3EZ5A 4OYBA 1P8GA 1RTHA 1FEHA 1HBUB 3FBFA 4FN5A 3THVA 2CJKA 4X4TA 1M1KT 4UQGA 4CH0S 2CVIA 1N0UA 3EE3A 1FRXA 2QV6A 2CPFA 3ZTSA 3K7RA 2WBMA 2VV5A 1PAEX 1IKVA 4ES2A 2F8HA 3CJQA 4WPAA 5CYMA 2ADCA 3WX8A 1H6KX 4F36A 2UZAA 2CQ3A 3NRBA 2CWXA 3KHGA 1ZA1B 1TL3B 4LT6A 5J2MA 3CCQS 2UUCJ 1PCAA 2MQQA 4Q44A 4DL4A 3H59A 3KHHA 3PDNA 1RISA 2UVWA 4I0WA 2CZVC 2IIHA 4NE9C 1R7IA 2FLLA 4OZJA 4J91A 5MLCV 3AFGA 2HZAA 5B0DA 2KXHA 2W9BA 3CCZA 4FYXB 2KI2A 1P1TA 5LL6d 3ENAA 5EHHA 1U24A 3ICLA 2E29A 3TP2A 3DN9A 1FFSB 1C0UB 3L4BC 1RWVB 1S99A 5KTQA 1JLBA 2IVYA 3NOGA 3QRQA 1BXNA 1LWEA 2EXUA 3L09A 3MOJB 3I5AA 2BRKA 1G4CA 2IAJB 5AXNA 1MWQA 3NGRA 4DMZA 4X66F 2CQ1A 2B8PA 3NCRA 4X4OA 2DNGA 3HHLC 1FTRA 1HBUA 2W9CB 4A8QA 4JV5F 4F3MA 5KT5A 1VC5A 3LGMA 2XGPA 1PAUB 3N6MA 1RJJA 3IM8A 2LA4A 1VQ7S 2J9DE 1H7WA 1MLAA 5GAHU 4ZA1A 1FE0A 5DG7A 1AT1B 3P5BP 4ZK7M 5LMNF 1P9QC 2CQHA 3K5LA 4LR8A 4I2PB 1TL3A 1NDCA 4B3MJ 1YGYA 2DJWA 4LF2A 4B9VA 3OD2A 2I1RA 3Q22A 3CEDA 2O67A 2C2MB 1TU0B 1NMEB 5BXIA 2BA9A 3NBPA 2V8VA 2BQUA 2NXCA 3BSAA 1DY3A 5L1LA 3JB9k 4X64J 3S8SA 3VWSA 4WU3A 1B3TA 2HQIA 1CQMA 2AW0A 3IAS9 2J6TA 1M90T 4FVMA 4EBCA 3M8QB 1RWOB 4ECQA 1RKIA 3VTIA 3OJSA 2IAJA 3EJMA 1UA1A 4RU2A 1Y3KA 1WF2A 3NAHA 2YNIB 1VRTB 1BQNB 2W9CA 4DR4J 4CLYA 1JLEB 4M5LA 2FJEB 2DNZA 3ILOA 4KJIA 3T5JA 4NA1A 2GNKA 4PWDA 4TQSA 2KHCA 1GXUA 3CCES 3CC7S 4PXCA 1HI8A 2VA3A 1MG7A 1NHKL 2NQPA 3O8WA 4I2PA 3TUPA 1Q16B 2EC0A 2AEMA 1FHTA 3CJRA 3C8YA 2B4UA 2G2YA 4J9RA 1NK4A 4DR2J 4FVCA 3OXGA 2KYXA 4C6AA 4CWBA 2BACA 1S97A 1YJUA 1JJHA 1Q8BA 3H25A 2YPYA 2D69A 5KFRA 4IFYB 2BBEA 4I6WA 1NRKA 3GSIA 2WSCC 2W4CA 2CNOB 3JSMB 3PFEA 4I56A 2B56A 3WC2A 1CJUB 3RUBL 3VHQA 2R7QA 4L3KA 4J9QA 3U7JA 3M8QA 4NCGB 2QL9B 2QEXS 1TMJA 3VAGA 2YNIA 3CDEA 3BBCA 1VRTA 1BQNA 2XS2A 2JC0A 4NEYA 1FJ7A 1JLEA 1H74A 1N34J 2DR7A 1X4BA 1YZ6A 2QL5B 4N56A 2B9YA 1VQNS 1MMNA 2RHSB 2IVFB 1DARA 4WE1A 4OZ2A 1HWIA 2V8HA 4N8NA 4J9KA 4G1PA 1JJ4A 4BHQA 1X0FA 5EN1A 1TKXB 1J5EF 2X7IA 4ICLB 2HIYA 4LRAA 4OMFG 1H3DA 4NLRA 3T1HF 3TWZA 3MM6B 1GK8A 4DQQA 5BYQA 1D8YA 3HHNB 2DNQA 2EBGA 4MAKA 5B0GA 4F02A 4JI8J 2L08A 3MUTP 1Q8IA 1B4SA 4IFYA 2DIUA 4NLGA 3IG1B 3T1YJ 2GAHC 3C6UA 3NS5A 4NRUA 3JSMA 3LALA 4ECTA 1SKRA 1L3UA 2KG1A 3AOBA 1CJUA 1UFLA 2CG8A 2KZMA 2HFZA 2DCUB 3U27A 4RZRA 4NCGA 1XR5A 4U95A 1RI7A 2VFVA 2DR9A 4RL1A 2CQ2A 3ENWA 2ZEJA 2QSFA 2I0XA 3HKZD 2Y1LB 2UUCF 3HDSA 4Q8EA 3M6XA 2EFVA 4Y2KA 3BN4A 5HMZA 2UVRA 3GJSB 3AQOA 4ZVQB 3FSIA 2YWGA 2G13A 4WKRA 4C8KA 1UW9A 3GLJA 4R25A 2J5AA 3BB5A 4DV7F 3NMAA 2AJ0A 3RTVA 2MQOA 2OSQA 4IDKB 2FJDB 2I5JB 3M8PB 3VCDA 3KJNB 3CJ4A 2VBZA 1S6UA 4FXWA 2DH7A 4K4XA 4YB7A 4CNYA 1FK9B 3I32A 1U8WA 4WJBA 3EGWB 3TA0A 3MM6A 1MU2B 4USHA 3MR2A 2A10A 5CZDA 1YX2A 3S6EA 2JX2A 4C9DA 3G8TA 3FK4A 1NSQA 1AW0A 3M8RA 1FT8A 1X7VA 1YKWA 3QLHB 3C6TB 3AODA 2IMWP 1NAQA 1WTBA 3IR6B 3PRVA 1DURA 2E1MC 3IG1A 4P6QA 4NCAA 5KFLA 4FF1A 2OTLS 4CIOA 4KR0B 4UOFA 3M8ZA 2RT3A 2CWKA 2W2MP 3JXOA 2XMTA 1SKUB 1SJQA 5CH7B 3FRZA 2C3UA 5KG7A 2QLJB 2IC3B 3KLIB 3KLFB 3WIUA 4LSNB 4WIIA 1M5PC 2VOOA 2LP4A 1PBAA 1XK8A 4IH6A 3G82B 3V6KA 3W66A 4DR5J 2XLKA 3ETMA 4QWEA 3HPOA 1FCAA 4KHMA 1X4HA 2RD5C 4DXLA 2RU3A 2PSZA 4DG1A 1PC5A 2XS5A 1XIQA 4M63A 2FHOB 3DOLA 1E6YB 3UWTA 2V4RA 1VBXA 4F4AA 1U0HB 1WI8A 5CA5A 3OT9A 2BMBA 1QM9A 3PY8A 5KFYA 2GQQA 1KVKA 2F3JA 4HEA9 4A4JA 2GW8A 1XERA 1AFIA 4KFBB 1C2PA 2OTJS 4MK9A 4WP9A 2F9JA 3MD3A 4IDKA 4FYYB 2AGQA 4C7QA 3GSDA 3OHAA 1J27A 3Q2TC 2JDJA 4X64F 1IBLJ 2Y1JA 1FK9A 2V2KA 5DDRC 1HMVB 2NXUA 1FRMA 3JQMA 2CQ0A 2M2BA 1Q95G 1RAEB 4ZJQA 2QA4G 2DYAA 3BV8A 4DQSA 5DG9A
chains in the Genus database with same CATH topology
3TZWA 2CUYA 2QO3A 5DZ6A 3TZXA 2G2YA 4RL1A 3IM8A 1MLAA 2VKZG 2C2NA 5DZ7A 3R97A 1NM2A 3G87A 3EZOA 3SBMA 3IM9A 3R8YA 5CZDA 2HG4A 2UV8G 2G2ZA 2PFFB 2H1YA 3HMJG 3TZYA 2JFKA 3PTWA 3TZZA 4QBUA 2QJ3A 3QATA 4RR5A 3K89A 3RGIA 3TQEA 2G2OA 3HJVA 5CZCA 2VZ9A 2QC3A 3BV8A 3CJ8A 2JFDA 2VZ8A 3H0PA 2G1HA 3HHDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TZW A;  2CUY A;  2QO3 A;  5DZ6 A;  3TZX A;  2G2Y A;  4RL1 A;  3IM8 A;  1MLA A;  2VKZ G;  2C2N A;  5DZ7 A;  3R97 A;  1NM2 A;  3G87 A;  3EZO A;  3SBM A;  3IM9 A;  3R8Y A;  5CZD A;  2HG4 A;  2UV8 G;  2G2Z A;  2PFF B;  2H1Y A;  3HMJ G;  3TZY A;  2JFK A;  3PTW A;  3TZZ A;  4QBU A;  2QJ3 A;  3QAT A;  4RR5 A;  3K89 A;  3RGI A;  3TQE A;  2G2O A;  3HJV A;  5CZC A;  2VZ9 A;  2QC3 A;  3BV8 A;  3CJ8 A;  2JFD A;  2VZ8 A;  3H0P A;  2G1H A;  3HHD A; 
#chains in the Genus database with same CATH topology
 1NHV A;  2Y8W A;  1QUP A;  3QLH A;  1JLA B;  3KTQ A;  5GMD A;  3C6T A;  2V4Q A;  3ITH B;  4ED8 A;  2FQQ B;  1K0T A;  2RF2 B;  3R7S B;  4YR0 A;  2M70 A;  4Y2A A;  1S9F A;  1B64 A;  2MZQ A;  3KG0 A;  5DO2 A;  4DR4 F;  2EFO A;  1HNI B;  1T9V A;  2IC3 A;  3B82 A;  3KLI A;  2OD4 A;  4GO5 X;  1R8B A;  5EDW A;  4LSN A;  3QT7 A;  1QLN A;  3A12 A;  2XO7 A;  3BRE A;  3ULH A;  4B17 A;  2YX1 A;  2IRY A;  3G82 A;  1LWF B;  1RWW B;  3PKM A;  3I9Z A;  2Y8Y A;  4NLX A;  3IXQ A;  1KS2 A;  2AMC B;  3CNQ P;  2K06 A;  4H4O B;  5IZH A;  3HVT B;  1YRU A;  2HAI A;  2ZVI A;  4NLV A;  1KQK A;  3OVB A;  3MM7 B;  1UJ5 A;  2LEP A;  1ZM3 A;  1E6Y A;  3TVK A;  3ISN D;  2JEF A;  1U0H A;  4R0E A;  3PIP Q;  2HHQ A;  2C2K B;  5DDP C;  3OTD A;  4DR2 F;  1NK7 A;  4NLT A;  1Y5I B;  3OR1 B;  2JOQ A;  2GIR A;  3W1Y C;  2XZW A;  3BPS P;  1K8A T;  2HWT A;  4KFB A;  4DSF A;  4RKU C;  2XMU A;  3ZTR A;  2LFV A;  2NS1 B;  2ZFH A;  1V3S A;  2QT7 A;  2MY8 A;  4TYB A;  4YR3 A;  2NCK L;  4NYZ A;  4K4Z A;  5KFK A;  4B9M A;  3IR7 B;  1URR A;  5KFN A;  1HMV A;  1UEK A;  1RP5 A;  1BC6 A;  1EJ7 L;  2UV8 G;  3EYZ A;  2QRR A;  5JMN A;  4CLT A;  2J8A A;  2QTW A;  4O3P A;  3KK1 B;  4LF4 F;  3R5D A;  1JLA A;  3HVA A;  5DQG A;  3ITH A;  4CH7 A;  2RF2 A;  1HPZ B;  1VQK S;  1U8S A;  2PMZ D;  3D68 A;  1VQM S;  2UXB J;  4RUB A;  2QYG A;  1ROF A;  3TQE A;  3G6V A;  3ZO7 A;  2M0G B;  3VZI A;  1ZTW A;  1HNI A;  5LMU F;  1SJ4 P;  4DZD A;  1N34 F;  1IQT A;  1HWK A;  2E44 A;  2XYP B;  4AMP A;  1SH0 A;  5E2Q A;  2BJ3 A;  3BSC A;  3DM2 B;  3W65 A;  4J9S A;  4X4Q A;  3PEJ A;  2EC2 A;  1LWF A;  3I55 S;  3OSP A;  1WC1 A;  4E8U A;  1KD1 T;  1UAW A;  2NUH A;  1S7I A;  2HWI A;  4H4O A;  4NML A;  3GR1 A;  1IWG A;  4NA3 A;  2RSQ A;  2JLG A;  1H72 C;  4ILL A;  3W63 A;  1N5Y B;  4N47 A;  3G4S S;  1F2H A;  2F5G A;  4F8R A;  3AQP A;  3ZZZ A;  1X9S A;  2AYE A;  3OR1 A;  3UN2 A;  3Q89 A;  4C8O A;  4IO9 Q;  1X0P A;  2ZZM A;  1RCX B;  2P6T A;  1H73 A;  5HVG A;  