3EZOA

Crystal structure of acyl-carrier-protein s-malonyltransferase from burkholderia pseudomallei 1710b
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
307
structure length
307
Chain Sequence
MKFAFVFPGQGSQSVGMLNAFADVAVVRETLDEASDALGQDIGKLIADGPADELNLTTNTQPVMLTAAYACYRAWQQAGGAQPSIVAGHSLGEYTALVAAGAIAFRDALPLVRFRAQAMQTAVPVGVGGMAAILGLDDDTVRAVCAEASATGVVEAVNFNAPAQVVIAGTKAGIEKACEIAKEKGAKRALPLPVSAPFHSSLLKPASDKLREYLAGVDVKAPKISVVNNIDVAVVSDPAAIKDALVRQAAGPVRWVECVQHIAREGVTHVIECGPGKVLAGLTKRIDGNLVGASVFDPASLDEALKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Malonyl CoA-acyl carrier protein transacylase
publication title Combining functional and structural genomics to sample the essential Burkholderia structome.
pubmed doi rcsb
source organism Burkholderia pseudomallei 1710b
molecule tags Transferase
total genus 109
structure length 307
sequence length 307
ec nomenclature ec 2.3.1.39: [Acyl-carrier-protein] S-malonyltransferase.
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00698 Acyl_transf_1 Acyl transferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.250 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Malonyl-CoA ACP transacylase, ACP-binding 3ezoA02
3.40.366.10 Alpha Beta 3-Layer(aba) Sandwich Malonyl-Coenzyme A Acyl Carrier Protein; domain 2 Malonyl-Coenzyme A Acyl Carrier Protein, domain 2 3ezoA01
4RL1A 3IM8A 1NM2A 3TZZA 3H0PA 2JFKA 3TQEA 3EZOA 3G87A 2JFDA 2QO3A 3IM9A 2G1HA 3TZYA 5CZDA 2VKZG 2VZ8A 1MLAA 3QATA 2QC3A 3HMJG 2G2OA 2CUYA 3HJVA 3RGIA 5DZ7A 2H1YA 2G2YA 3R97A 3TZWA 3CJ8A 2HG4A 2C2NA 5DZ6A 2VZ9A 3BV8A 2PFFB 2UV8G 3HHDA 4QBUA 3K89A 5CZCA 2G2ZA 4RR5A 3TZXA 3SBMA 3R8YA 3PTWA 2QJ3A
chains in the Genus database with same CATH superfamily
3M4XA 3RTVA 3MPDA 1RBAA 1S9GA 2K3IA 3OJUA 1T9VA 2R7UA 4QR2A 2R7XA 4JYAJ 1BQNA 4EYIB 1RE1B 5KFSA 2AD9A 1C0TA 4PR6A 2X1FA 2QEXS 2F9JA 1TUVA 3W62A 3NNAA 2VODA 1RWUA 1WC0A 2FPHX 4R8UB 4O4GB 3BBCA 4DR5J 4UOFA 4QBUA 2XM3A 3KLEB 1ZS6A 5ETRA 2AT1B 2MKHA 1YJNS 2MKYA 3TQEA 4M5LA 2DEIA 4DPXA 1B64A 1UJ6A 5KFQA 1WACA 3D54A 2QSWA 3T19A 1URRA 1FF2A 5IWAJ 3AB4B 1H2TZ 1DTTB 4MT1A 3SQGB 2LQ9A 1F2HA 4H4OA 4EZ6A 4DUZJ 3L09A 5K8PA 3FEXB 3OFEA 2WVCA 4R8UA 1NJZA 4ES1A 4O4GA 2CADA 3IAM9 1ULRA 3CCES 4AXIA 1MWZA 5K5MA 3KLEA 1IJFB 5RUBA 6FDRA 4IR1A 2KG1A 3CMQA 1UPMB 1K44A 2FC8A 2QMWA 1U0HB 2UP1A 4NXMF 3ISND 1VQMS 4OI6A 4PAAA 5ITHA 1FDDA 3AOAA 1DTTA 1DARA 1Q7LB 1G6BA 3SQGA 2ZE2B 4K4XA 3SI8A 4OLPA 4WXWA 4UZCA 3OT9A 2HVIA 1R27B 4WP8A 3K57A 4ES2A 4KIAA 3GIJA 2W1BA 1FDAA 5A6PA 4DV4J 3DRXA 1IJEB 4CYUB 3W63A 5DS7A 1F9FA 4LF9J 2CQHA 1KC8T 1KVIA 2FZKB 5LL6d 1WOOA 3UN2A 2WCXA 2LFVA 2HHVA 2DHAA 1I3OB 3AY0A 1XNQF 3O6QA 4DV1J 1KR4A 2ZE2A 2HVHA 2GQ2A 4ZPWR 3PIPQ 1HL6A 1SC1B 2JX2A 1IKVB 4RUBA 4WFZA 4IOCQ 1VFJA 2JLGA 3LALA 3PRVA 3GV8B 4WKRA 2E1PA 1F60B 1WG5A 4WCEQ 4RU2A 2OJ3A 1VRQC 4C4WA 3FBFA 1NRKA 2YKPA 4CYUA 4DPWA 1T3OA 4FYWB 5KG5A 4PXEA 3LANA 2HFOA 1WOPA 2YNHB 1U6ZA 2PC6A 5J2PB 2HFSA 3JYTA 3QT5A 4IG0B 1XMBA 4JB8B 1U1MA 3DXBA 3QFHA 4K2XA 4HDGA 3MGJA 5GADU 2NPIA 1L3KA 1UTAA 1EB0A 1EHWA 2KZMA 2CWXA 1IQZA 1BWVA 2FLOA 2VA3A 4RNMA 4M5MA 3NCPA 1NPPA 1BLUA 1M5VC 5L39A 2W9CA 4DF8A 2VFTA 1SH0A 2XY6A 3R6GB 2LA4A 3SYZA 4I0WA 4NX9A 2YNHA 1VGYA 4DDFA 4NLSA 3TA2A 5I42B 4K4YA 1A0OB 5J2PA 3Q8VA 3EGNA 4OZ0A 1N4LA 1IQTA 4Y6IA 1Z1ZA 4ZP9A 1TL3B 4O0IA 1PKUA 2V9WA 1J5OB 2ZD1A 5E0OA 3SSQA 2NXCA 2RMLA 2J0QD 2JWNA 1BGXT 1RWKB 3J80Y 1Q8BA 5K8OA 5KT6A 1FKPB 1IN0A 1JJ2R 2HQFA 3KDNA 4FXDA 2QO3A 4JI5F 2VQFF 3Q8UA 3T5JA 2EC0A 2I8EA 2WAQD 5I42A 1B70B 2M9KA 2MKJA 2WK4A 4FNIA 3BF4A 4NMLA 1JQGA 1KP6A 1TP7A 2QZ8A 3O1LA 2E5GA 4W4MA 3VQSA 2MJUA 1T94A 1TL3A 5BYQA 1BMQB 5HSPA 4J9PA 1S9FA 2DNMA 1J5OA 3RYLA 3P45B 3BQ0A 4F0KA 2C2KB 5D6GA 3TP2A 3TVKA 2FDNA 5JVGQ 5IS2A 1FKPA 2IJRA 1VHIA 4ZVUB 2I5JB 4F3MA 2G4BA 2RRNA 4K0KJ 4KGXB 2ZUAA 1HW8A 2FHJD 5AE3A 2VG6B 3ZC4A 2KVQE 3CCRS 1S5ZA 4X65F 1SQEA 5KG7A 2X1AA 3VZIA 5D8HB 3IR7B 3CC2S 2Z2MA 1DFDA 4IDKB 2CZ4A 2W2OP 2EFPA 1NSQA 1HBNB 3BPDA 5KOXA 3WBZA 2XQCA 4PQUA 2XO7A 2J8SA 2I5JA 3BM7A 1A6LA 3LO3A 2GJIA 2ROEA 5F8MA 3IGVA 5B0CA 5HK4A 1P9QC 2BJDA 1X4AA 2ILZA 1N5YB 2OPRB 3TI0A 3H98A 1FTCA 3IWXA 4PWUA 3D1HA 2ZC4A 3S7RA 1OSDA 3FBEA 3HHLB 4KO0B 4QQBA 4LR8A 4B3MJ 2QA1A 4ZKAA 4CH7A 3RAQA 4F4XA 1HR0J 3DNCA 3I56S 4IDKA 2GVZB 4PG8A 5JVHQ 1FI4A 2DY9A 2VDHA 4RPFA 1HBNA 1RBLA 4OYOA 3NKYA 3L3CA 2AX0A 4J9QA 2RU3A 4OJ1A 2LQJA 3OFGA 4LSZB 4OZJA 5KFOA 2F7VA 3EX7B 2DGVA 2UV8A 4A47A 3I4PA 1AA1B 1N5YA 4G65A 4CCHA 3CSKA 2RUGA 4ZVEA 4ZK7M 1TMJA 3HHLA 4KO0A 3LH2S 1NHKL 3FEZA 4OJ3A 2OHDA 2J9EA 1REGX 1BE4A 3RB4A 1X5TA 4IH6A 4HH1A 1Y11A 3R1HA 3UD5A 4F4KA 1CS4A 2VU5A 1XMQF 3PYEA 2BACA 3PR5B 1XBWA 3KUGA 1T9WA 2BDPA 1CJVB 1GFWB 4DQQA 5FJ4A 2QJ3A 3CJ4A 3SQOP 1RQ0A 3THPA 4RW8B 4DWIA 4LRCA 4CLUA 4C0BA 2ZWPA 4CLYA 1YBUA 2XZDB 3OLAA 2AEJA 1WTBA 4DN0A 4A8XA 4PWDB 4BWJA 2EKYA 2HLTA 4J9SA 4O3QA 4ICLB 5GMDA 4NA3A 1WNEA 5HMYA 4ITSA 3MHYA 5B0AA 3K5PA 3DOMA 3D68A 5K14B 5GAEU 2MZ1A 1XR5A 2BRKA 3WC0A 1TKXB 2FZCB 3W2VA 3E01B 3QNWB 2IVYA 1CJVA 2M3DA 3EYZA 1KLNA 2W4PA 4F26A 4IG3B 4RW8A 4C0HA 3PW0A 1LWXA 2FHOB 2KHCA 3LOUA 3S8SA 5D77A 2EXUA 4ZP6A 4UOGA 1VQYA 3OVSA 1QAJA 1UVNA 3H40A 4ICLA 2FVQA 2YY3A 4HTIA 3QGHA 4HHHA 1RK8A 2XULA 3W5XA 3G8TA 1CULB 3FJ2A 3M2UB 5K14A 3D9BA 2YBVA 1TKXA 3E01A 2WB4A 2EBGA 1NK4A 4PUOB 1YITS 1JLEB 4IG3A 3KNGA 3G8QA 1QM9A 1X4DA 4P7VA 1X31C 1YJUA 3ZZOA 1KS2A 4OHZA 2E1AA 1N48A 4U7UD 1QD1A 2R8JA 3BGUA 3HULA 2EFNA 4F4AA 2AEMA 1S6PB 1PAUB 1N8RT 1S76D 3GWCA 2ZBRA 2XSJB 1VIXA 3VAGA 1CULA 1G1XA 2W8LA 3M2UA 4M5NA 1L3SA 3MEDB 4HEA9 1LFPA 4DCJB 3GZ7A 1FVSA 4PUOA 3QFWA 1YIJS 2DBBA 1JLEA 3K8VA 1FCAA 2WVFA 3QGIA 3FCWA 1YVFA 1WTFA 4F8RA 2AX1A 5AT1B 3NP5A 2OPPB 3UQSA 3M8YA 3CJ3A 4LF6F 1SI9A 1S6PA 2V0NA 4WK1A 3NAIA 4AMNA 5KG4A 1FNMA 2RDDA 3BSOA 3DRYA 3V81B 4ZP7A 3UWTA 2XSJA 1FNOA 1W25A 1N36F 4G3IA 3W61A 2F4FA 1NSAA 4TYAA 5GVQA 4LF1A 3C16B 1IWAA 5HBMB 2GMHA 2IC3A 1TK8A 2A6MA 2IA0A 1G2EA 4C98A 4KH0B 2J9CA 4X4QA 3HM9A 1OYDA 2G13A 2XI2A 2OEKA 2OPPA 2Z2LA 4AMOA 2B8QA 3HFKA 2BKPA 3O5TB 1NB7A 2N4DA 4UZBA 3LA0A 3DOKA 5E5NA 4NL5A 3WIUA 2Q3PA 3I5BA 1F5CA 4X4VA 3HHKA 4FF4A 4V19J 1NJXA 2PE8A 1O8BA 1S0OA 2MHEA 3C16A 5HBMA 3MUTP 2PGCA 3MI7X 3BGFA 3I0RA 2GO9A 2MSTA 3FK4A 2RIJA 3CEDA 4U96A 4OLOA 3OR2B 2A10A 2DNZA 1RYSA 3H2UB 4OJHA 3OR1A 4KFBA 2J7WA 3VVTA 1C4AA 2LQ5A 3PW7A 5DDQC 1JLBA 4I7FB 3J80U 2LP4A 2OPQB 2FLLA 4UUWA 1FVQA 2CPYA 4NZ0A 1C0UB 1UVLA 1EIYB 3IN5A 3DRPA 1M0SA 3JB9k 2FD2A 3LGNA 2VC0A 4C3KA 2AGPA 5FLXY 4AFFA 1NNDA 2OMLA 3CDBA 1DRZA 1PJ5A 3GYXB 8RUCA 4O4RA 1YI2S 2VF3A 2Q6CA 5F41A 1K9MT 3FMBA 1KVJA 1XEZA 3OR2A 1TL5A 5DDOC 2XY5A 2Z57B 3VAHA 3B4MA 4Q0BB 1TV6B 3GJTB 1HNWF 1LK5A 1X4BA 5CYQB 1YJ7A 4M5GA 3LGMA 4DFJA 1DLOB 2YKOA 5BR8J 4JI7J 4I7FA 4H4KA 3TX8A 2HVDA 3MCNA 2OPQA 1X0PA 3Q83A 3E51A 3PHEA 3G71S 3OHBA 1NUEA 5L38A 4I2PB 4OZ2A 1RBOB 2BBEA 4LFCF 2H3EB 2V8VA 1AFIA 5KFXA 1OQ6A 1JNRB 3P96A 4USMA 4DV0F 3A3PB 4LR7A 1HNIB 1CJTB 1BD6A 4Q0BA 4KHRA 1SJ1A 1TV6A 4C8OA 3DDKA 2PN6A 3OL8A 2D7SA 1JXVA 3D7SB 4NLGA 3IM9A 5CYQA 1U1QA 3PW4A 2GVDB 4PKDB 1RTHA 3UO0A 2UV8G 4P10A 1C4CA 2ZBIA 4I2PA 1RHUB 2NUHA 4Y2AA 4ZLNA 3H7HB 2DPIA 4QJVA 4EZ9A 3DHXA 2AJQA 1SL2A 4B9UA 1PJ7A 1WF0A 1X4FA 2W2NP 4DLEA 4RR5A 1NKCA 1HNIA 5C24A 3GE9A 1CJTA 3A8KA 1YTYA 4L3KA 4ZVTB 3BQ2A 3W1YC 1WC6A 2JDJA 4IR9A 2GVDA 2W2QP 4RZRA 2Q43A 1S59A 4NE9C 1RA6A 4USJC 5ETQA 1WJ9A 3PTWA 3G2XA 2ZOGA 2FJBB 4PG5A 4DQPA 1BC6A 3NS6A 4KYZA 2BE7D 1OIAA 2C2EA 1S12A 2DGQA 2XMJA 2BQ3A 2KZZA 4LF8F 4DLGA 3ETOA 4QYZK 1OQ3A 4FVMA 4Y34A 2L08A 5A2QY 4UQTA 3LTOA 3L7OA 3QAEA 3KK1B 1YHQS 3W5YA 1S6OA 1UP1A 2QT7A 4M63A 4C97A 5D0HA 1LWCB 1C1CB 2R7QA 3DN9A 2K2PA 2XYPB 3IO1A 3BBBA 4P74A 4M1KA 2UXDF 1SPBP 4XTTA 4W90B 4ANCA 2QLWA 2IVMA 5DZ7A 3T1HF 4PPZA 1NKEA 1JXEA 2J0WA 2LYVA 1VQ8S 1U26A 3EJMA 2EWHA 3CJ5A 2RNEA 1N5VA 3TA1A 5JXSA 4P2SA 1S9EB 1B7FA 2MQMA 4OYXA 1PGZA 3HSGA 4C11B 2GHWA 2HQIA 2HHSA 1GT8A 1LWCA 3HKZD 1C1CA 3MPWA 3OD2A 4NZ6A 2WBRA 9ATCB 4BCAA 2HFNA 1TK0A 2RQCA 2FTRA 3RBEA 2WONA 1LXJA 3KK2B 1IKYB 4FP9A 4LSNB 1BY9A 1T9YA 4LRFA 5CXTA 3CGIA 2MMYA 4OZNA 2HNYB 1KTVA 2OELA 2OMOA 3KG1A 4IKAA 2Y8YA 2E5LJ 3MCOA 3VAFA 2RQKA 3GG0A 2C2MB 1FJ7A 4RW6B 4XDCA 1MMDA 4N8OA 4AXJA 2V69A 1MNEA 2R8IA 4ZVOB 3D0IE 3KG4A 3OVAA 5HQLA 1NK6A 1VYAA 3OLBA 3MD3A 1AZSB 5KFTA 1HFEL 3JTNA 3EXYA 3IMQJ 4GO5X 2W4DA 3CW2C 3GCWP 4DFPA 2MQPA 1S57A 3KK2A 2WHOA 4LSNA 2YKNB 1WSVA 4UY85 3W60A 4RBTA 2RF2B 2E1RA 3BN7A 1NK9A 4RW6A 5ETVA 3FRZA 1Z2ZA 3NWGA 5LMUF 2CDQA 4MJKA 2Z56B 2I2YA 4FVCA 2XS5A 2MKIA 1AZSA 2YX7A 5DLFA 3T9NA 4YQWA 3R2CJ 3BR8A 5GAHI 4F4WA 3QLHB 3DI6B 3CXCR 4ILMA 5MLCV 3PKYA 2YKNA 4MH8A 4C3MA 3EXCX 2FIUA 2BVZA 1XNQJ 2W7OA 4RUHA 2NYIA 3A3OB 1TKTB 1RYRA 2R42A 1M1KT 1NJIT 4ZPCA 2UXCF 3Q8SB 1HNVA 2ZJRQ 4P2FA 1Q79A 4LRAA 2Y1LB 3OUYB 3HHNB 1WEXA 1O5JA 2QE5A 2G9OA 1UW4A 3NWRA 3BO3A 1HLWA 3L7PA 3UN3A 3BGLA 2MPUA 2MGZA 4YHHF 2HEKA 2DY1A 4KGVB 3CDWA 4KR0B 4BLGA 1OJ4A 1BHNA 2OI2A 4IOAQ 1S79A 3V6KA 3PX0A 3C46A 2AMCB 3IA0A 4H54A 2K1RB 1N0UA 2IAJB 2ZOFA 1TKTA 4A8MP 4NLYA 3CJTA 1VQ5S 2KKHA 4WZMA 3QMQA 2WSEC 1AUSL 3MAAA 5F8JA 1VMBA 2E7WA 4PG7A 4CLFA 2F65A 3T9ZA 1KD1T 5L9XA 3FBBA 4FYYB 2NSBA 2ZOMA 3IGNA 4CLTA 2ASDA 1S1VB 5F8GA 4C3LA 4FYVB 2EKNA 3CNQP 1HWUA 1QDUB 5HVGA 2JVOA 4GVLA 4Q5VA 4ZPBA 2XS7A 5SUHA 5DLGA 4DV5J 1TUWA 3H5YA 2K1RA 2BR0A 3A8JA 3H4DA 2IAJA 1GEHA 4X62J 3KJNB 2QTWA 4HR2A 2CJBA 4HHUA 4CTAB 3T6JA 4HLBA 3C8YA 2CDRB 1VBXA 2ZHAA 4WKYA 4B3OA 2EEYA 1H7XA 2IM3A 3CMAS 2DGUA 4DR7F 3NNCA 1NDCA 5A0YB 1S1VA 2VQFJ 3B54A 1RT5B 1YZ6A 1RZMA 4N5SA 2AQ4A 4DXLA 1S0NA 2BW7A 2HWHA 3M6XA 4ILLA 2CZ9A 5H1SV 4DV3J 1XR6A 4RUAA 2C3UA 4PEOA 3MM6B 2V8HA 4OIXA 1MLAA 1LFWA 1K1QA 3FNNA 4CTAA 2DR6A 5LM7E 1HHTP 4C8ZA 2B4OA 2R7TA 2OD6A 4LF5F 5KG0A 4KBIA 4K59A 1EETB 1QUPA 3M05A 1UZHA 5A0YA 2DH9A 4DPUA 2B9WA 2AGQA 5IT4A 3C14B 1RDRA 3CCVS 3P49B 2WVEA 1TAUA 3DU5A 3FVYA 4OHYA 1A7GE 1XR7A 2OGUA 3KLVA 2JFDA 1TL7B 3EVWA 1S4FA 2VZ8A 3HF5A 2O01C 1U49A 4JV5F 2LXIA 2FYXA 4DL4A 3TA0A 5CHCB 2NQPA 3VF0B 3R6LB 2KT2A 4KPCA 5IWAF 3CC7S 4K50A 4KSEB 1UFKA 5E2QA 3DHWC 5LSRA 1M5OC 3IR5B 5T14A 1S1XB 3TAMB 1RKJA 3C14A 3TQ1A 5F0WA 3MAQA 2JEIA 1TKZB 3GR0A 3AQPA 5KFFA 2VKZG 4KB7A 3KUEA 4I64A 2ACMA 4MIBA 