3EZQB

Crystal structure of the fas/fadd death domain complex
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
99
structure length
99
Chain Sequence
GEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRSCQMNLVADLVQEVQQARDLQNRSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Fas-FADD death domain complex structure unravels signalling by receptor clustering
pubmed doi rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Tumor necrosis factor receptor superfamily member 6
total genus 36
structure length 99
sequence length 99
chains with identical sequence D, F, H, J, L, N, P
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00531 Death Death domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.533.10 Mainly Alpha Orthogonal Bundle Death Domain, Fas Death Domain, Fas 3ezqB00
4N1KA 1UCPA 2NAQA 3T6PA 2KM6A 4F44A 3KATA 4O9LA 4M9ZA 1NGRA 2YGSA 2A9IA 4A2QA 2LS7A 4O6XA 4M9XA 2DBFA 4JUPA 4IZ5E 4RHWE 4O9FA 2OF5A 2YU0A 4IZAB 1CWWA 1FADA 3J6JA 1ICHA 3LQRA 2DBGA 2VGQA 2MS7A 1C15A 2MB9A 1D2ZB 2MN4A 2LWEA 2N83A 3MOPA 4QOBA 2F1SA 1WMGA 2N00A 4M9SA 2M5VA 1DDFA 2N1FA 4P4HA 3MOPG 4IZ7B 4F42A 2L6AA 2P1HA 1A1ZA 2B1WA 1WH4A 2GF5A 3YGSC 2YVIA 3EZQA 1E3YA 2IB1A 1E41A 2BBRA 2DBDA 3EZQB 4EWIA 1YGOA 2G7RA 4I16A 4FH0A 2YQFA 3LQQA 2NZ7A 2O71A 4NQKA 4LWDA 4UZ0A 2MS8A 1PN5A 2OF5H 2N7ZA 4DWNA 3QF2A 3CRDA 2A5YB 3MOPK 2NSNA 2HM2Q 2L9MA 4ZBWA 1N3KA 2KN6A 3J63A 2DO9A 1DGNA 2N97A 2DBHA 1WXPA 4P4HI 1A1WA 2MPCA 3CL3A 2LWDA 2BBZA 4N1LA 1Z6TA 4JQWA 2D96A 4N1JA 4D8OA 4RHWA 1D2ZA 4O7QA 2N80A 3YGSP 1CY5A 4E9MA 4A2WA
chains in the Genus database with same CATH superfamily
4N1KA 1UCPA 2NAQA 3T6PA 2KM6A 4F44A 3KATA 4O9LA 4M9ZA 1NGRA 2YGSA 2A9IA 4A2QA 2LS7A 4O6XA 4M9XA 2DBFA 4JUPA 4IZ5E 4RHWE 4O9FA 2OF5A 2YU0A 4IZAB 1CWWA 1FADA 3J6JA 1ICHA 3LQRA 2DBGA 2VGQA 2MS7A 1C15A 2MB9A 1D2ZB 2MN4A 2LWEA 2N83A 3MOPA 4QOBA 2F1SA 1WMGA 2N00A 4M9SA 2M5VA 1DDFA 2N1FA 4P4HA 3MOPG 4IZ7B 4F42A 2L6AA 2P1HA 1A1ZA 2B1WA 1WH4A 2GF5A 2XV9A 3YGSC 2YVIA 3EZQA 1E3YA 2IB1A 1E41A 2BBRA 2DBDA 3EZQB 4EWIA 1YGOA 2G7RA 4I16A 4FH0A 2YQFA 3LQQA 2NZ7A 2O71A 4NQKA 4LWDA 4UZ0A 2MS8A 1PN5A 2OF5H 2N7ZA 4DWNA 3QF2A 3CRDA 2A5YB 3MOPK 2NSNA 2HM2Q 2L9MA 4ZBWA 1N3KA 2KN6A 3J63A 2DO9A 1DGNA 2N97A 2DBHA 1WXPA 4P4HI 1A1WA 2MPCA 3CL3A 2LWDA 2BBZA 4N1LA 1Z6TA 4JQWA 2MJMA 2D96A 4N1JA 4D8OA 4RHWA 1D2ZA 4O7QA 2N80A 3YGSP 1CY5A 4E9MA 4A2WA
