3EZXA

Structure of methanosarcina barkeri monomethylamine corrinoid protein
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
215
structure length
212
Chain Sequence
ANQEIFDKLRDAIVNQNVAGTPELCKEALAAGVPALDIITKGLSVGMKIVGDKFEAAEIFLPQIMMSGKAMSNAMEVLTPELEKNKKEAGLAITFVAEGDIHDIGHRLVTTMLGANGFQIVDLGVDVLNENVVEEAAKHKGEKVLLVGSALMTTSMLGQKDLMDRLNEEKLRDSVKCMFGGAPVSDKWIEEIGADATAENAAEAAKVALEVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Methanosarcina barkeri monomethylamine corrinoid protein
rcsb
molecule tags Transferase
molecule keywords Monomethylamine corrinoid protein 1
total genus 74
structure length 212
sequence length 215
ec nomenclature
pdb deposition date 2008-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02310 B12-binding B12 binding domain
A PF02607 B12-binding_2 B12 binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1240.10 Mainly Alpha Orthogonal Bundle Methyltransferase, Methionine Synthase (B12-binding Domains); Chain A, domain 1 Methionine synthase domain 3ezxA01
3.40.50.280 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Cobalamin-binding domain 3ezxA02
1B1AA 4HH1A 1REQB 3KOWA 3BULA 1E1CA 2XIJA 3KOYA 7REQB 1K7YA 1Y80A 1FMFA 3EZXA 6REQA 3REQB 4REQA 5C8DA 3IV9A 1BMTA 3WHPA 4HH0A 7REQA 5REQA 1BE1A 2REQA 1CCWA 4R3UC 1CB7A 3BICA 1I9CA 4HEHA 3KOZA 3KOXA 1K98A 1REQA 1E1CB 3KP1A 4HH3C 4Q37A 2I2XB 2YXBA 6REQB 3REQA 4JGIA 4REQB 1ID8A 2XIQA 5REQB 3IVAA 2REQB 1XRSB
chains in the Genus database with same CATH superfamily
3T5TA 1Q7BA 3D0QA 2W2NA 4OBBA 3EQ7A 1UL1X 4G9BA 2H4XA 3FFTA 3MUEA 4KE8A 3T54A 1XPRA 1SIWA 4Z3OA 3RJTA 3MEQA 3O38A 4YIKA 3KM0A 4LE0A 3DE5X 4QX6A 4LX0A 1OAKA 4U1RA 3UFXA 5G0TA 1RM0A 4ZVOA 1I2ZA 2ZDQA 1CZNA 2K87A 1YBVA 2YXEA 4O2AF 3MRVA 4DQVA 2JBAB 3W9UA 4C0KA 1PAUA 2ACVA 3UJPA 3DMYA 3GVHA 4KN8A 2YJ4A 1QH8B 3PUVA 4P7GA 4ZDIA 3QUCA 1ECPA 2AB0A 3N87A 2ZJBA 5LZ2A 2W58A 2IOFK 3LS2A 3LYUA 5U9CA 2P9HA 4EECA 4DS3A 2VDJA 3IAEA 4ZOCA 2DR3A 5LQUA 4S1WA 1SCUB 3AZPA 2A5GA 3SX2A 2BD0A 4Q02A 4EG3A 1AG9A 2OKCA 4MV6A 1P9NA 2M98A 4WKOA 3AB3A 4ARVA 3FUXA 3IKLA 2D1TA 4D92A 5JZBA 5BQPA 4BFLA 4G0ZA 3OZBA 2J46A 3ZYCA 1JVSA 4WW0A 3DP9A 4WXRA 3GAFA 4YAKA 5LQKA 4MRNA 3ZCXA 1E2BA 4IINA 3SF8B 3U3RA 3W8EA 3ENVA 1CETA 4G67A 5B1SA 3LPLA 1IM2A 3K4QA 4FHZA 1OFUA 3BEOA 3KQYA 4JEMA 4KQXA 4MKFA 4ERNA 2QTWB 1DQNA 2YXDA 2W6IA 3N8KA 4BJ3A 5LYJF 1X0XA 5BUCA 4NMLA 3DDWA 5IWAB 3FROA 4IILA 4X3CA 4H6VA 4NZPA 4YP5A 3PUJA 5ALOA 4KMOA 5EXSA 1MO6A 4ZVQA 3RC2A 4NFYA 3M0EA 4L08A 2D2IA 4OD0A 3L8DA 3C14C 3DKIA 2UYQA 2JGAA 3ZCPA 2C5GA 4JBHA 1YRBA 1MC1A 3EQ6A 1HE5A 4URFA 1BE0A 5AKGA 2Y1OA 3NWOA 4FDAA 3RV4A 4G4GA 3BWDD 1G3QA 4ZJUA 3E5RA 3TZEA 2QVYX 1Z22A 3IB3A 4H35A 4TXLA 3TJRA 5KOHB 3OESA 2H0AA 4UHJA 2ZTSA 4PNHA 1YDGA 2J5RA 2JCVA 3N0XA 4A8JB 3ZHQA 2F1JA 1GKUB 2FW8A 3QBVA 2NAPA 3DCNA 3UIEA 1HQYE 4RVUA 4YMUA 4AT1A 1O95C 4NJOA 3REGA 1SU7A 4CIVA 2J5XA 4WK4B 2ZSAA 5DRTA 4C43A 4B2IA 2WTMA 5U4XA 4QWMA 1NAIA 4I8DA 3UNXA 3VYRB 4KP7A 2MU1A 2WMNB 4P33A 1P1FA 2CDAA 2X5JO 1L5HB 2QIPA 3QLVA 4ND8B 1GPKA 5DXFA 1ZAKA 4A4DA 3M33A 4B2PA 4LSMA 4JLUA 4P86A 5AHRA 3TTWA 3ZI0A 4F1WA 2PD3A 1U8ZA 3HO8A 3MCUA 3GPBA 4ME6A 4PBTA 1BS9A 2BAGA 2VXBA 3OICA 4QOGA 3QOXA 3KVYA 4RHFA 4DJJA 3MOSA 5MF6A 2BI8A 1CD5A 4CKEA 3CN7A 3RBZA 4PICA 5BR8B 2GCPA 4RPGA 4UBIA 2CMKA 3BK7A 3W0LB 5ICCA 2GA9A 2R7KA 2J7PA 2VUSA 3GEHA 1FMFA 4LRQA 5KJFA 1AO0A 3DNPA 5GONF 1Z4PX 4YY3B 3PK0A 5M5BA 2OZEA 3GA0A 4FVTA 3HN2A 3RNOA 3KQPA 1C3OA 4D6PA 3GUYA 3TSYA 3NUGA 5TGZA 2AEMA 5D7BA 1WF6A 4PYKA 5GZ3A 4DANA 1ZK2A 1FK8A 1DXQA 3TNYA 3L46A 1L4KA 4ZEVA 2CVHA 3N70A 1R4ZA 3ITEA 2BCGY 4B7AA 1R0LA 3BZUA 3QELA 1IBKB 4Q12A 4KTVE 3AHIA 1HRDA 3FNFA 4NYJR 5JVDA 1BHQ1 2OP0A 4L8GA 1ML4A 1JAYA 1UT6A 3CPEA 1DARA 5COAA 5F3RA 4YCSA 5EJ9A 2RGRA 3QY0A 2XMCA 2PSFA 3RYHB 1T0IA 1COZA 4OK3A 2JASA 5B7GA 5CMLA 1CUYA 4YMIA 3V7WA 1UBOS 3M81A 4BC0A 3JXEA 3PEVA 3DVSX 2GI4A 2HU5A 3KEGA 4R8VA 1U2DA 4U7TB 1FXWF 2PQ2A 1MOZA 4ZEXA 2QYTA 3PC7A 1JRLA 1YMVA 4CE6A 3VOAA 5LD2B 1P75A 1IN8A 3FKJA 4K6MA 2XUAA 1ZNWA 2CFSA 4O5AA 1NLYA 1FNDA 1OPXA 2BHRA 3D6AA 3G0HA 4OOFA 2AI2A 2HA4A 3ZLBA 3CLTD 2VJMB 3TJZA 1I13A 1KYZA 3IAHA 3ZHCA 1Z33A 1J0DA 1JWAB 3MN1A 3UBMA 2Q5QA 4PPFA 4P5EA 4M7RA 3LBAA 2P6MA 3S3TA 1M34A 4CQLB 1FQOA 3V4OA 3O4GA 3JU3A 3NO4A 2OZLA 5KNDA 2O8FB 5CA0F 1MRNA 4B32A 3WDMA 4V03A 3WKBA 4M0MA 4BAUA 3S81A 1QG2A 5CVVA 2QAGA 1E9FA 1Z0IA 4ZP1A 3HVUA 2O5VA 4FEYA 3K1TA 2ECKA 4N47A 3W5JA 4CFYA 4Q3CA 3GX1A 4YAUA 1I3MA 1PTJC 1E89A 3ETDA 5HGXA 3ZDDA 1YBMA 4C6TB 2W93A 3E35A 2OWEA 1XQ1A 3E8XA 1C8BA 4UPDA 4D44A 4RM2A 1DEHA 1C0PA 1YRHA 4IQ8A 4MEJA 1S8AA 4PGGA 1TCCA 1XZCA 4IL5A 1C9NA 4IFEA 1SUBA 4OSOA 3LLSA 5EWMA 5G2OA 2QTGA 1QM5A 4OQDA 4RDHA 3RAFC 2WD7A 3GP5A 1TQ4A 4YCAA 5EERA 3FZQA 3IULA 4UTRA 1EA5A 2D2XA 2L69A 2NM0A 3DL2A 1WXXA 1MFPA 1NBHA 1ATIA 1VJTA 2L19A 4H27A 4IDFA 3OCUA 4QXPA 3TIIA 2X1LA 2E4YA 4UAJA 4JENA 4BMOB 3GRFA 4YMHA 1EM8B 3I34X 3OE5A 5KTSA 1WNFA 2ZOSA 1QP4A 5A0TA 1G2OA 2QSUA 2XVYA 1NJ6A 3SGLA 1KOLA 2JLBA 1AQYA 3D1VA 3QK7A 4DADA 5IASA 4D25A 