3B4DA 4B3RJ 2HIQA 3JTPA 4ATNA 2IA6A 1FRXA 2QA4G 2UVWA 1XC9A 3K5LA 3I4HX 4OYPA 1DBDA 4NCAA 1L3UA 4YP3A 1SVDA 4G1IA 1FEHA 2LMIA 2HGLA 3CDEA 4DFKA 4IRKA 3BEGB 3DYAB 4ETXA 4IRDA 2K8GA 4USTA 2EPIA 4GC7A 4ZCIA 1S1XA 4FN5A 2B43A 1OS5A 3M8WA 4YB6A 2H48B 4EGLA 2CQGA 2PA8D 1T3NA 1TKZA 2CVEA 2D9PA 4ZA1A 2XMMA 1NZ8A 2CQPA 3R5JB 1TR0A 1MROB 4LBHA 3TUZC 4DF4A 4MTPA 3VGUA 2OLWA 1PBAA 4LF9F 5M2PA 4URQU 1DJ0A 4FDFA 2VPYB 2V63A 2MQ8A 2A1BA 1PO6A 3ITHB 2QA2A 4DV1F 1WD6A 1KFDA 3HP6A 3NG8A 2V4JB 2HSEB 2C1EB 1XMQJ 3OFFA 2BABA 4C7QA 5G4DA 4R0EA 1NPKA 4KGMA 2BM0A 3C6TB 1UEVA 2HZAA 2A2CA 4AUKA 1N34F 2CQ4A 4CLLA 2V6AA 3CDAA 3G82B 1RTDB 3OTOF 2RS8A 2BW2A 3OJSA 1E6YB 1IM4A 2VJVA 1VBKA 2MHNA 3ITHA 1W26A 4HL9A 1JNZB 4QIFA 2VBXA 1BWEA 2XZTB 4A48A 2V4JA 3D5MA 2LKZA 4ZP8A 3JQKA 2ERRA 3LP2B 2YQ0A 1I94F 2WW8A 4J9RA 2CQCA 3UR3C 3KXDA 3C6TA 2H9ZA 2HBRB 2V4QA 3TEGA 2MZSA 1YJ9S 1KBRA 1D9DA 4O44B 1CEZA 2KM8B 1RTIA 4NPOA 2F5GA 2DNOA 1HNZJ 1RTDA 1FHTA 1E6YA 2Z30B 4PWWA 3VVUA 1Z4UA 5IM0A 1RHKB 3H25A 3I9V9 4P71A 1OPIA 1ZA2B 3OTCA 4EK2A 3ILOA 3QSIA 1EKSA 1SIZA 4EWTA 3GFXA 3MWBA 2E1MC 1HWLA 3LP2A 4PG6A 1RHMB 5B0BA 4P52A 1JJ4A 2V2KA 3PEJA 1SC6A 1NSKL 1G3OA 4QPTA 3PXGa 2XCAA 4K4ZA 4O44A 2C2ZB 3UCGA 3BSNA 2B8PA 3BKTA 1UA0A 1GXUA 1NK8A 1N33F 1RT6B 4L76A 4MKVA 3AD8C 2B9EA 5KFKA 2PI5A 4OYZA 4DUTA 3TEHB 5GMKa 2H54B 2FLNA 4N76A 3OVBA 2CPZA 2X3GA 2ZH9A 2CG4A 3DXSX 3SCJE 4AL5A 2IM2A 4MK9A 2ZZMA 4X4TA 5A8WB 1UWAA 3FMWA 8AT1B 4ZOSA 4V1Ak 2B4UA 4BBYA 2VBYA 3QYYA 1YZ7A 3H0PA 2Y0BB 1UVIA 3AQOA 2RQ4A 3GJSB 3CCMS 4RW7B 1PILA 1VS3A 3N5BA 4USHA 2FVRA 4JI6F 4NLPA 3J81j 5E3CA 4LF6J 2XBPA 3OV7A 2EVZA 4JUZA 3DU6A 1TQLA 2LEAA 3MD1A 3E8OA 2QL7B 2V34A 1FKOB 1V9OA 2PA3A 2R8HA 3BO4A 4MKAA 3KG0A 2OPSB 2WOMA 3W7BA 5A8WA 1JWWA 1VI7A 4FKYA 5J1EB 3G87A 4LFBF 1FX4A 2ASLA 1O0PA 3GYGA 5B08A 3IWLA 1PYSB 2N3OA 3M7VA 2J9DA 1CVJA 4DU7A 1NH8A 4CO0A 4EO6A 1UVJA 1PJ6A 4QIGA 4FXVA 4EO8A 5KG2A 1SUQA 3MR6A 1NH7A 2EG2A 4ECYA 1OO0B 3PCOB 4DPOA 2VONA 5C25B 3HI9A 3GIMA 5L1JA 4JI0J 2FJAB 1JK9B 2VZ9A 4M5IA 1IBKJ 4L3NA 5DJBA 3RJMB 2OPSA 2E1CA 2OO4A 2DT9A 1C1BB 1VR6A 4FXWA 2QLJB 4WFNQ 5J1EA 2V68A 3C15B 3QJJA 4B3MF 4RX6A 2ZHOA 3THVA 4R0JA 3RRHA 1JLAB 1VC0A 4DR3F 2Z2ZA 4OHVA 1VQ6S 2ZVIA 4MKBA 3RU0A 3DLKA 1RCXB 2DNKA 5D4OA 2OSRA 3SMZA 1R8BA 2HNDB 1MU2B 4XIUA 1K1SA 4F04B 4ECZA 1VC6A 4X66F 5KG6A 5C25A 3UDCA 3GMGA 2JLFA 1BXNA 1JKHB 5HMWA 2CQ0A 4YFUA 2DIUA 1QLNA 4OZ1A 1SKSA 1QSYA 5D15A 4XK8C 1U1PA 3D4JA 3DM2B 2GGPB 1H72C 2CJ9A 3V6JA 5ETSA 4WE1B 5E3AA 1YJRA 3NS5A 1R31A 4TYBA 1S48A 3K5OA 2R7WA 2CPIA 1LK7A 3V2UC 4A8OA 2L3MA 4JV0A 2E9TA 1KN6A 1FRHA 4P2XA 1QAYA 3UVJA 3IRWP 4PXCA 4K5RA 2NXEA 1NM2A 1HQUB 4TQSA 3RBDA 1JKHA 1KQSR 4K4TA 4NCGA 1R3NA 2DXEA 4FZVA 4FF2A 5LSLA 2V2ZA 3DM2A 4F4YA 2GGPA 5I3UA 2I9SA 1Q16B 4WE1A 4DV0J 2F1FA 5LJ3Y 4OI3A 3TVZA 3VWSA 5HQMA 3TO8A 1IWGA 3K89A 3GV5B 1S1TB 3TUJC 4OI1A 4K4WA 3BJYA 1HQUA 3PJ9A 3BGOP 1KOOA 4DL0C 2ZDPA 2WW4A 5F3ZA 2C42A 1Y5NB 1HQEB 1FRKA 2RSQA 1Y7PA 2V8PA 1U1NA 2UVRA 1J27A 4DR6F 5EUHA 1U48A 4RO0A 2D74B 4P72A 5HMXA 2DGOA 1X7VA 1QE1B 2CPDA 1R0AB 1PC5A 2HVEA 2HG4A 1SKUB 2DNNA 2RAQA 2YKMB 4DJBA 2VPXB 3GLJA 1KDNA 3AXMA 3GIIA 3DLJA 1HQEA 4KRWA 4X4RA 1VHFA 3ENVA 2HIYA 3WZ0A 2M7SA 1J2VA 3TWZA 4KJIA 2WBMA 4WJBA 2JC0A 3BR9A 4WP9A 3VAJA 5GAHU 3B8HA 4ZVQB 6AT1B 2LECA 4CNYA 1QE1A 1R6YA 3R27A 1R0AA 3BB5A 4NLVA 5JUMA 2JZ5A 4DI6A 5D4LA 5IT0A 2C28A 3OSPA 2RDJA 2R2TA 5F0UA 3OPKA 3T1HJ 4QWDA 2AYBA 2BOPA 1CQNA 2QLXA 4NLTA 4LF4J 2UXBJ 2CJXB 3B6BA 1U7LA 2EK6A 4WU2A 2J6UA 2HURA 4F02A 1Q86T 7FD1A 4DX6A 1REVB 4MAKA 2LXUA 2XC9A 2DK2A 4ZLJA 3MUMP 1RT3B 4Y2MA 1GMWD 4TU9A 5F3TA 1Y5LB 5CH7B 2E9ZA 1M5HA 2KRBA 4ZLPA 5GMEA 1P1TA 1LNQA 2DYAA 1RHQB 1WG4A 4NASA 1NK0A 3PYDA 2ZNZA 1UVMA 4QYRA 3MAHA 2C2OB 3JQJA 4P7TA 3NLCA 2YNFA 4ZCKA 2HHXA 1H3DA 2R3VA 2IBKA 3D0HE 4LIWA 2V2QA 4WBFA 4DL6A 2CA9A 4J90A 4OFZA 2ACYA 1Q53A 2HQ3A 4AMPA 3US5A 3HHLC 1PG5B 5F8IA 4OI2A 2XB2D 5CD4A 2ADBA 1TUGB 4DR4F 1RLDA 4D3HA 4OHXA 2BJEA 4EBEA 2BJ1A 5KG1A 1JIHA 3J7Z5 1JX4A 1IBLF 2KFYA 4YDDB 5B0DA 4U9RA 3EWGA 1P1LA 2J6TA 4J91A 4RBUA 3RBXA 3D1OA 1WI8A 4A8KA 4E98A 5CABA 3TUIC 2RILA 2R7OA 4NA2A 1GQEA 2W2PP 3MMJA 1XERA 2XI3A 3PR4A 3Q89A 4CWBA 4PRFA 3X1LB 3H4BA 1M5SA 2C2RA 2IIHA 5KT7A 1SH3A 1XWLA 3CTRA 4RJVA 3PW2A 4J9UE 2V8GA 2J8AA 1RAOA 1XMOJ 2XG8A 1X4CA 3RRKA 1VRUB 5LXYA 5BR8F 4B17A 1WEYA 2HK3A 4GO7X 3QO9B 5KFMA 1RXOB 1N0VC 4ZCLA 2UXCJ 4IQMA 3GONA 2A3JA 3QPIA 2CIMA 5HO4A 2VJUA 2B9YA 4LIRA 3KK3A 4I6WA 1UETA 4TU7A 4QIWD 4MFBA 4YHHJ 1MWYA 3D6TB 2XMVA 2GW8A 2CPEA 2PD1A 2I0XA 4KHPJ 1PIEA 2P9GA 1PCAA 3BYPA 5I3QA 3QO9A 4X4SA 4B3TJ 3GJRB 2BYCA 3R5CA 3F73A 2HHHF 4B9MA 4G6VB 2ZNYA 1RADB 5CCMA 1RAJA 4ELTA 1RTZA 1KLMB 4RKUC 2ZH3A 4DCOB 2KRRA 1B4SA 2GO8A 4RUCA 3NCQA 2QV6A 3B82A 1EQ0A 4DV6J 2FVPA 2HPUA 4QR1A 4O3NA 2XSFA 5I3PA 3RUBL 2CUYA 2LQ8A 3MF5A 4F2RA 3G96A 5L46A 1X4GA 3HKWA 5CZCA 5KFNA 4D3GA 5KFIA 4R5PB 2CG8A 1RWVB 2ZBCA 1FESA 1W2IA 4U7UK 4RNNA 2DH8A 1UL3A 4AMMA 3FZBA 3P4UB 5IC6B 1WKJA 4F67A 1FNXH 4BWMA 3CCWA 4RL1A 2NS1B 1F5AA 3HZGA 5BYRA 2Q6BA 5FDLB 2H4YB 5L1KA 4QIEA 2OH2A 1FJGF 4TLRA 1KNZA 1VDHA 1HNXF 4B02A 3ZNJ1 2MZJA 1P9YA 4UQGA 4DS4A 4EBDA 5KFPA 1NK5A 3Q24A 2I6WA 3VGVA 2CFXA 5K8NA 2ADCA 1GK8A 2C3YA 5B0FA 5T7LB 4WYLA 1MMNA 1HBUB 5FIIA 4CLSA 5CYJA 2DR5A 4LF5J 1URNA 1CLFA 3A1YG 4ZVHA 3VV2B 3NAHA 5DQHA 2DVIA 3PJWA 2JH3A 4O3SA 3EVMA 3EDRB 1IUJA 4LJMA 4C8LA 4ED5A 3AODA 3W9IA 1M1HA 4IQXA 5FDLA 3JSMB 1TKDA 3VAMA 1GMWA 2HZCA 3CD0A 2BM1A 4JV5J 2XEXA 1U2CA 3Q86A 4TY8B 5T7LA 1OSCA 2P9CA 2BZ2A 1HBUA 3Q2SC 2K06A 4F4ZA 2QFIA 4DU8A 1QVGR 2YNGB 3CVKA 1Q0NA 2NPFA 2AU0A 3DDIA 4NXNF 2E5LF 1F5BA 3CJ8A 3ZTPA 1YKWA 3SCKE 2H5EA 4DSLA 2RUSA 2B6AB 3OBIA 1L5UA 5LOQA 3JSMA 3MR5A 4I2QB 1GNKA 4DL3A 4A8YA 2CKWA 1FTRA 4WWSA 5KFYA 4ED7A 5DGBA 3MM5B 3R5BA 4QR0A 1HHSA 3KMQA 1WHYA 1D9FA 4H4KC 1TL4A 2YQ1A 2YNGA 1UW9A 3MPUB 2VHGA 1S10A 2Z2YB 3AFGA 3BYRA 3EZOA 4DBQA 1TELA 1EP4B 2VL1A 2DR9A 4C8KA 1FJCA 2G0IA 4I2QA 4Z2XA 2CQBA 2MZTA 2HYIB 2O1PA 4AQYF 3FSYA 3QZ8A 1SXLA 3JTOA 1X9WA 4ZVGA 3EM1A 5FD1A 3MMAB 4MIWA 1U0HA 2VG5B 2B0GA 3V6HA 3CD7A 3MM5A 3RW6A 4CT9A 2DNLA 2XCPA 5E7OB 2YKAA 4JI3J 4JI1J 4M94A 2ZH8A 4ZJLA 1ZOTA 2DPJA 3LUYA 3EMTA 5DQGA 1EP4A 4NLXA 4ZHRB 4CDIA 1VIOA 2GV1A 3I32A 1VQLS 2HGMA 3CCLS 3N6MA 2EW9A 2WSCC 2D3OR 4DPYA 4C2MA 2J0XA 2BJ9A 2VD3A 5GAGI 1N34J 2G0CA 3MMAA 2ZEJA 4CH0S 3OTOJ 4DS5A 5IZHA 1FJEB 4DOZA 5DM7Q 3DLBA 5F8NA 1YRTA 4OX9J 1M90T 4A8FA 4KE5A 3PKMA 2C2NA 1WOSA 2MY7A 1IKVA 2JLEA 1F9EB 1GMVA 5KFCA 1I94J 5E3PA 2IMWP 2A0FB 1JLCB 2O5DA 3OL6A 1NAQA 1V6HA 2ILYA 3DFEA 3QJPA 5I4MA 4IUFA 7FDRA 1Z2LA 2NXNA 2J9DE 2RKIB 4DV5F 4XPCA 2XNQA 1EARA 2D69A 2LXFA 2VA2A 1C2PA 4ED0A 4IG0A 3UNYA 2R2SA 4PXBA 2FGOA 3W65A 4X62F 5IV3A 5HLFB 4JI8F 1KONA 2ZBQA 2DHXA 1YJVA 5MAOA 4CIOA 3I0SB 1FO1A 2HRTA 4Z7CA 1RWOB 3MFIA 3BH6B 2XS2A 4Z37A 3KMSA 2VFVA 1YRUA 1JLCA 4O0NA 4UOCA 3UW1A 3CCZA 2DCLA 1WEZA 1VC5A 2BUNA 1JLFB 1YSJA 2M88A 3M6VA 2P2CB 3TUPA 1N33J 1EX8A 2YPYA 4DQRA 3LQVA 4YUDA 2RKIA 4DX7A 3MR7A 5IQ6A 4JI2J 1HBOB 4DV3F 1Q95G 2PMZD 2CZVC 4ED3A 1IKWB 2AJ2A 3HMJG 5EWGA 3D0GE 1S6QB 4DG1B 1EQMA 1E6VB 4EUVA 4V19X 2RHSB 4YS2A 3JQMA 4ECVA 2KHDA 3T1AA 2HBZB 3I9ZA 4JI6J 1FFSB 5LMNF 4J7CA 3G86A 2WSFC 2ZJPQ 3M6WA 3P5TL 3HDSA 2IPOB 1TAQA 2R2UA 4WFBQ 4EYHB 1UPPA 1UZDA 3PO5A 4KTQA 1RAEB 2RRAA 3WQPA 1IKWA 4IFYB 1H2UX 3ZXWA 3J7YI 1S6QA 5H9FK 4DG1A 1WDDA 1S0MA 3PW5A 1K8AT 4LFBJ 1E6VA 2HAFA 1ICEB 1P27B 1FWPA 1X5OA 2PSZA 1B3TA 1IR1A 2BE2B 3LGHA 2RS2A 1U0SA 2EC2A 2NSCA 2XHCA 4AYBD 1OPZA 1I5OB 3MEEB 2HW3A 1CJUB 2IFXA 4ED6A 4LRDA 3MR2A 3W9JA 1H74A 1RU2A 1NB2A 4YOEA 4B3RF 3M8QB 3DGPB 2XGPA 1H6KX 4YEAA 1RAIB 2VG6A 3SBMA 4K5SA 4WIQA 4QWAA 1SH2A 2H51B 4OYMA 1VQ7S 4I4BA 1GTEA 2P6SA 1EZZB 4NYZA 1FRIA 3S1TA 3ADAC 4DR3J 1KOHA 1LOUA 1Q5VA 4TU8A 2BE2A 1V3RA 3VTIA 5LJ5Y 4CQ1A 3MEEA 1H0HB 4X66J 4DSEA 5EN1A 3KHHA 1S99A 3DGPA 1AW0A 2OPRA 5EHHA 1AFJA 3HSJA 3M2VB 4DX5A 2IDEA 1VQOS 5B0EA 3GP9A 1ZAXA 1R8AA 2PDAA 2GCFA 3Q23A 2C2DA 2GVZA 2DIVA 3OQ2A 2ZKTA 4DEZA 3MM8B 5IV4A 2RVJA 2PO4A 1NJWA 3PM9A 1X8DA 4C8NA 2JC1A 2KTQA 2L41A 2FZGB 1T03B 5EWFA 3MOJB 4LREA 2XGQA 4W92B 4LRBA 2UUBF 2QRRA 2HHPA 1S77D 4ZN1A 3M2VA 3L9ZA 4M5DB 2FY1A 1QTNB 4ER8A 1QSSA 3NXZA 2FJWA 3M9NB 3MM8A 4JOUA 1U1KA 2CRLA 3NGUA 2HZVA 2JEGA 2CPXA 2Q66A 2NREA 4DFMA 1SC3B 3PX4A 2AJ1A 2D3ZA 3CJ2A 3MEKA 1U1RA 2QN6B 1T03A 3M8ZA 3PZPA 3JAMY 2ATLA 2XO6A 1VBZA 5A76A 4ELVA 4JBCA 1HNZF 4PWDA 3P6YC 1RAAB 4ZIVA 4DR6J 4M5DA 1EKRA 1NK7A 1RISA 4DZDA 4I56A 1F9HA 1RWWB 4J9OA 3SV3A 2CQDA 3UDVA 4EBCA 2DGTA 4BDPA 4HI1A 2UZAA 2GHPA 1RT2B 2XMAA 1HD1A 3MM7B 4JP8A 4DMZA 3AA9A 2Y8WA 4MK7A 2H5JB 4DSIA 1TL1B 5J2MB 1FRMA 4ELUA 4B9TA 1N54B 3WHIA 1ZA1B 3MDFA 4I1TA 3VZHA 1JLGB 4HDHA 3M9MB 3QRQA 4ZJQA 2RT3A 2IRYA 4DR1F 4ED4A 2MQNA 3UD3P 3P8BB 3CMES 1NDKA 3HO1A 3BKFA 2J5AA 1RT4B 4KY3A 3X3UA 4DL5A 3NGRA 5D0EA 1RT2A 4XO0A 2ZC3A 3K0JA 3MM7A 1T02A 2JSXA 1N88A 4ZVFA 1OY9A 3O44A 1AB8A 5A8KB 2HLUA 1FDNA 1WI6A 4CM0A 1FEEA 3MTKA 3I31A 2KXFA 4WFXA 3GR1A 2Y9HA 3UD4P 1GAOA 1NXIA 4M5KA 3KWMA 1JLGA 3BQ1A 2H4WB 4PABA 1X9MA 2CNNB 3P5BP 1QVFR 3PV8A 3BGRB 2AYMA 1EAYC 3UE2A 1G7CB 1X5SA 4A4JA 2V9KA 1RT4A 2K7JA 2D41A 1WG1A 4OZ3A 2FHJA 4ECWA 5CZXA 1TU0B 3MEDA 1HBMB 4NMXA 2BJ3A 1LXNA 2IRXA 2KO1A 3KLGB 3AT1B 5KFVA 5A8KA 5BYSA 3IWNC 5B09A 4TLQA 3TZWA 5C7PA 1U6BA 3SSSA 2M8HA 4ZIWA 3CC4S 4DUYJ 1CC8A 3ELHA 5KFZA 1S4EA 5J2NB 2OTLS 4Q8EA 4RBVA 3G9CA 5DO2A 4JI0F 3V81A 2ABYA 3BGRA 2FVSA 2O66A 2PMWA 1IBKF 3SXLA 2LU2A 1Y0HA 4F3QA 4BS2A 4XPEA 4NWBA 1QAIA 5G0RB 3UNGC 2PI4A 4M95A 3LPEA 2OEJA 5HVHA 4LBIA 4DR4J 4DZ6A 3I6PA 1EJ7L 3KLGA 4K8RA 5HMZA 1W2BR 2M2BA 2PEBA 4AL7A 2GJ2A 2QYGA 1IBLJ 2DGSA 4GVBB 5J2NA 4BC7A 3HSDA 2IHR1 2DNHA 5J2QB 4WU3A 5K20B 1OWXA 5L1LA 4O3RA 5G0RA 4KQZA 4LF7F 1NEEA 1FE4A 2ZM6J 1FWLA 4ANDA 4A8SA 1KQKA 1GXLA 2YX4A 2ALYB 1WHVA 2IYGA 3FQKA 1P6TA 2WZ1A 4OYIA 2L9DA 3BPSP 2ZH2A 3NMRA 1T7PA 4C8YA 3SIPB 4WXOA 2HMIB 2BEFA 1C0UA 4PYAA 3M8RA 4TN2A 2AEFA 4X4UA 3QZ7A 4YB7A 4KAIA 2N3LA 2NXUA 2Z0GA 1S9GB 3GFYA 3AD9C 2MLZA 3VR1A 3SSRA 8ATCB 2UUWA 1F2GA 4HYKA 2IJNA 4KGKA 3GG1A 4F3OA 4DQIA 4LSLB 2ZH5A 2CJQA 3EDQB 3MR3A 3RAMA 5BJRA 4KGZB 1DLOA 2IJFA 4LVNP 1F3VA 2U2FA 2W7PA 1HWKA 1VQKS 3V4MA 2HMIA 1NZAA 2HHHJ 1JB0C 4ERDA 4WYWA 2FHKA 1OMSA 