3OJU A;  4O3O A;  3QMQ A;  3CCT A;  2I6W A;  4AE5 A;  1Q86 T;  3T1Y F;  4LBP A;  2GZO A;  3QYY A;  3RRG A;  1HD1 A;  5C25 B;  2VIH A;  4G1I A;  2M9K A;  2FJB B;  1BUX A;  2BAB A;  1N36 F;  4FYD A;  3G86 A;  3UNG C;  4BLG A;  5AXK A;  1QSY A;  1JLG A;  1HNZ J;  5DM7 Q;  2ZBI A;  3T9N A;  5HAT A;  3TO8 A;  1JQG A;  3H5Y A;  4KRW A;  1ZAW A;  3LUY A;  2YPZ A;  3T5K A;  3R27 A;  1U47 A;  4ELT A;  4DV1 J;  3T3F A;  3KK1 A;  3CJ3 A;  1N32 F;  2XG8 A;  3R7N B;  3EGZ A;  2WVE A;  2DB1 A;  1HPZ A;  3PKY A;  3NNC A;  3CUL A;  1NM2 A;  2CQI A;  8ATC B;  1F9F A;  3SQO P;  2IYG A;  2C2E A;  4X65 J;  1FE4 A;  4OYP A;  1L5U A;  5ETK A;  3RBE A;  2FD2 A;  3GE9 A;  4DUZ J;  2L3M A;  3L7O A;  2B0G A;  2QGF B;  1S1V B;  2QMW A;  3ZZU A;  3SMZ A;  3QAT A;  1S9G B;  3QGP A;  2IM2 A;  3GIM A;  1N5Y A;  3QAE A;  5HL7 Q;  4N76 A;  4LSZ B;  3SCI E;  1AFJ A;  2MPU A;  5A6W A;  2HNY B;  2P9G A;  2KRR A;  2X51 A;  3FKB A;  4TYA A;  5KG4 A;  2VIC A;  3CDB A;  3GV8 B;  1FDN A;  1NLK L;  2KHD A;  1KWM A;  2CJQ A;  3RU0 A;  2CYY A;  3LO3 A;  1TEL A;  2CPZ A;  2NZC A;  3NEK A;  1IBM J;  3C46 A;  5C25 A;  1OYD A;  5GAE U;  1WKJ A;  1X5P A;  4OV1 A;  1VQO S;  2P9C A;  1OQ3 A;  2C2R A;  1VIS A;  6AT1 B;  5KFQ A;  3OLA A;  1ZBT A;  3WQP A;  1UZD A;  4Q0B B;  4QZV B;  1R27 B;  1TL7 B;  5HJX A;  1CJK B;  4EFA C;  1S1T B;  4DR5 F;  2CVE A;  2V63 A;  2F4F A;  4QOT A;  1BMQ B;  2QA2 A;  5IFM A;  3NNH A;  1N88 A;  1O5J A;  2ZHB A;  3D1H A;  2H48 B;  5ETS A;  1WAC A;  2CJX B;  4QYR A;  3HT0 A;  1UA0 A;  2FGC A;  3CXC R;  4C3M A;  4TY8 B;  1FWP A;  2CPX A;  4R5P B;  1UKU A;  5B0F A;  3D1Q A;  1LK7 A;  3HJV A;  1FRK A;  1U1K A;  2AV5 A;  3TW0 A;  1SJR A;  1EHW A;  3JSY A;  4N7T A;  4O3Q A;  5F8N A;  3G6E S;  3LP1 B;  5KFD A;  1U0S A;  1S9G A;  2ZH2 A;  1UEV A;  1IBL F;  3IC1 A;  5LXY A;  1YJN S;  5ETO A;  3AOC A;  2B5J B;  3KYL A;  2EKY A;  3M2U B;  2HNY A;  3MUR P;  4A46 A;  1U6B A;  3M1V A;  3BR9 A;  1ZA2 B;  2E1P A;  2VPX B;  3G2X A;  2J9E A;  1JK9 B;  2XUL A;  3DC2 A;  3OPK A;  5EWG A;  3P45 B;  5K20 B;  1SQF A;  4IQM A;  1RYR A;  1EET B;  2VOD A;  3IWL A;  3R5G A;  2BJ7 A;  3SFG A;  1CJT B;  3LAK A;  5LSL A;  3JYT B;  1QVG R;  4KBI A;  2QC3 A;  1KLN A;  4Q0B A;  1OPI A;  1TL7 A;  1N48 A;  3FGV A;  1OMS A;  4U8V A;  1CJK A;  3QGI A;  1NH7 A;  3OUY B;  1PBU A;  3UO0 A;  2YNF B;  1BQM B;  1RHR B;  4DS4 A;  2M8D B;  2LQB A;  4LQ3 A;  3U1M A;  2Z0G A;  4NLP A;  3MEE A;  1YJW S;  1ELO A;  3TZW A;  4S0M A;  1V9O A;  3IN5 A;  3L9Z A;  5IWA F;  5DDO C;  1BQX A;  4NLQ A;  2XI2 A;  1H0H B;  5A8W B;  1BWV A;  4TY8 A;  1FDB A;  4R5P A;  3VVU A;  3A4T A;  3BYR A;  3M05 A;  1GXL A;  3ILI A;  2C2O B;  5CD4 H;  4KY3 A;  5D6G A;  1BWE A;  3MTK A;  4CTA A;  3VGT A;  4DOZ A;  3H5S A;  2O66 A;  4TU8 A;  1C1B A;  4JYA J;  3LP1 A;  1NK6 A;  2POK A;  2BV3 A;  4TXS A;  2VB6 A;  3BGL A;  5E33 A;  4LBI A;  3FMW A;  2VFR A;  2B9E A;  5IT0 A;  1IKW B;  3DOM B;  4DQR A;  3RBZ A;  2KU7 A;  4G6V B;  1V3Z A;  3FDS A;  3DRS A;  1QAX A;  2XWX A;  3OV7 A;  1Q4R A;  1YRX A;  4D3G A;  4KE5 A;  2CZ9 A;  1UTA A;  2DGW A;  1WF0 A;  2UXB F;  1EET A;  1VYA A;  2UXD J;  1WKL A;  2FYX A;  3D5M A;  1CJT A;  1KDN A;  1VC0 A;  3OSN A;  1R6V A;  4K4S A;  3JYT A;  2MZJ A;  4X4V A;  4EUV A;  4M95 A;  2BJE A;  3BDE A;  2DGV A;  2QFI A;  4DDF A;  3IAM 9;  3OUY A;  5M2P A;  4YHH J;  2YNF A;  1BQM A;  1SI9 A;  4ECX A;  4WIQ A;  4K5S A;  4MTP A;  2FTR A;  2R7O A;  5DGB A;  1N6Q A;  2LEA A;  2IM1 A;  4B3O B;  4LF5 J;  3DXB A;  4QIF A;  2MMY A;  3MXH P;  3HF5 A;  2QN6 B;  3CTR A;  3J7A N;  1IN0 A;  2L48 A;  3CJK A;  1FI4 A;  5IS2 A;  2KJW A;  1K1Q A;  4L75 A;  1WG5 A;  1A9N B;  4HVZ A;  1R0A B;  1ACM B;  3JQK A;  1HNZ F;  4FBU A;  1IKW A;  3CMQ A;  3DOM A;  1RWU A;  1V5V A;  1RT1 A;  2DIT A;  4K2X A;  4L3N A;  4D3H A;  3J7Y I;  5CYJ A;  2CPJ A;  2V2V A;  1DZ5 A;  4KC5 A;  1T9U A;  2OEJ A;  4IH5 A;  2XNR A;  4DV1 F;  1VGY A;  2D3Z A;  1OY8 A;  1Q79 A;  4BS2 A;  2GJF A;  1A6L A;  1RAG B;  3GG1 A;  4IG3 B;  2XI3 A;  3F73 A;  1WC6 A;  2ZBC A;  3D54 A;  1T94 A;  4CO1 A;  2XMM A;  4I4B A;  3T5H A;  1LNQ A;  1LWC B;  3RYL A;  5D0G A;  2RS2 A;  5DZ7 A;  4LFA J;  1VCT A;  2OHD A;  4K0K F;  3NGK A;  1U7L A;  3DLG B;  3T9Z A;  1N56 A;  2LQ8 A;  1UWB B;  1YRT A;  4NYP A;  1G6B A;  5KG5 A;  1H2U X;  3CDA A;  4P72 A;  3V81 B;  4BWM A;  3R5J B;  2LEC A;  1PYO B;  1X4E A;  3PO4 A;  1FWK A;  1JNZ B;  4YUD A;  2CA9 A;  4O0I A;  1Q81 T;  4B3O A;  4ES3 A;  2QA1 A;  3TNV A;  5L39 A;  2WRM A;  2RIL A;  4M5H A;  4E0D A;  3RW7 A;  2FB0 A;  4U7U D;  4HHH A;  2Z2Z A;  2J7K A;  3TAR A;  1GMU A;  3LGH A;  2GMJ A;  2AJQ A;  1IBM F;  4RUC A;  3MCS A;  4PRF A;  2KT5 A;  1FKP B;  3E51 A;  1R0A A;  4WP3 A;  3MTJ A;  1HBO B;  2BE7 D;  3TX0 A;  1WKK A;  1K0V A;  1VRU B;  1AYE A;  5C24 B;  2E7X A;  2KO1 A;  4U6P A;  4V19 J;  3VAH A;  4QIV A;  1TK0 A;  3TVZ A;  3D2W A;  2O3D A;  1QTN B;  3G9C A;  2KXF A;  4IG3 A;  3IMQ J;  4M5M A;  4OIX A;  3K17 A;  3KDN A;  2QO3 A;  2PC6 A;  3QJJ A;  1FTC A;  3HT3 A;  4OI3 A;  5AXM A;  1LWC A;  2WB1 D;  2GAG C;  2B4V A;  2DKO B;  4J9V A;  1RWM B;  2N4D A;  4FS1 A;  1SBR A;  3OHB A;  3E8O A;  3KK2 B;  2KTQ A;  2DH8 A;  3DLG A;  3B78 A;  1JNR B;  3ZZ0 A;  1UWB A;  2HGM A;  2IRX A;  4MKB A;  2F4V J;  2HBR B;  1HW9 A;  2GQ2 A;  1WC0 A;  4USV A;  2DXF A;  1HBN B;  2DBB A;  3V81 A;  5J1E B;  2K7K A;  2FJW A;  2WOM B;  3I82 A;  4N8O A;  3ZXW A;  4PYD A;  3MMA B;  3MPW A;  3HM9 A;  5K8N A;  2E9R X;  2BM0 A;  4FBT A;  4K4Y A;  1QSL A;  2K3K A;  2QA4 S;  3V6D B;  4M94 A;  1EKS A;  3LPE A;  2N7C A;  3TJ9 A;  4QBU A;  4NZ6 A;  2DNN A;  4HL9 A;  2CXE A;  4DV5 F;  1KLM B;  2RS8 A;  4B3S J;  3JAM U;  2CQP A;  1I51 B;  1P9Y A;  3D6T B;  4KPC A;  1KHW A;  2EK1 A;  5C24 A;  2H51 B;  5JVG Q;  1XQI A;  2WW8 A;  4KHR A;  4ZPV R;  4ZLN A;  4PXB A;  3W2V A;  3SFU A;  3GJQ B;  3QPI A;  4ZP6 A;  2YWW A;  2J8S A;  4Q45 A;  3TA1 A;  4YP3 A;  1VLO A;  4CCH A;  4QWB A;  2UU9 J;  3EZU A;  3WBZ A;  2SXL A;  4KB7 A;  1GEH A;  1U49 A;  5HN0 A;  2E5J A;  2PFD A;  4MMO A;  2ILZ A;  3PZP A;  2KDO A;  4O44 B;  4USU A;  2DY1 A;  4J9P A;  1OSC A;  3KK2 A;  3K59 A;  3MZI A;  5J2Q B;  3SQG B;  3T6J A;  3E2E A;  4JYA F;  3MWB A;  2EKN A;  2FZC B;  1T9T A;  1HBN A;  1RSC A;  5HQ8 A;  5J1E A;  2GV1 A;  2WTF A;  2WOM A;  2EFP A;  3EUN A;  1PC4 A;  5ETV A;  1SQE A;  4IUF A;  5AXL A;  2OLW A;  1MWZ A;  1TFY