5IUNC 4LYEA 2Y3IA 1XUOA 2CBGA 3Q1KA 4B87A 4TMXA 4BB9A 4C7BA 4YWJA 1F20A 4GHWA 4TROA 4B4OA 2WKPA 4B3FX 1OF1A 3GRKA 1E0AA 2M6LA 1NR7A 1Z5UA 3DXFA 1P39A 4GNRA 1PDWA 4QKQA 2X9QA 2WSYB 4BFCA 5ECDA 5AHXA 5LP6F 3Q8LA 2O57A 3ZEIA 1WBJB 3N2ZB 1ATZA 3PVZA 2QRKA 2HRQA 5EWJA 4FYIA 4HEHA 4TZKA 1ZM3A 4F7DA 1IYZA 4EGJA 1K8YB 3ZHOA 4C6SA 3IA7A 4J03A 4YFYA 5EJEA 3T1TA 1CEYA 2EG5A 3RIGA 2QHXA 4J0GA 3VA7A 2B4KA 1CDZA 1SNYA 1XDZA 2MT9A 2VRCD 3QVLA 2WU4A 3PXEA 2CMDA 3A3NA 3IPCA 5AJUA 4MMYB 4F5DA 3P96A 4BNHA 1DX4A 2JJMA 1YUNA 2MINB 3BCRA 2XDYA 4U4AA 2FSVA 5IK2D 2F8TA 5FNVF 5F21A 3TR6A 3WRWA 1JR3A 1XEXB 3NU1A 2JFNA 2LIVA 3E15A 5JZMA 1X7ZA 1H2RS 1UPFA 3EVZA 4DLSA 5C1BA 2ZZNA 2PT5A 1HYHA 2PBIA 1WA5A 2IYSA 4IF4A 4UU0A 2YWRA 4EH1A 1WUTA 1Z36A 4X54A 1D09A 2PK3A 5KTMA 4EENA 2I80A 5ER6A 3LRXA 2HADA 1I94B 3OZIA 1O0CA 1W5AA 2OPHA 3THWB 3UV3A 3GFQA 3LE8A 1K5PA 5JSFA 2JLXA 1MG0A 1O54A 2YRFA 3QPVA 4N1AA 4KOAA 1SPBS 1I4OA 3VZCA 4AURA 1XZNA 3AUXA 1Z4QA 4KYUA 4P82A 3E8SA 1WSBA 3CS3A 2FR8A 2R6JA 4UBLA 1BCRA 3K1JA 1UBRS 3EDOA 1G21B 4RTLA 1V5FA 2Q1TA 3AKYA 3BL8A 3O4HA 2ASVA 1I1QB 2I1LA 3HCOA 5K2MA 3THYB 1JDZA 3FTDA 4PZAA 1N0HA 1XFDA 3ZK9A 5CNMA 2O6HA 3ZWQA 2PDAA 2IHTA 1LX7A 2P4SA 4BGUA 2P9BA 3H2YA 3LQFA 4OM7A 1Y1PA 2NUTB 1XTVA 2NPIA 1GGFA 4C7JA 5KBYA 4MQLA 2FMKA 2QLNA 3CT6A 4FMBB 4FX2A 3NDBB 4HVCA 3F5QA 4IH4A 4Q48A 1ZJYA 4RETA 5I5EA 3QWBA 1YFJA 2HQOA 4MYTA 4EZBA 3UK6A 5HJ2A 2NW6A 2Z08A 4BU0A 2REXB 1MXFA 5CAEA 1TPZA 1H2XA 3I8OA 4B47A 3RUCA 5T6BA 4XE5A 3QEOA 5JATA 3P20A 4FMDF 1JZSA 3A2LA 5BUQA 4JP2A 3KJZA 3C48A 5M29A 1GAQA 3S1SA 2VF8A 2NSHA 1H1TA 1P2FA 2ZBPA 3PC8A 1DT5A 1T25A 4DY6A 3O8CA 4Y2PA 5JPDA 1KF0A 2ZJ2A 2NU6B 5AK4A 1RE0A 2Q1XA 3ZZUA 5HCIA 4LMBA 1R8SA 1P1IA 4I3HA 1U1DA 3DDOA 3HKDB 4MPTA 3RSOA 3PXDA 1AUOA 3DGEC 3IQDB 3FKQA 3GVPA 4IMJB 4MYRA 2MTBA 1PT9A 3GGCA 3V7NA 1FVFA 1Y9EA 4TL9A 4XQGA 2QZSA 3LPAA 1LQUA 5L51A 1F51E 3LUAA 4WY2A 4IS2A 1KZ6A 1JYEA 4HNGA 1LK7A 4HXGA 4YP7A 5IANA 4B0OA 2YW9A 5KYVA 4QGGA 1XU7A 3DFKA 3RDPA 3KAQA 1OZ0A 1IOLA 4I6EA 2X8JA 3KUKA 2XSZA 4DMCA 3L07A 1T2EA 4A8JC 2ZSJA 1E0JA 2VNSA 3KFVA 3U3DA 4LCJA 3JZFA 1GP2A 5K03A 5IJ9A 3QE3A 5BQOA 3DUFA 3MWJA 4GQIA 1JWBB 4X00A 3PR1A 3PT9A 5L6LB 1E1RA 1XRRA 2OYSA 2EGHA 2CF6A 2XOXA 3IEKA 4P93A 3TCXB 4RDIA 3PNVA 1G1MA 3FDZB 2QYHA 4BHTA 2G8NA 4BX8A 2B7LA 2CLHB 3ENNA 2QAIA 3GYBA 5F3WB 2BTEA 2IEIA 1KC1A 2YNMA 4RVOA 5C7YA 3QVWA 1W0KD 2W4IA 2B8WA 3RTEA 1IXRC 3BE4A 4NHEA 5JJIA 3DMNA 2Q2NA 4IDEA 1X87A 3HCRA 1UXJA 2GBGA 1WU8A 4DLKA 3I8XA 4P54A 3PYLA 3QJYA 3ZQJA 4N6NA 3FCAA 4IX9A 3TW4A 1PU2A 2UVQA 3RARA 3KZKA 3TLMA 2WSLA 3A1UA 4Q3EA 3AEXA 3RVBA 4F6RB 1CJBA 1K7CA 4K81B 4L27A 3G9QA 4LKOA 1G8MA 5DASA 5B4UA 1D2GA 1C2YA 3E7FA 3E9CA 4I08A 4IHKA 3ZWXA 5KDDA 1XQXA 4RHCA 2JFQA 3N2YA 1SRRA 4FZ3A 4WDQA 4Y3UA 5FD8A 1BWRA 4HWOA 2HNAA 1NXTA 3EXAA 1II0A 1XELA 2IZ0A 2P2GA 5BNIA 1AZTA 2HU2A 2PBZA 2PQ0A 2QUIA 2AE2A 2BR5A 4L4XA 3CBGA 3GZNB 4TUYB 1GV0A 2A1TS 3AONB 3SXUA 4YCMA 4NZOA 5CA0B 5K3OA 2COUA 1QG0A 2EXXA 1K3UB 3GLHB 2AN9A 4NCJA 4BNJA 4B84A 5KJ6A 4H7HA 2OPBA 3AI3A 4UE3S 3DZKA 4CMJA 3VPDA 3HO6A 1CB0A 1E4EB 1WKBA 1XQYA 1ZKMA 4RIFA 4LFCB 1AXGA 1E4VA 2FXIA 3KC2A 4MW1A 4DA8A 5K05A 1ULTA 1X42A 4YLGA 3IBTA 3F3KA 4OREX 1WBDA 4ZMSA 1VL1A 2PX4A 3AUSA 5I7RA 1CZKA 4RCZA 1HLGA 4UE6A 3H4TA 4LF9B 3BFJA 4H77A 3ZH2A 5ANRB 3CVVA 3HKBA 2B69A 5ALYA 4GLJA 3IKVA 4MRPA 3WNBA 2WHPB 5ICEA 2DY1A 3OQPA 5C2JB 2O2XA 5BRAA 3QITA 1E99A 2I5PO 2P8SA 4TMTA 8AT1A 3B53X 3I6YA 3LYLA 1H42A 3PE3A 2VHVA 3Q88A 2H65A 2P30A 1KR2A 4Y1EA 1OFVA 3KR1A 3CJQA 4JV5B 3N2GB 1U5AA 3FPKA 1FFBA 2GYWA 1BIFA 3MD9A 2CZQA 3QHQA 3S2EA 4TWRA 3VHRA 1RS0A 3TZ6A 1UKBA 1M54A 3E58A 2FX3A 4FE7A 1H85A 3FJYA 1TU3A 3KEMA 4R98A 1H4TA 1V3QE 1H2BA 2NG1A 4TLCA 4EI9A 3NT4A 2CMFA 2D7CA 2NV6A 1C50A 2CXXA 4M76B 4QGSA 4FFBB 4UTVA 5BSKA 1Z6ZA 4KI0A 5JDCC 3OJLA 2OYCA 4BLSA 2F8SA 3AYXB 5FA5A 1VP9A 1V3UA 2Z6AA 4RORA 2J6BA 5TVGA 1IVSA 2QR5A 4QG7A 4DCOA 1LLQA 4B4DA 1UCFA 3H13A 2E5FA 2F1HA 5G3YA 4F4IA 1ABFA 1EZZA 3IO5A 4BNYA 2PHZA 4KUGA 4UASA 2FDCA 4ALKA 2HLHA 1T3SA 1YDHA 3EIHA 3I1FA 1XMVA 2RFLA 1HEUA 3UC9A 5G41A 1LPSA 3MTEA 2WG0A 5ADVA 2HF7A 3AKCA 3ROFA 1TM5E 2BRUC 4RCVA 5T3UA 3L79A 2C4VA 3IAUA 4CKWB 4IDOA 3B12A 1CJTC 2VJAA 4OKSA 1C29B 4WKBA 4GW3A 1IK4A 3NIDB 2V6BA 1U0JA 4LZLA 4B1FA 5JCZA 2J7KA 4Q4JB 1RJ9B 3E3LA 2O8NA 1E8MA 3RO7A 3C6MA 2NO5A 3QVMA 4BIIA 1OU4A 1KPHA 2FCAA 2ERXA 3BXHA 4HDCA 4ITVA 5KYWB 2C5FA 2GYVA 4F3CA 1TJPB 1T36A 1ZISA 2H17A 3BPSA 2F1RA 3N1UA 3NBXX 4KN5A 2GCGA 4PFJA 4TS9A 4YCBA 3ZDYB 2IVZA 3EEBA 2XB4A 3PQ5A 5CW2A 4EHDA 3WIDA 4TMVA 5HHTA 1MV8A 1TKCA 2NT3A 3D4IA 4MGIR 1L7EA 3L02A 1WW3A 1ADJA 4D8XA 4O2BA 5H1YA 2PKQP 2IS2A 3BD9A 1Z5ZA 3FHLA 2UVDA 3KV3O 5AW9A 4F06A 1THZA 4YRFA 3WGNA 1YZHA 3L7CA 5AM0A 3TVDA 2EYUA 2Z5GA 1P31A 4INZA 1G64A 2BI7A 1E2DA 2QEQA 3KR0A 5TT1A 1G16A 1MTZA 3CQ9A 2NVOA 3AEQA 3KTAB 3L6RA 5CT4A 4M1ZA 4JDUA 4M0DA 4GPD1 4AJ9A 1RHUA 1DC5A 3M9LA 3W3ZB 1HZZC 1E6KA 3QEKA 3BKWA 4C14A 4YP0A 2OFPA 4QYIA 2X9VA 4I55B 4Y2YA 2OCDA 4D8TA 4CM7A 2RGGA 5A5FA 2PT6A 1CY7A 2FGJA 3X2SA 1XVAA 