4CO1A 2RDIA 3K58A 1NJYA 3VCDA 3N5FA 2W01A 1IXKA 3ZNUA 3R7NB 1RWPB 2V2VA 1KKHA 1K0TA 2F8EX 4O3PA 4LSLA 4H4OB 3DGVA 4QPXA 3HVRA 1V5VA 4ENOA 2HK2A 3S6EA 2BQRA 3RW7A 1PYTA 1N5TA 2XMUA 4X4NA 1L3TA 1YBTA 1YLXA 2CYYA 2AZ3A 1Q5YA 4EEYA 1RT1B 3J7A1 3VQTA 4QIVA 3AJ2A 1AUDA 2GAHC 2RE1A 3QRPA 1I1GA 2P5VA 4CO4A 3CULA 4ED1A 3FGVA 1FFGB 4GC6A 2VQEF 1FJGJ 3H2VE 1HNXJ 1TK5A 2YXLA 3QSYB 2MYFA 3BDPA 2APOA 3GFZA 4P2MA 1LV5A 3EICA 3KHRA 5IT9Y 1XNRF 4KC5A 1UKUA 2MEWA 3HVAA 4LF4F 1RT1A 2YPZA 4USUA 4K4SA 2UXBF 4U67Q 1RAFB 2Y1IA 2DHGA 4OV6A 3D6HB 3LAKA 5GAGU 3RR7A 1HI8A 3CCSS 3R9LA 4LFAF 3OFHA 1UEUA 1NBEB 3U27A 3J81U 3Q8QB 3KK1A 2UUAJ 2XMKA 4DV7F 1HARA 2E66A 1N32F 5E41A 4ZJOA 3JSRA 5KFLA 2CPFA 1SL0A 4HTJA 2RQMA 2LEBA 2CPJA 4U8YA 3VHQA 2VFSA 2DGXA 1B0TA 2P8IA 3SDEB 3DDNA 2HWTA 2W4CA 3HHLD 1VLOA 1ZM2A 3ZZRA 1FRLA 2V50A 3MMBB 4NLUA 4NXNJ 4ED2A 4QU6A 1PBUA 1X4EA 3JAMU 2VH7A 3AOBA 3JSBA 3FKBA 1S9EA 3GFHA 3PO4A 3JYTB 4JV1A 4C11A 3KJVB 5C2CA 1GX6A 2GX8A 5C2GA 2SXLA 3QIPB 4ZLLA 4GKKF 4ECXA 2HRYA 2JL9A 2UU9F 3PRBA 4EU0A 1CBKA 2DD8S 3QT7A 3Q8YA 3W66A 3CT9A 3FC9A 1IKYA 1NDPA 5U47A 6FD1A 3NRBA 4KT0C 1UCNA 3SDEA 2W9CB 1GX5A 1SKRA 2HNYA 1PAEX 3MMBA 1TVRB 1H98A 3KUHA 1H2VZ 5ADZA 4N77A 4HT7A 2CJKA 3EPIA 1NU4A 4L6V3 2FC9A 1VJQA 1NCLA 2DR7A 4DSFA 1Y3KA 3KJVA 4J9KA 4F7VA 4DR2F 2NR0A 3QIPA 3NBPB 4AQYJ 2MLYA 2W9AA 1HI0P 2L9NA 2JEJA 2DH7A 4QWEA 3C3LA 2RJZA 1U1LA 2ZD1B 2KJVA 1DURA 3OHAA 3K5MA 1UFWA 3ZTSA 1S97A 5AXKA 2B9XA 1XMOF 5LSOA 3IBCB 1LW2B 2N4CA 3I55S 2M8DB 4F0HA 2M70A 4UW2A 2CPHA 4X84A 1R7IA 2RF2A 3CUNA 1TVRA 4DQSA 4ZVPB 1T95A 2YVSA 2ZDOA 3O8WA 5IOLA 3NBPA 1KTQA 1WHXA 3GJQB 5A6WA 3VAKA 2ZZNA 2YWWA 2A18A 2OTJS 3J7YU 3SCLE 4YY3J 3QGPA 3QLHA 1FRJA 3DI6A 1O6XA 1XK8A 2BXJA 4HHJA 1SL1A 4KHPF 1LW2A 3R1LA 3F41A 2RB7A 2QYCA 2OKQA 3HPOA 1WC3A 1WUUA 4B3TF 1WSRA 4CO5A 5DGAA 1YBAA 5KT5A 3TAPA 3DLGB 2MJNA 4C8MA 3T5LA 1NPRA 3AOCA 4I68A 2GIFA 1FA0A 3ENWA 2BJ8A 3OUYA 2MKSA 1HWIA 1KHVA 3G6VA 1AT1B 3NMAA 3SFGA 1U02A 4DV6F 3J7ZT 1Q1KA 3R2DJ 2UVUA 2QA4S 5H9EJ 2BX6A 1APSA 5L9NA 3KTQA 2N7CA 4PQUB 3O3LA 4LF2A 2KFNA 3GTYX 2ATCB 2QX0A 1FERA 3V6DB 4JI8J 4WZQA 5ETNA 2GIRA 3CWJA 2LVWA 2DB1A 1BUXA 3RZAA 2FLPA 3DLGA 3MTJA 4FNHA 1VLYA 3R8YA 2N82B 1DZ5A 1RHJB 3H59A 3JS9A 3C19A 2VFUA 1AXQA 2GJFA 1VOMA 2KL8A 2R2RA 5ETLA 3NEKA 2V67A 1XJWB 3V6DA 3GPAA 4RU9A 2VASA 1ZETA 2MSSA 3GCXP 2IYIA 4KHMA 3PG9A 3BZQA 2VIHA 1VQ4S 2M0GB 2VOOA 3D3CJ 1D8ZA 4OYWA 5KFGA 3IP0A 2E29A 4OI0A 3C66A 1RT5A 5LMNJ 3QJLA 2HFUA 4M5JA 3HXMA 2KB2A 1CS4B 2BE9B 2BKOA 1S6UA 3A12A 3JXOA 4FF1A 4ZDNA 1HHQA 1I51B 3MM6A 4B3SJ 4ZS6A 1MN7A 3ETMA 2HAIA 2D3O1 3MPVA 5HJYA 2FJDB 2W7AA 3W3SA 2DCUB 1OY8A 1D1UA 4RLEA 4C6AA 4ZN3A 4FYXB 4GMKA 1EETA 5H9FJ 5KTQA 1LW0B 3CPWR 1T9UA 4AT1B 4P73A 3U02A 3UPFA 3H8YA 3DOMB 3U1NA 2DNGA 2GA7A 4RW9B 3T5KA 3ENAA 1TL7A 3W2VB 4QW8A 1HWJA 2HWIA 4TY9A 3QGGA 3H42A 3BBFA 4ETZA 1P8GA 2IY5B 2BQUA 2KYZA 4IRCA 3UR0A 2MQOA 2YWFA 2GMJA 2KVIA 2XMTA 3VGTA 4ECTA 1TZ0A 4ID8A 2ZH7A 4BC9A 1FX2A 3GU0A 1ZTWA 1LW0A 3TAMA 3RR8A 3N6NA 1H38A 4ZITA 1ELOA 4RW9A 4B08A 1T9XA 3EPGA 3W5ZA 3M6UA 1HD0A 1JLQB 3W64A 2HHUA 3UDLA 1KHWA 2HVZA 3KKFA 2BA9A 2W24A 3PVXA 3B78A 3NS7B 3CJKB 4X64J 2GQCA 3DYAA 3G6ES 3W8PA 4YMEA 4JI3F 4JI1F 4ZCMA 1RUSA 3CB4A 2B56A 1Q4RA 2RU9A 1JXLA 1VISA 5IT9U 5CD4H 3G8SA 4IH7A 3IRXB 3ILIA 3HLUA 4P6QA 4USWA 1RT7B 4X4PA 2P6TA 4UUXA 2CJYB 1JLQA 3L95X 4FYDA 2OIHA 1MROA 4WFAQ 1QTMA 2J7UA 4J9NA 5K9FA 2UUBJ 3AH6A 2MLXA 4ZPTR 3MEGB 1HMVB 2NZ4A 4E2FB 1ZPVA 2COLA 3CJKA 3MURP 3D6FB 2C22A 3ZTOA 4Y00A 1SIWB 4OX9F 3H5SA 4YR0A 1ZZNA 3MECB 3A13A 4QZVB 3C6UB 3IRXA 3LP0B 4DV2F 4PCQA 3WX4A 3QQCD 1RT7A 1WC5A 1KFSA 5DDPC 2IC3B 2VPZB 4YDXA 3G82A 5AJ3F 2MQQA 2GMLA 3RRGA 3MEGA 1HMVA 4C48A 4ECUA 1F6TA 3NGDA 3HJVA 3OTEA 1Y5IB 5B0GA 1U25A 4E8UA 2CNLB 3GQCA 2X3DA 2EFGA 2DNPA 4EFAC 2VUGA 3DOKB 4I69A 3MECA 5HANA 1Q78A 2V8DA 3M1VB 3C6UA 1JJCB 1Q8IA 4YB5A 1ZPWX 3LP0A 3FSXA 3UFCX 4CT8A 2BMBA 2Z4PA 3Q0AA 3AA8A 3KDOA 3I0RB 4QWCA 4WTYA 2CQ3A 5HJXA 2UUTA 2F9DA 2XWXA 4M5HA 3CCQS 3K7RA 4DR1J 3OR1B 4KFBB 2BRLA 4JI2F 1S0VA 2DHSA 1U45A 1JLBB 3D1QA 1OYEA 4WK3A 4YR3A 3NGSA 5M2UA 3OSNA 5DG8A 3RB6A 3M1VA 1GTHA 3BO2A 3DRPB 4JI4F 3OL7A 4LUBA 2WRMA 2VBZA 1GH8A 5KFAA 2B5JB 1BQMB 1YWXA 3A4TA 5LXRA 5KOWA 1RABB 1NLKL 4DPTA 1RT6A 3MMCB 3DRSB 3SV4A 4BHQA 3QT8A 3Q8PB 1CC7A 2UUCF 2AV5A 4K7QA 1FD2A 2LLZA 3DCAA 2PEHA 4FS1A 3E3XA 1RAHB 3OTBA 5A8RB 4Q43A 4TNOA 5DM6Q 5DETA 2C3OA 4LR9A 3TJ9A 1HKAA 5CZDA 3HVWA 4ECRA 5HI7A 3HD2A 4RW7A 4Y3CA 1KQGB 2B5JA 1QY7A 1BQMA 1U6FA 1YQHA 5KFHA 1S1UB 3PNIA 2YWHA 3MMCA 2Y1JA 3DRSA 3BSCA 4RWWA 1VQ9S 2E5IA 4NLRA 5ETKA 5DG9A 4YB1P 1FKOA 3T6BA 4ZPDA 2CQ2A 1TTHB 2ZITA 2RD5C 1M5PC 2QG9B 3Q2TC 4GKJJ 1RTHB 5A8RA 4XDDA 3WIVA 2E5JA 3GV7B 5F9LA 1ZAVA 3BS9A 2VB6A 2HGNA 2NUUG 2B7CB 3T5HA 1YX2A 1U2RA 2AHOB 4B9SA 3FCVA 1J5EF 1S1UA 2ZH4A 2YWGA 5C24B 1V5IB 1DHMA 2HHTA 2HHWA 4TXSA 4NRTA 1NHVA 4K2JA 1MMLA 4RNFA 4FS2A 4F0MA 3AD7C 4X4OA 2ZH1A 1C1BA 2XMWA 2YTCA 4L72B 2DTJA 2YKQA 3FUYA 4LF7J 3PIOQ 4HI2A 3C15A 4G1PA 1UAWA 1N6QB 3MPYA 1JLAA 2KU7A 1R0BG 1VK8A 3CIMA 2HFZA 1FWKA 1UJ5A 2HNDA 1MU2A 2QL9B 3NOCA 3CJSA 4NLOA 3KYLA 1VBYA 1YGYA 1IBMF 1B7YB 2DISA 2NYHA 4E0DA 1ZBTA 4R25A 2B7BB 5AE2A 1CJKB 2F8MA 1KRPA 3CCUS 2E9RX 3H20A 4C0OC 1N6QA 2LA6A 3W2WB 4HVZA 4EMDA 3LAMA 3N28A 4U6PA 2CWKA 2E7XA 4LQ3A 1YG0A 1RTJB 2JVRA 2K3KA 2V94A 3N79A 1UMJA 2Z8QA 1YJWS 1R43A 1FXDA 3PX6A 3IFEA 5HVFA 2RH3A 1IR2A 5KFWA 1K73T 3KJFB 2DITA 4U8VA 2W9BB 4NEZA 4FBUA 4Q7AA 3DLLQ 2PIIA 2ZBPA 2LDIA 1CJKA 1HYSB 2AJ4A 1IKXB 1XQIA 2WONB 1KVKA 4PXDA 2HNZB 2CNOB 2DRAA 2H1YA 4AD6A 1RSCA 3W2WA 2AP6A 3CO0P 3CF5Q 2F4VF 3TR5A 4XAKA 5K8MA 1S1TA 1RTJA 2D9OA 1U47A 3M9OB 4AL6A 3PACA 3AHPA 1XN9A 5KFDA 1NSPA 4MKYA 5JJBA 3A3NB 2W8KA 1O51A 1RU1A 2W9BA 1VQSA 4Q44A 1HYSA 3WDOA 1R8PA 1IKXA 1H73A 2J6SA 2VV5A 1XTZA 2KYXA 2HNZA 2IM0A 4MYTA 3L4BC 2LQBA 4FKXA 3T41A 2VQEJ 1SC4B 3R97A 3MXHP 1TMMA 2EFOA 2PFFB 3BH7B 1SJRA 5HN0A 3RAXA 2E44A 3T1YF 2YKMA 5KT2A 2HQGA 4USIA 1WC1A 5M2RA 1XNRJ 5AXNA 5IC4B 3K59A 1HI1A 1U24A 3R5AA 3ONQA 1Y10A 2ASYA 2XYGB 2KT3A 4NXMJ 3EGWB 1FT8A 2R7SA 3DRRB 5AE1A 1RI7A 4LFAJ 3DC2A 3D66A 4OMFG 1YJTA 2G2YA 2GNKA 4DV7J 2BKNA 3ISNC 3I5AA 2JRSA 1N32J 4AE5A 3V4IB 4KPYA 1T0TV 2F63A 3RB0A 2W2MP 3GSIA 4FPIA 3FDSA 1HNVB 1DQ9A 2A6OA 3MCSA 2FVCA 2VC1A 2KI2A 1RACB 4DUYF 3DLHA 4CLZA 2VICA 2VG7B 3PFEA 2MGZB 5EDWA 1SQGA 3OL9A 2AW0A 4NYPA 3TARA 4UT4A 2MQLA 1REVA 2QLBB 2JJ4D 1Q82T 2ZKUA 3TANA 3DRRA 2B3TB 3M2RB 4CNZA 4URGA 2QLFB 1RT3A 4FF3A 4Q8FA 2XLIA 3FQLA 3TW0A 2W25A 4GKKJ 2HBYB 3V4IA 2UU9J 1T8EA 3MAAB 5KAKA 1DTQB 3IXQA 1K0VA 3TZZA 3BN4A 1ROFA 5D4PA 3RGIA 2VG7A 4NA1A 1MWQA 5DZ6A 1GXTA 4KV8B 1RHRB 3BSAA 3ZZUA 3HT0A 1KSPA 2IM1A 2FGCA 3M2RA 2IMOA 2D1CA 2EBEA 3U7JA 2Y0SD 5CCLA 4OQJA 4DR2J 1N56A 1R6VA 4DHVA 3KLHB 3D67A 4CO2A 2IVFB 3FEYB 2IDLA 2ZM6F 5CYMB 2LEPA 5JMNA 1KEKA 4CM2A 2J0SD 2ROGA 4B3OB 1DAXA 1WF1A 3U1MA 2R8KA 3LWMA 2DNYA 1DTQA 3N0VA 2MZQA 3ILJA 2MB0B 4B9VA 2NXJA 2CQ1A 3BV8A 3EVOA 2YNIB 3SZ2A 4KV8A 4LMZA 3VAIA 3TZYA 4OX8A 3EGVA 4Q2LA 2HFVA 4I67A 5C42B 4HH0A 3KLFB 4IO1A 3MCMA 1U8SA 1QJHA 5KT4A 4IYQA 3KLHA 4GRSA 2X1BA 4UF4A 3H2LA 3N6LA 4Y2KA 1WC4A 5CYMA 5L1IA 4USKA 2A2DA 3A8IA 1D9AA 1RAGB 4JI5J 4OI4A 2RRBA 1VRUA 3K2YA 2YNIA 2R8GA 1SJ4P 5FLXU 4EI2A 5KFRA 3EUNA 5EX0A 2DO0A 5C42A 3FZ2A 4OV1A 3IR6B 3KLFA 4OX6A 5CA5A 4P75A 3P3DA 4NYOA 1FKAF 2YH0A 4UTGA 4JYAF 1DQ8A 2G1DA 2R4FA 2AYGA 3UDEA 3IM8A 3UI3A 4F36A 1F0XA 3TYTA 5KG3A 1VK3A 1NMEB 4F2SA 4PZVA 3O2IA 4WTOB 2HQDA 4DR5F 2R7VA 3ZZZA 1HPZB 2YX1A 2R7RA 1N5QA 3ULHA 1IBCB 2DXFA 1AROP 2L48A 2ZUGA 3D6MB 4G1QB 3ZO7A 4WP3A 1N5SA 1KLMA 3OXLA 4ZVRB 4X65J 2ZWOA 2OP5A 2GAGC 5CAAA 1RCOB 5F8LA 1NDLA 2DO4A 5KFEA 1G4CA 1ACMB 3LPYA 3PYFA 2FQQB 3QATA 3KNAA 1D09B 4DUZF 1SCJB 1NKBA 4MK8A 4CP5A 3K5NA 1FDBA 4NRUA 2POKA 3CJQA 3NL0A 1SKWA 3R3TA 4MYUA 1IM6A 5E3QA 2DJWA 2VDIA 4R5PA 1HPZA 2ASJA 5KT3A 3TX0A 4A8QA 2OFGX 3TJAA 4G1QA 2XHWA 3WX8A 2QIFA 4K4UA 3GIKA 2ZHBA 1UA1A 1FXLA 4LBPA 1Y3JA 4I6YA 3BKUA 2ZH6A 4B9LA 1CQMA 2OAUA 2NZCA 4W98A 4NZ7A 2XWYA 5D0RA 2Y1RI 2UUAF 5EWEA 2HS3A 5IFMA 4QCLA 3KHLA 1MW7A 1FFWB 2K7KA 4Z7YA 1T9TA 4OJGA 2DGWA 3ENQA 3KJQB 4DV4F 3OXFA 3TVYA 1SBRA 2CJAA 1SJ3P 4ZVSB 5A2QU 1LKZA 2OD4A 4NLDA 2M4MA 2VPWB 3IBFB 2B4VA 5KFUA 4C9DA 1RA7A 3M8PB 3AJDA 3H5UA 4IH5A 4A46A 9RUBA 3I96A 4M8LA 1SJQA 2M5YA 3PYGA 3F44A 3I87A 4Y2IA 4QWBA 1RKIA 2FB0A 4ID5B 3HHEA 4TY8A 4PG4A 1Y00A 1U4BA 5E33A 1YDLA 3ILLA 2O67A 1RTIB 4USVA 2CQIA 2AWZA 4J37A 1UVKA 4OYBA 3KFWX 3I5CA 1RP5A 1U09A 5E3RA 2B6AA 5IM0B 3M8PA 2XLJA 2Z58B 2VKRA 5C5JA 1RWMB 2CXEA 3TAQA 2WVDA 3M30B 1WORA 3MUVP 1KWMA 3HCXA 4ID5A 1X4HA 1WKLA 1S7HA 5HATA 5HAOA 1V3ZA 4KH1B 1S49A 3NCRA 3RG6A 2H5IB 5D4NA 1RB0A 2VFRA 1H7WA 2DHHA 3GB0A 1HQ2A 2IRUA 2J7KA 3M30A 2EFVA 2KG0A 5SZTA 3ET6B 2H65B 4TKTA 4DX8H 1S72S 4TVAB 2VG5A 2I1RA 4YY3F 4OL8A 1LWFB 3AXKA 3LP1B 1VQPS 1D0EA 4QW9A 2KXHA 3BDEA 2FHMA 2NLWA 2OFHX 3CJ0A 2GIQA 1K47A 3PJXA 3BREA 4ZHRA 4CLPA 3CD5A 2AF6A 3ICLA 4DV2J 2MTLA 4YN3B 2WOMB 2KFZA 2OSQA 5H9EK 4Y28C 1HA1A 3L7UA 1IVZA 2UVVA 1Q7YT 3ET6A 2MDAA 2BOAA 5AJ3J 5J1PA 4WPAA 1LWFA 3LP1A 4N56A 4JV2A 4UY8T 4Y0FA 4Y65A 2MXYA 1SUQB 2LU1A 4K0KF 2MKKA 2ALZA 1PYOB 2ZZTA 3MOZA 1N36J 2Q1LA 2YWKA 2X7IA 3ISZA 1RLCL 1FE0A 3FCHA 3CD6S 2C3MA 2AJ0A 1IR0A 3KOAA 3A8EA 1Q8LA 2XLKA 3HD1A 4WIIA 2XYHB 3N4WA 4NEYA 1WKKA 4CO3A 3DLKB 2LCWA 5HL7Q 1M5KC 2ROPA 1NO8A 5ETPA 5GADI 3LWLA 5IQQA 4PQAA 1Q81T 5HLFA 1ZM9A 4ED8A 4U7CA 1VJWA 2X51A 2F3JA 1WELA 3I0SA 1TFWA 4RNOA 3GIRA 3NOGA 2R9LA 3PHTA 3PDNA 3NGTA 4JI4J 2P9EA 1X60A 2M52A 3KHGA 3ZZTA 2KXNB 2AKWB 1UEKA 4OHWA 5DQIA 4CI0B 3OTDA 4MMOA 1ZYQA 4RNHA 3M32B 3FRYA 1JLFA 4DL2A 2EK1A 2AYEA 1HR0F 2GZOA 2JHEA 1HBOA 3RB3A 3CCTA 5D0GA 2UUCJ 2LDYA 1AYEA 4B3SF 3MZIA 3UVJB 1WHWA 4H4MB 2E5HA 4WFYA 2U1AA 1QSLA 2AIRB 2KH9A 2JFKA 1NHUA 4NCGB 3MFHA 1VCTA 3LF0A 1T05B 2DXDA 3AJ1A 2KDOA 2AGOA 4LVOP 3DMJB 4A8WA 3PEHA 5I3UB 5BXIA 2DNRA 1RGVA 4ANEA 1ZH5A 3K17A 4PYDA 1S7IA 5KFBA 3M32A 3QRRA 4O23A 5T41A 5L8RC 2I38A 4ALZA 3EZUA 1U8WA 4ZPAA 4ILRA 5HP1B 1ZTTA 5DRKA 3AAWB 2CAJA 4Q45A 1R0CB 4RWXA 2FJEB 2WVBA 2QGFB 1HNWJ 4LT6A 1R8CA 2ZFHA 2HBQB 4H4MA 5ETMA 4IFYA 1HW9A 3EGZA 3HFZB 2RHQB 4KKOB 5AXMA 3MM9B 1T05A 1CPZA 2PFDA 1GMUA 4LFCJ 2HS0A 1U1OA 3DMJA 4N47A 