A;  2XYH B;  4IG0 A;  3MMA A;  3SSQ A;  2GVD B;  2V6A A;  2PA8 D;  3IR5 B;  4AL5 A;  4DCJ B;  2E5L J;  4CT8 A;  1NEE A;  1TKZ B;  1T0T V;  1D0E A;  2I2Y A;  5IT4 A;  2HBY B;  3UI3 A;  3KJQ B;  3V6D A;  2AQ4 A;  3UVJ A;  3W5Y A;  1VFJ A;  5AT1 B;  2JSX A;  4RW7 B;  3DLE A;  4A8K A;  3MMB B;  2UXD F;  2N3O A;  2BKP A;  4I67 A;  3MFI A;  5HI7 A;  4AL7 A;  1KLM A;  1UJ6 A;  2R2R A;  2HYI B;  1YWX A;  1R8A A;  5ADZ A;  2BE2 A;  4QWC A;  3I87 A;  2B7C B;  2JEG A;  3QRR A;  3M8Y A;  5ETM A;  4YHH F;  2ZH5 A;  3R5B A;  2IRU A;  2EFQ A;  1KHV A;  1DRZ A;  1RT4 B;  1XR7 A;  3DLL Q;  4IR9 A;  5IT9 U;  3FVY A;  4C8Z A;  2EFG A;  4U7U K;  2YTC A;  1IJE B;  3ZZR A;  2NRE A;  5CQG A;  2NXE A;  4F4Y A;  4I2Q B;  1C1C B;  3V4I B;  1IM4 A;  4PZV A;  2DO4 A;  4LF5 F;  3K89 A;  3QO9 B;  2V8D A;  3VF0 B;  4O44 A;  1FX2 A;  4O0N A;  3NGT A;  2UP1 A;  5J2Q A;  4LF6 F;  3SQG A;  2E1R A;  5HP1 A;  2B9W A;  1FO1 A;  4M8L A;  3DRP B;  2ACM A;  3DLJ A;  4JV1 A;  1X4G A;  4ZP9 A;  2F8M A;  5K5M A;  5GAH I;  2H3E B;  4R0J A;  2FZK B;  2GVD A;  4RX6 A;  2PI4 A;  3TA2 A;  2RDI A;  2VG6 A;  1VLY A;  1YHQ S;  3LW5 C;  1IBC B;  1MWY A;  4AXJ A;  5IT9 Y;  6FD1 A;  4ZPB A;  5F8L A;  4RJV A;  3CC2 S;  3M6V A;  4RW7 A;  3MMB A;  2YQ3 A;  3EXY A;  3PG9 A;  1NB2 A;  4ZJL A;  4GKK J;  3H7H B;  3AY0 A;  4K8R A;  2HK2 A;  2G2Z A;  4LFA F;  5KFV A;  4J9O A;  2JFD A;  5I3U B;  3C14 B;  4QWA A;  3NCP A;  1RT4 A;  4RO0 A;  3MM9 B;  1R8C A;  3P4U B;  1D9F A;  1KP6 A;  3GJT B;  2HPU A;  2VFU A;  2HVH A;  2NYH A;  3J80 U;  3ZTQ A;  2HZV A;  4A8X A;  2DK2 A;  4JI3 J;  2KJV A;  4I2Q A;  1URN A;  5D3G A;  1C1C A;  3V4I A;  2WON B;  3QO9 A;  3TJ8 A;  3KLG B;  3Q2S C;  3L95 X;  2YX4 A;  2WW4 A;  2VG7 A;  1AZS B;  2AKW B;  2L9D A;  2DNK A;  2GQC A;  2D1C A;  1K73 T;  1HYS B;  3LWM A;  3HP6 A;  5D8H B;  3DRP A;  3SV4 A;  1V6H A;  1M5V C;  3CCV S;  4DV6 J;  1ZH5 A;  4A8O A;  1EP4 A;  2YQ0 A;  5EGY A;  2HW3 A;  2B7B B;  1S4E A;  4CLK A;  3K5M A;  3D0I E;  3NMR A;  3JQJ A;  1LK5 A;  1TUG B;  1N33 J;  2ZOM A;  3D6F B;  4LBH A;  3TZY A;  3RAM A;  3AH6 A;  2XM3 A;  4AT1 B;  4ED6 A;  3CJS A;  2B4O A;  4C0O C;  4X2B A;  1U26 A;  3W5X A;  2YH0 A;  4LRD A;  4UY8 5;  3TUI C;  2XB2 D;  4RNN A;  1NH8 A;  3UN5 A;  2KYZ A;  4HR2 A;  4PG4 A;  1LV5 A;  4RPF A;  4USK A;  1SIZ A;  5IOL A;  5H9F J;  3PM9 A;  2HVZ A;  4LR7 A;  1RAB B;  1T3N A;  2JL9 A;  4RLE A;  4WF9 Q;  5I3U A;  4EZ9 A;  3C14 A;  2KM8 C;  2PFF B;  1YK9 A;  2ZZN A;  1O51 A;  3VAI A;  1ZTT A;  4YDX A;  4F67 A;  2RB7 A;  2MYF A;  1P27 B;  4TVA B;  1M1G A;  1VQP S;  1NKB A;  5B0A A;  1SB6 A;  1RB0 A;  2AEF A;  4CRJ A;  2WON A;  1DQ8 A;  1JKH B;  3PW7 A;  4OJ3 A;  4C8N A;  3KLG A;  2V4J B;  2BKN A;  3Q8P B;  3JTN A;  1Q7L B;  2VD3 A;  4YY3 J;  2KFZ A;  3RB0 A;  1AZS A;  4OX9 J;  4CLZ A;  4Y34 A;  3LOU A;  2PEH A;  1SJF A;  1EIY B;  1HYS A;  2FGO A;  4F3O A;  2UUA J;  2MJN A;  4JB8 B;  1D1U A;  4B3S F;  5HMW A;  1WDD A;  2V5H G;  2V9W A;  4QPX A;  1KSP A;  4A8F A;  5C7P A;  2DEJ A;  2ZH7 A;  4K7Q A;  2NZ4 A;  2KZZ A;  2MST A;  2RJZ A;  2G0C A;  3K58 A;  4GRS A;  1S0O A;  3MFH A;  2ALZ A;  2VKZ G;  1NCL A;  4ZPA A;  3BM7 A;  1YTY A;  4J9N A;  4NXN F;  4B3R J;  3DHX A;  1XJW B;  3S1T A;  5LSO A;  1CS4 B;  3UD3 P;  4ED4 A;  1X4A A;  1E6V A;  2JZ5 A;  4KH0 B;  2R8G A;  3FEZ A;  2UU9 F;  1RXO B;  2D74 B;  1DAX A;  1KKH A;  2M4M A;  3BGO P;  3DOK B;  1PYT A;  1A7G E;  4TQR A;  1KQG B;  2XTJ P;  3RGI A;  4F50 A;  1LWX A;  4U9R A;  3TAP A;  1OQ6 A;  2MZT A;  2XLI A;  3VAM A;  2PDA A;  4OZ0 A;  2CQG A;  5CCL A;  4OYZ A;  2XBP A;  2FHJ D;  1CUL B;  3DLB A;  3PW0 A;  2V9K A;  1RT6 B;  2R3V A;  5D77 A;  3TX8 A;  2V4J A;  1S0M A;  4ENO A;  3I56 S;  5A0Y B;  2VDH A;  1HWL A;  2C22 A;  5K8M A;  2YWK A;  4N5S A;  3NS7 B;  1CEZ A;  5I3Q A;  3GV5 B;  2EW9 A;  4OYM A;  3PW2 A;  1NND A;  1VQS A;  5L38 A;  4DI6 A;  5E5N A;  2AT1 B;  2ZJR Q;  4DX7 A;  3CD6 S;  1CS4 A;  1IWA A;  1VBK A;  3CWJ A;  2RQK A;  2IDL A;  3K8W A;  2ZE2 B;  3DOK A;  1WUU A;  3H20 A;  1JWW A;  1VQ8 S;  4USJ C;  3AT1 B;  4YB6 A;  1QDU B;  5KFH A;  2DTJ A;  1KNZ A;  1FF2 A;  4PG5 A;  3SYZ A;  5HAN A;  3NGD A;  3ZFV A;  3KLE A;  3PJ9 A;  1U1L A;  4WU2 A;  4DJB A;  1BD6 A;  1AUD A;  2VF3 A;  1EZZ B;  3B8H A;  3W62 A;  1WDT A;  1W2B R;  1FXD A;  1CUL A;  5F8I A;  3AD7 C;  4DL5 A;  3MGJ A;  4RNM A;  3QT6 A;  4OFZ A;  3P49 B;  5HLF B;  1RT6 A;  4B9S A;  1NK9 A;  2QLW A;  4WFX A;  4JI4 J;  4RBV A;  1RA7 A;  7FD1 A;  5A0Y A;  5CYM B;  3MM5 B;  3PHE A;  4HI2 A;  4LF1 A;  2H54 B;  1HL6 A;  1FDD A;  1U1P A;  4OYA A;  1WHV A;  4NYO A;  3H90 A;  4GKK F;  3SSR A;  2ZOF A;  3ELH A;  4C8M A;  2KXN B;  3L7P A;  3VGV A;  1NUE A;  2CJA A;  8RUC A;  1PKU A;  3TAM A;  3UQS A;  3M8W A;  2LVW A;  5E3C A;  4RBU A;  2BJ9 A;  2FJA B;  1RWP B;  4C3L A;  2ZJP Q;  4AXI A;  1RK8 A;  1WSV A;  1JLC B;  3BO4 A;  3R5A A;  2HQC A;  5T7L B;  1FRJ A;  3HJF A;  2BEF A;  4OX6 A;  5CZV A;  4JI3 F;  3AOA A;  2GJI A;  2ZE2 A;  2NPF A;  2E7V A;  2RH3 A;  4CO3 A;  2RVJ A;  1SL1 A;  1T8E A;  4NA2 A;  1LWE B;  5G0R B;  2HLU A;  3Q86 A;  1K44 A;  4LF9 J;  3R7B B;  4ZLP A;  2L9W A;  1NKC A;  1JXL A;  1TVR A;  1VIO A;  3IM9 A;  1U48 A;  1SC6 A;  2FDN A;  4LF7 J;  3C2P A;  4ED1 A;  2R7S A;  3H5X A;  1T9W A;  5HLF A;  3ZTP A;  4JOU A;  3HFV A;  2M7S A;  4ZVO B;  2EI5 A;  5KFT A;  2KVI A;  1N33 F;  1UVN A;  2ZNY A;  2MY7 A;  4B3T J;  1UVL A;  5GMK a;  4JI7 J;  5D15 A;  2LEB A;  3MM5 A;  4MFB A;  3VR1 A;  1SVD A;  5KFF A;  2UUB J;  5BR8 F;  2R7U A;  2ROG A;  2Y3Y A;  4OHX A;  4P71 A;  1HI1 A;  1HW8 A;  1HWU A;  1Z1Z A;  3R6L B;  2RUG A;  2BAN A;  2Z2L A;  4JI6 J;  4ES1 A;  2X3G A;  5A8K B;  3BEG B;  2GFF A;  2KT3 A;  5KFW A;  4WFN Q;  3W8G A;  3PX4 A;  3NBP B;  2GHV C;  1JLC A;  1T9Y A;  2WSE C;  3DCA A;  5DZ6 A;  5T7L A;  1BLU A;  5GAG U;  4ELV A;  3Q8Y A;  4NCB A;  2OO4 A;  4YQW A;  3I6P A;  2OMO A;  3G71 S;  5D4L A;  4PPD A;  2XHW A;  3DDK A;  1KVJ A;  4URQ U;  2VL1 A;  3MOZ A;  2LCW A;  4U8Y A;  5KFA A;  2R8J A;  2IYI A;  2IJR A;  3R5C A;  5G0R A;  3DRR B;  2FVS A;  2F1F A;  4OX9 F;  2FHK A;  4XDD A;  3PYD A;  2HRT A;  5CHC B;  1J2V A;  1RWN B;  3KXD A;  3TVY A;  2GJ2 A;  4PAB A;  3OL6 A;  5SZT A;  4JUZ A;  2UUA F;  3EZO A;  2R7X A;  2OEM A;  4O4G B;  4RUA A;  4TY9 A;  1PJ7 A;  2VC0 A;  1C0T B;  1T3O A;  1RE1 B;  2BX6 A;  2EEY A;  2E66 A;  2KG0 A;  4PWD B;  3MPV A;  1ZOT A;  