chains in the Genus database with same CATH topology
4N1KA 1UCPA 2NAQA 3T6PA 2KM6A 4F44A 3KATA 4O9LA 4M9ZA 1NGRA 2YGSA 2A9IA 4A2QA 2LS7A 4O6XA 4M9XA 2DBFA 4JUPA 4IZ5E 4RHWE 4O9FA 2OF5A 2YU0A 4IZAB 1CWWA 1FADA 3J6JA 1ICHA 3LQRA 2DBGA 2VGQA 2MS7A 1C15A 2MB9A 1D2ZB 2MN4A 2LWEA 2N83A 3MOPA 4QOBA 2F1SA 1WMGA 2N00A 4M9SA 2M5VA 1DDFA 2N1FA 4P4HA 3MOPG 4IZ7B 4F42A 2L6AA 2P1HA 1A1ZA 2B1WA 1WH4A 2GF5A 2XV9A 3YGSC 2YVIA 3EZQA 1E3YA 2IB1A 1E41A 2BBRA 2DBDA 3EZQB 4EWIA 1YGOA 2G7RA 4I16A 4FH0A 2YQFA 3LQQA 2NZ7A 2O71A 4NQKA 4LWDA 4UZ0A 2MS8A 1PN5A 2OF5H 2N7ZA 4DWNA 3QF2A 3CRDA 2A5YB 3MOPK 2NSNA 2HM2Q 2L9MA 4ZBWA 1N3KA 2KN6A 3J63A 2DO9A 1DGNA 2N97A 2DBHA 1WXPA 4P4HI 1A1WA 2MPCA 3CL3A 2LWDA 2BBZA 4N1LA 1Z6TA 4JQWA 2MJMA 2D96A 4N1JA 4D8OA 4RHWA 1D2ZA 4O7QA 2N80A 3YGSP 1CY5A 4E9MA 4A2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N1K A;  1UCP A;  2NAQ A;  3T6P A;  2KM6 A;  4F44 A;  3KAT A;  4O9L A;  4M9Z A;  1NGR A;  2YGS A;  2A9I A;  4A2Q A;  2LS7 A;  4O6X A;  4M9X A;  2DBF A;  4JUP A;  4IZ5 E;  4RHW E;  4O9F A;  2OF5 A;  2YU0 A;  4IZA B;  1CWW A;  1FAD A;  3J6J A;  1ICH A;  3LQR A;  2DBG A;  2VGQ A;  2MS7 A;  1C15 A;  2MB9 A;  1D2Z B;  2MN4 A;  2LWE A;  2N83 A;  3MOP A;  4QOB A;  2F1S A;  1WMG A;  2N00 A;  4M9S A;  2M5V A;  1DDF A;  2N1F A;  4P4H A;  3MOP G;  4IZ7 B;  4F42 A;  2L6A A;  2P1H A;  1A1Z A;  2B1W A;  1WH4 A;  2GF5 A;  3YGS C;  2YVI A;  3EZQ A;  1E3Y A;  2IB1 A;  1E41 A;  2BBR A;  2DBD A;  3EZQ B;  4EWI A;  1YGO A;  2G7R A;  4I16 A;  4FH0 A;  2YQF A;  3LQQ A;  2NZ7 A;  2O71 A;  4NQK A;  4LWD A;  4UZ0 A;  2MS8 A;  1PN5 A;  2OF5 H;  2N7Z A;  4DWN A;  3QF2 A;  3CRD A;  2A5Y B;  3MOP K;  2NSN A;  2HM2 Q;  2L9M A;  4ZBW A;  1N3K A;  2KN6 A;  3J63 A;  2DO9 A;  1DGN A;  2N97 A;  2DBH A;  1WXP A;  4P4H I;  1A1W A;  2MPC A;  3CL3 A;  2LWD A;  2BBZ A;  4N1L A;  1Z6T A;  4JQW A;  2D96 A;  4N1J A;  4D8O A;  4RHW A;  1D2Z A;  4O7Q A;  2N80 A;  3YGS P;  1CY5 A;  4E9M A;  4A2W A; 
#chains in the Genus database with same CATH topology