3Q22A 1J5EJ 2MKCA 1PSDA 3QAUA 1CJUA 1ZM3A 4FPRA 5HP1A 2JEFA 1F1BB 3NGKA 3M8QA 5IXUA 2CVIA 2JOQA 2XY7A 4HT5A 2ZVSA 5CZVA 3TNVA 4J5OA 1X0FA 4CZCA 4X64F 3TRGA 3QWPA 1JMTA 1RWXB 1T11A 4KKOA 4IFVB 3MM9A 2O3DA 2VOPA 2KT5A 3UN5A 4NLQA 3M8SA 3HJFA 2C3PA 2X1GA 3QBCA 3LW5C 2FJXA 4OZ5A 4OZLA 1IBMJ 1BQXA 1CSJA 5ETOA 2PT0A 5THWA 4YR2A 2FUG9 3J81Y 4OYAA 2GHVC 3Q8RB 1MN9A 1YK9A 3FSIA 2QMUB 1HIYA 1U2FA 4IFVA 5J1NA 2Y3YA 2J76E 4L75A 4LF8J 3W8GA 3SFUA 3ZTRA 3QWUA 4DSKA 7AT1B 5DDRC 3HK2A 1ITPA 1LEOA 4QYZJ 3G6XA 4PPDA 3PY8A 1FD8A 3V5RA 3HFVA 2DKOB 2FJVA 4N7TA 1TFYA 4B9NA 4L73A 2UXDJ 4OX7A 1LQ9A 4CLWA 1OY6A 2G2OA 2YNFB 3NNHA 1ZZFA 4J9VA 1A9NB 2BJ7A 4U95A 2F4VJ 3TZXA 3D2WA 1X9SA 1UWBB 3EZ5A 3VGSA 3E2EA 1LWEB 3CCJS 5F9NA 4P9SA 2XZWA 2DRBA 1RWNB 1VRTB 1VQNS 4X2BA 3EE3A 1JJHA 1UJ4A 2JNJA 4CRJA 3THTA 2DEJA 4ZMMA 2V5HG 2PMHA 1DQAA 3FBCA 5D78A 4J9MA 1FXRA 3PFOA 1PC4A 5ETTA 2XNRA 3D28A 5GAEI 4FBTA 2KN4A 3FFIB 3R7SB 2E7VA 3R7BB 3VALA 2AZ1A 1W7WA 3CO9A 2QC3A 1UWBA 3SCIE 1M1GA 1MSWD 3J7AN 1LWEA 3HHDA 3H90A 2HS4A 3T1YJ 1VRTA 2BANB 3N9UC 1D3WA 1TL1A 5J2MA 2WTFA 3UCZP 3IC1A 2YH1A 4N41A 1I6JA 2N7YA 3JSYA 4N8NA 1S1WB 3HT3A 2QMXA 2GS8A 2HQCA 3FFIA 4NCBA 1QUVA 3IBWA 3ZZYA 3ZTQA 4I6AA 2V4RA 3S01A 4ZPVR 1V3SA 1XIQA 3DLEB 3GYNA 1QAXA 1B0VA 1WF2A 5LT5A 2OUGA 4S0MA 3G6YA 5LMUJ 2BANA 3CIZA 4J9LA 1SQFA 4NLWA 1B0PA 4NOHA 2B51A 5HROB 2DR8A 3R5GA 5EX3A 3ZFVA 1DY3A 3KK3B 4Q2MA 4MFBB 5F8HA 1X5PA 2B4PA 2EG1A 5CQGA 5HQ8A 1SV5B 1R89A 3HX9A 1S1WA 4QOTA 4DL7A 4DN9A 4URSA 2D3UA 4ECSA 2VBWA 3IS9B 3QIDA 1SB6A 1D8YA 2G2ZA 3RBZA 3CJRA 1SJFA 4DSJA 2OEMA 5DG7A 2GQQA 4JI7F 2KJWA 2YQ3A 4UOHA 1CG2A 4GKJF 3TJ8A 1HBMA 3DLEA 4L74A 5EGYA 3PRDA 3GSDA 1ZAWA 3HZEA 2XTJP 3DOLB 1WWHA 2Q79A 2EFQA 3KLIB 4F25A 2BV3A 3DKDA 3OXGA 5HROA 2FY8A 3U1LA 2NCKL 4QU7A 1Y9OA 3POTB 2MZRA 2HRUA 1B99A 1SV5A 3D3BJ 3F0NA 3K8WA 3IS9A 3IAS9 4DCPB 3HVTB 3W9HA 5KFJA 3AB2B 2ZJQQ 3NY0A 3ZZ0A 3CE8A 3WC2A 4Y2CA 4F50A 1ZM4A 1YRXA 3UCUP 2HHQA 2F40A 3IG1B 1L3VA 2GC8A 4TQRA 3DOLA 4NI2B 2L9WA 3G4SS 2MY8A 3KLIA 2YWEA 3SEOA 1MG7A 5D3GB 4WF9Q 3F56A 2QFJA 1FK9B 2QSFA 4HACB 2DNQA 4MIAA 4RW4B 4IO9Q 3T3FA 2GFFA 4O3OA 4GVBA 1R8HA 1KQFB 2G0JA 3POTA 4ECQA 4IOBA 2G1HA 4ES3A 1F3FA 3TOQA 5J2QA 1N52B 2DRDA 3HVTA 2F8HA 3QT6A 2AJFE 4HKQA 1UFLA 1BQNB 2QL5B 2WB1D 3ZZPA 1Q8KA 3R5DA 1C0TB 3IG1A 3C2PA 3I82A 4NI2A 2EI5A 4DR7J 5D3GA 2IBOA 4CH1A 4CLKA 1FK9A 4LQ9A 2HKEA 4HACA 4RW4A 5B7WA 1Y4ZB 3CDUA 1WDTA 3GILA 1RJJA 2CNKB 3N01A 5AXLA 2KM8C 3H5XA 3HSZA 4K4VA 3OW2R
chains in the Genus database with same CATH topology
4RL1A 3IM8A 1NM2A 3TZZA 3H0PA 2JFKA 3TQEA 3EZOA 3G87A 2JFDA 2QO3A 3IM9A 2G1HA 3TZYA 5CZDA 2VKZG 2VZ8A 1MLAA 3QATA 2QC3A 3HMJG 2G2OA 2CUYA 3HJVA 3RGIA 5DZ7A 2H1YA 2G2YA 3R97A 3TZWA 3CJ8A 2HG4A 2C2NA 5DZ6A 2VZ9A 3BV8A 2PFFB 2UV8G 3HHDA 4QBUA 3K89A 5CZCA 2G2ZA 4RR5A 3TZXA 3SBMA 3R8YA 3PTWA 2QJ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RL1 A;  3IM8 A;  1NM2 A;  3TZZ A;  3H0P A;  2JFK A;  3TQE A;  3EZO A;  3G87 A;  2JFD A;  2QO3 A;  3IM9 A;  2G1H A;  3TZY A;  5CZD A;  2VKZ G;  2VZ8 A;  1MLA A;  3QAT A;  2QC3 A;  3HMJ G;  2G2O A;  2CUY A;  3HJV A;  3RGI A;  5DZ7 A;  2H1Y A;  2G2Y A;  3R97 A;  3TZW A;  3CJ8 A;  2HG4 A;  2C2N A;  5DZ6 A;  2VZ9 A;  3BV8 A;  2PFF B;  2UV8 G;  3HHD A;  4QBU A;  3K89 A;  5CZC A;  2G2Z A;  4RR5 A;  3TZX A;  3SBM A;  3R8Y A;  3PTW A;  2QJ3 A; 
#chains in the Genus database with same CATH topology
 3M4X A;  3RTV A;  3MPD A;  1RBA A;  1S9G A;  2K3I A;  3OJU A;  1T9V A;  2R7U A;  4QR2 A;  2R7X A;  4JYA J;  1BQN A;  4EYI B;  1RE1 B;  5KFS A;  2AD9 A;  1C0T A;  4PR6 A;  2X1F A;  2QEX S;  2F9J A;  1TUV A;  3W62 A;  3NNA A;  2VOD A;  1RWU A;  1WC0 A;  2FPH X;  4R8U B;  4O4G B;  3BBC A;  4DR5 J;  4UOF A;  4QBU A;  2XM3 A;  3KLE B;  1ZS6 A;  5ETR A;  2AT1 B;  2MKH A;  1YJN S;  2MKY A;  3TQE A;  4M5L A;  2DEI A;  4DPX A;  1B64 A;  1UJ6 A;  5KFQ A;  1WAC A;  3D54 A;  2QSW A;  3T19 A;  1URR A;  1FF2 A;  5IWA J;  3AB4 B;  1H2T Z;  1DTT B;  4MT1 A;  3SQG B;  2LQ9 A;  1F2H A;  4H4O A;  4EZ6 A;  4DUZ J;  3L09 A;  5K8P A;  3FEX B;  3OFE A;  2WVC A;  4R8U A;  1NJZ A;  4ES1 A;  4O4G A;  2CAD A;  3IAM 9;  1ULR A;  3CCE S;  4AXI A;  1MWZ A;  5K5M A;  3KLE A;  1IJF B;  5RUB A;  6FDR A;  4IR1 A;  2KG1 A;  3CMQ A;  1UPM B;  1K44 A;  2FC8 A;  2QMW A;  1U0H B;  2UP1 A;  4NXM F;  3ISN D;  1VQM S;  4OI6 A;  4PAA A;  5ITH A;  1FDD A;  3AOA A;  1DTT A;  1DAR A;  1Q7L B;  1G6B A;  3SQG A;  2ZE2 B;  4K4X A;  3SI8 A;  4OLP A;  4WXW A;  4UZC A;  3OT9 A;  2HVI A;  1R27 B;  4WP8 A;  3K57 A;  4ES2 A;  4KIA A;  3GIJ A;  2W1B A;  1FDA A;  5A6P A;  4DV4 J;  3DRX A;  1IJE B;  4CYU B;  3W63 A;  5DS7 A;  1F9F A;  4LF9 J;  2CQH A;  1KC8 T;  1KVI A;  2FZK B;  5LL6 d;  1WOO A;  3UN2 A;  2WCX A;  2LFV A;  2HHV A;  2DHA A;  1I3O B;  3AY0 A;  1XNQ F;  3O6Q A;  4DV1 J;  1KR4 A;  2ZE2 A;  2HVH A;  2GQ2 A;  4ZPW R;  3PIP Q;  1HL6 A;  1SC1 B;  2JX2 A;  1IKV B;  4RUB A;  4WFZ A;  4IOC Q;  1VFJ A;  2JLG A;  3LAL A;  3PRV A;  3GV8 B;  4WKR A;  2E1P A;  1F60 B;  1WG5 A;  4WCE Q;  4RU2 A;  2OJ3 A;  1VRQ C;  4C4W A;  3FBF A;  1NRK A;  2YKP A;  4CYU A;  4DPW A;  1T3O A;  4FYW B;  5KG5 A;  4PXE A;  3LAN A;  2HFO A;  1WOP A;  2YNH B;  1U6Z A;  2PC6 A;  5J2P B;  2HFS A;  3JYT A;  3QT5 A;  4IG0 B;  1XMB A;  4JB8 B;  1U1M A;  3DXB A;  3QFH A;  4K2X A;  4HDG A;  3MGJ A;  5GAD U;  2NPI A;  1L3K A;  1UTA A;  1EB0 A;  1EHW A;  2KZM A;  2CWX A;  1IQZ A;  1BWV A;  2FLO A;  2VA3 A;  4RNM A;  4M5M A;  3NCP A;  1NPP A;  1BLU A;  1M5V C;  5L39 A;  2W9C A;  4DF8 A;  2VFT A;  1SH0 A;  2XY6 A;  3R6G B;  2LA4 A;  3SYZ A;  4I0W A;  4NX9 A;  2YNH A;  1VGY A;  4DDF A;  4NLS A;  3TA2 A;  5I42 B;  4K4Y A;  1A0O B;  5J2P A;  3Q8V A;  3EGN A;  4OZ0 A;  1N4L A;  1IQT A;  4Y6I A;  1Z1Z A;  4ZP9 A;  1TL3 B;  4O0I A;  1PKU A;  2V9W A;  1J5O B;  2ZD1 A;  5E0O A;  3SSQ A;  2NXC A;  2RML A;  2J0Q D;  2JWN A;  1BGX T;  1RWK B;  3J80 Y;  1Q8B A;  5K8O A;  5KT6 A;  1FKP B;  1IN0 A;  1JJ2 R;  2HQF A;  3KDN A;  4FXD A;  2QO3 A;  4JI5 F;  2VQF F;  3Q8U A;  3T5J A;  2EC0 A;  2I8E A;  2WAQ D;  5I42 A;  1B70 B;  2M9K A;  2MKJ A;  2WK4 A;  4FNI A;  3BF4 A;  4NML A;  1JQG A;  1KP6 A;  1TP7 A;  2QZ8 A;  3O1L A;  2E5G A;  4W4M A;  3VQS A;  2MJU A;  1T94 A;  1TL3 A;  5BYQ A;  1BMQ B;  5HSP A;  4J9P A;  1S9F A;  2DNM A;  1J5O A;  3RYL A;  3P45 B;  3BQ0 A;  4F0K A;  2C2K B;  5D6G A;  3TP2 A;  3TVK A;  2FDN A;  5JVG Q;  5IS2 A;  1FKP A;  2IJR A;  1VHI A;  4ZVU B;  2I5J B;  4F3M A;  2G4B A;  2RRN A;  4K0K J;  4KGX B;  2ZUA A;  1HW8 A;  2FHJ D;  5AE3 A;  2VG6 B;  3ZC4 A;  2KVQ E;  3CCR S;  1S5Z A;  4X65 F;  1SQE A;  5KG7 A;  2X1A A;  3VZI A;  5D8H B;  3IR7 B;  3CC2 S;  2Z2M A;  1DFD A;  4IDK B;  2CZ4 A;  2W2O P;  2EFP A;  1NSQ A;  1HBN B;  3BPD A;  5KOX A;  3WBZ A;  2XQC A;  4PQU A;  2XO7 A;  2J8S A;  2I5J A;  3BM7 A;  1A6L A;  3LO3 A;  2GJI A;  2ROE A;  5F8M A;  3IGV A;  5B0C A;  5HK4 A;  1P9Q C;  2BJD A;  1X4A A;  2ILZ A;  1N5Y B;  2OPR B;  3TI0 A;  3H98 A;  1FTC A;  3IWX A;  4PWU A;  3D1H A;  2ZC4 A;  3S7R A;  1OSD A;  3FBE A;  3HHL B;  4KO0 B;  4QQB A;  4LR8 A;  4B3M J;  2QA1 A;  4ZKA A;  4CH7 A;  3RAQ A;  4F4X A;  1HR0 J;  3DNC A;  3I56 S;  4IDK A;  2GVZ B;  4PG8 A;  5JVH Q;  1FI4 A;  2DY9 A;  2VDH A;  4RPF A;  1HBN A;  1RBL A;  4OYO A;  3NKY A;  3L3C A;  2AX0 A;  4J9Q A;  2RU3 A;  4OJ1 A;  2LQJ A;  3OFG A;  4LSZ B;  4OZJ A;  5KFO A;  2F7V A;  3EX7 B;  2DGV A;  2UV8 A;  4A47 A;  3I4P A;  1AA1 B;  1N5Y A;  4G65 A;  4CCH A;  3CSK A;  2RUG A;  4ZVE A;  4ZK7 M;  1TMJ A;  3HHL A;  4KO0 A;  3LH2 S;  1NHK L;  3FEZ A;  4OJ3 A;  2OHD A;  2J9E A;  1REG X;  1BE4 A;  3RB4 A;  1X5T A;  4IH6 A;  4HH1 A;  1Y11 A;  3R1H A;  3UD5 A;  4F4K A;  1CS4 A;  2VU5 A;  1XMQ F;  3PYE A;  2BAC A;  3PR5 B;  1XBW A;  3KUG A;  1T9W A;  2BDP A;  1CJV B;  1GFW B;  4DQQ A;  5FJ4 A;  2QJ3 A;  3CJ4 A;  3SQO P;  1RQ0 A;  3THP A;  4RW8 B;  4DWI A;  4LRC A;  4CLU A;  4C0B A;  2ZWP A;  4CLY A;  1YBU A;  2XZD B;  3OLA A;  2AEJ A;  1WTB A;  4DN0 A;  4A8X A;  4PWD B;  4BWJ A;  2EKY A;  2HLT A;  4J9S A;  4O3Q A;  4ICL B;  5GMD A;  4NA3 A;  1WNE A;  5HMY A;  4ITS A;  3MHY A;  5B0A A;  3K5P A;  3DOM A;  3D68 A;  5K14 B;  5GAE U;  2MZ1 A;  1XR5 A;  2BRK A;  3WC0 A;  1TKX B;  2FZC B;  3W2V A;  3E01 B;  3QNW B;  2IVY A;  1CJV A;  2M3D A;  3EYZ A;  1KLN A;  2W4P A;  4F26 A;  4IG3 B;  4RW8 A;  4C0H A;  3PW0 A;  1LWX A;  2FHO B;  2KHC A;  3LOU A;  3S8S A;  5D77 A;  2EXU A;  4ZP6 A;  4UOG A;  1VQY A;  3OVS A;  1QAJ A;  1UVN A;  3H40 A;  4ICL A;  2FVQ A;  2YY3 A;  4HTI A;  3QGH A;  4HHH A;  1RK8 A;  2XUL A;  3W5X A;  3G8T A;  1CUL B;  3FJ2 A;  3M2U B;  5K14 A;  3D9B A;  2YBV A;  1TKX A;  3E01 A;  2WB4 A;  2EBG A;  1NK4 A;  4PUO B;  1YIT S;  1JLE B;  4IG3 A;  3KNG A;  3G8Q A;  1QM9 A;  1X4D A;  4P7V A;  1X31 C;  1YJU A;  3ZZO A;  1KS2 A;  4OHZ A;  2E1A A;  1N48 A;  4U7U D;  1QD1 A;  2R8J A;  3BGU A;  3HUL A;  2EFN A;  4F4A A;  2AEM A;  1S6P B;  1PAU B;  1N8R T;  1S76 D;  3GWC A;  2ZBR A;  2XSJ B;  1VIX A;  3VAG A;  1CUL A;  1G1X A;  2W8L A;  3M2U A;  4M5N A;  1L3S A;  3MED B;  4HEA 9;  1LFP A;  4DCJ B;  3GZ7 A;  1FVS A;  4PUO A;  3QFW A;  1YIJ S;  2DBB A;  1JLE A;  3K8V A;  1FCA A;  2WVF A;  3QGI A;  3FCW A;  1YVF A;  1WTF A;  4F8R A;  2AX1 A;  5AT1 B;  3NP5 A;  2OPP B;  3UQS A;  3M8Y A;  3CJ3 A;  4LF6 F;  1SI9 A;  1S6P A;  2V0N A;  4WK1 A;  3NAI A;  4AMN A;  5KG4 A;  1FNM A;  2RDD A;  3BSO A;  3DRY A;  3V81 B;  4ZP7 A;  3UWT A;  2XSJ A;  1FNO A;  1W25 A;  1N36 F;  4G3I A;  3W61 A;  2F4F A;  1NSA A;  4TYA A;  5GVQ A;  4LF1 A;  3C16 B;  1IWA A;  5HBM B;  2GMH A;  2IC3 A;  1TK8 A;  2A6M A;  2IA0 A;  1G2E A;  4C98 A;  4KH0 B;  2J9C A;  4X4Q A;  3HM9 A;  1OYD A;  2G13 A;  2XI2 A;  2OEK A;  2OPP A;  2Z2L A;  4AMO A;  2B8Q A;  3HFK A;  2BKP A;  3O5T B;  1NB7 A;  2N4D A;  4UZB A;  3LA0 A;  3DOK A;  5E5N A;  4NL5 A;  3WIU A;  2Q3P A;  3I5B A;  1F5C A;  4X4V A;  3HHK A;  4FF4 A;  4V19 J;  1NJX A;  2PE8 A;  1O8B A;  1S0O A;  2MHE A;  3C16 A;  5HBM A;  3MUT P;  2PGC A;  3MI7 X;  3BGF A;  3I0R A;  2GO9 A;  2MST A;  3FK4 A;  2RIJ A;  3CED A;  4U96 A;  4OLO A;  