3FMB A;  2ZC4 A;  2DNO A;  3PO5 A;  2EK6 A;  5EX3 A;  4B3R F;  3KJF B;  2HHV A;  2XMK A;  2DHX A;  3M2V B;  5HMX A;  2G1H A;  4P2S A;  4EU0 A;  2GC8 A;  4CO4 A;  4I64 A;  1HQ2 A;  1IBK J;  1W2I A;  2YNG B;  1U1M A;  4JV2 A;  2DY9 A;  3EDQ B;  3MHY A;  4PUO B;  1D09 B;  5A8K A;  3J7Z 5;  2RQM A;  1F2G A;  3DLK A;  5G4D A;  4RW9 B;  4LSL B;  4P2F A;  2IJN A;  4WZM A;  2GA7 A;  1AB8 A;  3J81 U;  4DR7 J;  2GIQ A;  4ZVG A;  5U47 A;  4DX6 A;  4F4X A;  1JIH A;  5KFG A;  1YIT S;  3P5T L;  2LYV A;  2QIF A;  2VA2 A;  1VRQ C;  5E3R A;  3AA8 A;  3DRR A;  3PNI A;  4IRD A;  2ZC3 A;  4CO0 A;  4C8Y A;  4HTI A;  4DWI A;  1NSK L;  3THT A;  3D3C J;  2VH7 A;  1Z2Z A;  2DIS A;  4LFB J;  1YG0 A;  4O4G A;  4OX7 A;  4KH1 B;  4OI6 A;  1B7Y B;  1RT2 A;  3NS6 A;  4UW2 A;  3H5U A;  1C0T A;  3GB0 A;  1HFE L;  3BDP A;  4M1K A;  4ECS A;  4WE1 B;  3VVT A;  3TYT A;  5B08 A;  1DTQ B;  4WBF A;  5HBM B;  5EWF A;  4BWJ A;  1NO8 A;  2FVQ A;  1WWH A;  1YJT A;  2AJ4 A;  4PPZ A;  4LRF A;  3M2V A;  2F40 A;  1HNX J;  2J7W A;  2V0N A;  4ZVP B;  4E2F B;  3PV8 A;  4ANE A;  5EUH A;  5KFX A;  2MLZ A;  3OFH A;  2HZC A;  2YNG A;  5K9F A;  1YJR A;  5LJ3 Y;  3VQS A;  4OZ3 A;  4PUO A;  2HQG A;  3MCN A;  2HBZ B;  1MRO B;  3GJR B;  2C2Z B;  1Y5N B;  1FA0 A;  5GAE I;  4RW9 A;  4CLU A;  4LSL A;  4NEZ A;  5B09 A;  3US5 A;  4Y2C A;  4HYK A;  2A2C A;  2AYB A;  3C6U B;  4OZ1 A;  4PXE A;  4IQX A;  5L9X A;  3H4D A;  2LQ5 A;  9RUB A;  3TQ1 A;  3LQV A;  4J90 A;  4RW6 B;  4RR5 A;  5BYS A;  4MIW A;  1RQ0 A;  2JH3 A;  5JUM A;  1YJ7 A;  2L9N A;  3ZZY A;  4DUY J;  1FWL A;  2RIJ A;  4LVO P;  4JI4 F;  2XO6 A;  4DPU A;  1OS5 A;  3CC4 S;  4Y65 A;  4DL0 C;  3BKT A;  2GCF A;  1B99 A;  3HCX A;  3EGN A;  1VQ6 S;  3CME S;  1B7F A;  5GVQ A;  4JV0 A;  4C8L A;  3SCL E;  4BBY A;  1KTV A;  4HT7 A;  2ZM6 F;  4ALZ A;  4DSE A;  2QSW A;  1RWK B;  2FIU A;  1VJQ A;  1RKJ A;  1K9M T;  3Q83 A;  1F3V A;  3MUM P;  3DNC A;  3OBI A;  2HFS A;  4LVN P;  4IO1 A;  4YB5 A;  2IJF A;  1I6J A;  1VBZ A;  1GAO A;  4KGM A;  3GIK A;  4KGK A;  1DTQ A;  3V6H A;  5HBM A;  1UW4 A;  4O3R A;  3UN3 A;  1IVZ A;  5J1N A;  4FF4 A;  3HHL B;  4UQT A;  3LGN A;  2LLZ A;  4GVB B;  2HHT A;  4UUW A;  2KH9 A;  2CRL A;  3IBC B;  4QW8 A;  4DV3 J;  2M3D A;  5F8J A;  2KVQ E;  4Q43 A;  3BF4 A;  2LKZ A;  2RHQ B;  3GQC A;  2ZH3 A;  1HQE A;  2GO8 A;  4KKO B;  1REV B;  2IVM A;  3KWM A;  4EGL A;  3H2V E;  1MRO A;  3HX9 A;  2ASJ A;  2HHS A;  5CZX A;  2R2T A;  3UR0 A;  1XR6 A;  2VPY B;  2DRA A;  2Y0B B;  2JWN A;  3LPY A;  2ACY A;  4ERD A;  1C4C A;  4DR3 J;  2MJU A;  5B7W A;  4LF7 F;  5CCM A;  4F4W A;  4A8S A;  4RW6 A;  5F9L A;  3ISZ A;  2FY8 A;  3ENV A;  2JC1 A;  3NG8 A;  3P3D A;  1RDR A;  5L1K A;  3VAF A;  1IUJ A;  4J9M A;  3O44 A;  4B3T F;  2LDY A;  4FXV A;  3OTB A;  4ETZ A;  2Y0S D;  5KT7 A;  4JI7 F;  4ZVH A;  4URS A;  3TRG A;  2OAU A;  3N6L A;  4G3I A;  2UVV A;  1SIW B;  1H2T Z;  2UUB F;  1F1B B;  2UV8 A;  4DG1 B;  1I3O B;  3DOL B;  4WKY A;  1DQA A;  2A1B A;  2NYI A;  3Q23 A;  2DHA A;  3CVK A;  4C3K A;  3OVS A;  3BKU A;  4KGX B;  1M0S A;  4JI6 F;  3D0G E;  3W9J A;  2RAQ A;  4LJM A;  1GQE A;  1QTM A;  1Y00 A;  4L73 A;  3CPW R;  4X4S A;  2XMA A;  5KFM A;  1TL1 B;  1H2V Z;  3HHL A;  4YME A;  2CPD A;  4GVB A;  2OJ3 A;  3HZG A;  1QE1 B;  2AYG A;  4ZVT B;  4KGV B;  2C28 A;  1NPR A;  4C98 A;  3LAM A;  4U96 A;  2AD9 A;  3MDF A;  4KKO A;  1REV A;  4I68 A;  1YBU A;  1KQS R;  4CI0 B;  2JFK A;  3DYA B;  1U02 A;  2AZ3 A;  3MED B;  1PIL A;  2VZ8 A;  3O5T B;  3OLB A;  3GP9 A;  2JLF A;  4YDD B;  4OHW A;  1CSJ A;  2BW7 A;  2OML A;  2DXE A;  3QID A;  2D9P A;  2GMH A;  1APS A;  2M5Y A;  4NZ0 A;  2DCL A;  2VZ9 A;  5F8H A;  5RUB A;  1A0O B;  4ID5 B;  4BCA A;  1VQ4 S;  1FNM A;  3ZC4 A;  2DIV A;  2MHE A;  4CLL A;  2AJF E;  1JB0 C;  2XCP A;  4Y00 A;  1XNR J;  2QG9 B;  2W1B A;  2VOP A;  4CLW A;  2C2D A;  2VUG A;  3T6B A;  2MQ8 A;  3RR7 A;  4ILM A;  4B3M F;  1NPK A;  4I7F B;  6FDR A;  4J7C A;  1F3F A;  1EAR A;  3KHR A;  2QLB B;  3HVW A;  2CAD A;  3HHL D;  3CW2 C;  2K1R B;  2GS8 A;  4IOB A;  3A3N B;  2ROP A;  4PKD B;  2FVR A;  5KFS A;  3QSY B;  3KHL A;  1D8Z A;  5E7O B;  4EBD A;  1UJ4 A;  1X5T A;  4ZCL A;  3AXM A;  3FCH A;  1TL1 A;  2OSR A;  5KAK A;  2DGS A;  3EVW A;  4OHV A;  3J7A 1;  4ZVF A;  3HK2 A;  1QE1 A;  1D9D A;  2BZ2 A;  2LU1 A;  4P2X A;  1LW2 B;  5KT4 A;  1RZM A;  4QR0 A;  2ZHA A;  4KAI A;  1T95 A;  3KDO A;  3QJP A;  3IWN C;  3BGU A;  5DG8 A;  3DYA A;  4U67 Q;  1KOO A;  3MED A;  4DX5 A;  2VQF J;  2R8I A;  4DS5 A;  4LRB A;  1CC8 A;  1NB7 A;  1XC9 A;  2J9C A;  1XMQ J;  2UUT A;  2BQ3 A;  2NXJ A;  4LFB F;  2QLF B;  2HWH A;  2CIM A;  4FZV A;  4Z7Y A;  3W8P A;  4KQZ A;  1Y5L B;  4ID5 A;  4J37 A;  1RAA B;  2DR8 A;  3MPU B;  2W2Q P;  1ZPW X;  4CZC A;  3KNG A;  4EYH B;  3R97 A;  5IM0 B;  3L3C A;  2WVB A;  2BR0 A;  5DDQ C;  1VK8 A;  2VON A;  1HNX F;  4RW4 B;  1KBR A;  4TN2 A;  4I7F A;  4W92 B;  3IRW P;  4WFY A;  4YEA A;  4X4P A;  3F0N A;  2Y1R I;  4C2M A;  5HQL A;  2XSF A;  5I42 B;  4EBE A;  4DBQ A;  2K1R A;  3B4D A;  3BSN A;  4JI0 J;  1RBA A;  4YB1 P;  3D66 A;  1U6F A;  1U2R A;  4DU7 A;  2XCA A;  3C15 A;  1FKA F;  2MKK A;  2CUY A;  2GHP A;  1F5C A;  2FLO A;  5AE2 A;  4DR1 J;  3HD2 A;  3TEG A;  2O5D A;  3RRH A;  4FNH A;  2YKN A;  2QJ3 A;  4LMZ A;  3KUE A;  2DHS A;  1F9H A;  2YWF A;  2CJY B;  4EYI B;  3HZE A;  1LW2 A;  1GT8 A;  1JLG B;  1MW7 A;  1I1G A;  4DUY F;  2JVR A;  2AF6 A;  4CM2 A;  1KTQ A;  2ZBQ A;  2R2S A;  4DR6 J;  4ZMM A;  1RLC L;  4DFK A;  1MN9 A;  1HWJ A;  3FEY B;  2J6S A;  1TAQ A;  4F0M A;  3DKD A;  3NXZ A;  3M32 B;  3QGG A;  1P1L A;  1XMO J;  3W7B A;  1TL5 A;  4L74 A;  4AMN A;  3CJT A;  1HA1 A;  2OEK A;  2HG4 A;  2CNK B;  3MEC B;  3WHI A;  3N28 A;  1J5O A;  2EBE A;  1Q78 A;  4BC7 A;  4DQP A;  4DLE A;  1FXL A;  1XN9 A;  4CO5 A;  1LOU A;  2MEW A;  2VPW B;  1RT3 B;  5D0E A;  2BJD A;  4ID8 A;  1VS3 A;  3HSZ A;  4F4K A;  5IM0 A;  2LXU A;  3D28 A;  1MML A;  4G1Q B;  3O3L A;  2OKQ A;  5KG2 A;  5AE1 A;  4ECU A;  4DPW A;  2J7U A;  2OPP B;  1TTH B;  1VQ5 S;  4YFU A;  3G87 A;  2PEB A;  4RW4 A;  2ZBR A;  4CO2 A;  1RAI B;  4NLU A;  4DV3 F;  4EEY A;  3J7Z T;  3HHD A;  3DLH A;  3SXL A;  5I42 A;  2G1D A;  5IQQ A;  4DPT A;  1SL0 A;  2AGP A;  1SJ3 P;  1M5O C;  2W7O A;  3MMC B;  4JI8 F;  3G6Y A;  2DNH A;  1OSD A;  5L46 A;  1R8P A;  4C97 A;  4QPT A;  3CIM A;  3V5R A;  4DR3 F;  3BBF A;  5FJ4 A;  4ER8 A;  3D6M B;  1R0B G;  3FQK