3EZQB

Crystal structure of the fas/fadd death domain complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
GEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fas-FADD death domain complex structure unravels signalling by receptor clustering
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 6
total genus 36
structure length 99
sequence length 99
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3ezqB00
4O6XA 2DO9A 2O71A 4F44A 3YGSC 1A1WA 2LS7A 1DGNA 3CL3A 2BBRA 4IZ7B 1CWWA 4P4HA 4QOBA 2HM2Q 2D96A 4A2WA 3KATA 2N1FA 2BBZA 3MOPK 1NGRA 1WMGA 3T6PA 1WXPA 1A1ZA 4N1LA 2N97A 2DBDA 2YQFA 2MPCA 2MN4A 1E3YA 2IB1A 2DBGA 2LWDA 4ZBWA 2KM6A 2YU0A 4A2QA 4UZ0A 2P1HA 3EZQA 3EZQB 2DBFA 4IZ5E 4I16A 2NAQA 2G7RA 4M9SA 4NQKA 1D2ZA 1D2ZB 2MS7A 2L9MA 3YGSP 1N3KA 2N80A 2VGQA 2N7ZA 1UCPA 3J63A 2A5YB 2B1WA 1PN5A 4DWNA 1DDFA 4O7QA 1WH4A 2L6AA 3LQQA 2NSNA 4E9MA 3MOPA 2NZ7A 2LWEA 4JUPA 4O9FA 3LQRA 4P4HI 2YGSA 1FADA 2DBHA 4EWIA 2A9IA 2M5VA 3J6JA 2OF5A 2MB9A 4LWDA 4O9LA 4M9ZA 4JQWA 1Z6TA 1YGOA 4N1KA 1E41A 4FH0A 3QF2A 1C15A 1ICHA 2KN6A 4F42A 3MOPG 1CY5A 2GF5A 2OF5H 4RHWE 4D8OA 4RHWA 2YVIA 4M9XA 2F1SA 2N83A 4IZAB 2MS8A 3CRDA 4N1JA 2N00A
chains in the Genus database with same CATH superfamily
4O6XA 2DO9A 2O71A 4F44A 3YGSC 1A1WA 2LS7A 1DGNA 3CL3A 2BBRA 4IZ7B 1CWWA 4P4HA 4QOBA 2HM2Q 2D96A 4A2WA 3KATA 2N1FA 2BBZA 3MOPK 1NGRA 1WMGA 3T6PA 1WXPA 1A1ZA 4N1LA 2N97A 2DBDA 2YQFA 2MPCA 2MN4A 1E3YA 2IB1A 2DBGA 2LWDA 4ZBWA 2KM6A 2YU0A 4A2QA 4UZ0A 2P1HA 3EZQA 3EZQB 2DBFA 4IZ5E 2XV9A 4I16A 2NAQA 2G7RA 4M9SA 4NQKA 1D2ZA 1D2ZB 2MS7A 2L9MA 3YGSP 2MJMA 1N3KA 2N80A 2VGQA 2N7ZA 1UCPA 3J63A 2A5YB 2B1WA 1PN5A 4DWNA 1DDFA 4O7QA 1WH4A 2L6AA 3LQQA 2NSNA 4E9MA 3MOPA 2NZ7A 2LWEA 4JUPA 4O9FA 3LQRA 4P4HI 2YGSA 1FADA 2DBHA 4EWIA 2A9IA 2M5VA 3J6JA 2OF5A 2MB9A 4LWDA 4O9LA 4M9ZA 4JQWA 1Z6TA 1YGOA 4N1KA 1E41A 4FH0A 3QF2A 1C15A 1ICHA 2KN6A 4F42A 3MOPG 1CY5A 2GF5A 2OF5H 4RHWE 4D8OA 4RHWA 2YVIA 4M9XA 2F1SA 2N83A 4IZAB 2MS8A 3CRDA 4N1JA 2N00A
chains in the Genus database with same CATH topology