3OR2 B;  2A10 A;  2DNZ A;  1RYS A;  3H2U B;  4OJH A;  3OR1 A;  4KFB A;  2J7W A;  3VVT A;  1C4A A;  2LQ5 A;  3PW7 A;  5DDQ C;  1JLB A;  4I7F B;  3J80 U;  2LP4 A;  2OPQ B;  2FLL A;  4UUW A;  1FVQ A;  2CPY A;  4NZ0 A;  1C0U B;  1UVL A;  1EIY B;  3IN5 A;  3DRP A;  1M0S A;  3JB9 k;  2FD2 A;  3LGN A;  2VC0 A;  4C3K A;  2AGP A;  5FLX Y;  4AFF A;  1NND A;  2OML A;  3CDB A;  1DRZ A;  1PJ5 A;  3GYX B;  8RUC A;  4O4R A;  1YI2 S;  2VF3 A;  2Q6C A;  5F41 A;  1K9M T;  3FMB A;  1KVJ A;  1XEZ A;  3OR2 A;  1TL5 A;  5DDO C;  2XY5 A;  2Z57 B;  3VAH A;  3B4M A;  4Q0B B;  1TV6 B;  3GJT B;  1HNW F;  1LK5 A;  1X4B A;  5CYQ B;  1YJ7 A;  4M5G A;  3LGM A;  4DFJ A;  1DLO B;  2YKO A;  5BR8 J;  4JI7 J;  4I7F A;  4H4K A;  3TX8 A;  2HVD A;  3MCN A;  2OPQ A;  1X0P A;  3Q83 A;  3E51 A;  3PHE A;  3G71 S;  3OHB A;  1NUE A;  5L38 A;  4I2P B;  4OZ2 A;  1RBO B;  2BBE A;  4LFC F;  2H3E B;  2V8V A;  1AFI A;  5KFX A;  1OQ6 A;  1JNR B;  3P96 A;  4USM A;  4DV0 F;  3A3P B;  4LR7 A;  1HNI B;  1CJT B;  1BD6 A;  4Q0B A;  4KHR A;  1SJ1 A;  1TV6 A;  4C8O A;  3DDK A;  2PN6 A;  3OL8 A;  2D7S A;  1JXV A;  3D7S B;  4NLG A;  3IM9 A;  5CYQ A;  1U1Q A;  3PW4 A;  2GVD B;  4PKD B;  1RTH A;  3UO0 A;  2UV8 G;  4P10 A;  1C4C A;  2ZBI A;  4I2P A;  1RHU B;  2NUH A;  4Y2A A;  4ZLN A;  3H7H B;  2DPI A;  4QJV A;  4EZ9 A;  3DHX A;  2AJQ A;  1SL2 A;  4B9U A;  1PJ7 A;  1WF0 A;  1X4F A;  2W2N P;  4DLE A;  4RR5 A;  1NKC A;  1HNI A;  5C24 A;  3GE9 A;  1CJT A;  3A8K A;  1YTY A;  4L3K A;  4ZVT B;  3BQ2 A;  3W1Y C;  1WC6 A;  2JDJ A;  4IR9 A;  2GVD A;  2W2Q P;  4RZR A;  2Q43 A;  1S59 A;  4NE9 C;  1RA6 A;  4USJ C;  5ETQ A;  1WJ9 A;  3PTW A;  3G2X A;  2ZOG A;  2FJB B;  4PG5 A;  4DQP A;  1BC6 A;  3NS6 A;  4KYZ A;  2BE7 D;  1OIA A;  2C2E A;  1S12 A;  2DGQ A;  2XMJ A;  2BQ3 A;  2KZZ A;  4LF8 F;  4DLG A;  3ETO A;  4QYZ K;  1OQ3 A;  4FVM A;  4Y34 A;  2L08 A;  5A2Q Y;  4UQT A;  3LTO A;  3L7O A;  3QAE A;  3KK1 B;  1YHQ S;  3W5Y A;  1S6O A;  1UP1 A;  2QT7 A;  4M63 A;  4C97 A;  5D0H A;  1LWC B;  1C1C B;  2R7Q A;  3DN9 A;  2K2P A;  2XYP B;  3IO1 A;  3BBB A;  4P74 A;  4M1K A;  2UXD F;  1SPB P;  4XTT A;  4W90 B;  4ANC A;  2QLW A;  2IVM A;  5DZ7 A;  3T1H F;  4PPZ A;  1NKE A;  1JXE A;  2J0W A;  2LYV A;  1VQ8 S;  1U26 A;  3EJM A;  2EWH A;  3CJ5 A;  2RNE A;  1N5V A;  3TA1 A;  5JXS A;  4P2S A;  1S9E B;  1B7F A;  2MQM A;  4OYX A;  1PGZ A;  3HSG A;  4C11 B;  2GHW A;  2HQI A;  2HHS A;  1GT8 A;  1LWC A;  3HKZ D;  1C1C A;  3MPW A;  3OD2 A;  4NZ6 A;  2WBR A;  9ATC B;  4BCA A;  2HFN A;  1TK0 A;  2RQC A;  2FTR A;  3RBE A;  2WON A;  1LXJ A;  3KK2 B;  1IKY B;  4FP9 A;  4LSN B;  1BY9 A;  1T9Y A;  4LRF A;  5CXT A;  3CGI A;  2MMY A;  4OZN A;  2HNY B;  1KTV A;  2OEL A;  2OMO A;  3KG1 A;  4IKA A;  2Y8Y A;  2E5L J;  3MCO A;  3VAF A;  2RQK A;  3GG0 A;  2C2M B;  1FJ7 A;  4RW6 B;  4XDC A;  1MMD A;  4N8O A;  4AXJ A;  2V69 A;  1MNE A;  2R8I A;  4ZVO B;  3D0I E;  3KG4 A;  3OVA A;  5HQL A;  1NK6 A;  1VYA A;  3OLB A;  3MD3 A;  1AZS B;  5KFT A;  1HFE L;  3JTN A;  3EXY A;  3IMQ J;  4GO5 X;  2W4D A;  3CW2 C;  3GCW P;  4DFP A;  2MQP A;  1S57 A;  3KK2 A;  2WHO A;  4LSN A;  2YKN B;  1WSV A;  4UY8 5;  3W60 A;  4RBT A;  2RF2 B;  2E1R A;  3BN7 A;  1NK9 A;  4RW6 A;  5ETV A;  3FRZ A;  1Z2Z A;  3NWG A;  5LMU F;  2CDQ A;  4MJK A;  2Z56 B;  2I2Y A;  4FVC A;  2XS5 A;  2MKI A;  1AZS A;  2YX7 A;  5DLF A;  3T9N A;  4YQW A;  3R2C J;  3BR8 A;  5GAH I;  4F4W A;  3QLH B;  3DI6 B;  3CXC R;  4ILM A;  5MLC V;  3PKY A;  2YKN A;  4MH8 A;  4C3M A;  3EXC X;  2FIU A;  2BVZ A;  1XNQ J;  2W7O A;  4RUH A;  2NYI A;  3A3O B;  1TKT B;  1RYR A;  2R42 A;  1M1K T;  1NJI T;  4ZPC A;  2UXC F;  3Q8S B;  1HNV A;  2ZJR Q;  4P2F A;  1Q79 A;  4LRA A;  2Y1L B;  3OUY B;  3HHN B;  1WEX A;  1O5J A;  2QE5 A;  2G9O A;  1UW4 A;  3NWR A;  3BO3 A;  1HLW A;  3L7P A;  3UN3 A;  3BGL A;  2MPU A;  2MGZ A;  4YHH F;  2HEK A;  2DY1 A;  4KGV B;  3CDW A;  4KR0 B;  4BLG A;  1OJ4 A;  1BHN A;  2OI2 A;  4IOA Q;  1S79 A;  3V6K A;  3PX0 A;  3C46 A;  2AMC B;  3IA0 A;  4H54 A;  2K1R B;  1N0U A;  2IAJ B;  2ZOF A;  1TKT A;  4A8M P;  4NLY A;  3CJT A;  1VQ5 S;  2KKH A;  4WZM A;  3QMQ A;  2WSE C;  1AUS L;  3MAA A;  5F8J A;  1VMB A;  2E7W A;  4PG7 A;  4CLF A;  2F65 A;  3T9Z A;  1KD1 T;  5L9X A;  3FBB A;  4FYY B;  2NSB A;  2ZOM A;  3IGN A;  4CLT A;  2ASD A;  1S1V B;  5F8G A;  4C3L A;  4FYV B;  2EKN A;  3CNQ P;  1HWU A;  1QDU B;  5HVG A;  2JVO A;  4GVL A;  4Q5V A;  4ZPB A;  2XS7 A;  5SUH A;  5DLG A;  4DV5 J;  1TUW A;  3H5Y A;  2K1R A;  2BR0 A;  3A8J A;  3H4D A;  2IAJ A;  1GEH A;  4X62 J;  3KJN B;  2QTW A;  4HR2 A;  2CJB A;  4HHU A;  4CTA B;  3T6J A;  4HLB A;  3C8Y A;  2CDR B;  1VBX A;  2ZHA A;  4WKY A;  4B3O A;  2EEY A;  1H7X A;  2IM3 A;  3CMA S;  2DGU A;  4DR7 F;  3NNC A;  1NDC A;  5A0Y B;  1S1V A;  2VQF J;  3B54 A;  1RT5 B;  1YZ6 A;  1RZM A;  4N5S A;  2AQ4 A;  4DXL A;  1S0N A;  2BW7 A;  2HWH A;  3M6X A;  4ILL A;  2CZ9 A;  5H1S V;  4DV3 J;  1XR6 A;  4RUA A;  2C3U A;  4PEO A;  3MM6 B;  2V8H A;  4OIX A;  1MLA A;  1LFW A;  1K1Q A;  3FNN A;  4CTA A;  2DR6 A;  5LM7 E;  1HHT P;  4C8Z A;  2B4O A;  2R7T A;  2OD6 A;  4LF5 F;  5KG0 A;  4KBI A;  4K59 A;  1EET B;  1QUP A;  3M05 A;  1UZH A;  5A0Y A;  2DH9 A;  4DPU A;  2B9W A;  2AGQ A;  5IT4 A;  3C14 B;  1RDR A;  3CCV S;  3P49 B;  2WVE A;  1TAU A;  3DU5 A;  3FVY A;  4OHY A;  1A7G E;  1XR7 A;  2OGU A;  3KLV A;  2JFD A;  1TL7 B;  3EVW A;  1S4F A;  2VZ8 A;  3HF5 A;  2O01 C;  1U49 A;  4JV5 F;  2LXI A;  2FYX A;  4DL4 A;  3TA0 A;  5CHC B;  2NQP A;  3VF0 B;  3R6L B;  2KT2 A;  4KPC A;  5IWA F;  3CC7 S;  4K50 A;  4KSE B;  1UFK A;  5E2Q A;  3DHW C;  5LSR A;  1M5O C;  3IR5 B;  5T14 A;  1S1X B;  3TAM B;  1RKJ A;  3C14 A;  3TQ1 A;  5F0W A;  3MAQ A;  2JEI A;  1TKZ B;  3GR0 A;  3AQP A;  5KFF A;  2VKZ G;  4KB7 A;  3KUE A;  4I64 A;  2ACM A;  4MIB A;  3B4D A;  4B3R J;  2HIQ A;  3JTP A;  4ATN A;  2IA6 A;  1FRX A;  2QA4 G;  2UVW A;  1XC9 A;  3K5L A;  3I4H X;  4OYP A;  1DBD A;  4NCA A;  1L3U A;  4YP3 A;  1SVD A;  4G1I A;  1FEH A;  2LMI A;  2HGL A;  3CDE A;  4DFK A;  4IRK A;  3BEG B;  3DYA B;  4ETX A;  4IRD A;  2K8G A;  4UST A;  2EPI A;  4GC7 A;  4ZCI A;  1S1X A;  4FN5 A;  2B43 A;  1OS5 A;  3M8W A;  4YB6 A;  2H48 B;  4EGL A;  2CQG A;  2PA8 D;  1T3N A;  1TKZ A;  2CVE A;  2D9P A;  4ZA1 A;  2XMM A;  1NZ8 A;  2CQP A;  3R5J B;  1TR0 A;  1MRO B;  4LBH A;  3TUZ C;  4DF4 A;  4MTP A;  3VGU A;  2OLW A;  1PBA A;  4LF9 F;  5M2P A;  4URQ U;  1DJ0 A;  4FDF A;  2VPY B;  2V63 A;  2MQ8 A;  2A1B A;  1PO6 A;  3ITH B;  2QA2 A;  4DV1 F;  1WD6 A;  1KFD A;  3HP6 A;  3NG8 A;  2V4J B;  2HSE B;  2C1E B;  1XMQ J;  3OFF A;  2BAB A;  4C7Q A;  5G4D A;  4R0E A;  1NPK A;  4KGM A;  2BM0 A;  3C6T B;  1UEV A;  2HZA A;  2A2C A;  4AUK A;  1N34 F;  2CQ4 A;  4CLL A;  2V6A A;  3CDA A;  3G82 B;  1RTD B;  3OTO F;  2RS8 A;  2BW2 A;  3OJS A;  1E6Y B;  1IM4 A;  2VJV A;  1VBK A;  2MHN A;  3ITH A;  1W26 A;  4HL9 A;  1JNZ B;  4QIF A;  2VBX A;  1BWE A;  2XZT B;  4A48 A;  2V4J A;  3D5M A;  2LKZ A;  4ZP8 A;  3JQK A;  2ERR A;  3LP2 B;  2YQ0 A;  1I94 F;  2WW8 A;  4J9R A;  2CQC A;  3UR3 C;  3KXD A;  3C6T A;  2H9Z A;  2HBR B;  2V4Q A;  3TEG A;  2MZS A;  1YJ9 S;  1KBR A;  1D9D A;  4O44 B;  1CEZ A;  2KM8 B;  1RTI A;  4NPO A;  2F5G A;  2DNO A;  1HNZ J;  1RTD A;  1FHT A;  1E6Y A;  2Z30 B;  4PWW A;  3VVU A;  1Z4U A;  5IM0 A;  1RHK B;  3H25 A;  3I9V 9;  4P71 A;  1OPI A;  1ZA2 B;  3OTC A;  4EK2 A;  3ILO A;  3QSI A;  1EKS A;  1SIZ A;  4EWT A;  3GFX A;  3MWB A;  2E1M C;  1HWL A;  3LP2 A;  4PG6 A;  1RHM B;  5B0B A;  4P52 A;  1JJ4 A;  2V2K A;  3PEJ A;  1SC6 A;  1NSK L;  1G3O A;  4QPT A;  3PXG a;  2XCA A;  4K4Z A;  4O44 A;  2C2Z B;  3UCG A;  3BSN A;  2B8P A;  3BKT A;  1UA0 A;  1GXU A;  1NK8 A;  1N33 F;  1RT6 B;  4L76 A;  4MKV A;  3AD8 C;  2B9E A;  5KFK A;  2PI5 A;  4OYZ A;  4DUT A;  3TEH B;  5GMK a;  2H54 B;  2FLN A;  4N76 A;  3OVB A;  2CPZ A;  2X3G A;  2ZH9 A;  2CG4 A;  3DXS X;  3SCJ E;  4AL5 A;  2IM2 A;  4MK9 A;  2ZZM A;  4X4T A;  5A8W B;  1UWA A;  3FMW A;  8AT1 B;  4ZOS A;  4V1A k;  2B4U A;  4BBY A;  2VBY A;  3QYY A;  1YZ7 A;  3H0P A;  2Y0B B;  1UVI A;  3AQO A;  2RQ4 A;  3GJS B;  3CCM S;  4RW7 B;  1PIL A;  1VS3 A;  3N5B A;  4USH A;  2FVR A;  4JI6 F;  4NLP A;  3J81 j;  5E3C A;  4LF6 J;  2XBP A;  3OV7 A;  2EVZ A;  4JUZ A;  3DU6 A;  1TQL A;  2LEA A;  3MD1 A;  3E8O A;  2QL7 B;  2V34 A;  1FKO B;  1V9O A;  2PA3 A;  2R8H A;  3BO4 A;  4MKA A;  3KG0 A;  2OPS B;  2WOM A;  3W7B A;  5A8W A;  1JWW A;  1VI7 A;  4FKY A;  5J1E B;  3G87 A;  4LFB F;  1FX4 A;  2ASL A;  1O0P A;  3GYG A;  5B08 A;  3IWL A;  1PYS B;  2N3O A;  3M7V A;  2J9D A;  1CVJ A;  4DU7 A;  1NH8 A;  4CO0 A;  4EO6 A;  1UVJ A;  1PJ6 A;  4QIG A;  4FXV A;  4EO8 A;  5KG2 A;  1SUQ A;  3MR6 A;  1NH7 A;  2EG2 A;  4ECY A;  1OO0 B;  3PCO B;  4DPO A;  2VON A;  5C25 B;  3HI9 A;  3GIM A;  5L1J A;  4JI0 J;  2FJA B;  1JK9 B;  2VZ9 A;  4M5I A;  1IBK J;  4L3N A;  5DJB A;  3RJM B;  2OPS A;  2E1C A;  2OO4 A;  2DT9 A;  1C1B B;  1VR6 A;  4FXW A;  2QLJ B;  4WFN Q;  5J1E A;  2V68 A;  3C15 B;  3QJJ A;  4B3M F;  4RX6 A;  2ZHO A;  3THV A;  4R0J A;  3RRH A;  1JLA B;  1VC0 A;  4DR3 F;  2Z2Z A;  4OHV A;  1VQ6 S;  2ZVI A;  4MKB A;  3RU0 A;  3DLK A;  1RCX B;  2DNK A;  5D4O A;  2OSR A;  3SMZ A;  1R8B A;  2HND B;  1MU2 B;  4XIU A;  1K1S A;  4F04 B;  4ECZ A;  1VC6 A;  4X66 F;  5KG6 A;  5C25 A;  3UDC A;  3GMG A;  2JLF A;  1BXN A;  1JKH B;  5HMW A;  2CQ0 A;  4YFU A;  2DIU A;  1QLN A;  4OZ1 A;  1SKS A;  1QSY A;  5D15 A;  4XK8 C;  1U1P A;  3D4J A;  3DM2 B;  2GGP B;  1H72 C;  2CJ9 A;  3V6J A;  5ETS A;  4WE1 B;  5E3A A;  1YJR A;  3NS5 A;  1R31 A;  4TYB A;  1S48 A;  3K5O A;  2R7W A;  2CPI A;  1LK7 A;  3V2U C;  4A8O A;  2L3M A;  4JV0 A;  2E9T A;  1KN6 A;  1FRH A;  4P2X A;  1QAY A;  3UVJ A;  3IRW P;  4PXC A;  4K5R A;  2NXE A;  1NM2 A;  1HQU B;  4TQS A;  3RBD A;  1JKH A;  1KQS R;  4K4T A;  4NCG A;  1R3N A;  2DXE A;  4FZV A;  4FF2 A;  5LSL A;  2V2Z A;  3DM2 A;  4F4Y A;  2GGP A;  5I3U A;  2I9S A;  1Q16 B;  4WE1 A;  4DV0 J;  2F1F A;  5LJ3 Y;  4OI3 A;  3TVZ A;  3VWS A;  5HQM A;  3TO8 A;  1IWG A;  3K89 A;  3GV5 B;  1S1T B;  3TUJ C;  4OI1 A;  4K4W