A;  2VJV A;  2CZ4 A;  2COL A;  2AIR B;  1S48 A;  2DNY A;  1S4F A;  4MKA A;  3PHT A;  3RBX A;  2HS3 A;  3U1L A;  3T1A A;  1JLF B;  1VOM A;  4MH8 A;  3RW6 A;  3D0H E;  3EVM A;  5JJB A;  2MKH A;  4OJH A;  2HQD A;  4GKJ J;  4DN9 A;  4DZ6 A;  2ZH8 A;  1WD6 A;  3TAQ A;  3M32 A;  1NJX A;  5KFZ A;  1UL3 A;  5F9N A;  2JHE A;  1D3W A;  4IR1 A;  3OTC A;  4DU8 A;  3FQL A;  3MEC A;  3BGF A;  4IH7 A;  5HVF A;  2RU9 A;  5M2U A;  2GX8 A;  2AU0 A;  1RLD A;  2DEI A;  2E1C A;  3ZZP A;  2XY7 A;  1RT3 A;  3RAQ A;  2YQ1 A;  3MD1 A;  5C2C A;  4X62 J;  2Q6B A;  3IO1 A;  1OO0 B;  3D4J A;  4EO6 A;  1HR0 J;  2JJ4 D;  4G1Q A;  2Q79 A;  2DGO A;  3FEX B;  2F7V A;  4B02 A;  1TFW A;  2OPP A;  2FHM A;  1TUW A;  2I9S A;  1N4L A;  3W5Z A;  2JEJ A;  4ILR A;  1R89 A;  3UDV A;  4F26 A;  1RAO A;  3PR5 B;  2MZS A;  1Q5Y A;  2O1P A;  4NLO A;  2CAJ A;  3IA0 A;  1OY9 A;  1S77 D;  3M1V B;  3X1L B;  4DV7 J;  3MR7 A;  4LF8 J;  2BE9 B;  1Q0N A;  1SV5 B;  3UNY A;  3MMC A;  4AMM A;  3R6G B;  4FF2 A;  4M5I A;  3R2C J;  3JTO A;  2HHU A;  4DL3 A;  1N5Q A;  2R7T A;  4CQ1 A;  1PGZ A;  3CT9 A;  1IQZ A;  2IHR 1;  4ELU A;  1GTH A;  1DTT B;  2XY6 A;  2FLN A;  2MKI A;  3IRX A;  3FZ2 A;  3PW4 A;  4HHJ A;  1JLF A;  1RHQ B;  1ZM4 A;  1DBD A;  4NLW A;  1U2F A;  1KN6 A;  5D4O A;  4X4N A;  3D6H B;  1XEZ A;  4B08 A;  4H4M B;  2CJ9 A;  1XNR F;  1NSP A;  2HQ3 A;  3N79 A;  1L3K A;  3QGH A;  1LFP A;  1AUS L;  2CPH A;  1OPZ A;  3MEE B;  2PMW A;  3AJ2 A;  1X9W A;  1VIX A;  1NPP A;  3ADA C;  3CCM S;  1KFD A;  3OXF A;  3GR0 A;  4WFZ A;  3P6Y C;  5I4M A;  1Q1K A;  4C0B A;  1AXQ A;  1FD8 A;  2BKO A;  3PYE A;  2MSS A;  2DGX A;  5K8P A;  3PIO Q;  3RB6 A;  2XY5 A;  4KPY A;  3GYX B;  3MR5 A;  2H9Z A;  4CTA B;  3GFY A;  4DSI A;  1C1B B;  4JBC A;  4ZLJ A;  1RU1 A;  5FD1 A;  4JI5 J;  4OL8 A;  1JX4 A;  3I31 A;  4AQY J;  3HHE A;  3H2U B;  3V4M A;  4P9S A;  3P8B B;  3CCJ S;  4WFB Q;  2RDD A;  4WK3 A;  3DRS B;  5JVH Q;  1SV5 A;  2F9D A;  1Q53 A;  1UWA A;  3M9M B;  3KMQ A;  4I1T A;  2VQF F;  1WHY A;  1WHW A;  3QBC A;  2OFG X;  1VQY A;  4Z2X A;  1TKD A;  3KUG A;  2HS4 A;  3JTP A;  4DFM A;  3G8S A;  1XMQ F;  1FEE A;  2OPQ B;  3D3B J;  2A2D A;  1UMJ A;  1FJE B;  1C4A A;  4CYU B;  3ZZO A;  3W9I A;  3DDN A;  3ZNJ 1;  1C0U A;  4ZP7 A;  4USM A;  5T41 A;  2XHC A;  1SCJ B;  1DTT A;  3W64 A;  3N0V A;  3ZNU A;  2BYC A;  2IMO A;  3I9V 9;  3VAL A;  5HAO A;  4HDH A;  4Q8F A;  4Z7C A;  4H4M A;  3ISN C;  4JI1 J;  4WYW A;  4WTY A;  2R4F A;  1PIE A;  1RHM B;  5A76 A;  4M5G A;  4WCE Q;  4KO0 B;  1HIY A;  3WC0 A;  4NL5 A;  2A6M A;  3RB3 A;  4RW8 B;  1N6Q B;  1WEX A;  1YJ9 S;  4OX8 A;  3RZA A;  1PO6 A;  4WXW A;  4DHV A;  1S6O A;  1RWX B;  1LXN A;  1DQ9 A;  5GME A;  2YKA A;  1M5K C;  4JI0 F;  4FKX A;  4DSK A;  4P2M A;  3SBM A;  4DR1 F;  5E3P A;  3KNA A;  1NZ8 A;  4HLB A;  3CJK B;  2WVF A;  1L3V A;  5KT6 A;  2XGQ A;  1RAF B;  2N7Y A;  3SV3 A;  1Y4Z B;  2CG4 A;  4A47 A;  2MTL A;  1LW0 B;  1FER A;  5DET A;  3C16 B;  4U7C A;  3M2R B;  1G1X A;  1RT1 B;  4MKY A;  5C2G A;  3WIV A;  4DR6 F;  2WHO A;  2FZG B;  2YXL A;  2MKY A;  4DN0 A;  1KFS A;  3K0J A;  4NRT A;  2FY1 A;  3FC9 A;  2RRA A;  3CD5 A;  3GPA A;  1XMO F;  2LA6 A;  3K2Y A;  2HNZ B;  3HHK A;  3EPI A;  1U4B A;  2OPQ A;  4G65 A;  3HFZ B;  4CYU A;  3R3T A;  4RUH A;  1VMB A;  1XNQ J;  3CD7 A;  3H40 A;  4IRK A;  3PXG a;  3KMS A;  4LF4 J;  4ECY A;  4DPY A;  4M5D B;  2GHW A;  3C19 A;  3F41 A;  1F0X A;  1R31 A;  3BGR B;  3M8S A;  3D1O A;  2O01 C;  4KO0 A;  4OZN A;  1F5A A;  4KIA A;  3M9N B;  4RW8 A;  1WG4 A;  1RAH B;  4TLR A;  3HKW A;  5LMU J;  1DHM A;  2WBR A;  3O2I A;  2OGU A;  2C3P A;  2XZT B;  4AND A;  4CLP A;  3DHW C;  2ZIT A;  2HFV A;  1FRH A;  1FD2 A;  3TR5 A;  5KOX A;  4QJV A;  4ANC A;  4ECZ A;  5F41 A;  3I5C A;  4W4M A;  4QYZ K;  1TP7 A;  2ZH4 A;  4DV4 J;  2HFU A;  3EM1 A;  1EX8 A;  4I69 A;  2OH2 A;  2XMV A;  1VHI A;  1S79 A;  4DV0 J;  1LW0 A;  2K8G A;  1RHJ B;  3C16 A;  3ILL A;  2QX0 A;  4FF3 A;  3M2R A;  4WK1 A;  3VAJ A;  1QVF R;  2G4B A;  5KFE A;  4ZLL A;  1IR1 A;  4FNI A;  2AYM A;  2AJ1 A;  3LP0 B;  4ZOS A;  3P96 A;  4GKJ F;  3H8Y A;  2H5J B;  4LIR A;  1QD1 A;  1P6T A;  2HNZ A;  4WXO A;  4CT9 A;  1N36 J;  3EX7 B;  2VG5 B;  2K3I A;  3HD1 A;  2V2Q A;  3OFG A;  2NR0 A;  4EMD A;  3Q8S B;  1EAY C;  1X5S A;  4X65 F;  4O4R A;  4ZJO A;  3CJ5 A;  1MN7 A;  4DUZ F;  5CXT A;  2MLY A;  1T05 B;  1BE4 A;  5F8M A;  1N32 J;  1NJZ A;  2DXD A;  4M5D A;  4E98 A;  4MIB A;  4X62 F;  4LQ9 A;  4I6A A;  1HR0 F;  1CVJ A;  3C66 A;  3GCW P;  4KYZ A;  1OWX A;  3BGR A;  1XWL A;  2X3D A;  1U09 A;  2ZNZ A;  4OQJ A;  4FYV B;  4L6V 3;  2ZHO A;  3HVR A;  3HSG A;  1IXK A;  3TUZ C;  1H98 A;  4UTG A;  2NXN A;  5C42 B;  5HRO B;  1RT5 B;  3TZZ A;  2EG2 A;  1O8B A;  2W2P P;  1SUQ B;  2MXY A;  4WWS A;  4F2S A;  3UCZ P;  1NK0 A;  1S7H A;  3QT8 A;  4LF8 F;  3IGN A;  3A8J A;  3BJY A;  3UDC A;  3A8K A;  2KB2 A;  5D4P A;  5DGA A;  4P74 A;  1Q5V A;  2P5V A;  3FUY A;  1TKX A;  4ICL A;  2HHX A;  2DPI A;  4PCQ A;  4MYT A;  3W60 A;  2BUN A;  2LDI A;  3PYF A;  4LR9 A;  1WC5 A;  1WEL A;  3F44 A;  4OYW A;  3K8V A;  3OVA A;  4L72 B;  2FJV A;  3UCG A;  1GFW B;  4USI A;  4NMX A;  3LA0 A;  2BQR A;  2HHW A;  4ED0 A;  4Y2M A;  1ZET A;  2V2Z A;  2Z2M A;  3LP0 A;  1YBA A;  5LJ5 Y;  5F3T A;  4RWX A;  3BH6 B;  1ITP A;  2I8E A;  2R42 A;  2XQC A;  2JEI A;  3W2V B;  3IFE A;  1WOP A;  4RNF A;  2VG5 A;  3M4X A;  1JXV A;  3JSR A;  1JXE A;  3GYN A;  4QQB A;  1KRP A;  2BVZ A;  1TK5 A;  3JSB A;  2MZ1 A;  1GX5 A;  2A18 A;  1FJG J;  5GAD U;  2R7W A;  4HI1 A;  3UW1 A;  4DLG A;  2XC9 A;  1T05 A;  5EWE A;  2MQN A;  1FES A;  2CDR B;  4PWU A;  2RNE A;  5ETQ A;  2CFX A;  4ZS6 A;  5LOQ A;  3OL8 A;  2W24 A;  2RML A;  2OD6 A;  3DU5 A;  3NWR A;  4FXD A;  4P75 A;  4ZDN A;  4O23 A;  1RTZ A;  2OUG A;  2E9Z A;  2J9D A;  4JI5 F;  1TR0 A;  2IM0 A;  5C42 A;  5HRO A;  1HQU B;  5H9F K;  2N3L A;  1RT5 A;  2DT9 A;  4UST A;  4AQY F;  2ZH6 A;  4OLO A;  1SUQ A;  2LU2 A;  4IG0 B;  1UVJ A;  3NGS A;  1FXR A;  1RHU B;  3NKY A;  2I5J A;  2YNH B;  3M8P A;  4OJG A;  2MQM A;  4ZIV A;  3T19 A;  1S9E B;  3UVJ B;  5LSR A;  2QYC A;  3DLE B;  1RAJ A;  1QJH A;  1HHT P;  2FPH X;  2U2F A;  2HS0 A;  2WVD A;  4R8U B;  1MU2 A;  3AHP A;  2L41 A;  2NSC A;  2BE2 B;  1TAU A;  3QAU A;  2D3O 1;  2YX7 A;  5SUH A;  4NOH A;  3BO2 A;  4I6Y A;  1VDH A;  3UDL A;  1QAI A;  3EMT A;  1WTF A;  4JI1 F;  1O6X A;  3LF0 A;  3I5B A;  1YSJ A;  3POT B;  