3GUUA 3QU7A 4D9BA 2FYTA 2VP9A 1E64A 1GUDA 3L8EA 5DWDA 1Z7BA 2FEKA 4LPKA 1GPMA 2V98A 3L6CA 4NPCA 1ECCA 2GBLC 4HH1A 4UHDA 1A5BB 1E9EA 3LUBA 4L7VA 4TV9B 4EGCB 5K4GA 2UU9B 3T4PA 3CW2A 1UJ4A 2ZIFA 2O7VA 2B9EA 1Y98A 1R6XA 3NP9A 3TSOA 4BO6A 2V1UA 1Q83A 2HA7A 4KO4S 1CW2B 1U2GC 4MKHA 3RVOA 1GYPA 2GN8A 4XSHA 3ZDFA 2ZJ6A 4IHAA 2JEZA 4LXQA 3R3XA 3GGDA 4DZZA 1ZO8A 2D0IA 4RKEA 2XGGA 4B8YA 3TLXA 5JJBA 4PZEA 1N2ZA 1T2UA 3KSDO 1ZYUA 1PEYA 4MV3A 3ZBUA 3K4HA 3S6JA 2QUAA 1NQTA 4AUKA 2TMYA 1M2KA 4C4TA 2V7EA 3A6DA 2HTFA 5CD9A 4ZCMA 2Y4OA 4G8DA 2RK4A 2MYPA 2QL6A 4U2KA 3I01M 1WCXA 3DLTA 1GTMA 3NCHA 3ET4A 4PXSA 3V1LA 3PDCA 2QK4A 3BXXA 3IPXA 4JXXA 4Q9IA 4IUYA 4BNVA 3BIOA 1YDWA 1DDIA 3PXXA 2Z09A 4YH1A 1IUOA 1LUAA 2DG2A 5B58T 2MWMA 1EAYA 1XTUA 4NX2A 4B33A 3Q3VA 4FSXA 3EF3A 4NE7A 4OHOA 3VJRA 1CFZA 3NC1C 5CFOA 2FMFA 1G6HA 2XBLA 5KNCD 5LP6A 2H92A 1GTZA 5IKMA 2I6FA 1OZFA 1WSWA 2CLCX 3RH0A 1QB8A 4MS3A 1C7FA 1NQOA 3V4LA 5ITWA 4YACA 5C8XA 4TV8B 1V7ZA 4W5QA 2ZBGA 5DF1A 4OP2A 4MDYA 3SQMA 3QKRA 2EDCA 4HPWA 3CZ9A 4E2YA 3QUQA 2ZUFA 1O6GA 1U0SY 2HOQA 1VMEA 1ODIA 1L3IA 1TCUA 4NH4A 3RVKA 2GFQA 1N4DA 1NX9A 5JXWA 4URWR 2QWXA 2QY9A 1CY4A 3I3SR 3RU7A 4JLNA 4F2HA 3CF4G 3SYKA 5DSTA 3INTA 4G1VA 1CE8A 1WXQA 1MZPA 4I6JA 1WM1A 2PMCA 4Y2XA 3U19A 4X24A 2XKKA 2IH4A 3E5MA 1Z0DA 1BXKA 1KDYA 3CKLA 2GD6A 4HY3A 3V1YA 3PU6A 4NEHB 1JVBA 1KJYA 1WUIS 2I8LA 2XVMA 4M8KA 5EINA 4ZXPA 2IKQA 1QIIA 5LBIA 2LZ0A 1CZLA 2C58A 2DWUA 2Q46A 2QGNA 1P5ZB 4FNAA 4J07A 4OPMA 1K6XA 1JT9A 3T8YA 4KLRA 3HK2A 4TQ9A 2JD2A 4WOKA 4FJ1A 2IF0A 1Z5VA 2O2EA 1FNBA 4L9AA 4P2BA 8ATCA 1DMRA 3NHMA 1K89A 4DSUA 5KC8A 4KXVA 2MHCA 1PZNA 2ZJOA 3BCHA 3EIWA 4JLJA 1DAGA 1WD5A 4QTXA 3FSGD 3QYJA 4CIWA 1S7CA 2O06A 3K1AB 4F93B 1JDBB 2XJ4A 1PEAA 1I6LA 3O4JA 3QFRA 4M0UA 4TL8A 3HKCB 5KOIA 1MEEA 2F9LA 2F6RA 3NOQA 5I7EA 3SI7A 2C4WA 3ISJA 1N6HA 2NZUG 2WFZA 2IPNA 4IPTA 3N07A 3TLBA 4C05A 2FZGA 1RQGA 1O96B 4CQMD 3GLQA 1KY4A 3BL5A 1P1RA 2Y99A 3MTJA 4AVYA 3TLCA 4ADSG 3NNNA 4PQEA 4NMXB 3BD6A 4ZAWA 4D45A 4AD8A 4JQCA 3COPA 1OH7A 3H6HA 3EZ7A 4ER5A 2FOIA 3M1YA 2VUTA 3IVXA 3OY7A 1XMSA 2B5WA 4N5LA 4PV7A 2A1UA 1Q0QA 3EZGA 2B78A 3PTLA 4JYZA 3EG5A 1XVUA 4JI4B 4KBGA 3CEAA 4HGYA 2DGDA 2YV1A 3VAZA 3L8YA 5ALFA 3JYHA 1IPHA 1D5WA 1U0LA 1Y6ZA 3CX7A 1ZOSA 4D5GA 4XRGA 3RSHA 1RIFA 1Q17A 3R09A 1R4NA 4UBOA 1OWPA 3ELBA 1JHPA 1XE3A 3RVMA 4BO1A 4ZZ1A 5JI3E 5AUPB 2DB3A 4Z4FA 1TPYA 3UANA 3WL8A 3VU1A 2PFGA 3TZQA 3EPHA 1BNCA 1H0KA 2BPOA 3RSFA 3K05A 1BD4A 4CUZA 3SQNA 4WXMA 3CLRC 2ZIVB 1UZ3A 2CBXA 1LWNA 2J30A 4KW7A 2AGVA 5I9MA 3UYKA 1F12A 4KPEC 1PP4A 3MUFA 1CUJA 3GA5A 3AF0A 3CVYA 2ODAA 1W0KA 2JFYA 1LX6A 2NV2B 1OXMA 3JQ7A 1E3EA 1VMIA 3PFHA 3SZRA 2Q41A 2YXBA 4K6CA 2AOUA 4HRVA 4XJVA 3VYSB 4E6EA 1KI9A 2X3FA 2IV2X 4OHRA 2DQKA 2ZSKA 2BEUA 4AJOA 2FSGA 4ZCRA 3E7XA 3R5XA 1Q6BA 4B79A 4KIUA 3FNGA 2H85A 4Y6RA 3H7IA 3ZW7A 6AT1A 5ES4B 4O4IB 1C41A 4UUOA 5KJEA 4AS2A 1FIUA 3P9RA 4LW8A 1ORTA 3MT9A 2Q5JA 4D6YA 5K4HA 2IZ1A 2ZW9A 2W9XA 3U13A 4BZXA 4B3SB 1W9HA 2D2FA 2OXEA 4DA6A 1Z62A 4GOLD 2Q7OE 4J4BA 5AI8A 1VYUA 1N0VC 1MB4A 4QOJA 1YC2A 3L92A 2MYUA 3A6FA 5EHIA 4C08A 1AK2A 1IXSB 1HQKA 2PIAA 4I4NA 2QX4A 3BBLA 3M89A 3P2OA 4HNSA 1JT2A 1ZIDA 1KSGA 3DVQX 5J59A 4DGQA 5JEDA 4KITB 2ASEA 5G4KA 4WK0B 4FGKA 2F43A 4LQLA 2YX1A 2PVSA 5FV4A 3AJEA 5IJZA 4A2PA 5HQ3A 4J0EA 3VKGA 4HAZA 1EK0A 1RACA 1V71A 3G1WA 3JCZA 2VLIA 4JHLA 1NDQA 5TSDA 3AFIA 2W6QA 3QKUA 1C7EA 1WF3A 5ALIA 5HK8A 2RIRA 3T9AA 4RQUA 2BFNA 3K35A 2QAJA 5AW4A 1N32B 4G07A 2F00A 1G21E 2BEWA 4DQ0A 3NCTA 3TW6A 4X71A 3INNA 3MK31 4MRSA 2OVFA 5EEHA 2HK8A 3IIEA 5EGNA 1L3BA 1U0NA 1F8FA 2DYKA 5CVEA 4BFXA 3CNEA 3KKPA 2J1LA 1ZD8A 1X7DA 2IP4A 4EVQA 1O5OA 4G4JA 3RK1A 3TLKA 3KZCA 1RKBA 2DT8A 3RCBA 2WKSA 4W5HA 3WWPA 3H86A 1SUEA 2W2KA 3D43A 3GLSA 3EAQA 3I2GA 2H1WA 1CQIA 4JIGA 4OHBA 1E58A 2LCFA 3GNTA 4LFAB 3T5BA 3UWKA 3TDKA 3C1UA 1H9BA 1RT9A 1X7WA 4UVEA 1BOOA 1XD9A 4DNFA 5JRJA 2FH5B 2J9RA 3ADDA 4H7JA 1VPDA 4PPGA 2ZRLA 2ESRA 4F72A 3L7OA 4KYTA 1WZUA 3T9EA 1PJQA 3GG2A 4P4SA 1ZU4A 1R10A 2QPLA 5DNVA 3OE7D 5KPJA 4RDCA 3E2MA 1W5FA 4BDTA 3CZAA 4XGNA 1AKRA 1IVNA 4G5QA 1XI2A 1U9JA 4C78A 1DC3A 2V58A 3BYZA 4K9NA 4Y67A 4ZDWA 5JCJA 1M2FA 3REQA 4LV8B 2NSDA 3HEAA 2HMWA 4ZU1X 4YRIA 1VLHA 1GGMA 2XYHA 1J6UA 2HTEA 1YGPA 4ER0A 2NADA 4LXTA 2BM8A 2Q1SA 1UAGA 1ZUNB 4TQAA 5BORA 1ARZA 1E79A 1SKAA 3PUHA 5CEJA 2XNDD 1OH8A 3MYRA 1VB3A 2CJWA 5C3MA 2XCQA 2PQ6A 2AVDA 4DWOA 3IOCA 4FEAA 3WMXA 4PIVA 5DOZA 2AQIA 2HEGA 2IOQA 3BN3A 4TGLA 1LDNA 2MOKA 1YQ9A 1PZEA 3D6HA 2FRXA 4URVR 4B82A 4LZZA 1SOMA 2WVHA 4N7JA 2HK6A 3Q7TA 4GM4A 4RZ3A 4TKUB 5DHAA 3TFWA 1Z9BA 3V8NA 1RXWA 4Y0VA 5B7PA 5A5EA 1P62B 2QNBA 3LC0A 4M9CA 2WUEA 3NT5A 1E2EA 5JBNA 3PFIA 2X3UA 3R3HA 3IDSA 1TEZA 3JSXA 4ZYYA 1D1QA 1F48A 3IEIA 1T8TA 5EYPB 3T5GA 4DUGD 4AQYB 5LKRA 3RYCB 1CBUA 1BA3A 1G3RA 2G9UA 3CONA 3IT0A 3AUKA 4X45A 3HP4A 4ZD6A 1XPUA 3HADA 2R9VA 5GM2A 1T9DA 3FA2A 3T34A 1XQ6A 4HH0A 2X2PA 1YS1X 1ENOA 1M1UA 1P91A 3QVTA 4X6YA 1B26A 3GFSA 5E7QA 2VF2A 3EVEA 3VJMA 3K70D 1PJ4A 2AK3A 2ONYA 3KWLA 1KPIA 4JD5A 4LSGA 4WI1A 3YASA 4EJSC 4MS4A 2ZAOA 