A;  3BJY A;  1HQU A;  3PJ9 A;  3BGO P;  1KOO A;  4DL0 C;  2ZDP A;  2WW4 A;  5F3Z A;  2C42 A;  1Y5N B;  1HQE B;  1FRK A;  2RSQ A;  1Y7P A;  2V8P A;  1U1N A;  2UVR A;  1J27 A;  4DR6 F;  5EUH A;  1U48 A;  4RO0 A;  2D74 B;  4P72 A;  5HMX A;  2DGO A;  1X7V A;  1QE1 B;  2CPD A;  1R0A B;  1PC5 A;  2HVE A;  2HG4 A;  1SKU B;  2DNN A;  2RAQ A;  2YKM B;  4DJB A;  2VPX B;  3GLJ A;  1KDN A;  3AXM A;  3GII A;  3DLJ A;  1HQE A;  4KRW A;  4X4R A;  1VHF A;  3ENV A;  2HIY A;  3WZ0 A;  2M7S A;  1J2V A;  3TWZ A;  4KJI A;  2WBM A;  4WJB A;  2JC0 A;  3BR9 A;  4WP9 A;  3VAJ A;  5GAH U;  3B8H A;  4ZVQ B;  6AT1 B;  2LEC A;  4CNY A;  1QE1 A;  1R6Y A;  3R27 A;  1R0A A;  3BB5 A;  4NLV A;  5JUM A;  2JZ5 A;  4DI6 A;  5D4L A;  5IT0 A;  2C28 A;  3OSP A;  2RDJ A;  2R2T A;  5F0U A;  3OPK A;  3T1H J;  4QWD A;  2AYB A;  2BOP A;  1CQN A;  2QLX A;  4NLT A;  4LF4 J;  2UXB J;  2CJX B;  3B6B A;  1U7L A;  2EK6 A;  4WU2 A;  2J6U A;  2HUR A;  4F02 A;  1Q86 T;  7FD1 A;  4DX6 A;  1REV B;  4MAK A;  2LXU A;  2XC9 A;  2DK2 A;  4ZLJ A;  3MUM P;  1RT3 B;  4Y2M A;  1GMW D;  4TU9 A;  5F3T A;  1Y5L B;  5CH7 B;  2E9Z A;  1M5H A;  2KRB A;  4ZLP A;  5GME A;  1P1T A;  1LNQ A;  2DYA A;  1RHQ B;  1WG4 A;  4NAS A;  1NK0 A;  3PYD A;  2ZNZ A;  1UVM A;  4QYR A;  3MAH A;  2C2O B;  3JQJ A;  4P7T A;  3NLC A;  2YNF A;  4ZCK A;  2HHX A;  1H3D A;  2R3V A;  2IBK A;  3D0H E;  4LIW A;  2V2Q A;  4WBF A;  4DL6 A;  2CA9 A;  4J90 A;  4OFZ A;  2ACY A;  1Q53 A;  2HQ3 A;  4AMP A;  3US5 A;  3HHL C;  1PG5 B;  5F8I A;  4OI2 A;  2XB2 D;  5CD4 A;  2ADB A;  1TUG B;  4DR4 F;  1RLD A;  4D3H A;  4OHX A;  2BJE A;  4EBE A;  2BJ1 A;  5KG1 A;  1JIH A;  3J7Z 5;  1JX4 A;  1IBL F;  2KFY A;  4YDD B;  5B0D A;  4U9R A;  3EWG A;  1P1L A;  2J6T A;  4J91 A;  4RBU A;  3RBX A;  3D1O A;  1WI8 A;  4A8K A;  4E98 A;  5CAB A;  3TUI C;  2RIL A;  2R7O A;  4NA2 A;  1GQE A;  2W2P P;  3MMJ A;  1XER A;  2XI3 A;  3PR4 A;  3Q89 A;  4CWB A;  4PRF A;  3X1L B;  3H4B A;  1M5S A;  2C2R A;  2IIH A;  5KT7 A;  1SH3 A;  1XWL A;  3CTR A;  4RJV A;  3PW2 A;  4J9U E;  2V8G A;  2J8A A;  1RAO A;  1XMO J;  2XG8 A;  1X4C A;  3RRK A;  1VRU B;  5LXY A;  5BR8 F;  4B17 A;  1WEY A;  2HK3 A;  4GO7 X;  3QO9 B;  5KFM A;  1RXO B;  1N0V C;  4ZCL A;  2UXC J;  4IQM A;  3GON A;  2A3J A;  3QPI A;  2CIM A;  5HO4 A;  2VJU A;  2B9Y A;  4LIR A;  3KK3 A;  4I6W A;  1UET A;  4TU7 A;  4QIW D;  4MFB A;  4YHH J;  1MWY A;  3D6T B;  2XMV A;  2GW8 A;  2CPE A;  2PD1 A;  2I0X A;  4KHP J;  1PIE A;  2P9G A;  1PCA A;  3BYP A;  5I3Q A;  3QO9 A;  4X4S A;  4B3T J;  3GJR B;  2BYC A;  3R5C A;  3F73 A;  2HHH F;  4B9M A;  4G6V B;  2ZNY A;  1RAD B;  5CCM A;  1RAJ A;  4ELT A;  1RTZ A;  1KLM B;  4RKU C;  2ZH3 A;  4DCO B;  2KRR A;  1B4S A;  2GO8 A;  4RUC A;  3NCQ A;  2QV6 A;  3B82 A;  1EQ0 A;  4DV6 J;  2FVP A;  2HPU A;  4QR1 A;  4O3N A;  2XSF A;  5I3P A;  3RUB L;  2CUY A;  2LQ8 A;  3MF5 A;  4F2R A;  3G96 A;  5L46 A;  1X4G A;  3HKW A;  5CZC A;  5KFN A;  4D3G A;  5KFI A;  4R5P B;  2CG8 A;  1RWV B;  2ZBC A;  1FES A;  1W2I A;  4U7U K;  4RNN A;  2DH8 A;  1UL3 A;  4AMM A;  3FZB A;  3P4U B;  5IC6 B;  1WKJ A;  4F67 A;  1FNX H;  4BWM A;  3CCW A;  4RL1 A;  2NS1 B;  1F5A A;  3HZG A;  5BYR A;  2Q6B A;  5FDL B;  2H4Y B;  5L1K A;  4QIE A;  2OH2 A;  1FJG F;  4TLR A;  1KNZ A;  1VDH A;  1HNX F;  4B02 A;  3ZNJ 1;  2MZJ A;  1P9Y A;  4UQG A;  4DS4 A;  4EBD A;  5KFP A;  1NK5 A;  3Q24 A;  2I6W A;  3VGV A;  2CFX A;  5K8N A;  2ADC A;  1GK8 A;  2C3Y A;  5B0F A;  5T7L B;  4WYL A;  1MMN A;  1HBU B;  5FII A;  4CLS A;  5CYJ A;  2DR5 A;  4LF5 J;  1URN A;  1CLF A;  3A1Y G;  4ZVH A;  3VV2 B;  3NAH A;  5DQH A;  2DVI A;  3PJW A;  2JH3 A;  4O3S A;  3EVM A;  3EDR B;  1IUJ A;  4LJM A;  4C8L A;  4ED5 A;  3AOD A;  3W9I A;  1M1H A;  4IQX A;  5FDL A;  3JSM B;  1TKD A;  3VAM A;  1GMW A;  2HZC A;  3CD0 A;  2BM1 A;  4JV5 J;  2XEX A;  1U2C A;  3Q86 A;  4TY8 B;  5T7L A;  1OSC A;  2P9C A;  2BZ2 A;  1HBU A;  3Q2S C;  2K06 A;  4F4Z A;  2QFI A;  4DU8 A;  1QVG R;  2YNG B;  3CVK A;  1Q0N A;  2NPF A;  2AU0 A;  3DDI A;  4NXN F;  2E5L F;  1F5B A;  3CJ8 A;  3ZTP A;  1YKW A;  3SCK E;  2H5E A;  4DSL A;  2RUS A;  2B6A B;  3OBI A;  1L5U A;  5LOQ A;  3JSM A;  3MR5 A;  4I2Q B;  1GNK A;  4DL3 A;  4A8Y A;  2CKW A;  1FTR A;  4WWS A;  5KFY A;  4ED7 A;  5DGB A;  3MM5 B;  3R5B A;  4QR0 A;  1HHS A;  3KMQ A;  1WHY A;  1D9F A;  4H4K C;  1TL4 A;  2YQ1 A;  2YNG A;  1UW9 A;  3MPU B;  2VHG A;  1S10 A;  2Z2Y B;  3AFG A;  3BYR A;  3EZO A;  4DBQ A;  1TEL A;  1EP4 B;  2VL1 A;  2DR9 A;  4C8K A;  1FJC A;  2G0I A;  4I2Q A;  4Z2X A;  2CQB A;  2MZT A;  2HYI B;  2O1P A;  4AQY F;  3FSY A;  3QZ8 A;  1SXL A;  3JTO A;  1X9W A;  4ZVG A;  3EM1 A;  5FD1 A;  3MMA B;  4MIW A;  1U0H A;  2VG5 B;  2B0G A;  3V6H A;  3CD7 A;  3MM5 A;  3RW6 A;  4CT9 A;  2DNL A;  2XCP A;  5E7O B;  2YKA A;  4JI3 J;  4JI1 J;  4M94 A;  2ZH8 A;  4ZJL A;  1ZOT A;  2DPJ A;  3LUY A;  3EMT A;  5DQG A;  1EP4 A;  4NLX A;  4ZHR B;  4CDI A;  1VIO A;  2GV1 A;  3I32 A;  1VQL S;  2HGM A;  3CCL S;  3N6M A;  2EW9 A;  2WSC C;  2D3O R;  4DPY A;  4C2M A;  2J0X A;  2BJ9 A;  2VD3 A;  5GAG I;  1N34 J;  2G0C A;  3MMA A;  2ZEJ A;  4CH0 S;  3OTO J;  4DS5 A;  5IZH A;  1FJE B;  4DOZ A;  5DM7 Q;  3DLB A;  5F8N A;  1YRT A;  4OX9 J;  1M90 T;  4A8F A;  4KE5 A;  3PKM A;  2C2N A;  1WOS A;  2MY7 A;  1IKV A;  2JLE A;  1F9E B;  1GMV A;  5KFC A;  1I94 J;  5E3P A;  2IMW P;  2A0F B;  1JLC B;  2O5D A;  3OL6 A;  1NAQ A;  1V6H A;  2ILY A;  3DFE A;  3QJP A;  5I4M A;  4IUF A;  7FDR A;  1Z2L A;  2NXN A;  2J9D E;  2RKI B;  4DV5 F;  4XPC A;  2XNQ A;  1EAR A;  2D69 A;  2LXF A;  2VA2 A;  1C2P A;  4ED0 A;  4IG0 A;  3UNY A;  2R2S A;  4PXB A;  2FGO A;  3W65 A;  4X62 F;  5IV3 A;  5HLF B;  4JI8 F;  1KON A;  2ZBQ A;  2DHX A;  1YJV A;  5MAO A;  4CIO A;  3I0S B;  1FO1 A;  2HRT A;  4Z7C A;  1RWO B;  3MFI A;  3BH6 B;  2XS2 A;  4Z37 A;  3KMS A;  2VFV A;  1YRU A;  1JLC A;  4O0N A;  4UOC A;  3UW1 A;  3CCZ A;  2DCL A;  1WEZ A;  1VC5 A;  2BUN A;  1JLF B;  1YSJ A;  2M88 A;  3M6V A;  2P2C B;  3TUP A;  1N33 J;  1EX8 A;  2YPY A;  4DQR A;  3LQV A;  4YUD A;  2RKI A;  4DX7 A;  3MR7 A;  5IQ6 A;  4JI2 J;  1HBO B;  4DV3 F;  1Q95 G;  2PMZ D;  2CZV C;  4ED3 A;  1IKW B;  2AJ2 A;  3HMJ G;  5EWG A;  3D0G E;  1S6Q B;  4DG1 B;  1EQM A;  1E6V B;  4EUV A;  4V19 X;  2RHS B;  4YS2 A;  3JQM A;  4ECV A;  2KHD A;  3T1A A;  2HBZ B;  3I9Z A;  4JI6 J;  1FFS B;  5LMN F;  4J7C A;  3G86 A;  2WSF C;  2ZJP Q;  3M6W A;  3P5T L;  3HDS A;  2IPO B;  1TAQ A;  2R2U A;  4WFB Q;  4EYH B;  1UPP A;  1UZD A;  3PO5 A;  4KTQ A;  1RAE B;  2RRA A;  3WQP A;  1IKW A;  4IFY B;  1H2U X;  3ZXW A;  3J7Y I;  1S6Q A;  5H9F K;  4DG1 A;  1WDD A;  1S0M A;  3PW5 A;  1K8A T;  4LFB J;  1E6V A;  2HAF A;  1ICE B;  1P27 B;  1FWP A;  1X5O A;  2PSZ A;  1B3T A;  1IR1 A;  2BE2 B;  3LGH A;  2RS2 A;  1U0S A;  2EC2 A;  2NSC A;  2XHC A;  4AYB D;  1OPZ A;  1I5O B;  3MEE B;  2HW3 A;  1CJU B;  2IFX A;  4ED6 A;  4LRD A;  3MR2 A;  3W9J A;  1H74 A;  1RU2 A;  1NB2 A;  4YOE A;  4B3R F;  3M8Q B;  3DGP B;  2XGP A;  1H6K X;  4YEA A;  1RAI B;  2VG6 A;  3SBM A;  4K5S A;  4WIQ A;  4QWA A;  1SH2 A;  2H51 B;  4OYM A;  1VQ7 S;  4I4B A;  1GTE A;  2P6S A;  1EZZ B;  4NYZ A;  1FRI A;  3S1T A;  3ADA C;  4DR3 J;  1KOH A;  1LOU A;  1Q5V A;  4TU8 A;  2BE2 A;  1V3R A;  3VTI A;  5LJ5 Y;  4CQ1 A;  3MEE A;  1H0H B;  4X66 J;  4DSE A;  5EN1 A;  3KHH A;  1S99 A;  3DGP A;  1AW0 A;  2OPR A;  5EHH A;  1AFJ A;  3HSJ A;  3M2V B;  4DX5 A;  2IDE A;  1VQO S;  5B0E A;  3GP9 A;  1ZAX A;  1R8A A;  2PDA A;  2GCF A;  3Q23 A;  2C2D A;  2GVZ A;  2DIV A;  3OQ2 A;  2ZKT A;  4DEZ A;  3MM8 B;  5IV4 A;  2RVJ A;  2PO4 A;  1NJW A;  3PM9 A;  1X8D A;  4C8N A;  2JC1 A;  2KTQ A;  2L41 A;  2FZG B;  1T03 B;  5EWF A;  3MOJ B;  4LRE A;  2XGQ A;  4W92 B;  4LRB A;  2UUB F;  2QRR A;  2HHP A;  1S77 D;  4ZN1 A;  3M2V A;  3L9Z A;  4M5D B;  2FY1 A;  1QTN B;  4ER8 A;  1QSS A;  3NXZ A;  2FJW A;  3M9N B;  3MM8 A;  4JOU A;  1U1K A;  2CRL A;  3NGU A;  2HZV A;  2JEG A;  2CPX A;  2Q66 A;  2NRE A;  4DFM A;  1SC3 B;  3PX4 A;  2AJ1 A;  2D3Z A;  3CJ2 A;  3MEK A;  1U1R A;  2QN6 B;  1T03 A;  3M8Z A;  3PZP A;  3JAM Y;  2ATL A;  2XO6 A;  1VBZ A;  5A76 A;  4ELV A;  4JBC A;  1HNZ F;  4PWD A;  3P6Y C;  1RAA B;  4ZIV A;  4DR6 J;  4M5D A;  1EKR A;  1NK7 A;  1RIS A;  4DZD A;  4I56 A;  1F9H A;  1RWW B;  4J9O A;  3SV3 A;  2CQD A;  3UDV A;  4EBC A;  2DGT A;  4BDP A;  4HI1 A;  2UZA A;  2GHP A;  1RT2 B;  2XMA A;  1HD1 A;  3MM7 B;  4JP8 A;  4DMZ A;  3AA9 A;  2Y8W A;  4MK7 A;  2H5J B;  4DSI A;  1TL1 B;  5J2M B;  1FRM A;  4ELU A;  4B9T A;  1N54 B;  3WHI A;  1ZA1 B;  3MDF A;  4I1T A;  3VZH A;  1JLG B;  4HDH A;  3M9M B;  3QRQ A;  4ZJQ A;  2RT3 A;  2IRY A;  4DR1 F;  4ED4 A;  2MQN A;  3UD3 P;  3P8B B;  3CME S;  1NDK A;  3HO1 A;  3BKF A;  2J5A A;  1RT4 B;  4KY3 A;  3X3U A;  4DL5 A;  3NGR A;  5D0E A;  1RT2 A;  4XO0 A;  2ZC3 A;  3K0J A;  3MM7 A;  1T02 A;  2JSX A;  1N88 A;  4ZVF A;  1OY9 A;  3O44 A;  1AB8 A;  5A8K B;  2HLU A;  1FDN A;  1WI6 A;  4CM0 A;  1FEE A;  3MTK A;  3I31 A;  2KXF A;  4WFX A;  3GR1 A;  2Y9H A;  3UD4 P;  1GAO A;  1NXI A;  4M5K A;  3KWM A;  1JLG A;  3BQ1 A;  2H4W B;  4PAB A;  1X9M A;  2CNN B;  3P5B P;  1QVF R;  3PV8 A;  3BGR B;  2AYM A;  1EAY C;  3UE2 A;  1G7C B;  1X5S A;  4A4J A;  2V9K A;  1RT4 A;  2K7J A;  2D41 A;  1WG1 A;  4OZ3 A;  2FHJ A;  4ECW A;  5CZX A;  1TU0 B;  3MED A;  1HBM B;  4NMX A;  2BJ3 A;  1LXN A;  2IRX A;  2KO1 A;  3KLG B;  3AT1 B;  5KFV A;  5A8K A;  5BYS A;  3IWN C;  5B09 A;  4TLQ A;  3TZW A;  5C7P A;  1U6B A;  3SSS A;  2M8H A;  4ZIW A;  3CC4 S;  4DUY J;  1CC8 A;  3ELH A;  5KFZ A;  1S4E A;  5J2N B;  2OTL S;  4Q8E A;  4RBV A;  3G9C A;  5DO2 A;  4JI0 F;  3V81 A;  2ABY A;  3BGR A;  2FVS A;  2O66 A;  2PMW A;  1IBK F;  3SXL A;  2LU2 A;  1Y0H A;  4F3Q A;  4BS2 A;  4XPE A;  4NWB A;  1QAI A;  5G0R B;  3UNG C;  2PI4 A;  4M95 A;  3LPE A;  2OEJ A;  5HVH A;  4LBI A;  4DR4 J;  4DZ6 A;  3I6P A;  1EJ7 L;  3KLG A;  4K8R A;  5HMZ A;  1W2B R;  2M2B A;  2PEB A;  4AL7 A;  2GJ2 A;  2QYG A;  1IBL J;  2DGS A;  4GVB B;  5J2N A;  4BC7 A;  3HSD A;  2IHR 1;  2DNH A;  5J2Q B;  4WU3 A;  5K20 B;  1OWX A;  5L1L A;  4O3R