1WG1 A;  4ZPT R;  4ED7 A;  4JP8 A;  3FBB A;  3RAX A;  5HO4 A;  3LTO A;  4ZCK A;  3KLF A;  4Q2L A;  9ATC B;  3FNN A;  3H42 A;  4RNO A;  4J9L A;  4MK8 A;  1ZYQ A;  2R2U A;  3EDR B;  1RUS A;  1S0N A;  4ZPW R;  3S7R A;  2BOP A;  3LP2 B;  3RBD A;  4Z37 A;  1NBE B;  2W25 A;  3GIJ A;  1YLX A;  3BKF A;  3D7S B;  1T9X A;  1H7X A;  1ZM9 A;  5HP1 B;  4DL2 A;  4H4K C;  3OW2 R;  1VK3 A;  4MKV A;  2IY5 B;  2AZ1 A;  4DV2 J;  5IWA J;  4A8M P;  3PFO A;  4FPR A;  2QMX A;  4K4T A;  2V50 A;  3JAM Y;  4PR6 A;  1HQU A;  1ZPV A;  2Y1I A;  2LXI A;  3S01 A;  1IR2 A;  4QU6 A;  1RA6 A;  3JS9 A;  5ETT A;  1TQL A;  2VG6 B;  4C4W A;  4YR2 A;  4OJ1 A;  2YNH A;  1R0C B;  2LQJ A;  4Q2M A;  1FNO A;  3EWG A;  4WTO B;  2ZD1 B;  1S9E A;  3GTY X;  1U45 A;  1KEK A;  1T02 A;  1RTD B;  3MCO A;  4HTJ A;  5JXS A;  3GZ7 A;  4ZCI A;  3KUH A;  2PO4 A;  2Z2Y B;  3RRK A;  1Z4U A;  1F60 B;  1CBK A;  4R8U A;  1F5B A;  5H9E K;  1EB0 A;  1W25 A;  2VU5 A;  3DDI A;  1S6Q B;  2N4C A;  3CO0 P;  1XNQ F;  1U1O A;  3AB4 B;  1B0P A;  4DSL A;  3CCL S;  1DFD A;  3KLV A;  1WHX A;  5GAG I;  2X1G A;  3POT A;  3DGV A;  4P7T A;  1FX4 A;  2WCX A;  4NPO A;  3R1H A;  3W2W B;  2XMW A;  2ROE A;  3A13 A;  2C42 A;  2MDA A;  1WC3 A;  2QMU B;  3HSJ A;  3SDE B;  5D3G B;  1RHK B;  3K5O A;  3OFF A;  1SPB P;  3R9L A;  1X9M A;  3SCK E;  3SZ2 A;  2HEK A;  1ZZF A;  4XK8 C;  4YS2 A;  5AE3 A;  1YIJ S;  3LP2 A;  3DU6 A;  4PG8 A;  3BSO A;  4UZC A;  1RTJ B;  2VG7 B;  2HHH J;  4XIU A;  3HVT A;  4HKQ A;  4K4W A;  3MM7 A;  4DV4 F;  2W01 A;  4PEO A;  3TJA A;  2Z57 B;  1KQF B;  1S49 A;  3NY0 A;  2QL7 B;  1U1R A;  2R7R A;  5KFB A;  2G0I A;  2XEX A;  4HAC B;  2H4W B;  4DV0 F;  1NZA A;  1R6Y A;  2WZ1 A;  2D7S A;  4HH0 A;  1EP4 B;  4FS2 A;  5IC4 B;  3K5N A;  1T03 B;  2J0Q D;  1Q8K A;  4DUT A;  2HSE B;  1MSW D;  2EVZ A;  1WJ9 A;  2UUW A;  2V69 A;  3KOA A;  1YQH A;  2QZ8 A;  3Q8V A;  3KJV B;  2RRN A;  4NX9 A;  2D9O A;  3FCW A;  2RRB A;  2ZD1 A;  2QLX A;  3NLC A;  3HI9 A;  1RTD A;  3NL0 A;  2DHG A;  4DF4 A;  5B0E A;  1T7P A;  4EK2 A;  2J0S D;  4PG6 A;  3BS9 A;  5HJY A;  1NJY A;  3E01 B;  2EPI A;  5CYQ B;  2KFN A;  3TAN A;  4NXM J;  1S6Q A;  3Q8Q B;  1M5S A;  3KG4 A;  2WB4 A;  1JJC B;  4OYO A;  2ALY B;  5A2Q U;  4OV6 A;  3PVX A;  3HUL A;  2R8K A;  3AD8 C;  1X4D A;  3M6U A;  2AX1 A;  3MEG B;  5D0R A;  2HVE A;  4KTQ A;  4N41 A;  5IXU A;  2WK4 A;  2HIQ A;  4C11 B;  5J2P B;  3MPY A;  1QAJ A;  3W2W A;  2KFY A;  1S0V A;  3ONQ A;  4F3Q A;  1VQ9 S;  2DNR A;  2ILY A;  2PD1 A;  3DM2 A;  1WOR A;  1KR4 A;  3OQ2 A;  2BJ8 A;  3SDE A;  4QCL A;  1QAY A;  3SI8 A;  1S1U B;  2YVS A;  3BBB A;  4RWW A;  1SQG A;  4K0K J;  1MNE A;  3X3U A;  2W2O P;  1RTJ A;  2OFH X;  4ED3 A;  3VV2 B;  2W7A A;  1EKR A;  1NDL A;  5KT3 A;  4PG7 A;  3OTE A;  4HAC A;  3QJL A;  4KHP J;  2KL8 A;  4WZQ A;  2OEL A;  4FYW B;  2CPI A;  1L3S A;  2VBY A;  3R1L A;  4K50 A;  1T03 A;  3CDW A;  5A2Q Y;  3WZ0 A;  2XWY A;  4NLS A;  5L1J A;  3TI0 A;  4PXD A;  5IV4 A;  3FCV A;  3MI7 X;  1R8H A;  4AMO A;  3BH7 B;  5DJB A;  3KJV A;  1ZZN A;  1W26 A;  3J81 j;  2JVO A;  3J80 Y;  2X1A A;  4LUB A;  4FKY A;  8AT1 B;  1E6V B;  4JI2 J;  4K59 A;  3E01 A;  5CYQ A;  3TEH B;  4TLQ A;  1FJG F;  1SL2 A;  2XS7 A;  1EQM A;  1FDA A;  3MEG A;  5LXR A;  4FP9 A;  4ZN3 A;  2AP6 A;  2F4V F;  3RR8 A;  3W3S A;  2MQL A;  1U2C A;  4C11 A;  4AYB D;  5J2P A;  4LRC A;  4K4U A;  3CE8 A;  4FPI A;  3IGV A;  1WEY A;  2P8I A;  4EWT A;  3M6W A;  4F0K A;  2V34 A;  1S1U A;  3EPG A;  2CQ4 A;  3IBF B;  1S1V A;  2BOA A;  5AJ3 J;  2FHJ A;  3V6J A;  3CSK A;  2A6O A;  4QW9 A;  1NDP A;  2IA0 A;  4DFP A;  1XBW A;  4IYQ A;  2W2N P;  1DLO B;  5F0W A;  1TL4 A;  3EVO A;  4F0H A;  1RCO B;  3UCU P;  3HSD A;  4ECW A;  3VGS A;  1SC1 B;  3CCS S;  1KC8 T;  2V8P A;  3DRX A;  2Q66 A;  4LIW A;  2YH1 A;  4P52 A;  1OIA A;  1GX6 A;  4H4K A;  4CP5 A;  2DRD A;  4X4R A;  4HT5 A;  2CQD A;  3ZZT A;  2FVC A;  2JRS A;  4C48 A;  1S12 A;  5ITH A;  4DV5 J;  2W4P A;  2VAS A;  4TU9 A;  1G7C B;  5E3A A;  1NSA A;  3FRY A;  3AXK A;  1R43 A;  4XAK A;  2Z4P A;  1WOO A;  4AL6 A;  4W90 B;  2F65 A;  3G8Q A;  1S1T A;  2H1Y A;  1CPZ A;  1RBL A;  3AD9 C;  5ETL A;  3CDU A;  3ETO A;  3LH2 S;  3D9B A;  1FJC A;  3KLE B;  4DV2 F;  3OR2 B;  3QQC D;  5L8R C;  3HFK A;  1QY7 A;  5K14 B;  5B0C A;  4IOA Q;  2NSB A;  1TKT B;  2AX0 A;  2DR6 A;  3ZTO A;  3H4B A;  2ASL A;  2G9O A;  4LRE A;  2ZVS A;  5CD4 A;  4XTT A;  3VGU A;  4OI4 A;  3EGV A;  1FKO B;  2E5L F;  1SKS A;  2HVI A;  4P7V A;  3PRB A;  2HRU A;  2HLT A;  4IOC Q;  2MHN A;  1NU4 A;  3M30 B;  2CQB A;  2QE5 A;  5KG0 A;  3CMA S;  3TZX A;  1S6P B;  5LM7 E;  4ECR A;  4J9U E;  4ZVR B;  3NOC A;  4K4V A;  3HO1 A;  1DLO A;  5HQM A;  4MYU A;  2IPO B;  5KFU A;  1TK8 A;  1PSD A;  2B5J A;  3M2U A;  2APO A;  1PG5 B;  3DGP B;  3I4P A;  4QIG A;  4TU7 A;  1Q7Y T;  4PAA A;  1WNE A;  1VC6 A;  3SCJ E;  2DRB A;  3CJ2 A;  2G0J A;  1Y9O A;  3TAM B;  3A8E A;  3QZ8 A;  2HND B;  5ETN A;  2ATC B;  2ASY A;  1RYS A;  2DGU A;  2G2O A;  1S1X B;  2ZDO A;  3GON A;  5KG1 A;  1YBT A;  1GTE A;  3IBW A;  2V67 A;  2KRB A;  1UFK A;  4DSJ A;  3GFX A;  3OXL A;  3CCU S;  1WC4 A;  2PA3 A;  4OLP A;  3EIC A;  2H5I B;  4DX8 H;  3NP5 A;  2ZBP A;  2H65 B;  2HHH F;  4HHU A;  3PX0 A;  1TVR B;  3QFW A;  4WFA Q;  2VFT A;  3OR2 A;  3WDO A;  3IP0 A;  3QSI A;  5K14 A;  3FZB A;  5DRK A;  5A8W A;  1YI2 S;  1TKT A;  3QWU A;  2RQ4 A;  1KON A;  4O3S A;  4ZPD A;  4L76 A;  1OY6 A;  5THW A;  4IRC A;  3CB4 A;  5KG3 A;  1FKO A;  1Y3J A;  2YY3 A;  4LF6 J;  4TKT A;  2KM8 B;  2FLP A;  3KKF A;  5M2R A;  2M8H A;  3M30 A;  3QNW B;  2C3M A;  4MFB B;  2YKQ A;  1JJ2 R;  3OL7 A;  5CAA A;  1S6P A;  2CQC A;  1D9A A;  1NK8 A;  2PII A;  2X1F A;  4BC9 A;  2ZWP A;  3FFI B;  3DGP A;  4K5R A;  3ET6 B;  4NXM F;  5IQ6 A;  1L3T A;  2BAN B;  2B9X A;  3BPD A;  2AJ2 A;  3B4M A;  1FNX H;  1GMW A;  2HND A;  2V8G A;  2H5E A;  1VI7 A;  4ITS A;  4DPO A;  3CUN A;  1S1X A;  2FC8 A;  3BZQ A;  3PJX A;  2GGP B;  2C3O A;  4J5O A;  4ECV A;  2ZKU A;  2I38 A;  1HAR A;  5KFC A;  1WSR A;  2Z30 B;  1SC4 B;  1GXT A;  3FSY A;  5DLG A;  4Y3C A;  3CO9 A;  3AAW B;  1YJV A;  1X8D A;  5D4N A;  4W98 A;  2ERR A;  2HVD A;  4Y28 C;  5H1S V;  3M7V A;  2ADB A;  4QIE A;  2HQF A;  2RUS A;  1N5V A;  4KHP F;  2IBK A;  4DV6 F;  1G3O A;  4P10 A;  5FII A;  3BQ1 A;  2J0X A;  2F8E X;  3LAN A;  1NKE A;  2ZOG A;  2E5I A;  3EXC X;  1XMB A;  3TOQ A;  4DL6 A;  1VR6 A;  2CDQ A;  2EWH A;  3AJ1 