3E1SA 1OLUB 1JHQA 1JHOA 1LA2A 1DAIA 3KB8A 1Z5PA 1H1LA 1MIOA 2NAFA 3P5SA 4PANA 2O59A 2IXAA 3E9QA 4L76A 3A9CA 4BECA 2IXGA 4EHFA 3DV0B 3GJ8A 1O58A 4ERXA 1SCIA 5M04A 4ZVLA 4L85A 3ZKWB 4IJWA 1G6KA 3D3WB 4CKZA 2V7QD 2EFDB 1N92A 3FCUB 4M21A 4WBNA 5SZKB 3GNLA 5BY2A 4NPAA 1GUYA 1V35A 3RKUA 3WHPA 4I2NA 3AVQA 4ZQHA 4NULA 3UG7A 1RSZA 3DAPA 3G5TA 2P35A 5E2IA 3BIWA 2JDID 4MWCA 1BVUA 5E6UB 4HVTA 1A8UA 2YYYA 4ID3A 3WC4A 2DBRA 2OCBA 4KODA 1GKKA 4YONB 4ZVMA 4GYKA 2R6DA 2I6SA 3AERB 4GM1A 4IH1A 4X85A 5D01A 1PJAA 2I2CA 4ZVRA 3VR4A 3KYCA 2H1IA 1AMUA 5BYKA 2JBAA 1UKCA 3QPWA 4UVDA 1L7OA 4X1IB 1NU6A 1VG8A 3QKIA 5EXEA 2YBEA 3WGLA 3QY9A 1NBOA 1Z4IA 2KLHA 5IULC 1TM2A 3K2BA 4IDQA 4N7RA 2J87A 4KFCA 3KQQA 4LF6B 1FRZA 3DH0A 4RD2A 2ZQYA 4IFBA 3UW3A 2QG4A 4IJVA 1G7TA 2ZQ5A 4FLMA 1P7VA 3K9GA 4QJ4A 2X6RA 3RWOA 3THXA 4Z86A 5EIOA 4AJLA 2GN1A 3IQGX 1AC5A 1DKOA 1RYEA 4MUJA 5ILGA 4G0PA 1N36B 2C97A 1JG4A 3K6KA 3TLJA 4ZFNA 3KLNA 5HQJA 1JKJB 2HHJA 2CXHA 4FMPA 1PR3A 4XJTA 3GT4A 3T4UA 3ZGYA 1LBHA 4O4JF 1KEZA 2JJ2D 1RYBA 4JR0A 4G41A 4IWNA 5E4YA 3ZE6A 3SMVA 2R65A 4BMSA 1TB4A 3E23A 5CX1B 2VDWB 3MQ4A 3OPYB 3PFBA 5EMJA 1L5KA 4IFIA 2WWYA 1U6JA 1E7QA 1X74A 2GZAA 5I7HA 3PX3A 4Q39A 3Q8MA 3JQBC 4LQDA 3DZFA 1XROA 2YHBA 1DSSG 4IIJB 1NOIA 3PF9A 4LRXA 3KUXA 4I7EA 4RF5A 3TLYA 2ZCUA 3NHJA 3PE6A 1VYHA 2R1TA 4LDZA 1DBIA 4F04A 4O59O 4JLDA 1G17A 3JX9A 3MCVA 1R0YA 3UJNA 1X80A 4EJ0A 1PL8A 2Z3VA 3EDMA 1AKMA 2B5VA 2QVCA 3BXPA 4L4ZA 4MV7A 4NFLA 5EKSA 4EFKA 3F9RA 3H65A 1EDZA 1FUEA 1BDMA 3JQQA 1FX0A 1S2GA 3OEED 1DX9A 4GE3A 4R1OA 5FADA 2PAAA 4DA9A 2BGWA 4TYWA 4I9NA 2YW2A 2FW1A 2Q3LA 3TQRA 5IC4A 5B2ZA 3DYBA 4RKFA 1XAJA 1RI5A 1NNI1 3N0WA 3A1FA 3FMFA 3OEEA 4OXQA 4R7ZA 4BMCA 4MDFA 1OOEA 1QGUB 1A9PA 3PS9A 1MNAA 3S5UA 4HGNA 3TQOA 3CCBA 2GVDC 4NEQA 3R5KA 2OK7A 4R8LA 4BO2A 4ZAZA 2ATEA 1KWGA 4UVIA 4RTOA 5FORA 2FRDA 1QWSA 5JO9A 1JS1X 3L7KA 5F78A 5B3JA 3A26A 1SBTA 1GNTA 2F90A 3DZ8A 3P7MA 3PEYA 2IE0A 2OILA 3CRQA 2VZEA 1MJ5A 1NRJB 4PZZA 5D5PA 1UDAA 3FBTA 3Q7SA 5CYFA 2ZIUB 3GJ6A 3U60B 2JG3A 4TTJA 1DUSA 4ZAFA 4LYFA 3GLFA 4PPNA 2HA3A 3HABA 4QLAA 3UA4A 3U0BA 4C0HA 4YYZA 2FSVC 3EUAA 3QEJA 3KQKA 5FPTA 2CCGA 1DOZA 3LQYA 1N5KA 1A76A 2DSTA 4GLFA 3GBSA 4HAOA 4KLNA 3H5RA 3VC3A 4CMCA 3QENA 1I4TD 1SIBE 1MQ9A 1XKQA 3D8BA 4BWGA 2OB1A 3SJAA 3U39A 4Z1OA 3BH7A 2PH5A 1LSOA 1MO5A 3HV0A 4QL3A 3DW3X 3WB9A 4C7MA 1BHO1 1E1KA 3AR3A 3GFBA 3L8HA 4LK3A 3K0CA 4G25A 5DWQA 1G66A 4FGSA 4C0WA 1EVQA 2GBPA 4D3ZA 3H99A 1CWUA 2GZDA 1QC5B 3AFMA 3PHIA 4MVJG 2F1OA 2LE0A 4R9SA 3UVEA 5AVTA 3PP8A 2J3KA 3P0EA 5FYQA 5H4GA 4O5OA 3EYWA 3ETGA 5JZOA 1ZCZA 4N4AA 4UNRA 4ZZ3A 2F9FA 4YAOA 1PFWA 1DBSA 3OMXA 4TSFD 1G8GA 1CY6A 3ZE9A 2H54A 4FX5A 2VAXA 2E4ZA 2X2EA 4UCWA 5AW5A 1NHWA 1NLFA 4MGYR 2W2OA 4TSFA 2Q4DA 4ND8A 4Q3DA 4ESVA 4JYPA 3DCIA 3IPAA 3PD1A 4WKNA 4FSHA 3R75A 4BTEA 1L8QA 2JHGA 1MOQA 1X8KA 2PUJA 3LNTA 3ESBA 4MJXA 2Q6KA 4MVJF 5B55A 2LIPA 1IZ0A 4IIXA 3P97A 3BOSA 2IY7A 4QJ5A 4FZJA 5AKXA 1U28C 1P9OA 4MI9A 4J0HA 2IYEA 1UXGA 4PG8A 3H1EA 3Q7PA 3RS2A 1Z45A 3PQ3A 3MIZA 3WWEA 2P2ZA 2HN9A 3A2NA 5IK2A 1DOAA 5A7FA 4KQGA 2YZ2A 3RFXA 2VHUA 1QHHA 3DOFA 2XE8A 2MYTA 2DWPA 1ZMOA 1C9JA 4XD2A 4TKVA 3MGBA 2GAJA 2QTTA 4C7KA 2HF8A 4OH7A 3KOYA 3UV7A 5AVYA 4O4LB 4DR3B 1I1OA 1GNSA 4TKUA 4A0RA 3GLFE 4C5AA 5K8CA 3NRJA 4XFDA 4AY5A 3TTTA 2Z8XA 3U16A 3DMGA 3LT4A 4IXWA 2GJKA 3SC4A 4CM9A 5HNKA 3W1VA 4LYGA 4AMUA 3UJAA 1FJXA 2JGFA 1L7NA 1TYCA 4MKXA 2ADMA 2ZSBA 3IT2A 3FPJA 4NP6A 2V7GA 3OY2A 3RNLA 5B30A 4PM4A 5KJ1A 1OE0A 5D3MB 2O5EA 3LKVA 4HYQA 4IDAA 3M4ZA 2ZYUX 2P78A 3AHDA 3GRAA 1HZJA 1KJWA 2HRCA 3R44A 2C7VA 2QMUA 1CUVA 4HJRA 4H17A 1R0BA 4FN4A 2FN4A 2HREA 4QXAA 1U7XA 3R7DA 3V80A 3F8WA 4P22A 4B73A 5FAKA 3KL4A 2HY7A 3JD0A 3DMFA 4IVPA 5JWOA 4K86A 2JB9A 5EIFA 5FUYA 5KOJB 3HMQA 3TOVA 5EMLA 1J8DA 1Q44A 3JYPA 4J0FA 4ND4A 4CLOA 3ANSA 2A94A 4L5BA 1ODLA 3RRJA 3LW7A 5CVJA 4MRRA 4BO3A 1ADFA 1JEJA 2H1CA 3DV0A 3ETEA 4E7PA 3MWEA 4PYMA 3KPYA 3LD9A 1P3JA 5LZ7A 1EA7A 1KAGA 3QWIA 5K0BA 1GWNA 1USWA 1QZUA 1NVKA 1P8JA 2I33A 1MABB 5F7OA 3PX7A 4UHEA 2PZJA 2C9BA 4K9SA 1HC7A 3AHFA 1EJ6A 1Y48E 3V8PA 4XDHA 3EGXA 1TF5A 5HIMA 5BN5B 1JH8A 2QN2A 1UK9A 2J32A 2OECA 3ZPXA 3N3AC 3SR3A 1I0ZA 4I4LA 3L05A 4X1OA 3LCMA 2H0QA 2PLRA 5E6UA 5AUQA 1YR8A 4HH4A 3QW2A 1LGYA 1CZRA 3L77A 3MGCA 2RSLA 4HP8A 1KE1A 1V25A 1UBSB 3OFNA 1NTOA 2BLLA 2GSWA 2AFIB 3BRWD 4EGQA 3NAZA 4E5YA 4F21A 2OO5C 1XJCA 5CURA 4ZYUA 4GMGA 5AO9A 3KSMA 3UXEA 1SJ9A 2HD4A 3VOTA 1CFJA 3RSQA 1GUAA 1PFUA 3U4HA 2OQ2A 3MINB 2WAOA 2XYRA 4HSEA 5YASA 3ZKAA 1KVTA 1THMA 2ACEA 2HM7A 1B00A 5HKOA 4PO8A 1FZTA 3BQNB 1J8MF 1HTWA 3C16C 3DHNA 5CBKA 2FRDC 1IEXA 3D7SA 1ODTC 3ULKA 1GNRA 2G76A 4OYHA 1NI3A 2DLDA 3EXEA 3FYDA 5IH7A 1I7SB 1R0SA 2H2IA 3GEEA 1QV6A 4LZJA 2PD4A 2ZYSA 1X6VA 1QWOA 3TGWA 3ICEA 3I53A 3UPTA 2PT9A 1QV7A 1EX9A 2DBQA 4BGDA 4KR3A 5K0LA 1JYFA 1Z26A 1GGJA 2A7QA 3B9BA 3MCAA 4W8GA 1QYVA 4V3CA 1DVRA 2VH5R 5IEBA 3A6PC 2WJPA 5U4QA 4MHOA 1F2UA 4KR9A 3BXOA 4PNZA 2J6HA 4CT5A 1W4ZA 3U31A 4CQJA 4DFDA 3B7WA 5I01A 3CZCA 5LZ9A 4PCVA 3HDYA 4Y0AA 2AYYA 1SD2A 2DHQA 3GCZA 5KNBA 1DV1A 