A;  5G0R A;  4KQZ A;  4LF7 F;  1NEE A;  1FE4 A;  2ZM6 J;  1FWL A;  4AND A;  4A8S A;  1KQK A;  1GXL A;  2YX4 A;  2ALY B;  1WHV A;  2IYG A;  3FQK A;  1P6T A;  2WZ1 A;  4OYI A;  2L9D A;  3BPS P;  2ZH2 A;  3NMR A;  1T7P A;  4C8Y A;  3SIP B;  4WXO A;  2HMI B;  2BEF A;  1C0U A;  4PYA A;  3M8R A;  4TN2 A;  2AEF A;  4X4U A;  3QZ7 A;  4YB7 A;  4KAI A;  2N3L A;  2NXU A;  2Z0G A;  1S9G B;  3GFY A;  3AD9 C;  2MLZ A;  3VR1 A;  3SSR A;  8ATC B;  2UUW A;  1F2G A;  4HYK A;  2IJN A;  4KGK A;  3GG1 A;  4F3O A;  4DQI A;  4LSL B;  2ZH5 A;  2CJQ A;  3EDQ B;  3MR3 A;  3RAM A;  5BJR A;  4KGZ B;  1DLO A;  2IJF A;  4LVN P;  1F3V A;  2U2F A;  2W7P A;  1HWK A;  1VQK S;  3V4M A;  2HMI A;  1NZA A;  2HHH J;  1JB0 C;  4ERD A;  4WYW A;  2FHK A;  1OMS A;  4CO1 A;  2RDI A;  3K58 A;  1NJY A;  3VCD A;  3N5F A;  2W01 A;  1IXK A;  3ZNU A;  3R7N B;  1RWP B;  2V2V A;  1KKH A;  1K0T A;  2F8E X;  4O3P A;  4LSL A;  4H4O B;  3DGV A;  4QPX A;  3HVR A;  1V5V A;  4ENO A;  2HK2 A;  3S6E A;  2BQR A;  3RW7 A;  1PYT A;  1N5T A;  2XMU A;  4X4N A;  1L3T A;  1YBT A;  1YLX A;  2CYY A;  2AZ3 A;  1Q5Y A;  4EEY A;  1RT1 B;  3J7A 1;  3VQT A;  4QIV A;  3AJ2 A;  1AUD A;  2GAH C;  2RE1 A;  3QRP A;  1I1G A;  2P5V A;  4CO4 A;  3CUL A;  4ED1 A;  3FGV A;  1FFG B;  4GC6 A;  2VQE F;  1FJG J;  3H2V E;  1HNX J;  1TK5 A;  2YXL A;  3QSY B;  2MYF A;  3BDP A;  2APO A;  3GFZ A;  4P2M A;  1LV5 A;  3EIC A;  3KHR A;  5IT9 Y;  1XNR F;  4KC5 A;  1UKU A;  2MEW A;  3HVA A;  4LF4 F;  1RT1 A;  2YPZ A;  4USU A;  4K4S A;  2UXB F;  4U67 Q;  1RAF B;  2Y1I A;  2DHG A;  4OV6 A;  3D6H B;  3LAK A;  5GAG U;  3RR7 A;  1HI8 A;  3CCS S;  3R9L A;  4LFA F;  3OFH A;  1UEU A;  1NBE B;  3U27 A;  3J81 U;  3Q8Q B;  3KK1 A;  2UUA J;  2XMK A;  4DV7 F;  1HAR A;  2E66 A;  1N32 F;  5E41 A;  4ZJO A;  3JSR A;  5KFL A;  2CPF A;  1SL0 A;  4HTJ A;  2RQM A;  2LEB A;  2CPJ A;  4U8Y A;  3VHQ A;  2VFS A;  2DGX A;  1B0T A;  2P8I A;  3SDE B;  3DDN A;  2HWT A;  2W4C A;  3HHL D;  1VLO A;  1ZM2 A;  3ZZR A;  1FRL A;  2V50 A;  3MMB B;  4NLU A;  4NXN J;  4ED2 A;  4QU6 A;  1PBU A;  1X4E A;  3JAM U;  2VH7 A;  3AOB A;  3JSB A;  3FKB A;  1S9E A;  3GFH A;  3PO4 A;  3JYT B;  4JV1 A;  4C11 A;  3KJV B;  5C2C A;  1GX6 A;  2GX8 A;  5C2G A;  2SXL A;  3QIP B;  4ZLL A;  4GKK F;  4ECX A;  2HRY A;  2JL9 A;  2UU9 F;  3PRB A;  4EU0 A;  1CBK A;  2DD8 S;  3QT7 A;  3Q8Y A;  3W66 A;  3CT9 A;  3FC9 A;  1IKY A;  1NDP A;  5U47 A;  6FD1 A;  3NRB A;  4KT0 C;  1UCN A;  3SDE A;  2W9C B;  1GX5 A;  1SKR A;  2HNY A;  1PAE X;  3MMB A;  1TVR B;  1H98 A;  3KUH A;  1H2V Z;  5ADZ A;  4N77 A;  4HT7 A;  2CJK A;  3EPI A;  1NU4 A;  4L6V 3;  2FC9 A;  1VJQ A;  1NCL A;  2DR7 A;  4DSF A;  1Y3K A;  3KJV A;  4J9K A;  4F7V A;  4DR2 F;  2NR0 A;  3QIP A;  3NBP B;  4AQY J;  2MLY A;  2W9A A;  1HI0 P;  2L9N A;  2JEJ A;  2DH7 A;  4QWE A;  3C3L A;  2RJZ A;  1U1L A;  2ZD1 B;  2KJV A;  1DUR A;  3OHA A;  3K5M A;  1UFW A;  3ZTS A;  1S97 A;  5AXK A;  2B9X A;  1XMO F;  5LSO A;  3IBC B;  1LW2 B;  2N4C A;  3I55 S;  2M8D B;  4F0H A;  2M70 A;  4UW2 A;  2CPH A;  4X84 A;  1R7I A;  2RF2 A;  3CUN A;  1TVR A;  4DQS A;  4ZVP B;  1T95 A;  2YVS A;  2ZDO A;  3O8W A;  5IOL A;  3NBP A;  1KTQ A;  1WHX A;  3GJQ B;  5A6W A;  3VAK A;  2ZZN A;  2YWW A;  2A18 A;  2OTJ S;  3J7Y U;  3SCL E;  4YY3 J;  3QGP A;  3QLH A;  1FRJ A;  3DI6 A;  1O6X A;  1XK8 A;  2BXJ A;  4HHJ A;  1SL1 A;  4KHP F;  1LW2 A;  3R1L A;  3F41 A;  2RB7 A;  2QYC A;  2OKQ A;  3HPO A;  1WC3 A;  1WUU A;  4B3T F;  1WSR A;  4CO5 A;  5DGA A;  1YBA A;  5KT5 A;  3TAP A;  3DLG B;  2MJN A;  4C8M A;  3T5L A;  1NPR A;  3AOC A;  4I68 A;  2GIF A;  1FA0 A;  3ENW A;  2BJ8 A;  3OUY A;  2MKS A;  1HWI A;  1KHV A;  3G6V A;  1AT1 B;  3NMA A;  3SFG A;  1U02 A;  4DV6 F;  3J7Z T;  1Q1K A;  3R2D J;  2UVU A;  2QA4 S;  5H9E J;  2BX6 A;  1APS A;  5L9N A;  3KTQ A;  2N7C A;  4PQU B;  3O3L A;  4LF2 A;  2KFN A;  3GTY X;  2ATC B;  2QX0 A;  1FER A;  3V6D B;  4JI8 J;  4WZQ A;  5ETN A;  2GIR A;  3CWJ A;  2LVW A;  2DB1 A;  1BUX A;  3RZA A;  2FLP A;  3DLG A;  3MTJ A;  4FNH A;  1VLY A;  3R8Y A;  2N82 B;  1DZ5 A;  1RHJ B;  3H59 A;  3JS9 A;  3C19 A;  2VFU A;  1AXQ A;  2GJF A;  1VOM A;  2KL8 A;  2R2R A;  5ETL A;  3NEK A;  2V67 A;  1XJW B;  3V6D A;  3GPA A;  4RU9 A;  2VAS A;  1ZET A;  2MSS A;  3GCX P;  2IYI A;  4KHM A;  3PG9 A;  3BZQ A;  2VIH A;  1VQ4 S;  2M0G B;  2VOO A;  3D3C J;  1D8Z A;  4OYW A;  5KFG A;  3IP0 A;  2E29 A;  4OI0 A;  3C66 A;  1RT5 A;  5LMN J;  3QJL A;  2HFU A;  4M5J A;  3HXM A;  2KB2 A;  1CS4 B;  2BE9 B;  2BKO A;  1S6U A;  3A12 A;  3JXO A;  4FF1 A;  4ZDN A;  1HHQ A;  1I51 B;  3MM6 A;  4B3S J;  4ZS6 A;  1MN7 A;  3ETM A;  2HAI A;  2D3O 1;  3MPV A;  5HJY A;  2FJD B;  2W7A A;  3W3S A;  2DCU B;  1OY8 A;  1D1U A;  4RLE A;  4C6A A;  4ZN3 A;  4FYX B;  4GMK A;  1EET A;  5H9F J;  5KTQ A;  1LW0 B;  3CPW R;  1T9U A;  4AT1 B;  4P73 A;  3U02 A;  3UPF A;  3H8Y A;  3DOM B;  3U1N A;  2DNG A;  2GA7 A;  4RW9 B;  3T5K A;  3ENA A;  1TL7 A;  3W2V B;  4QW8 A;  1HWJ A;  2HWI A;  4TY9 A;  3QGG A;  3H42 A;  3BBF A;  4ETZ A;  1P8G A;  2IY5 B;  2BQU A;  2KYZ A;  4IRC A;  3UR0 A;  2MQO A;  2YWF A;  2GMJ A;  2KVI A;  2XMT A;  3VGT A;  4ECT A;  1TZ0 A;  4ID8 A;  2ZH7 A;  4BC9 A;  1FX2 A;  3GU0 A;  1ZTW A;  1LW0 A;  3TAM A;  3RR8 A;  3N6N A;  1H38 A;  4ZIT A;  1ELO A;  4RW9 A;  4B08 A;  1T9X A;  3EPG A;  3W5Z A;  3M6U A;  1HD0 A;  1JLQ B;  3W64 A;  2HHU A;  3UDL A;  1KHW A;  2HVZ A;  3KKF A;  2BA9 A;  2W24 A;  3PVX A;  3B78 A;  3NS7 B;  3CJK B;  4X64 J;  2GQC A;  3DYA A;  3G6E S;  3W8P A;  4YME A;  4JI3 F;  4JI1 F;  4ZCM A;  1RUS A;  3CB4 A;  2B56 A;  1Q4R A;  2RU9 A;  1JXL A;  1VIS A;  5IT9 U;  5CD4 H;  3G8S A;  4IH7 A;  3IRX B;  3ILI A;  3HLU A;  4P6Q A;  4USW A;  1RT7 B;  4X4P A;  2P6T A;  4UUX A;  2CJY B;  1JLQ A;  3L95 X;  4FYD A;  2OIH A;  1MRO A;  4WFA Q;  1QTM A;  2J7U A;  4J9N A;  5K9F A;  2UUB J;  3AH6 A;  2MLX A;  4ZPT R;  3MEG B;  1HMV B;  2NZ4 A;  4E2F B;  1ZPV A;  2COL A;  3CJK A;  3MUR P;  3D6F B;  2C22 A;  3ZTO A;  4Y00 A;  1SIW B;  4OX9 F;  3H5S A;  4YR0 A;  1ZZN A;  3MEC B;  3A13 A;  4QZV B;  3C6U B;  3IRX A;  3LP0 B;  4DV2 F;  4PCQ A;  3WX4 A;  3QQC D;  1RT7 A;  1WC5 A;  1KFS A;  5DDP C;  2IC3 B;  2VPZ B;  4YDX A;  3G82 A;  5AJ3 F;  2MQQ A;  2GML A;  3RRG A;  3MEG A;  1HMV A;  4C48 A;  4ECU A;  1F6T A;  3NGD A;  3HJV A;  3OTE A;  1Y5I B;  5B0G A;  1U25 A;  4E8U A;  2CNL B;  3GQC A;  2X3D A;  2EFG A;  2DNP A;  4EFA C;  2VUG A;  3DOK B;  4I69 A;  3MEC A;  5HAN A;  1Q78 A;  2V8D A;  3M1V B;  3C6U A;  1JJC B;  1Q8I A;  4YB5 A;  1ZPW X;  3LP0 A;  3FSX A;  3UFC X;  4CT8 A;  2BMB A;  2Z4P A;  3Q0A A;  3AA8 A;  3KDO A;  3I0R B;  4QWC A;  4WTY A;  2CQ3 A;  5HJX A;  2UUT A;  2F9D A;  2XWX A;  4M5H A;  3CCQ S;  3K7R A;  4DR1 J;  3OR1 B;  4KFB B;  2BRL A;  4JI2 F;  1S0V A;  2DHS A;  1U45 A;  1JLB B;  3D1Q A;  1OYE A;  4WK3 A;  4YR3 A;  3NGS A;  5M2U A;  3OSN A;  5DG8 A;  3RB6 A;  3M1V A;  1GTH A;  3BO2 A;  3DRP B;  4JI4 F;  3OL7 A;  4LUB A;  2WRM A;  2VBZ A;  1GH8 A;  5KFA A;  2B5J B;  1BQM B;  1YWX A;  3A4T A;  5LXR A;  5KOW A;  1RAB B;  1NLK L;  4DPT A;  1RT6 A;  3MMC B;  3DRS B;  3SV4 A;  4BHQ A;  3QT8 A;  3Q8P B;  1CC7 A;  2UUC F;  2AV5 A;  4K7Q A;  1FD2 A;  2LLZ A;  3DCA A;  2PEH A;  4FS1 A;  3E3X A;  1RAH B;  3OTB A;  5A8R B;  4Q43 A;  4TNO A;  5DM6 Q;  5DET A;  2C3O A;  4LR9 A;  3TJ9 A;  1HKA A;  5CZD A;  3HVW A;  4ECR A;  5HI7 A;  3HD2 A;  4RW7 A;  4Y3C A;  1KQG B;  2B5J A;  1QY7 A;  1BQM A;  1U6F A;  1YQH A;  5KFH A;  1S1U B;  3PNI A;  2YWH A;  3MMC A;  2Y1J A;  3DRS A;  3BSC A;  4RWW A;  1VQ9 S;  2E5I A;  4NLR A;  5ETK A;  5DG9 A;  4YB1 P;  1FKO A;  3T6B A;  4ZPD A;  2CQ2 A;  1TTH B;  2ZIT A;  2RD5 C;  1M5P C;  2QG9 B;  3Q2T C;  4GKJ J;  1RTH B;  5A8R A;  4XDD A;  3WIV A;  2E5J A;  3GV7 B;  5F9L A;  1ZAV A;  3BS9 A;  2VB6 A;  2HGN A;  2NUU G;  2B7C B;  3T5H A;  1YX2 A;  1U2R A;  2AHO B;  4B9S A;  3FCV A;  1J5E F;  1S1U A;  2ZH4 A;  2YWG A;  5C24 B;  1V5I B;  1DHM A;  2HHT A;  2HHW A;  4TXS A;  4NRT A;  1NHV A;  4K2J A;  1MML A;  4RNF A;  4FS2 A;  4F0M A;  3AD7 C;  4X4O A;  2ZH1 A;  1C1B A;  2XMW A;  2YTC A;  4L72 B;  2DTJ A;  2YKQ A;  3FUY A;  4LF7 J;  3PIO Q;  4HI2 A;  3C15 A;  4G1P A;  1UAW A;  1N6Q B;  3MPY A;  1JLA A;  2KU7 A;  1R0B G;  1VK8 A;  3CIM A;  2HFZ A;  1FWK A;  1UJ5 A;  2HND A;  1MU2 A;  2QL9 B;  3NOC A;  3CJS A;  4NLO A;  3KYL A;  1VBY A;  1YGY A;  1IBM F;  1B7Y B;  2DIS A;  2NYH A;  4E0D A;  1ZBT A;  4R25 A;  2B7B B;  5AE2 A;  1CJK B;  2F8M A;  1KRP A;  3CCU S;  2E9R X;  3H20 A;  4C0O C;  1N6Q A;  2LA6 A;  3W2W B;  4HVZ A;  4EMD A;  3LAM A;  3N28 A;  4U6P A;  2CWK A;  2E7X A;  4LQ3 A;  1YG0 A;  1RTJ B;  2JVR A;  2K3K A;  2V94 A;  3N79 A;  1UMJ A;  2Z8Q A;  1YJW S;  1R43 A;  1FXD A;  3PX6 A;  3IFE A;  5HVF A;  2RH3 A;  1IR2 A;  5KFW A;  1K73 T;  3KJF B;  2DIT A;  4U8V A;  2W9B B;  4NEZ A;  4FBU A;  4Q7A A;  3DLL Q;  2PII A;  2ZBP A;  2LDI A;  1CJK A;  1HYS B;  2AJ4 A;  1IKX B;  1XQI A;  2WON B;  1KVK A;  4PXD A;  2HNZ B;  2CNO B;  2DRA A;  2H1Y A;  4AD6 A;  1RSC A;  3W2W A;  2AP6 A;  3CO0 P;  3CF5 Q;  2F4V F;  3TR5 A;  4XAK A;  5K8M A;  1S1T A;  1RTJ A;  2D9O A;  1U47 A;  3M9O B;  4AL6 A;  3PAC A;  3AHP A;  1XN9 A;  5KFD A;  1NSP A;  4MKY A;  5JJB A;  3A3N B;  2W8K A;  1O51 A;  1RU1 A;  2W9B A;  1VQS A;  4Q44 A;  1HYS A;  3WDO A;  1R8P A;  1IKX A;  1H73 A;  2J6S A;  2VV5 A;  1XTZ A;  2KYX A;  2HNZ A;  2IM0 A;  4MYT A;  3L4B C;  2LQB A;  4FKX A;  3T41 A;  2VQE J;  1SC4 B;  3R97 A;  3MXH P;  1TMM A;  2EFO A;  2PFF B;  3BH7 B;  1SJR A;  5HN0 A;  3RAX A;  2E44 A;  3T1Y F;  2YKM A;  5KT2 A;  2HQG A;  4USI A;  1WC1 A;  5M2R A;  1XNR J;  5AXN A;  5IC4 B;  3K59 A;  1HI1 A;  1U24 A;  3R5A A;  3ONQ A;  1Y10 A;  2ASY A;  2XYG B;  2KT3 A;  4NXM J;  3EGW B;  1FT8 A;  2R7S A;  3DRR B;  5AE1 A;  1RI7 A;  4LFA J;  3DC2 A;  3D66 A;  4OMF G;  1YJT A;  2G2Y A;  2GNK A;  4DV7 J;  2BKN A;  3ISN C;  3I5A A;  2JRS A;  1N32 J;  4AE5 A;  3V4I B;  4KPY A;  1T0T V;  2F63 A;  3RB0 A;  2W2M P;  3GSI A;  4FPI A;  3FDS A;  1HNV B;  1DQ9 A;  2A6O A;  3MCS A;  2FVC A;  2VC1 A;  2KI2 A;  1RAC