 4N1K A;  1UCP A;  2NAQ A;  3T6P A;  2KM6 A;  4F44 A;  3KAT A;  4O9L A;  4M9Z A;  1NGR A;  2YGS A;  2A9I A;  4A2Q A;  2LS7 A;  4O6X A;  4M9X A;  2DBF A;  4JUP A;  4IZ5 E;  4RHW E;  4O9F A;  2OF5 A;  2YU0 A;  4IZA B;  1CWW A;  1FAD A;  3J6J A;  1ICH A;  3LQR A;  2DBG A;  2VGQ A;  2MS7 A;  1C15 A;  2MB9 A;  1D2Z B;  2MN4 A;  2LWE A;  2N83 A;  3MOP A;  4QOB A;  2F1S A;  1WMG A;  2N00 A;  4M9S A;  2M5V A;  1DDF A;  2N1F A;  4P4H A;  3MOP G;  4IZ7 B;  4F42 A;  2L6A A;  2P1H A;  1A1Z A;  2B1W A;  1WH4 A;  2GF5 A;  2XV9 A;  3YGS C;  2YVI A;  3EZQ A;  1E3Y A;  2IB1 A;  1E41 A;  2BBR A;  2DBD A;  3EZQ B;  4EWI A;  1YGO A;  2G7R A;  4I16 A;  4FH0 A;  2YQF A;  3LQQ A;  2NZ7 A;  2O71 A;  4NQK A;  4LWD A;  4UZ0 A;  2MS8 A;  1PN5 A;  2OF5 H;  2N7Z A;  4DWN A;  3QF2 A;  3CRD A;  2A5Y B;  3MOP K;  2NSN A;  2HM2 Q;  2L9M A;  4ZBW A;  1N3K A;  2KN6 A;  3J63 A;  2DO9 A;  1DGN A;  2N97 A;  2DBH A;  1WXP A;  4P4H I;  1A1W A;  2MPC A;  3CL3 A;  2LWD A;  2BBZ A;  4N1L A;  1Z6T A;  4JQW A;  2MJM A;  2D96 A;  4N1J A;  4D8O A;  4RHW A;  1D2Z A;  4O7Q A;  2N80 A;  3YGS P;  1CY5 A;  4E9M A;  4A2W A; 
#chains in the Genus database with same CATH homology
 4N1K A;  1UCP A;  2NAQ A;  3T6P A;  2KM6 A;  4F44 A;  3KAT A;  4O9L A;  4M9Z A;  1NGR A;  2YGS A;  2A9I A;  4A2Q A;  2LS7 A;  4O6X A;  4M9X A;  2DBF A;  4JUP A;  4IZ5 E;  4RHW E;  4O9F A;  2OF5 A;  2YU0 A;  4IZA B;  1CWW A;  1FAD A;  3J6J A;  1ICH A;  3LQR A;  2DBG A;  2VGQ A;  2MS7 A;  1C15 A;  2MB9 A;  1D2Z B;  2MN4 A;  2LWE A;  2N83 A;  3MOP A;  4QOB A;  2F1S A;  1WMG A;  2N00 A;  4M9S A;  2M5V A;  1DDF A;  2N1F A;  4P4H A;  3MOP G;  4IZ7 B;  4F42 A;  2L6A A;  2P1H A;  1A1Z A;  2B1W A;  1WH4 A;  2GF5 A;  2XV9 A;  3YGS C;  2YVI A;  3EZQ A;  1E3Y A;  2IB1 A;  1E41 A;  2BBR A;  2DBD A;  3EZQ B;  4EWI A;  1YGO A;  2G7R A;  4I16 A;  4FH0 A;  2YQF A;  3LQQ A;  2NZ7 A;  2O71 A;  4NQK A;  4LWD A;  4UZ0 A;  2MS8 A;  1PN5 A;  2OF5 H;  2N7Z A;  4DWN A;  3QF2 A;  3CRD A;  2A5Y B;  3MOP K;  2NSN A;  2HM2 Q;  2L9M A;  4ZBW A;  1N3K A;  2KN6 A;  3J63 A;  2DO9 A;  1DGN A;  2N97 A;  2DBH A;  1WXP A;  4P4H I;  1A1W A;  2MPC A;  3CL3 A;  2LWD A;  2BBZ A;  4N1L A;  1Z6T A;  4JQW A;  2MJM A;  2D96 A;  4N1J A;  4D8O A;  4RHW A;  1D2Z A;  4O7Q A;  2N80 A;  3YGS P;  1CY5 A;  4E9M A;  4A2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...