1RLTA 4CU5A 2R1TB 2O0MA 2DPYA 1E7MA 3R0JA 4PQYA 4S1VA 3ML1A 4LJ8A 3TZKA 2GLXA 4ZRDA 1ZX1A 5B3LA 1ZM7A 1WB5A 5AJYA 1R4MB 1NQUA 1C0LA 4PR0A 3TTYA 3TOXA 3T95A 1HFJA 2Q50A 2GJAA 1Z7YA 5A71A 1K6EA 4KAXA 5EIBC 2JLWA 2JBHA 4AMBA 3OE7A 1DFIA 1M8GA 5HKAA 5EFOA 3TZHA 2IIPA 4A0SA 1P80A 2HCBA 2EFHB 3GFRA 4EUKA 2C9CA 2GKSA 3C3MA 2QYOA 4GWLA 2PGOA 3C5WP 5J58A 1O89A 2YWHA 3CRVA 3NTQA 4QYSA 3GLHE 1QONA 2JATA 4KFUA 2B1JA 5DT9A 1KEWA 1G5HA 1UPXA 5IKEA 3WVNA 4OVKA 1XZGA 2I2WA 4DABA 2BEJA 3RAJA 1J2EA 3T7EA 2A5FA 1AQNA 2ORIA 1XZMA 2IV3A 1SXJA 1XLUA 4WZBE 3VTKA 1JFVA 3EWSA 3D1LA 3I6IA 4V0SA 1NQVA 2ZU0C 4HO1X 1QYCA 4YAWA 4O1IA 1KP9A 3QMMA 1SC9A 4Q4LA 4WDRA 4R2HA 1E4OA 3WGTA 2V6MA 4C89A 4YDQA 5HTOA 2Y1XA 4QXOA 3BIFA 1G4HA 3C8UA 3LP5A 5F98A 4OQMA 5FI0B 2V0CA 1K7XB 4UMEA 3TEJA 1I10A 1V4BA 2XX3A 1T4CA 3TI7A 4BEBA 4PIMA 4HDSA 3Q9LA 2BTOA 3WP1B 1HO3A 3KYDB 1JIJA 1HDIA 1YHZA 4GXRA 1NBWB 5A4FS 1VYVA 3M9XA 1DUIA 2CDCA 2PNFA 3JD2A 1U5BB 2EW2A 2GILA 4R9RA 3VR2D 2VP5A 1KH1A 1V3VA 1DC7A 3PJDA 3TTSA 3RREA 3TBKA 5CXSA 4DPLA 3T1YB 5K0SA 3CNQS 3QNMA 5CT5A 4BBZA 1PQUA 2B94A 3TG8A 2W00A 4JP5A 5JVDF 4QBGB 2IV7A 1AN9A 2ZRAA 2HIAA 3WJ1A 3LH5A 1SCUA 3C4QA 4H59A 1K9VF 1EJBA 1U9IC 3JRNA 2JI6A 3R6DA 1EUZA 2JGNA 4OMFG 3Q10A 3SYNA 2G7MC 2ZU6A 5HM6A 2NSLA 2CJYA 1NSFA 5HBRA 1ORIA 4DHEA 4MV8A 3TZCA 4NEGA 5LB2A 4IW3B 1LS6A 1T6NA 2FVYA 4DJ5X 1X3LA 2ZSEA 3ENKA 2AYXA 2Y1FA 1U8EA 1AS3A 1PR0A 4PYRA 3ZV5A 3CUUA 5AVSA 3RTCA 1TU0A 4P38A 1OBOA 1OI4A 4XDZA 1IEWA 1F4PA 2VK1A 4X20A 3MSXA 1Z4NA 2PZFA 3LHIA 3EF0A 3RFCA 1KKMA 5BOSA 1GFSA 1GNPA 3PC8C 3PNSA 4DJTA 3W5AA 3IIKA 1NSTA 3B6ZA 3HL4A 1WXIA 3TAUA 4F2PA 4ZOEA 1EXVA 1U0TA 1KERA 2KLBA 3AU9A 3JATA 4O4LA 5FLEX 4DXAA 4U2EA 2XV1A 4CDNA 2P0YA 4ZYTA 3UK1A 1CHNA 4RY8A 2C2WA 1L9KA 2OLKA 2JRLA 2CB0A 1EGAA 1SELA 1UOPA 2A3RA 4H6WA 2JGMA 4HFRA 3ZC3A 3O8OA 2FP4B 4GX1A 1P3Y1 1M7GA 2NO6A 1Z29A 3QKWA 1PL7A 5DYGA 3U9LA 1EB8A 1S6YA 1IUKA 2XEXA 1X1TA 1IUPA 1XDUA 5DEOA 4MUNA 4QPZA 1XTQA 2GEJA 2Y9MB 4DNQA 4M1SA 5D3MA 4D0SA 5FPYA 5TJHA 1AKYA 1E1NA 3I9FA 4KVFA 7YASA 4KMRA 1TECE 5B53A 4L75A 3V48A 3ZHXA 1V5EA 2YASA 2XD9A 2GN2A 1X8JA 4L4SA 5EUQB 2GNAA 1Y3AA 1V8ZA 3CUSA 1YDMA 3A36A 2ZTUA 3KE8A 1S8NA 1U7WA 4PRKA 5DLEA 4JJ8A 1W8DA 1TMYA 3SBOA 3H2ZA 2DLNA 1ZVVA 1M1XB 4YMWA 3DHYA 3U3MA 3NUQA 3FM9A 4IMIB 1ZS9A 5F2KA 1BSVA 4MO2A 4WCFB 5F73A 4FDTA 4DN6A 3CLVA 2R6HA 3AESA 3GDOA 1ECLA 3Q9UA 3VYVA 4CM8A 2R48A 5ILOA 1R6UA 5FUXA 2OE2A 1JIXA 4QQFA 1TQHA 1UDBA 2BGMA 3FDZA 2IOYA 4PZYA 1J7JA 4Z3DA 1ZM4A 4UPVA 1O08A 1CUDA 1I80A 1NPTO 2XCIA 1Y80A 4WE3A 3SZLA 5I51A 3KV1A 4KSCA 3TL3A 3KKLA 1CKEA 1O95D 1NW3A 3EGXB 4FR5A 3B7PA 4WZAB 3OPXA 4F9EA 3IE1A 1YI1A 5G4LA 3LVBA 4JNCA 2O05A 2G9ZA 3HRKA 3JTEA 4FI3F 1K5HA 4BO5A 2BHTA 1WEKA 2Q9AA 1L0BA 2C1ZA 2W37A 1HETA 4JASB 3Q11A 2QD1A 3HJFA 1FA9A 4NZZA 1UJNA 1E8DA 1X1RA 2WTEA 3BCSA 4ARSA 1P60A 1T9BA 1E2MA 1XCGB 2GBIA 4EB6A 2QORA 3LCUA 4F6RA 1HNWB 4LQ4A 2EJWA 5BNWA 1OGIA 2QZPA 2WAAA 5LMNB 2UYYA 3MINA 3N0VA 1U2GA 1L7RA 4XWGA 4YMTA 3EZFA 2QOEA 2YDYA 3IUYA 3GJQA 4TMZA 2ZWOA 2O0JA 3FDIA 3OU7A 3WLIA 2OD7A 3F6RA 1IB0A 1A96A 1U9CA 2GUWA 2DQYA 2HEIA 1G0OA 1UXOA 2HWYA 2VVTA 2DUJA 4WHMA 4YEDA 1CX9B 2ZAYA 1FXSA 1SQ6A 1NXPA 3II6X 4MINA 1E3LA 3LL4A 1J21A 2ORWA 4C2BA 3RJMA 1DTWA 1V6SA 3LX8A 2G88A 5DGXA 1KJIA 3OZVA 4WLVA 2QNRA 3SM3A 1ECBA 1FE8A 3TD6A 4LJKA 2PLNA 3NB0A 4RLSA 2OGSA 2LUOA 3DMTC 5JARA 3AVUA 1E66A 4M4SA 4NDZA 3F7MA 5TVKA 2QV0A 1Z2NX 4IAOA 4BO0A 2B4TO 6NULA 2WILA 5D87A 3G9ZA 3V2GA 4FDLA 5HZHA 1CUSA 3GO4A 5DBOA 3A25A 1U2ZA 4KIFA 1SB9A 4GUDA 4NBKA 5BN3A 1RDFA 2G17A 3HXLA 3O3OB 1AHNA 2VG8A 1E94E 3QVOA 4TV8F 3AV0B 3QRWA 3IX7A 4ZOAA 2GN0A 5ES3A 1NC1A 1XLTC 4GZ5A 1YRWA 3FVQA 3LUCA 4UD2A 1M75A 1PJ3A 3IP7A 1K06A 4G9EA 3NHFA 1A5TA 1L1RA 3NFRA 5C5CA 3OJXA 5KDLA 1V8PA 1QZZA 1Y6QA 1DIGA 2OZLB 4AS3A 2Q3CA 1A2BA 2C4KA 2V3CC 3AGPA 1EDDA 4C22A 4OHWA 3QXXA 5IVDA 4ENUA 1SVIA 1Z0AA 2ZT8A 2J3MA 4ZKDA 1OVGA 2WF5A 2YZ7A 3U7EB 2DUMA 1A8HA 2HIHA 1DKLA 9LDTA 1VG9B 5BSEA 3OU6A 3IVGA 5I45A 2GLTA 4BKUA 4RDXA 3VXKA 4ZT5A 3MS7A 3T3MB 1Q19A 1W2WB 2HQBA 4MGKR 5BYJA 1O94A 4FTWA 3CR7A 4RO0A 3B5EA 1ZJZA 2GVZC 4HLNA 1JJFA 2RHRA 5AK0A 5FIUA 1GTSA 3PJRA 2JJ1A 1N8TA 5ALDA 1DOHA 2HV9A 3I2KA 4RFLA 3JWPA 1I33A 3WHIA 5LWQA 3K9FC 4Q9JA 4FONA 2G9QA 1K98A 4UNNA 2BJHA 2RB4A 4FFNA 1WMDA 1LSSA 4WKPA 4M49A 3ZOKA 1IZ8A 1NW9B 3WJ7A 1V26A 1J8VA 3X1MA 2IUTA 2D1YA 1GQYA 1HOXA 1U2TA 2IYWA 4DA0A 4DEVA 4XYEA 4HDAA 3N6XA 3E3MA 1EK6A 2HMUA 4I3FA 4G37A 1ECGA 3GUHA 4YXWA 1JIQA 1WJGA 3U48A 2H08A 1QQBA 1RPJA 1KDZA 2AN3A 1FSSA 1Y33E 1CIJA 3LX6A 2CHGA 4H1UA 1R64A 2Q2VA 2J0QA 5JPIA 1HUQA 3D7NA 2R47A 2C83A 4J1QA 1J2RA 4U63A 3DB1A 4XM2A 3GBPA 2BEVA 4DQXA 4F12A 3ER9A 1JALA 3GN1A 5F1KA 2ZSHA 3HI6A 4C01A 4KXWA 3RSSA 1QAOA 3L0OA 3DPSA 3HBMA 1OFIA 5I9LA 1TKBA 3PC4A 4G36A 3I01A 1M76A 2VBGA 3B1FA 2PYZA 3PWSA 4HB0A 4L0MA 1IXZA 1T36B 2OHOA 4H3SA 4YJDA 3S2FA 2W6ID 2ZK7A 4B6GA 1ADBA 1RM4A 2PZAA 4PYLA 5EWJB 4CHGA 4IQFA 4PLVA 1ODJA 3OFND 3ZD9A 2GZMA 5JSHA 1RVV1 1XAIA 1A5ZA 3IHWA 3HACA 1G7SA 3JQGB 4PRZA 1OC2A 5KYUB 5LN1A 4EJSA 