B;  4DUY F;  3DLH A;  4CLZ A;  2VIC A;  2VG7 B;  3PFE A;  2MGZ B;  5EDW A;  1SQG A;  3OL9 A;  2AW0 A;  4NYP A;  3TAR A;  4UT4 A;  2MQL A;  1REV A;  2QLB B;  2JJ4 D;  1Q82 T;  2ZKU A;  3TAN A;  3DRR A;  2B3T B;  3M2R B;  4CNZ A;  4URG A;  2QLF B;  1RT3 A;  4FF3 A;  4Q8F A;  2XLI A;  3FQL A;  3TW0 A;  2W25 A;  4GKK J;  2HBY B;  3V4I A;  2UU9 J;  1T8E A;  3MAA B;  5KAK A;  1DTQ B;  3IXQ A;  1K0V A;  3TZZ A;  3BN4 A;  1ROF A;  5D4P A;  3RGI A;  2VG7 A;  4NA1 A;  1MWQ A;  5DZ6 A;  1GXT A;  4KV8 B;  1RHR B;  3BSA A;  3ZZU A;  3HT0 A;  1KSP A;  2IM1 A;  2FGC A;  3M2R A;  2IMO A;  2D1C A;  2EBE A;  3U7J A;  2Y0S D;  5CCL A;  4OQJ A;  4DR2 J;  1N56 A;  1R6V A;  4DHV A;  3KLH B;  3D67 A;  4CO2 A;  2IVF B;  3FEY B;  2IDL A;  2ZM6 F;  5CYM B;  2LEP A;  5JMN A;  1KEK A;  4CM2 A;  2J0S D;  2ROG A;  4B3O B;  1DAX A;  1WF1 A;  3U1M A;  2R8K A;  3LWM A;  2DNY A;  1DTQ A;  3N0V A;  2MZQ A;  3ILJ A;  2MB0 B;  4B9V A;  2NXJ A;  2CQ1 A;  3BV8 A;  3EVO A;  2YNI B;  3SZ2 A;  4KV8 A;  4LMZ A;  3VAI A;  3TZY A;  4OX8 A;  3EGV A;  4Q2L A;  2HFV A;  4I67 A;  5C42 B;  4HH0 A;  3KLF B;  4IO1 A;  3MCM A;  1U8S A;  1QJH A;  5KT4 A;  4IYQ A;  3KLH A;  4GRS A;  2X1B A;  4UF4 A;  3H2L A;  3N6L A;  4Y2K A;  1WC4 A;  5CYM A;  5L1I A;  4USK A;  2A2D A;  3A8I A;  1D9A A;  1RAG B;  4JI5 J;  4OI4 A;  2RRB A;  1VRU A;  3K2Y A;  2YNI A;  2R8G A;  1SJ4 P;  5FLX U;  4EI2 A;  5KFR A;  3EUN A;  5EX0 A;  2DO0 A;  5C42 A;  3FZ2 A;  4OV1 A;  3IR6 B;  3KLF A;  4OX6 A;  5CA5 A;  4P75 A;  3P3D A;  4NYO A;  1FKA F;  2YH0 A;  4UTG A;  4JYA F;  1DQ8 A;  2G1D A;  2R4F A;  2AYG A;  3UDE A;  3IM8 A;  3UI3 A;  4F36 A;  1F0X A;  3TYT A;  5KG3 A;  1VK3 A;  1NME B;  4F2S A;  4PZV A;  3O2I A;  4WTO B;  2HQD A;  4DR5 F;  2R7V A;  3ZZZ A;  1HPZ B;  2YX1 A;  2R7R A;  1N5Q A;  3ULH A;  1IBC B;  2DXF A;  1ARO P;  2L48 A;  2ZUG A;  3D6M B;  4G1Q B;  3ZO7 A;  4WP3 A;  1N5S A;  1KLM A;  3OXL A;  4ZVR B;  4X65 J;  2ZWO A;  2OP5 A;  2GAG C;  5CAA A;  1RCO B;  5F8L A;  1NDL A;  2DO4 A;  5KFE A;  1G4C A;  1ACM B;  3LPY A;  3PYF A;  2FQQ B;  3QAT A;  3KNA A;  1D09 B;  4DUZ F;  1SCJ B;  1NKB A;  4MK8 A;  4CP5 A;  3K5N A;  1FDB A;  4NRU A;  2POK A;  3CJQ A;  3NL0 A;  1SKW A;  3R3T A;  4MYU A;  1IM6 A;  5E3Q A;  2DJW A;  2VDI A;  4R5P A;  1HPZ A;  2ASJ A;  5KT3 A;  3TX0 A;  4A8Q A;  2OFG X;  3TJA A;  4G1Q A;  2XHW A;  3WX8 A;  2QIF A;  4K4U A;  3GIK A;  2ZHB A;  1UA1 A;  1FXL A;  4LBP A;  1Y3J A;  4I6Y A;  3BKU A;  2ZH6 A;  4B9L A;  1CQM A;  2OAU A;  2NZC A;  4W98 A;  4NZ7 A;  2XWY A;  5D0R A;  2Y1R I;  2UUA F;  5EWE A;  2HS3 A;  5IFM A;  4QCL A;  3KHL A;  1MW7 A;  1FFW B;  2K7K A;  4Z7Y A;  1T9T A;  4OJG A;  2DGW A;  3ENQ A;  3KJQ B;  4DV4 F;  3OXF A;  3TVY A;  1SBR A;  2CJA A;  1SJ3 P;  4ZVS B;  5A2Q U;  1LKZ A;  2OD4 A;  4NLD A;  2M4M A;  2VPW B;  3IBF B;  2B4V A;  5KFU A;  4C9D A;  1RA7 A;  3M8P B;  3AJD A;  3H5U A;  4IH5 A;  4A46 A;  9RUB A;  3I96 A;  4M8L A;  1SJQ A;  2M5Y A;  3PYG A;  3F44 A;  3I87 A;  4Y2I A;  4QWB A;  1RKI A;  2FB0 A;  4ID5 B;  3HHE A;  4TY8 A;  4PG4 A;  1Y00 A;  1U4B A;  5E33 A;  1YDL A;  3ILL A;  2O67 A;  1RTI B;  4USV A;  2CQI A;  2AWZ A;  4J37 A;  1UVK A;  4OYB A;  3KFW X;  3I5C A;  1RP5 A;  1U09 A;  5E3R A;  2B6A A;  5IM0 B;  3M8P A;  2XLJ A;  2Z58 B;  2VKR A;  5C5J A;  1RWM B;  2CXE A;  3TAQ A;  2WVD A;  3M30 B;  1WOR A;  3MUV P;  1KWM A;  3HCX A;  4ID5 A;  1X4H A;  1WKL A;  1S7H A;  5HAT A;  5HAO A;  1V3Z A;  4KH1 B;  1S49 A;  3NCR A;  3RG6 A;  2H5I B;  5D4N A;  1RB0 A;  2VFR A;  1H7W A;  2DHH A;  3GB0 A;  1HQ2 A;  2IRU A;  2J7K A;  3M30 A;  2EFV A;  2KG0 A;  5SZT A;  3ET6 B;  2H65 B;  4TKT A;  4DX8 H;  1S72 S;  4TVA B;  2VG5 A;  2I1R A;  4YY3 F;  4OL8 A;  1LWF B;  3AXK A;  3LP1 B;  1VQP S;  1D0E A;  4QW9 A;  2KXH A;  3BDE A;  2FHM A;  2NLW A;  2OFH X;  3CJ0 A;  2GIQ A;  1K47 A;  3PJX A;  3BRE A;  4ZHR A;  4CLP A;  3CD5 A;  2AF6 A;  3ICL A;  4DV2 J;  2MTL A;  4YN3 B;  2WOM B;  2KFZ A;  2OSQ A;  5H9E K;  4Y28 C;  1HA1 A;  3L7U A;  1IVZ A;  2UVV A;  1Q7Y T;  3ET6 A;  2MDA A;  2BOA A;  5AJ3 J;  5J1P A;  4WPA A;  1LWF A;  3LP1 A;  4N56 A;  4JV2 A;  4UY8 T;  4Y0F A;  4Y65 A;  2MXY A;  1SUQ B;  2LU1 A;  4K0K F;  2MKK A;  2ALZ A;  1PYO B;  2ZZT A;  3MOZ A;  1N36 J;  2Q1L A;  2YWK A;  2X7I A;  3ISZ A;  1RLC L;  1FE0 A;  3FCH A;  3CD6 S;  2C3M A;  2AJ0 A;  1IR0 A;  3KOA A;  3A8E A;  1Q8L A;  2XLK A;  3HD1 A;  4WII A;  2XYH B;  3N4W A;  4NEY A;  1WKK A;  4CO3 A;  3DLK B;  2LCW A;  5HL7 Q;  1M5K C;  2ROP A;  1NO8 A;  5ETP A;  5GAD I;  3LWL A;  5IQQ A;  4PQA A;  1Q81 T;  5HLF A;  1ZM9 A;  4ED8 A;  4U7C A;  1VJW A;  2X51 A;  2F3J A;  1WEL A;  3I0S A;  1TFW A;  4RNO A;  3GIR A;  3NOG A;  2R9L A;  3PHT A;  3PDN A;  3NGT A;  4JI4 J;  2P9E A;  1X60 A;  2M52 A;  3KHG A;  3ZZT A;  2KXN B;  2AKW B;  1UEK A;  4OHW A;  5DQI A;  4CI0 B;  3OTD A;  4MMO A;  1ZYQ A;  4RNH A;  3M32 B;  3FRY A;  1JLF A;  4DL2 A;  2EK1 A;  2AYE A;  1HR0 F;  2GZO A;  2JHE A;  1HBO A;  3RB3 A;  3CCT A;  5D0G A;  2UUC J;  2LDY A;  1AYE A;  4B3S F;  3MZI A;  3UVJ B;  1WHW A;  4H4M B;  2E5H A;  4WFY A;  2U1A A;  1QSL A;  2AIR B;  2KH9 A;  2JFK A;  1NHU A;  4NCG B;  3MFH A;  1VCT A;  3LF0 A;  1T05 B;  2DXD A;  3AJ1 A;  2KDO A;  2AGO A;  4LVO P;  3DMJ B;  4A8W A;  3PEH A;  5I3U B;  5BXI A;  2DNR A;  1RGV A;  4ANE A;  1ZH5 A;  3K17 A;  4PYD A;  1S7I A;  5KFB A;  3M32 A;  3QRR A;  4O23 A;  5T41 A;  5L8R C;  2I38 A;  4ALZ A;  3EZU A;  1U8W A;  4ZPA A;  4ILR A;  5HP1 B;  1ZTT A;  5DRK A;  3AAW B;  2CAJ A;  4Q45 A;  1R0C B;  4RWX A;  2FJE B;  2WVB A;  2QGF B;  1HNW J;  4LT6 A;  1R8C A;  2ZFH A;  2HBQ B;  4H4M A;  5ETM A;  4IFY A;  1HW9 A;  3EGZ A;  3HFZ B;  2RHQ B;  4KKO B;  5AXM A;  3MM9 B;  1T05 A;  1CPZ A;  2PFD A;  1GMU A;  4LFC J;  2HS0 A;  1U1O A;  3DMJ A;  4N47 A;  3Q22 A;  1J5E J;  2MKC A;  1PSD A;  3QAU A;  1CJU A;  1ZM3 A;  4FPR A;  5HP1 A;  2JEF A;  1F1B B;  3NGK A;  3M8Q A;  5IXU A;  2CVI A;  2JOQ A;  2XY7 A;  4HT5 A;  2ZVS A;  5CZV A;  3TNV A;  4J5O A;  1X0F A;  4CZC A;  4X64 F;  3TRG A;  3QWP A;  1JMT A;  1RWX B;  1T11 A;  4KKO A;  4IFV B;  3MM9 A;  2O3D A;  2VOP A;  2KT5 A;  3UN5 A;  4NLQ A;  3M8S A;  3HJF A;  2C3P A;  2X1G A;  3QBC A;  3LW5 C;  2FJX A;  4OZ5 A;  4OZL A;  1IBM J;  1BQX A;  1CSJ A;  5ETO A;  2PT0 A;  5THW A;  4YR2 A;  2FUG 9;  3J81 Y;  4OYA A;  2GHV C;  3Q8R B;  1MN9 A;  1YK9 A;  3FSI A;  2QMU B;  1HIY A;  1U2F A;  4IFV A;  5J1N A;  2Y3Y A;  2J76 E;  4L75 A;  4LF8 J;  3W8G A;  3SFU A;  3ZTR A;  3QWU A;  4DSK A;  7AT1 B;  5DDR C;  3HK2 A;  1ITP A;  1LEO A;  4QYZ J;  3G6X A;  4PPD A;  3PY8 A;  1FD8 A;  3V5R A;  3HFV A;  2DKO B;  2FJV A;  4N7T A;  1TFY A;  4B9N A;  4L73 A;  2UXD J;  4OX7 A;  1LQ9 A;  4CLW A;  1OY6 A;  2G2O A;  2YNF B;  3NNH A;  1ZZF A;  4J9V A;  1A9N B;  2BJ7 A;  4U95 A;  2F4V J;  3TZX A;  3D2W A;  1X9S A;  1UWB B;  3EZ5 A;  3VGS A;  3E2E A;  1LWE B;  3CCJ S;  5F9N A;  4P9S A;  2XZW A;  2DRB A;  1RWN B;  1VRT B;  1VQN S;  4X2B A;  3EE3 A;  1JJH A;  1UJ4 A;  2JNJ A;  4CRJ A;  3THT A;  2DEJ A;  4ZMM A;  2V5H G;  2PMH A;  1DQA A;  3FBC A;  5D78 A;  4J9M A;  1FXR A;  3PFO A;  1PC4 A;  5ETT A;  2XNR A;  3D28 A;  5GAE I;  4FBT A;  2KN4 A;  3FFI B;  3R7S B;  2E7V A;  3R7B B;  3VAL A;  2AZ1 A;  1W7W A;  3CO9 A;  2QC3 A;  1UWB A;  3SCI E;  1M1G A;  1MSW D;  3J7A N;  1LWE A;  3HHD A;  3H90 A;  2HS4 A;  3T1Y J;  1VRT A;  2BAN B;  3N9U C;  1D3W A;  1TL1 A;  5J2M A;  2WTF A;  3UCZ P;  3IC1 A;  2YH1 A;  4N41 A;  1I6J A;  2N7Y A;  3JSY A;  4N8N A;  1S1W B;  3HT3 A;  2QMX A;  2GS8 A;  2HQC A;  3FFI A;  4NCB A;  1QUV A;  3IBW A;  3ZZY A;  3ZTQ A;  4I6A A;  2V4R A;  3S01 A;  4ZPV R;  1V3S A;  1XIQ A;  3DLE B;  3GYN A;  1QAX A;  1B0V A;  1WF2 A;  5LT5 A;  2OUG A;  4S0M A;  3G6Y A;  5LMU J;  2BAN A;  3CIZ A;  4J9L A;  1SQF A;  4NLW A;  1B0P A;  4NOH A;  2B51 A;  5HRO B;  2DR8 A;  3R5G A;  5EX3 A;  3ZFV A;  1DY3 A;  3KK3 B;  4Q2M A;  4MFB B;  5F8H A;  1X5P A;  2B4P A;  2EG1 A;  5CQG A;  5HQ8 A;  1SV5 B;  1R89 A;  3HX9 A;  1S1W A;  4QOT A;  4DL7 A;  4DN9 A;  4URS A;  2D3U A;  4ECS A;  2VBW A;  3IS9 B;  3QID A;  1SB6 A;  1D8Y A;  2G2Z A;  3RBZ A;  3CJR A;  1SJF A;  4DSJ A;  2OEM A;  5DG7 A;  2GQQ A;  4JI7 F;  2KJW A;  2YQ3 A;  4UOH A;  1CG2 A;  4GKJ F;  3TJ8 A;  1HBM A;  3DLE A;  4L74 A;  5EGY A;  3PRD A;  3GSD A;  1ZAW A;  3HZE A;  2XTJ P;  3DOL B;  1WWH A;  2Q79 A;  2EFQ A;  3KLI B;  4F25 A;  2BV3 A;  3DKD A;  3OXG A;  5HRO A;  2FY8 A;  3U1L A;  2NCK L;  4QU7 A;  1Y9O A;  3POT B;  2MZR A;  2HRU A;  1B99 A;  1SV5 A;  3D3B J;  3F0N A;  3K8W A;  3IS9 A;  3IAS 9;  4DCP B;  3HVT B;  3W9H A;  5KFJ A;  3AB2 B;  2ZJQ Q;  3NY0 A;  3ZZ0 A;  3CE8 A;  3WC2 A;  4Y2C A;  4F50 A;  1ZM4 A;  1YRX A;  3UCU P;  2HHQ A;  2F40 A;  3IG1 B;  1L3V A;  2GC8 A;  4TQR A;  3DOL A;  4NI2 B;  2L9W A;  3G4S S;  2MY8 A;  3KLI A;  2YWE A;  3SEO A;  1MG7 A;  5D3G B;  4WF9 Q;  3F56 A;  2QFJ A;  1FK9 B;  2QSF A;  4HAC B;  2DNQ A;  4MIA A;  4RW4 B;  4IO9 Q;  3T3F A;  2GFF A;  4O3O A;  4GVB A;  1R8H A;  1KQF B;  2G0J A;  3POT A;  4ECQ A;  4IOB A;  2G1H A;  4ES3 A;  1F3F A;  3TOQ A;  5J2Q A;  1N52 B;  2DRD A;  3HVT A;  2F8H A;  3QT6 A;  2AJF E;  4HKQ A;  1UFL A;  1BQN B;  2QL5 B;  2WB1 D;  3ZZP A;  1Q8K A;  3R5D A;  1C0T B;  3IG1 A;  3C2P A;  3I82 A;  4NI2 A;  2EI5 A;  4DR7 J;  5D3G A;  2IBO A;  4CH1 A;  4CLK A;  1FK9 A;  4LQ9 A;  2HKE A;  4HAC A;  4RW4 A;  5B7W A;  1Y4Z B;  3CDU A;  1WDT A;  3GIL A;  1RJJ A;  2CNK B;  3N01 A;  5AXL A;  2KM8 C;  3H5X A;  3HSZ A;  4K4V A;  3OW2 R; 
#chains in the Genus database with same CATH homology
 4RL1 A;  3IM8 A;  1NM2 A;  3TZZ A;  3H0P A;  2JFK A;  3TQE A;  3EZO A;  3G87 A;  2JFD A;  2QO3 A;  3IM9 A;  2G1H A;  3TZY A;  5CZD A;  2VKZ G;  2VZ8 A;  1MLA A;  3QAT A;  2QC3 A;  3HMJ G;  2G2O A;  2CUY A;  3HJV A;  3RGI A;  5DZ7 A;  2H1Y A;  2G2Y A;  3R97 A;  3TZW A;  3CJ8 A;  2HG4 A;  2C2N A;  5DZ6 A;  2VZ9 A;  3BV8 A;  2PFF B;  2UV8 G;  3HHD A;  4QBU A;  3K89 A;  5CZC A;  2G2Z A;  4RR5 A;  3TZX A;  3SBM A;  3R8Y A;  3PTW A;  2QJ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...