A;  1HNV B;  4LFC J;  2YKP A;  1KOH A;  1FVQ A;  5KFP A;  4OHZ A;  3A3P B;  2PGC A;  2IM3 A;  3T5L A;  1GMW D;  4UT4 A;  3GCX P;  1K1S A;  4JI2 F;  4GC6 A;  1UZH A;  3I0R B;  5L9N A;  4QR2 A;  1ZAV A;  3FFI A;  3CCR S;  1JLQ B;  4CM0 A;  3GWC A;  3ET6 A;  2PE8 A;  3KLH B;  3QWP A;  1N8R T;  1VBY A;  2FVP A;  3UE2 A;  3NCQ A;  2ZKT A;  2B43 A;  2ZWO A;  1Z2L A;  3DLK B;  4AD6 A;  4ZIT A;  1SKW A;  2HGN A;  1HI0 P;  2GGP A;  4NAS A;  4QIW D;  4ATN A;  2VQE J;  1GH8 A;  4F25 A;  4ZHR B;  1UPM B;  5F3Z A;  4OZL A;  1I5O B;  1M5H A;  1PYS B;  5HVH A;  3MMJ A;  3Q8R B;  2RKI B;  1X5O A;  2MZR A;  4YY3 F;  5AJ3 F;  2ATL A;  3DXS X;  4RNH A;  1UVM A;  3WX4 A;  3B6B A;  4OYI A;  4M5N A;  3V2U C;  1QSS A;  4MJK A;  2ASD A;  3FSX A;  3GIL A;  4ZVU B;  2Z8Q A;  4USW A;  2XNQ A;  2QFJ A;  4EI2 A;  1RT2 B;  3IWX A;  2M52 A;  3UDE A;  1RTI B;  4B9T A;  3PW5 A;  2CKW A;  2B4P A;  5T14 A;  3G6X A;  1T11 A;  3CIZ A;  2VJU A;  2VFS A;  4B9U A;  3CCW A;  3GFH A;  1HNV A;  5L1I A;  4UZB A;  4HDG A;  2V68 A;  2DH9 A;  1I94 J;  1IKY B;  4WYL A;  3MAH A;  1ZM2 A;  2GO9 A;  1FKP A;  1WOS A;  3QFH A;  4UUX A;  2P9E A;  5F0U A;  3I0R A;  4PYA A;  4K2J A;  1HBO A;  1JLQ A;  2VBW A;  1VRU A;  3KLH A;  5LT5 A;  4OHY A;  4ZP8 A;  3O1L A;  2VDI A;  1HD0 A;  1S59 A;  3MPD A;  1REG X;  1SXL A;  3BR8 A;  1NXI A;  1LEO A;  5E0O A;  3DI6 B;  4M5K A;  4NXN J;  1B70 B;  1X31 C;  5DM6 Q;  2Q43 A;  4V19 X;  3HMJ G;  1FFG B;  3QRP A;  2A0F B;  3FBC A;  3H98 A;  1GMV A;  2XYG B;  3N4W A;  2MKJ A;  3GV7 B;  2CNN B;  2YBV A;  2HBQ B;  4ZHR A;  3KFW X;  2K2P A;  1N0V C;  1N52 B;  4IFV B;  2E1A A;  4ZVS B;  2RKI A;  2DR5 A;  1QUV A;  1UVK A;  3HXM A;  4CH1 A;  5CZC A;  2BRL A;  1TUV A;  2RDJ A;  2YKM B;  5D0H A;  3NNA A;  3PR4 A;  2EFN A;  3ENQ A;  3W9H A;  1IJF B;  4ETX A;  3PTW A;  1TMM A;  2HAF A;  4ZVE A;  1RT7 B;  2HFN A;  2HFO A;  4OYX A;  5E41 A;  2KKH A;  3UFC X;  3NWG A;  3RJM B;  1RTI A;  2IA6 A;  1S1W B;  3I0S B;  4HH1 A;  2AWZ A;  5C5J A;  4Q7A A;  3B54 A;  1X4F A;  5CAB A;  3J81 Y;  1IKY A;  3PEH A;  4UY8 T;  4XO0 A;  1F6T A;  2E5H A;  2HKE A;  2XMJ A;  2E5G A;  2MGZ B;  3RG6 A;  3MF5 A;  3UD4 P;  2HHP A;  5J2N B;  5KT2 A;  1UP1 A;  1LQ9 A;  2DPJ A;  2W7P A;  1HQE B;  2P6S A;  3AJD A;  4GVL A;  1HLW A;  3R8Y A;  7AT1 B;  3DI6 A;  2XLJ A;  3T41 A;  2D3O R;  5DQI A;  4BDP A;  4KGZ B;  1HKA A;  4QYZ J;  3DMJ B;  1JMT A;  3QZ7 A;  1UET A;  3ILJ A;  1DJ0 A;  4B9L A;  2CPE A;  2NLW A;  2VPZ B;  2BM1 A;  3MM8 B;  2ZZT A;  1BGX T;  3PRD A;  1BHN A;  1O0P A;  5DQH A;  3Q0A A;  1UFW A;  3D67 A;  5HK4 A;  4IFV A;  1FFW B;  2DHH A;  3MAQ A;  5ETR A;  1NDK A;  1CC7 A;  3M9O B;  3OTO J;  5K8O A;  3TUJ C;  1R3N A;  5A8R B;  3MEK A;  2PI5 A;  1ZS6 A;  2YKM A;  2VKR A;  5BJR A;  1AA1 B;  2Z58 B;  1UEU A;  2JNJ A;  1CG2 A;  2Q6C A;  2OIH A;  2J76 E;  1CQN A;  1Y7P A;  5E3Q A;  4AUK A;  1RT7 A;  2FC9 A;  3BQ0 A;  2DNP A;  1G2E A;  2CPY A;  1SH2 A;  2GIF A;  1TKZ A;  3UR3 C;  1S1W A;  3I0S A;  2LQ9 A;  3AA9 A;  1RAC B;  2UXC J;  2PT0 A;  3RB4 A;  3OL9 A;  4OI2 A;  1S10 A;  4CLF A;  2FUG 9;  3GII A;  1S57 A;  4ZIW A;  2MGZ A;  1HNW J;  1YDL A;  1LKZ A;  5ETP A;  5J2N A;  2D3U A;  2H4Y B;  2HUR A;  3MUV P;  3BO3 A;  2NPI A;  1ULR A;  4XPC A;  3CF5 Q;  1TV6 B;  2FJX A;  3A3O B;  4LF9 F;  4KV8 B;  1SC3 B;  5BYR A;  3BN7 A;  4KSE B;  2RQC A;  1KVI A;  3CJ0 A;  5FDL B;  5I3P A;  3DMJ A;  2OPS B;  2B6A B;  1IM6 A;  2C3Y A;  1Q82 T;  3MM8 A;  3AB2 B;  3U1N A;  4C0H A;  5KFJ A;  2ZDP A;  2DD8 S;  1HBM B;  4F04 B;  2A3J A;  1N5S A;  4ZPC A;  3KK3 B;  3GFZ A;  1VJW A;  5A8R A;  3L7U A;  2W4D A;  4LFC F;  2VC1 A;  4P73 A;  3O6Q A;  1YZ7 A;  3BYP A;  1UCN A;  1XTZ A;  4M5J A;  2CJB A;  2DNM A;  3NGU A;  1SH3 A;  2PN6 A;  1WF1 A;  2BDP A;  1VHF A;  2LXF A;  4MK7 A;  2GML A;  2Y9H A;  3GMG A;  3DRY A;  2AEJ A;  4DEZ A;  1YVF A;  2EG1 A;  3PJW A;  1F9E B;  4CDI A;  3NAI A;  3QIP B;  5BR8 J;  1B0V A;  4DQI A;  4X84 A;  3SIP B;  1RU2 A;  1H38 A;  2VQE F;  1RGV A;  5IV3 A;  4UOG A;  1U1Q A;  3Q24 A;  5D78 A;  1EQ0 A;  4NWB A;  2YKO A;  3QT5 A;  2AGO A;  5B0B A;  3E3X A;  1U25 A;  5KFI A;  4Y2I A;  2R9L A;  4UOC A;  1NJI T;  3CGI A;  1TV6 A;  2D41 A;  2HMI B;  4CLS A;  4GO7 X;  3K57 A;  1GNK A;  2IFX A;  4B9N A;  1Q8L A;  3MM9 A;  4KV8 A;  2V94 A;  3H0P A;  4DFJ A;  1IR0 A;  5FDL A;  2C1E B;  2IBO A;  2OPS A;  2B6A A;  1ARO P;  2ZH9 A;  3Q8U A;  3N6N A;  4QWD A;  1Y11 A;  1NHU A;  3N5B A;  1HBM A;  4ZN1 A;  4H54 A;  4KT0 C;  4RU9 A;  2N82 B;  3KK3 A;  1UVI A;  4PQU B;  4XPE A;  3CD0 A;  4X66 J;  4Y6I A;  2AHO B;  1I94 F;  3UD5 A;  2OPR B;  2ABY A;  4DL7 A;  1S76 D;  4JV5 J;  2DGQ A;  1IBK F;  1CLF A;  2LMI A;  1PJ6 A;  3K5P A;  3F56 A;  3DFE A;  2YWH A;  2WSF C;  3J7Y U;  1OYE A;  5DS7 A;  2XSJ B;  2MQP A;  4GC7 A;  3C15 B;  1V5I B;  2R8H A;  3G96 A;  2BW2 A;  5LMN J;  4F4Z A;  1U1N A;  3A1Y G;  3QIP A;  4DCO B;  2M88 A;  2Q3P A;  4DCP B;  3FBE A;  2BXJ A;  2YKN B;  4X4U A;  4DR7 F;  3PX6 A;  4YN3 B;  3I96 A;  1NJW A;  4MIA A;  2NUU G;  3GYG A;  4O3N A;  5HSP A;  1IKX B;  3W61 A;  2WAQ D;  2HMI A;  4WP8 A;  4QU7 A;  2DVI A;  3PCO B;  3IS9 B;  2X1B A;  2PMH A;  2ZUA A;  2K7J A;  2R7V A;  2IDE A;  3GU0 A;  4Y0F A;  2YWE A;  4URG A;  5IC6 B;  1NK5 A;  3CJ8 A;  3THP A;  3N01 A;  1OJ4 A;  4F7V A;  3SEO A;  2XZD B;  1J5O B;  1JKH A;  1VQL S;  4YOE A;  4N77 A;  2B8Q A;  4TNO A;  1ZAX A;  5H9E J;  2MKS A;  4NZ7 A;  5EX0 A;  3N5F A;  4PQU A;  2GVZ B;  1M1H A;  2DNL A;  3C3L A;  2OPR A;  4FDF A;  5KOW A;  3MAA B;  3GG0 A;  1WEZ A;  3H2L A;  7FDR A;  4ED2 A;  3FJ2 A;  4IKA A;  4ZKA A;  1S5Z A;  4NI2 B;  4RBT A;  1CJV B;  2BJ1 A;  3OFE A;  4Q5V A;  4OI1 A;  4A8Y A;  1RAD B;  5FLX U;  2XSJ A;  4CNZ A;  4MT1 A;  4ZCM A;  2J6U A;  1LFW A;  4EO8 A;  4F2R A;  4XDC A;  3KG1 A;  1LXJ A;  2C2N A;  4UOH A;  4NLY A;  3PAC A;  4GMK A;  2OP5 A;  3MR3 A;  2Q1L A;  5J1P A;  2W9A A;  3U02 A;  4V1A k;  5HMY A;  3MCM A;  4AFF A;  2ZUG A;  1SJ1 A;  3GIR A;  3VQT A;  2ZH1 A;  2OI2 A;  1HHQ A;  1B0T A;  1S72 S;  4A8W A;  1IKX A;  5KG6 A;  3OTO F;  5DLF A;  2CNL B;  2B51 A;  1WI6 A;  1V3R A;  3IS9 A;  3R2D J;  1BY9 A;  2Z56 B;  3HLU A;  4ED5 A;  1RTH B;  2B3T B;  5GAD I;  2HRY A;  3I4H X;  2HGL A;  2KN4 A;  2KT2 A;  2DO0 A;  2J0W A;  1UPP A;  3VZH A;  4UF4 A;  5FLX Y;  1FVS A;  1IKV B;  4OZ5 A;  3VAK A;  5F8G A;  2UXC F;  1MMD A;  2DGT A;  2GVZ A;  2P2C B;  1FRI A;  