4HF7A 3QW4B 4IIVA 4BZQA 4HB4A 2EU8A 2JGDA 4WJZA 5JJCA 2J3QA 3K72B 4JL6A 5BYAA 1SQ5A 1XNJA 4G4IA 1C1DB 4TMYA 3RC1A 2XCUA 4AZVA 3QXJA 3RSCA 1EZ4A 2DHCA 3BF8A 3EGDB 3DFUA 1NIJA 1T5BA 4YRGA 4DRZA 3VOSA 4NOKA 3HA5A 2I65A 2HHLA 4PLWA 4NH0A 5JH7F 1G6Q1 4OYRA 2CCKA 1NF9A 3KKEA 3UENA 5F5NA 2YTZA 1MVOA 4I55A 3OIDA 4NBNA 3RLFA 3EOBI 4E70A 1DKPA 1EGQA 3M6FA 5AJVB 1GN8A 5AVJA 3SVZA 2H1OA 3OC0A 2E87A 3TBFA 1SKYB 4Z9BA 4MYCA 4RJJA 5DBIA 1BAPA 1W5EA 2YWXA 2GSDA 2ZEJA 5AI0A 5F1YA 3TRIA 4BGVA 4C4RA 2PXHA 3E6AA 2X19A 4G5YA 4DLVA 3FLEA 2WI8A 2QW0X 1Q21A 2VQEB 1V16A 3NBZC 2VRNA 4L28A 2ZUDA 2Q5EA 4CQNA 1RWWA 3SIWA 1GAJA 1YNSA 2AZ4A 2VHTA 1NV9A 1LPPA 2I4MA 4ICIA 4H7DA 3VU0A 2P5YA 3I52A 4CMEC 4YRBA 1WX1A 4MCIA 1W36C 2NO0A 2SKCA 4KQJA 1FPMA 4MWZA 5JJLA 2P9QA 1NNEA 3DAFA 4JJFA 4EHNA 4PO9A 4RANA 3OZEA 3VO8A 3TE7A 4N3CA 4PLTA 5LKAA 2ZCVA 3QU5A 4TYMA 2B7CA 4LTMA 1VHJA 2PRKA 1EJ2A 3P2KA 4LDJA 2X7HA 3PXUA 1DT3A 3DKRA 3AMVA 4NBUA 2PUTA 3H1AA 4C3UA 1ZXBA 1XRMA 4GE0A 3E0QA 4LHYA 5DHRA 5IN4A 4QVIA 4ZU3A 1OR8A 1EFVB 2C9DA 2NPOA 1E3WB 2VHQA 3K6JA 3OOJA 2R8OA 3ONFA 4IQ4A 1VI2A 2JFUA 3GJ3A 1RBMA 3HDTA 4UMDA 5J5AA 4JJIA 3TD2A 4P0QB 5F33A 5E9AA 2MR6A 2ZWIA 2WSMA 3EWNA 4M60A 4UJ5A 4GBGA 3NDJA 2P2NA 4G0QA 1D6SA 1EYZA 3CBQA 1TGYA 5K6AC 2OAP1 3E05A 2HRDA 1GZ3A 1G19A 2P67A 3IIJA 2A7XA 5HQTA 2AEEA 5JH7B 1Y6RA 4ANFA 3ZD7A 3PNPA 1EG2A 4JL8A 4NZYA 5BMVA 2FEOA 4V0OA 2E18A 2P3LA 4BO4A 3SAJA 2IIQA 2FPUA 4M86A 1CR2A 3UPDA 5IU6A 3OZAA 1TVEA 2DXIA 4H3HB 1QVZA 4DWWA 3R7SA 4AP5A 4WZZA 3SC2A 3DQQA 4NBSA 4HX9A 2OM6A 4RVCA 3WO0A 4KHPB 3KSUA 2I7DA 3ZJ4A 1QU3A 4JX9A 5CDFA 1QGZA 1FNCA 2PMWB 3PDWA 4KK3A 4Q3OA 4QTZA 4AZWA 5KKCA 1IBCA 1P5HA 1BVHA 3Q7EA 2DMRA 2QX7A 1WP4A 4QTUB 2G70A 2GDJA 4Q66C 1AUQA 4LNUA 3ZCTA 5H16A 4P4TA 4L7QA 4Q4DA 3B2NA 1YQWA 4EGSA 1Y82A 3ZWVA 4U2BA 3VPBA 3WYFA 3S2YA 4LV5B 1K92A 2WR8A 2HC9A 2WC1A 4EG4A 2AG1A 1DKQA 5G40A 4YROA 4H1HA 2W22A 4WZ6A 3ZD6A 2VPPA 3U49A 1XF9A 2XTAA 4KPYA 2ID8A 1VSVA 3B6EA 2L42A 3FPBA 3Q2KA 5EP1A 3THRA 5C34B 1K2VN 2F3RA 2SHKA 3CA8A 1G98A 3FR7A 2LR0A 2ZULA 2AI1A 3P32A 4X93A 5FHRA 1O0BA 3N8NA 3PGXA 3RTDA 4LOLA 2B2CA 2A0KA 2BT4A 2ZRQA 2XKJE 3IERA 4R51A 4Y9DA 5JYBA 2A92A 5P21A 1KZ4A 4BUJA 4AZ3B 2HSJA 3CIFA 2QJWA 3QBEA 3A6HA 1CXZA 1T1SA 3ON5A 5ERXA 2AJCA 4L22A 2GPJA 1JIKA 3DYVA 3FE2A 1P0MA 2H2AA 2HH9A 1Z2EA 3IELA 4FE3A 2OFFA 5LA6F 4DMRA 3FTFA 2BBOA 3DOEA 3QUTA 3NJ4A 3JARB 5D51S 3UT5B 3DEIA 3SJCA 1IY8A 4DOMA 1KDTA 1F4VA 4R05A 2IYXA 1KDPA 2E1PA 2QT1A 1Y4DE 1IXKA 2BRUA 2NACA 2R84A 2WT9A 3K1AA 3T7CA 1FNNA 1LI4A 2NT4A 2RHLA 5E9WA 1R4NB 1YUMA 3LMKA 3HKCA 5K6TA 4NNJA 1VG0B 5LLTA 1XD2B 3A28A 1MO3A 2Q45A 4AF7A 2WG2A 3L6EA 3WGUA 5L4SA 1MQSA 1HZZA 4AJNA 4RE5A 3NTOA 3ZIDA 3HCBA 4JI8B 5GPBA 4TPKA 4MARA 1CR1A 1X7GA 4A9AA 1XKXA 2XB9A 4B09A 3G9XA 3G9UA 4YO7A 5IBRA 5G1PA 3SXUB 2ZRDA 1ZGHA 2IDMA 3ASUA 1USIA 2P4HX 1JU3A 2WVGA 3GXBA 3K9CA 4HDRA 4MYSA 1EVYA 4HZUA 4AZSA 2G1PA 4HEA1 2ISQA 3V4FA 3EXHA 4HI0E 1VGVA 1ND5A 4N0DA 3D7RA 1LLFA 1ISFA 4F5EA 1E4EA 2A5DA 1KGDA 1NMEA 1SKUA 1IQPA 4ARZB 1A9XA 3QF7A 4ZAGA 1B8UA 2HBZA 1SCKA 2VA9A 3UMYA 4ZJZA 2DKNA 3W6NA 1EVJA 1B74A 1X70A 3WLKX 1VHLA 4YR7A 3WXBA 2NN3C 1L9XA 4X44A 3WRVA 3A1NA 2H9YA 2YY5A 3VR2A 2YV2A 1C30A 1T13A 2UUOA 3VOBA 3DQZA 1GYQA 5LSAA 1FFSA 4NXMB 2FAXA 2JLAA 3R40A 2C84A 3HXMA 1JSLA 1QFSA 2RHMA 3GAZA 3KJEA 4K9MA 2R7MA 2RK6A 5FOVA 1QRTA 1K75A 4YJGA 4I66A 4UFNA 4JYAB 3AY0A 3MNFA 2DOKA 2J07A 4IUDS 3QA9A 4MKGA 4L9SA 4A1OA 1M2EA 4BRUA 3OQOA 3ZWPA 1PX2A 3FOAA 1XG5A 1LFAA 2GEVA 1QBGA 4QBHA 4E12A 4E5DA 2EJTA 5CXQA 4O4IA 4DC0A 4EJSB 1RI1A 2IZOA 1OJ7A 2WA2A 3EA5A 2Y27A 3N2GA 4G5SA 1U3UA 5AOVA 3EISA 2JGDB 3IQZA 2ZRMA 1JN0A 3X44A 2XCSB 2GERA 1J2JA 2QZZA 5D1NA 2RGAA 4LF7B 1RWXA 3M3PA 1LJ8A 3H42B 2ZATA 4Q4HA 3TXAA 3ACDA 3MXTA 3SZUA 4ER7A 1WMSA 5F5XA 1JQDA 3EGDA 521PA 3VC2A 4D82A 2A9OA 2J9GA 5IFLA 3CUVA 3PNBA 1CY1A 3SS7X 2P8JA 1EHCA 1OIVA 3PUKA 5I9SA 2V4ZA 1AK9A 1YRQA 3DS8A 4IZHA 1M2HA 4FEEA 1H8EA 5JHGB 3FAZA 4ENWA 1JLLA 4FXOA 4P5DA 3S1AA 1T0PA 4B9AA 3OKPA 1SKYE 2J9FB 3B78A 1B3BA 3HGQA 5HMMA 3PUZA 4B75A 5K8TA 4XAQA 1C7JA 4LYJA 1LNSA 5JFGA 1OH5A 3I64A 4X3OA 1P6UA 1CUWA 4ASUA 2YCBA 1J8YF 4AU1A 2Q3EA 1UPCA 1V16B 3OTHA 4WECA 1SU4A 1E1QA 2I6XA 2JAWA 3C6BA 4XB1A 3WOVA 1HX7A 5HSGA 4OV6B 1R6DA 3FHOA 1YRLA 2C2MA 2EV9A 4I1OA 5CHEA 3REQB 4BYMA 3IMCA 3C97A 4U6SA 3UHAA 1K5GA 1I8TA 2YXPX 3AILA 4RK5A 2HRZA 2IHJA 2ID4A 3OJCA 4NJEB 4X7MA 1KVQA 4MQ5A 3VNUA 1R66A 4LJ6A 3DV9A 1F2TA 3WSWA 4LS3A 3OH8A 1G20B 2Y2VA 4CKEB 4JLMA 3OWOA 3KOZA 3Q3EA 3IQFA 4QYWA 2BE7A 4PN7A 4NU0A 1KEUA 1CQIB 1B8NA 10MHA 1F5SA 2YZNA 1WDKA 3HDGA 3TL6A 2OK8A 3CEPB 1AF4A 3G3EA 2B3DA 1ILEA 1ZJWA 2IRWA 4MS1A 4ES6A 3CHYA 1D0VA 1GPNA 3O2SB 3WB1A 4HLCA 2SICE 3RRZA 1GPWB 1WMBA 4BQNA 4IDHA 4AXBA 2QL9A 3BTOA 3DMDA 3MJTA 1YU9A 4M0PA 2E49A 3V1KA 1FP4A 3LLVA 5HBGA 2YWBA 4HBGA 4UXIA 1BFDA 3P2EA 3GARA 3VR5H 4G4SO 3WKAA 2GMWA 4B2LA 4NF2A 3U0VA 4EVRA 1O94D 2DM6A 1JPJA 1NUAA 2FW7A 2NXCA 3BBPA 1Z5WA 2VPIA 3AEQB 3IA2A 3O74A 3OLCX 5E7MA 2PU7A 2JJ1D 4W99A 3U62A 5CH5A 4P7KA 3TLGB 3KHKA 1KAEA 