4O6XA 2DO9A 2O71A 4F44A 3YGSC 1A1WA 2LS7A 1DGNA 3CL3A 2BBRA 4IZ7B 1CWWA 4P4HA 4QOBA 2HM2Q 2D96A 4A2WA 3KATA 2N1FA 2BBZA 3MOPK 1NGRA 1WMGA 3T6PA 1WXPA 1A1ZA 4N1LA 2N97A 2DBDA 2YQFA 2MPCA 2MN4A 1E3YA 2IB1A 2DBGA 2LWDA 4ZBWA 2KM6A 2YU0A 4A2QA 4UZ0A 2P1HA 3EZQA 3EZQB 2DBFA 4IZ5E 2XV9A 4I16A 2NAQA 2G7RA 4M9SA 4NQKA 1D2ZA 1D2ZB 2MS7A 2L9MA 3YGSP 2MJMA 1N3KA 2N80A 2VGQA 2N7ZA 1UCPA 3J63A 2A5YB 2B1WA 1PN5A 4DWNA 1DDFA 4O7QA 1WH4A 2L6AA 3LQQA 2NSNA 4E9MA 3MOPA 2NZ7A 2LWEA 4JUPA 4O9FA 3LQRA 4P4HI 2YGSA 1FADA 2DBHA 4EWIA 2A9IA 2M5VA 3J6JA 2OF5A 2MB9A 4LWDA 4O9LA 4M9ZA 4JQWA 1Z6TA 1YGOA 4N1KA 1E41A 4FH0A 3QF2A 1C15A 1ICHA 2KN6A 4F42A 3MOPG 1CY5A 2GF5A 2OF5H 4RHWE 4D8OA 4RHWA 2YVIA 4M9XA 2F1SA 2N83A 4IZAB 2MS8A 3CRDA 4N1JA 2N00A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O6X A;  2DO9 A;  2O71 A;  4F44 A;  3YGS C;  1A1W A;  2LS7 A;  1DGN A;  3CL3 A;  2BBR A;  4IZ7 B;  1CWW A;  4P4H A;  4QOB A;  2HM2 Q;  2D96 A;  4A2W A;  3KAT A;  2N1F A;  2BBZ A;  3MOP K;  1NGR A;  1WMG A;  3T6P A;  1WXP A;  1A1Z A;  4N1L A;  2N97 A;  2DBD A;  2YQF A;  2MPC A;  2MN4 A;  1E3Y A;  2IB1 A;  2DBG A;  2LWD A;  4ZBW A;  2KM6 A;  2YU0 A;  4A2Q A;  4UZ0 A;  2P1H A;  3EZQ A;  3EZQ B;  2DBF A;  4IZ5 E;  4I16 A;  2NAQ A;  2G7R A;  4M9S A;  4NQK A;  1D2Z A;  1D2Z B;  2MS7 A;  2L9M A;  3YGS P;  1N3K A;  2N80 A;  2VGQ A;  2N7Z A;  1UCP A;  3J63 A;  2A5Y B;  2B1W A;  1PN5 A;  4DWN A;  1DDF A;  4O7Q A;  1WH4 A;  2L6A A;  3LQQ A;  2NSN A;  4E9M A;  3MOP A;  2NZ7 A;  2LWE A;  4JUP A;  4O9F A;  3LQR A;  4P4H I;  2YGS A;  1FAD A;  2DBH A;  4EWI A;  2A9I A;  2M5V A;  3J6J A;  2OF5 A;  2MB9 A;  4LWD A;  4O9L A;  4M9Z A;  4JQW A;  1Z6T A;  1YGO A;  4N1K A;  1E41 A;  4FH0 A;  3QF2 A;  1C15 A;  1ICH A;  2KN6 A;  4F42 A;  3MOP G;  1CY5 A;  2GF5 A;  2OF5 H;  4RHW E;  4D8O A;  4RHW A;  2YVI A;  4M9X A;  2F1S A;  2N83 A;  4IZA B;  2MS8 A;  3CRD A;  4N1J A;  2N00 A; 
#chains in the Genus database with same CATH topology