5J2M B;  2VBX A;  3MR6 A;  2E7W A;  2MKC A;  2F63 A;  1HNW F;  3MAA A;  4PQA A;  1PJ5 A;  2ZM6 J;  1Y0H A;  5MAO A;  2E9T A;  4PWW A;  3N9U C;  3A8I A;  4NI2 A;  1CJV A;  4DPX A;  4DF8 A;  4EZ6 A;  1Y10 A;  2UVU A;  2JLE A;  2W9B B;  4QR1 A;  3PYG A;  2W8K A;  2W8L A;  1J5E J;  5KFO A;  1U6Z A;  3UPF A;  5A6P A;  2MB0 B;  3BQ2 A;  3T1H J;  1FRL A;  1X4C A;  4NLD A;  2HK3 A;  4A48 A;  1JLB B;  2RE1 A;  1ICE B;  3IRX B;  1X60 A;  1W7W A;  1TZ0 A;  4OI0 A;  1HHS A;  2ZJQ Q;  1N5T A;  2U1A A;  1K47 A;  1N54 B;  2MLX A;  2VHG A;  3SSS A;  2WVC A;  3LWL A;  1RBO B;  3EZ5 A;  4OYB A;  1P8G A;  1RTH A;  1FEH A;  1HBU B;  3FBF A;  4FN5 A;  3THV A;  2CJK A;  4X4T A;  1M1K T;  4UQG A;  4CH0 S;  2CVI A;  1N0U A;  3EE3 A;  1FRX A;  2QV6 A;  2CPF A;  3ZTS A;  3K7R A;  2WBM A;  2VV5 A;  1PAE X;  1IKV A;  4ES2 A;  2F8H A;  3CJQ A;  4WPA A;  5CYM A;  2ADC A;  3WX8 A;  1H6K X;  4F36 A;  2UZA A;  2CQ3 A;  3NRB A;  2CWX A;  3KHG A;  1ZA1 B;  1TL3 B;  4LT6 A;  5J2M A;  3CCQ S;  2UUC J;  1PCA A;  2MQQ A;  4Q44 A;  4DL4 A;  3H59 A;  3KHH A;  3PDN A;  1RIS A;  2UVW A;  4I0W A;  2CZV C;  2IIH A;  4NE9 C;  1R7I A;  2FLL A;  4OZJ A;  4J91 A;  5MLC V;  3AFG A;  2HZA A;  5B0D A;  2KXH A;  2W9B A;  3CCZ A;  4FYX B;  2KI2 A;  1P1T A;  5LL6 d;  3ENA A;  5EHH A;  1U24 A;  3ICL A;  2E29 A;  3TP2 A;  3DN9 A;  1FFS B;  1C0U B;  3L4B C;  1RWV B;  1S99 A;  5KTQ A;  1JLB A;  2IVY A;  3NOG A;  3QRQ A;  1BXN A;  1LWE A;  2EXU A;  3L09 A;  3MOJ B;  3I5A A;  2BRK A;  1G4C A;  2IAJ B;  5AXN A;  1MWQ A;  3NGR A;  4DMZ A;  4X66 F;  2CQ1 A;  2B8P A;  3NCR A;  4X4O A;  2DNG A;  3HHL C;  1FTR A;  1HBU A;  2W9C B;  4A8Q A;  4JV5 F;  4F3M A;  5KT5 A;  1VC5 A;  3LGM A;  2XGP A;  1PAU B;  3N6M A;  1RJJ A;  3IM8 A;  2LA4 A;  1VQ7 S;  2J9D E;  1H7W A;  1MLA A;  5GAH U;  4ZA1 A;  1FE0 A;  5DG7 A;  1AT1 B;  3P5B P;  4ZK7 M;  5LMN F;  1P9Q C;  2CQH A;  3K5L A;  4LR8 A;  4I2P B;  1TL3 A;  1NDC A;  4B3M J;  1YGY A;  2DJW A;  4LF2 A;  4B9V A;  3OD2 A;  2I1R A;  3Q22 A;  3CED A;  2O67 A;  2C2M B;  1TU0 B;  1NME B;  5BXI A;  2BA9 A;  3NBP A;  2V8V A;  2BQU A;  2NXC A;  3BSA A;  1DY3 A;  5L1L A;  3JB9 k;  4X64 J;  3S8S A;  3VWS A;  4WU3 A;  1B3T A;  2HQI A;  1CQM A;  2AW0 A;  3IAS 9;  2J6T A;  1M90 T;  4FVM A;  4EBC A;  3M8Q B;  1RWO B;  4ECQ A;  1RKI A;  3VTI A;  3OJS A;  2IAJ A;  3EJM A;  1UA1 A;  4RU2 A;  1Y3K A;  1WF2 A;  3NAH A;  2YNI B;  1VRT B;  1BQN B;  2W9C A;  4DR4 J;  4CLY A;  1JLE B;  4M5L A;  2FJE B;  2DNZ A;  3ILO A;  4KJI A;  3T5J A;  4NA1 A;  2GNK A;  4PWD A;  4TQS A;  2KHC A;  1GXU A;  3CCE S;  3CC7 S;  4PXC A;  1HI8 A;  2VA3 A;  1MG7 A;  1NHK L;  2NQP A;  3O8W A;  4I2P A;  3TUP A;  1Q16 B;  2EC0 A;  2AEM A;  1FHT A;  3CJR A;  3C8Y A;  2B4U A;  2G2Y A;  4J9R A;  1NK4 A;  4DR2 J;  4FVC A;  3OXG A;  2KYX A;  4C6A A;  4CWB A;  2BAC A;  1S97 A;  1YJU A;  1JJH A;  1Q8B A;  3H25 A;  2YPY A;  2D69 A;  5KFR A;  4IFY B;  2BBE A;  4I6W A;  1NRK A;  3GSI A;  2WSC C;  2W4C A;  2CNO B;  3JSM B;  3PFE A;  4I56 A;  2B56 A;  3WC2 A;  1CJU B;  3RUB L;  3VHQ A;  2R7Q A;  4L3K A;  4J9Q A;  3U7J A;  3M8Q A;  4NCG B;  2QL9 B;  2QEX S;  1TMJ A;  3VAG A;  2YNI A;  3CDE A;  3BBC A;  1VRT A;  1BQN A;  2XS2 A;  2JC0 A;  4NEY A;  1FJ7 A;  1JLE A;  1H74 A;  1N34 J;  2DR7 A;  1X4B A;  1YZ6 A;  2QL5 B;  4N56 A;  2B9Y A;  1VQN S;  1MMN A;  2RHS B;  2IVF B;  1DAR A;  4WE1 A;  4OZ2 A;  1HWI A;  2V8H A;  4N8N A;  4J9K A;  4G1P A;  1JJ4 A;  4BHQ A;  1X0F A;  5EN1 A;  1TKX B;  1J5E F;  2X7I A;  4ICL B;  2HIY A;  4LRA A;  4OMF G;  1H3D A;  4NLR A;  3T1H F;  3TWZ A;  3MM6 B;  1GK8 A;  4DQQ A;  5BYQ A;  1D8Y A;  3HHN B;  2DNQ A;  2EBG A;  4MAK A;  5B0G A;  4F02 A;  4JI8 J;  2L08 A;  3MUT P;  1Q8I A;  1B4S A;  4IFY A;  2DIU A;  4NLG A;  3IG1 B;  3T1Y J;  2GAH C;  3C6U A;  3NS5 A;  4NRU A;  3JSM A;  3LAL A;  4ECT A;  1SKR A;  1L3U A;  2KG1 A;  3AOB A;  1CJU A;  1UFL A;  2CG8 A;  2KZM A;  2HFZ A;  2DCU B;  3U27 A;  4RZR A;  4NCG A;  1XR5 A;  4U95 A;  1RI7 A;  2VFV A;  2DR9 A;  4RL1 A;  2CQ2 A;  3ENW A;  2ZEJ A;  2QSF A;  2I0X A;  3HKZ D;  2Y1L B;  2UUC F;  3HDS A;  4Q8E A;  3M6X A;  2EFV A;  4Y2K A;  3BN4 A;  5HMZ A;  2UVR A;  3GJS B;  3AQO A;  4ZVQ B;  3FSI A;  2YWG A;  2G13 A;  4WKR A;  4C8K A;  1UW9 A;  3GLJ A;  4R25 A;  2J5A A;  3BB5 A;  4DV7 F;  3NMA A;  2AJ0 A;  3RTV A;  2MQO A;  2OSQ A;  4IDK B;  2FJD B;  2I5J B;  3M8P B;  3VCD A;  3KJN B;  3CJ4 A;  2VBZ A;  1S6U A;  4FXW A;  2DH7 A;  4K4X A;  4YB7 A;  4CNY A;  1FK9 B;  3I32 A;  1U8W A;  4WJB A;  3EGW B;  3TA0 A;  3MM6 A;  1MU2 B;  4USH A;  3MR2 A;  2A10 A;  5CZD A;  1YX2 A;  3S6E A;  2JX2 A;  4C9D A;  3G8T A;  3FK4 A;  1NSQ A;  1AW0 A;  3M8R A;  1FT8 A;  1X7V A;  1YKW A;  3QLH B;  3C6T B;  3AOD A;  2IMW P;  1NAQ A;  1WTB A;  3IR6 B;  3PRV A;  1DUR A;  2E1M C;  3IG1 A;  4P6Q A;  4NCA A;  5KFL A;  4FF1 A;  2OTL S;  4CIO A;  4KR0 B;  4UOF A;  3M8Z A;  2RT3 A;  2CWK A;  2W2M P;  3JXO A;  2XMT A;  1SKU B;  1SJQ A;  5CH7 B;  3FRZ A;  2C3U A;  5KG7 A;  2QLJ B;  2IC3 B;  3KLI B;  3KLF B;  3WIU A;  4LSN B;  4WII A;  1M5P C;  2VOO A;  2LP4 A;  1PBA A;  1XK8 A;  4IH6 A;  3G82 B;  3V6K A;  3W66 A;  4DR5 J;  2XLK A;  3ETM A;  4QWE A;  3HPO A;  1FCA A;  4KHM A;  1X4H A;  2RD5 C;  4DXL A;  2RU3 A;  2PSZ A;  4DG1 A;  1PC5 A;  2XS5 A;  1XIQ A;  4M63 A;  2FHO B;  3DOL A;  1E6Y B;  3UWT A;  2V4R A;  1VBX A;  4F4A A;  1U0H B;  1WI8 A;  5CA5 A;  3OT9 A;  2BMB A;  1QM9 A;  3PY8 A;  5KFY A;  2GQQ A;  1KVK A;  2F3J A;  4HEA 9;  4A4J A;  2GW8 A;  1XER A;  1AFI A;  4KFB B;  1C2P A;  2OTJ S;  4MK9 A;  4WP9 A;  2F9J A;  3MD3 A;  4IDK A;  4FYY B;  2AGQ A;  4C7Q A;  3GSD A;  3OHA A;  1J27 A;  3Q2T C;  2JDJ A;  4X64 F;  1IBL J;  2Y1J A;  1FK9 A;  2V2K A;  5DDR C;  1HMV B;  2NXU A;  1FRM A;  3JQM A;  2CQ0 A;  2M2B A;  1Q95 G;  1RAE B;  4ZJQ A;  2QA4 G;  2DYA A;  3BV8 A;  4DQS A;  5DG9 A; 
#chains in the Genus database with same CATH homology
 3TZW A;  2CUY A;  2QO3 A;  5DZ6 A;  3TZX A;  2G2Y A;  4RL1 A;  3IM8 A;  1MLA A;  2VKZ G;  2C2N A;  5DZ7 A;  3R97 A;  1NM2 A;  3G87 A;  3EZO A;  3SBM A;  3IM9 A;  3R8Y A;  5CZD A;  2HG4 A;  2UV8 G;  2G2Z A;  2PFF B;  2H1Y A;  3HMJ G;  3TZY A;  2JFK A;  3PTW A;  3TZZ A;  4QBU A;  2QJ3 A;  3QAT A;  4RR5 A;  3K89 A;  3RGI A;  3TQE A;  2G2O A;  3HJV A;  5CZC A;  2VZ9 A;  2QC3 A;  3BV8 A;  3CJ8 A;  2JFD A;  2VZ8 A;  3H0P A;  2G1H A;  3HHD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...