1CZHA 2W71A 3MPOA 5LLDA 4HN4B 2X42A 3PC6A 3LC1O 5HZGA 5C0OE 5SY6A 3OX3A 3I0ZA 4GT1A 1LQ2A 1VE7A 3O03A 1RRPA 1T5HX 2WM9B 4MVCA 4BMDA 5C80A 1JKMA 1HDRA 3DEJA 3WAGA 1JTEA 3DM9B 1MHTA 1JQJC 4N9WA 4X8OA 1KU0A 1FP7A 1CIPA 2PMFA 4W9NA 1Q1QA 3AI7A 5DP1A 3KD2A 1G3IA 1XWWA 4DRYA 4N65A 4TLAA 1J2YA 2EFYA 4HYTA 2ZT5A 1KYTA 3FG9A 4GC5A 1GFZA 4L9WA 4BNIA 1KEEB 5JS7A 2PUEA 3CPJB 3V8RA 4RTKA 3RQIA 3ZXSA 4XB6B 1NYTA 3JD4A 4BV8A 2O2GA 4WBNB 2UYGA 1L7VC 3PFFA 1J24A 3KTOA 2Y92A 3IR6A 2ABWA 3UCFA 4YHHB 5FB3A 1FUYB 2E4VA 2RHDA 1UP4A 1M34B 2FUNB 3KXIA 4ZPJA 2XIQA 3RFTA 3VV2A 1SEPA 1MU0A 4J7XA 4LXYA 1T1IA 3HLKA 3O2QB 5EXXA 3GBVA 4W1QA 421PA 4HEJA 3RVLA 4F3TA 1A9TA 1N77A 4XTCS 2FX5A 2WHXA 3FNHA 4CF5A 2PKRA 2C7GA 1U4NA 2ZUWA 1QE5A 3AERA 3G1TA 3TM4A 4YT4A 5A3QA 3NDPA 1OI2A 3KVOA 1CYDA 1EWQA 3KYCB 4EA7A 4HWSA 8ADHA 3CX6A 4YV1A 4C6TA 1FQWA 1KZHA 3SZMA 3V4RA 1CZOA 3MJCA 3OBIA 3RVSA 2IU0A 1L4GA 2DH5A 4M1MA 4OA5A 1OTXA 4Q93A 4U2CA 2PXAA 3LQ1A 2VDQB 2XI4A 2FWRA 1MVLA 3AXTA 2DPMA 2N1BA 3F6EX 4KQMA 4WFQA 3WMFA 1ZY2A 1M6VB 3AF3A 3WLTA 4Z0HO 1GRVA 1RYZA 3IAFA 2JFZA 3U61B 3PB3A 2HJSA 3BMCB 3L84A 1ILWA 4TYNA 3IR5A 1Z8DA 2WWGA 1GCGA 3BIJA 2FPLA 1QAMA 2G4LA 3EEIA 2Z98A 4KXQA 2FGKA 3PYXA 4IXDA 1KP3A 5E3HA 3BSSA 4JT4A 1AKVA 3OX4A 4NDAA 2X0DA 9ATCA 1F17A 3CNLA 4R0NA 1X1QA 2QVLA 6Q21A 4I1RA 2A9JA 4IMRA 2JVKA 3DZJA 3ABRB 3AEKA 4DCUA 5JV5A 4XQCA 2H51A 3RPEA 1JSZA 2BDEA 1OI7A 2DHRA 1LVGA 4RLFA 4HQRA 3D81A 3PZBA 3DKKA 3E84A 4OQ4A 5IP5A 5FL7A 2I1QA 3SHFA 1ADCA 1YQGA 4HUQB 5H82A 2QLBA 4DR6B 3PICA 4QD3A 1BHJA 1MORA 5TB5A 3RC9A 5FLKA 2ZBRA 2QZ4A 1QZXA 3AY7A 3MBKA 3ILHA 3O4IA 4WMLA 4YP9A 3CJTA 2QVZX 5AESA 5LC1A 2Z8YM 3D7LA 1JKJA 5TDHA 4HAYA 3STUA 1PTJA 1J7KA 1BCSA 1NE7A 5E95A 2CDBA 4XVQA 2XWPA 1G6OA 1CR4A 2IVFA 2R6ZA 3EDQA 4OHXA 1UKZA 3WO1A 3HCCA 3U2QA 4K7JA 3MYYA 4FI3C 1Z8HA 1ONSA 3KAKA 4JJGA 5CX1A 3UAVA 3R7NA 5FX2A 4MMZB 4S2UA 1XEWY 3H4MA 4OQYA 1GRQA 4E1VA 2FJPA 3LTEA 3TSZA 2IPOA 2I4IA 3MFQA 4Z0NA 5CM9C 4LGCA 1Z28A 4YUVA 3WGQA 4ZPXA 3I5XA 4QYMA 4EMSA 1ZICA 3VDNB 1FJ2A 1GG9A 2VEOA 2VP0A 2Z95A 1JDTA 4PU0A 1ORVA 1JILA 3HR8A 3GHHA 1XN1A 3L3BA 5D3QA 2IYQA 2ILTA 3W9YA 3AQIA 4M22A 1JQBA 4DQKA 2XR1A 1ZU5A 3USZA 4HQNA 5DMHA 3W3AH 1UDXA 4DLRA 2P1ZA 2CD7A 2COKA 3GEBA 2BGTA 2ECPA 3BGSA 1VZ3A 1ZUIA 2NZ8A 4BNNA 2WWHA 3ECSA 5JANA 1KFCB 4XM0A 3MHTA 2G28A 3RHZA 4BVLA 3DQPA 1UDRA 4HFNA 3R8XA 4BQIA 2Y0BA 3PZRA 3UTCA 1JHZA 1Y4AE 5F51A 4NONA 4FM9A 4I1IA 1NW7A 1QGUA 1ZVMA 3GT3A 1GYRA 2GB4A 4URUR 1XXHA 1JEOA 2QI9F 4DLPA 2JKVA 4YP6A 1G4AE 1C0IA 1QC5A 1F5NA 1X0VA 3ESXA 3CKKA 3F90A 1RQXA 1NVWQ 2GEFA 1RZRA 2VPZA 3LC2O 5LYYA 1LDMA 2GCEA 2R5FA 2XOKA 4KACA 4F2GA 1FSZA 4ZCQA 3PIDA 2HKIA 3DL0A 1G291 4U3JB 5TGTA 4E5VA 4EY7A 2J41A 1ZSYA 5HCUA 1Y3HA 3RRYA 1L5SA 1YK0A 1KETA 2AJTA 1FP2A 1CQJB 5J2UF 4DV3B 4AG6A 1BRMA 1NI5A 3DDUA 3SE7A 2F3PA 3GR6A 2H9AA 2WQ7A 4X66B 1HL7A 5BSTA 4TRRA 4Q9AA 1QTQA 3EIUA 1GPAA 1KI6A 3IKTA 3CNBA 2DCUA 3AVPA 5JSKA 3QXCA 4GFDA 5LXTF 3ER8A 2GM4A 2XGSA 1XMOB 2V65A 3DF7A 4KDEA 4FFSA 1N2CB 4DNXA 3HA3A 3LK7A 3C6ZA 3PPXA 1TO6A 3VX3A 1XK7A 5KSZA 2PKQO 1P1BA 2P4UA 2V7PA 1DJPA 3QHAA 2FOLA 4HNUA 5BT8A 2IW3A 2W2LA 3KT6A 3SZ3A 4RTRA 2HF2A 2YYZA 3LWZA 3BD7A 3QA3E 3CG0A 2HWWA 3D0KA 4BZWA 2CLMB 3KVRA 2QQ0A 2VP6A 4JH0A 5HG0A 2OCYC 3L9TA 3NETA 3MBOA 4AXXA 3NATA 2J33A 3IDQA 3NTXA 1DQRA 2E6KA 2H1VA 1RMQA 4ER3A 4C0XA 1W87A 4EITA 5MN5A 2WMOB 3N2EA 1IBRA 1KI1A 3NJ8A 621PA 5GVSA 1U3TA 3LA8A 3SEFA 2E89A 4HWPA 4O4HF 1JE1A 4LRSB 2I6UA 1PL6A 4DLTA 5T6MA 2BDTA 4MUBA 4L0QA 1SHLA 5CEEA 1G63A 1KMCA 1COWD 4L4RA 2B6NA 1Q50A 3HN6A 1HPLA 4H15A 4ND6A 4YREA 3WA7A 2CV1A 5EE1A 1PQPA 1W6RA 1Z37A 2HU8A 3HZZA 3ISVA 5AVVA 4S05A 1VE9A 3EIFA 3OHPA 3ZEAA 3O8NA 3CKMA 4PTYA 5JD4A 5JMWA 3QE9Y 3ZDAA 1NL3A 2XNHA 5G4KB 3EWIA 4IDGA 4N3BA 2PQMA 3RAPR 1YACA 3P9ZA 4D57A 1BXRA 2I1WA 3G89A 4YRLA 4OHVA 4ABYA 1XKLA 2IYTA 1JE0A 1LJUA 5DI9A 4L78A 1I3OA 4DLYA 4U0KA 1SU8A 5IJ9B 2WHRA 4CV2A 1I30A 1TX4B 3VR4H 3LDGA 3OEWA 4MAAA 2KS6A 2PSEA 3OCJA 4FFRA 4Q05A 1KEEA 5LMUB 2HJGA 3HPQA 4UM8B 4EWLA 3MCWA 1EBUA 2VUUA 4MUEA 5THXA 2ZRIA 4JEHA 4BLTA 2QMQA 3I39X 3KDPA 2F4NA 2OENG 5AK3A 4EOGA 5CDSA 4J3FA 4JCCA 4DVJA 3HU1A 4P4UA 2JLSA 2PKWA 4BP1A 4CL0A 1W35A 2PMKA 2ZSDA 3AO0B 4DLUA 5EY5B 3PQ4A 4YRCA 3UGKA 4AJ2A 4U6QA 2QUJA 4INAA 3FN4A 3RQSA 4DBLE 1HT2E 3GRZA 3EZ2A 5CTJA 3LAWA 3WV5A 1W53A 1CUGA 1QCCA 3D6VA 1O9BA 2IYVA 5D5HA 4JDPA 4P3PA 4U02A 2ZWMA 5TC4A 3F7OA 4D46A 4KZKA 4HNRA 2Q0HA 2ZTVA 3WICA 3UJ8A 4NE9A 3EFBA 1PWXA 4LDAA 5GVRA 5AKEA 3P0HA 3AJ9A 2CE2X 3A14A 1JXMA 4IJKA 4L15A 2JA1A 3DAGA 2KW5A 4Y8VA 5AW0A 4KR6A 2P2DA 3CH6A 3S1LA 4WGGA 1EGMB 1GGHA 1UBNA 2H59A 3O82A 2ZUEA 2PUWA 2V9ZA 1FPQA 2H1FA 2WABA 4J94A 3ROMA 2XUFA 1VA4A 4G24A 2VI5A 3L2OB 4TMFA 2BHNA 3G2NA 3E9DA 4Y9SA 1GA4A 1VQ1A 3RS8A 1T1RA 4QXQA 2JEOA 1WVIA 2GHTA 4XDGA 1VJ1A 3WNQA 3RS4A 4KRYA 1L7DA 5JYCA 2CJWB 3K0AB 4RHYA 3IOBA 4BKRA 3O26A 3ESZA 1HFKA 2P4EA 3BWVA 3AHJA 3ZE8A 4OI0A 4JY7A 1DAKA 4ENVA 4PAOA 1Q11A 2FV8A 2QUHA 3L82B 5AI6A 4WJKB 3EVGA 3AEKB 4NJMA 1W4BA 1GZ4A 3B6KA 5C8ZA 4Q0MA 4FNOA 2BLNA 