 4O6X A;  2DO9 A;  2O71 A;  4F44 A;  3YGS C;  1A1W A;  2LS7 A;  1DGN A;  3CL3 A;  2BBR A;  4IZ7 B;  1CWW A;  4P4H A;  4QOB A;  2HM2 Q;  2D96 A;  4A2W A;  3KAT A;  2N1F A;  2BBZ A;  3MOP K;  1NGR A;  1WMG A;  3T6P A;  1WXP A;  1A1Z A;  4N1L A;  2N97 A;  2DBD A;  2YQF A;  2MPC A;  2MN4 A;  1E3Y A;  2IB1 A;  2DBG A;  2LWD A;  4ZBW A;  2KM6 A;  2YU0 A;  4A2Q A;  4UZ0 A;  2P1H A;  3EZQ A;  3EZQ B;  2DBF A;  4IZ5 E;  2XV9 A;  4I16 A;  2NAQ A;  2G7R A;  4M9S A;  4NQK A;  1D2Z A;  1D2Z B;  2MS7 A;  2L9M A;  3YGS P;  2MJM A;  1N3K A;  2N80 A;  2VGQ A;  2N7Z A;  1UCP A;  3J63 A;  2A5Y B;  2B1W A;  1PN5 A;  4DWN A;  1DDF A;  4O7Q A;  1WH4 A;  2L6A A;  3LQQ A;  2NSN A;  4E9M A;  3MOP A;  2NZ7 A;  2LWE A;  4JUP A;  4O9F A;  3LQR A;  4P4H I;  2YGS A;  1FAD A;  2DBH A;  4EWI A;  2A9I A;  2M5V A;  3J6J A;  2OF5 A;  2MB9 A;  4LWD A;  4O9L A;  4M9Z A;  4JQW A;  1Z6T A;  1YGO A;  4N1K A;  1E41 A;  4FH0 A;  3QF2 A;  1C15 A;  1ICH A;  2KN6 A;  4F42 A;  3MOP G;  1CY5 A;  2GF5 A;  2OF5 H;  4RHW E;  4D8O A;  4RHW A;  2YVI A;  4M9X A;  2F1S A;  2N83 A;  4IZA B;  2MS8 A;  3CRD A;  4N1J A;  2N00 A; 
#chains in the Genus database with same CATH homology
 4O6X A;  2DO9 A;  2O71 A;  4F44 A;  3YGS C;  1A1W A;  2LS7 A;  1DGN A;  3CL3 A;  2BBR A;  4IZ7 B;  1CWW A;  4P4H A;  4QOB A;  2HM2 Q;  2D96 A;  4A2W A;  3KAT A;  2N1F A;  2BBZ A;  3MOP K;  1NGR A;  1WMG A;  3T6P A;  1WXP A;  1A1Z A;  4N1L A;  2N97 A;  2DBD A;  2YQF A;  2MPC A;  2MN4 A;  1E3Y A;  2IB1 A;  2DBG A;  2LWD A;  4ZBW A;  2KM6 A;  2YU0 A;  4A2Q A;  4UZ0 A;  2P1H A;  3EZQ A;  3EZQ B;  2DBF A;  4IZ5 E;  2XV9 A;  4I16 A;  2NAQ A;  2G7R A;  4M9S A;  4NQK A;  1D2Z A;  1D2Z B;  2MS7 A;  2L9M A;  3YGS P;  2MJM A;  1N3K A;  2N80 A;  2VGQ A;  2N7Z A;  1UCP A;  3J63 A;  2A5Y B;  2B1W A;  1PN5 A;  4DWN A;  1DDF A;  4O7Q A;  1WH4 A;  2L6A A;  3LQQ A;  2NSN A;  4E9M A;  3MOP A;  2NZ7 A;  2LWE A;  4JUP A;  4O9F A;  3LQR A;  4P4H I;  2YGS A;  1FAD A;  2DBH A;  4EWI A;  2A9I A;  2M5V A;  3J6J A;  2OF5 A;  2MB9 A;  4LWD A;  4O9L A;  4M9Z A;  4JQW A;  1Z6T A;  1YGO A;  4N1K A;  1E41 A;  4FH0 A;  3QF2 A;  1C15 A;  1ICH A;  2KN6 A;  4F42 A;  3MOP G;  1CY5 A;  2GF5 A;  2OF5 H;  4RHW E;  4D8O A;  4RHW A;  2YVI A;  4M9X A;  2F1S A;  2N83 A;  4IZA B;  2MS8 A;  3CRD A;  4N1J A;  2N00 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...