3BB1A 1O77A 1TW3A 4EG0A 1TEHA 3GRCA 4PFQA 3H1GA 5B1HA 2CWWA 4MA4A 1QKKA 1IPEA 2NTVA 2G9VA 1D4ZA 4KC0A 4ZAXA 3CB4A 3RUEA 3T35A 3VNRA 2CFRA 3T5DA 4KRGA 1ZMRA 2VDMB 3H2IA 2XE6A 2Q8QA 4O4LF 2F3SA 5A5VA 2XXAA 2BWJA 3P19A 4B80A 2UUPA 3LX4A 5ARCA 2J5KA 1KI2A 4JP8A 1HURA 1RRMA 3MOIA 3CZMA 1IN4A 5CCEA 1SLYA 4G0VA 5CTAA 4HDOB 4UPEA 1C1XA 1ESDA 2XXBA 2FW6A 4EI7A 4DR2B 2IXTA 3C8MA 4BGIA 2VDKB 2ZKLA 4Y6PA 3NPAA 2P3SA 1B6GA 2BGRA 4PYQA 1P4SA 1Z34A 1JZTA 2PRYA 1ISJA 2GM3A 4WN3A 4XSGA 5BURA 5IM4F 4ZOBA 1EBFA 4JBIA 3H20A 5AK5A 4FFBA 3KCNA 3MTBA 2VT7A 2GOYA 2AL7A 1N1GA 1YFKA 4MQ4A 3H1TA 4R3UC 1R4MA 3L40A 5F7JA 2Q2OA 3FUUA 4X6UA 2Q5OA 5FO1A 3GCWA 2QS9A 5D8DA 4Q37A 2FE4A 4WY5A 2DCMA 2FPSA 1FFHA 1W9MA 3G8AA 3SICE 1E6CA 1Z3IX 1QDLB 1K0UA 3F96A 4IRUB 3VSCA 2VYCA 4G01B 2IS6A 3C98A 3IT1A 1XHLA 4LVNA 4BCDA 5MN4A 3DE2X 3M6XA 4FMCB 4ILEA 4X92A 3IEPA 1NC3A 1US8B 5LQMA 3CEJA 4URXR 3B9RA 2E5LB 4R54A 4BVEA 4J1TC 3KB6A 4IG4A 5EP4A 3GG9A 2VAVA 4ZVTA 3WIOA 4E4TA 3U80A 3K94A 3ZY4A 2X0JA 1RRGA 3ZGZA 3FPHA 3MJVA 4ZOLF 4CKWA 1I4LD 4P3KA 1QU2A 3M6WA 4CG3A 1GTG1 1SN7A 2K2QB 4XKJA 1Q5PA 2GTPA 4EUSA 4B3GA 3NHWA 5TXGA 5KU7A 4JLWA 1X38A 4AY4A 4F5YA 6REQB 3JQPA 1NPDA 3TDNA 2G3YA 3Q12A 1HDOA 1ZH0A 1IC6A 3GEGA 4IQGA 1D2AA 1TI7A 3OI7A 3OZDA 3T3DA 4EELA 3BH0A 3VO9A 4UW9A 4YIHA 1K88A 2DUNA 2B1RA 2RI1A 3OUZA 1R27A 3NALA 2OV1A 1R16A 4H6XA 1JDJA 4ITUA 5C37A 1HT1E 4CI9A 2PUGA 4E0BA 4ZA2A 1UBGA 2VTBB 5IT0A 3OPYA 4WD3A 4ZJPA 1M83A 5EFZA 5KTTA 2NVBA 3GCGA 2ZUBA 2AFHB 3UHJA 1F6DA 2RHHA 4RABA 1PN3A 1DWPA 4GSLA 4GX0A 2JHFA 3IODA 1E2LA 3OO1A 1A27A 3N58A 2GFIA 3JWEA 3TM5A 4DG5A 3OT1A 2MINA 3HA7A 3M82A 3DZCA 3CTMA 1MG5A 1UK8A 2JAOA 4BOYA 2A59A 4ND2A 1WV0A 4QSHA 1ID8A 3RBXA 1EUDA 5K0CA 5CA1A 1JG3A 3DOOA 4MQFA 4D79A 3TVYA 2XDWA 1PSZA 4TKMA 3E5HA 4MTCA 1O7JA 4ZXFA 3TCKA 3R5TA 4CJXA 2O9JA 3BREA 3PI7A 1T3TA 3K9QO 1FX0B 2EF1A 2O4CA 2XQFA 3VR3A 4YV0A 2Y1EA 3O8OB 3MRXA 4UEOA 2ZGVA 1WZEA 3DW1X 4EHKA 2VHXA 3AR7A 4CTJA 7ABPA 3KQHA 1P29A 1Z0SA 1Y5IA 4TXHA 3HCDA 2I6QA 3CH4B 3T1QA 3JAKB 1HV8A 1G5TA 1XPOA 1J20A 1H0RA 3SQLA 3RK4A 2G4CA 2IUYA 1IK6A 2GF0A 2VCYA 3G2PA 3KK0A 4XRRA 4E11A 3DMRA 5L4LA 4MMXB 3X1ZA 4AIIA 3OP4A 5AK6A 4W7IA 2AOTA 2W48A 4Q7QA 4OH1A 3ILSA 1JQKA 2YZMA 2HLDD 3DM5A 2Z57A 1GCAA 2WM2A 3JZDA 3BMOB 1LPAB 5KSYA 5L7TA 3W5BA 2Z6QA 2ZZMA 5C51B 3MM4A 1X13A 4FHGA 1JBEA 4F2DA 2FLVA 3T7KA 1K8XB 3AESB 4BP8A 2P79A 4US1R 3VSEA 1U0OC 3VR0A 3BILA 1K08A 2AJLI 3MTIA 3ROGA 2E21A 3RVDA 2FP4A 2PMEA 2B8NA 4Q18A 2WUGA 4MB6A 1N2JA 2VR1A 2YIDA 1QGOA 4R2LA 4U2DA 1X1SA 3BRCA 4TTPA 5THQA 1UPTA 4E2FA 3LCVB 3C3YA 4NYMQ 1KNXA 5FO0A 3L7LA 3BJRA 5AI9A 4XCXA 4J2OA 5B3JC 2Z3WA 1KR5A 1IULA 3ES9A 4P58A 4QHSA 3IP9A 3A58B 1JIUA 1LV8A 3PGJA 2R8PA 5TQVA 3ZTTA 3E03A 3GLUA 3GWGA 4DXDA 1C0EA 3AM1A 2O1WA 1ZEJA 2QQ5A 4FCWA 4RNDB 5KYYB 3J81k 5AJWA 3ZHTA 4O08A 3HBJA 4DDKA 4GKAA 5FTJA 2QG6A 3KTDA 1RQNA 3DEKA 2BMEA 3OQJA 3T0FA 1KSFX 4DIUA 4MROA 3CRZA 2X5NA 1L5NA 1FLNA 1Q74A 4KDRA 4LAFA 4XIYA 1FMCA 4ITRC 1JR3E 5F1PA 3D8HA 4AZTA 2R4UA 4RMNA 4YPFA 1GPYA 2H6EA 3A3YA 4D7AA 1C4XA 4XEHA 1LBIA 1FZQA 1TD9A 3Q0TA 1RLUA 1M74A 3QFCA 2ZYWX 5K3BA 2OKGA 3LCCA 4N5IX 3ZWMA 1P5FA 4CLDA 1K9SA 3QKRB 3AHCA 3F5DA 1HF3A 4HLQB 4NFSA 4BC1A 1L5ZA 3OKCA 3Q41A 4E07A 1B6TA 4Y7DA 1MVNA 2QN3A 1XGKA 1MDBA 2VS1A 3B20A 2QL5A 2QRQA 1E2KA 1ZZGA 1OHHA 1TUBB 5GP1A 4BX2A 4BO7A 2VWPA 3FDJA 1WLSA 4ZJYA 4KQWA 1XL1A 2XA9A 2ENWA 2YJ6A 3CIOA 4J4TA 4QBTA 4RS3A 2FN3A 2B1QA 3AUAA 4DIEA 2QN1A 1WLYA 2XTJA 4RLHA 3TQFA 4F71A 1SCAA 5LR6A 4QECA 1OB2A 1NZDA 1TMOA 4OHKA 1YI0A 4MVWA 5A05A 2JK1A 4JKIA 4A2CA 3PXGA 3RRMA 4PSVA 2B2XA 5IM5A 1HWYA 1XQVA 4FDVA 5CDTA 5DN6A 4WLNA 3NGMA 3DF9A 4OK5A 2F9MA 2EL7A 2KJQA 3LK6A 2RC5A 4G8JA 1RQRA 1SM4A 2G40A 2I8CA 2D2VA 2BKUA 3NRCA 4XB2A 3UXMA 1ZRSA 3UJ3X 2Y1DA 2JNWA 3HJTA 4LWPA 2VOEA 3RIEA 3VZDA 3OOEA 2BM9A 2VPTA 3AW9A 4I4CA 4K9OA 3UAWA 4CVNA 5BXYA 1YOVB 3I62A 2UYOA 1AS2A 4BRZA 3ZZ0A 4GPBA 4C2AA 1NWCA 3RFVA 5TMEA 3RT1A 1MQ8B 1E7SA 4DIKA 3QX7A 1OYWA 2PX2A 2XZTA 4CF6A 2LRHA 1YK1A 1AA9A 1UBUS 2VIIA 4HK4A 4WWHA 4AJIA 1RFGE 5K0FA 3U4MA 1FDTA 1U3CA 3GFFA 1HDCA 3F67A 3PKIA 4LNAA 1VMAA 2OZKA 4NSNA 3TLEA 4EKGA 3HJCA 2ZITA 3OUUA 5ECGC 4V38A 1F7UA 1A8PA 1QB7A 2GUGA 3KKNA 4MPRA 3ZLVA 4CMHA 1J1UA 1IEQA 3TQCA 1ZVQA 3L0IB 1E3TA 3OKAA 3T7RA 1QR2A 5LOVF 1ODFA 1EWKA 1Z0ZA 2K5UA 1W5BA 4YDSA 2H8GA 1KFJB 3T5AA 4N12A 4QTYA 4G6ZA 3HUUA 4R5MA 4N5HX 4IH9A 7MDHA 4PX5A 1Z06A 3SVLA 3EXIA 3OEHD 2O2IA 3GZNA 3Q15C 1MC8A 1SULA 1ZRMA 4KYVA 3N5CA 1T24A 4LRYA 3ZDCA 5TRTA 3FFBA 1SC3A 5DKFA 1EP3B 1IG0A 4M8NE 4V3BA 1O4WA 3C1AA 1US8A 4QUGA 4OGFA 3RRFA 3PUXA 1X7HA 1DJNA 3O2JA 1VIVA 4WBNF 1A8SA 1GZHB 1EK5A 2PEYA 5EJGA 3UUGA 2VBCA 1VI5A 5DCWA 1JAZA 1OW3B 2BKXA 4CKCA 2PJRA 3G2MA 4KVZA 2BEVB 3AR2A 2RE8A 2TMGA 3IMGA 4NMWA 1CEEA 2B34A 3V00A 3SQDA 1M0SA 2OZVA 2JS7A 4YDRA 3COYA 4UZFA 1RC0A 3O4VA 4MVJE 1EKXA 1O9HA 2R11A 2ZJYA 2OAQ1 3DOUA 3H97A 4X61A 5BMVF 3T38A 1M2VA 5DU2A 1BJRE 1LBQA 3ZWCA 2J5BA 4GP7A 4FHFA 2AOXA 3TLAA 4OB7A 5F7XA 1OASA 4NENB 3DDZX 5I6DA 3FMPB 1TMGE 2E6UX 4RWEA 4AMVA 3ZHVA 2V6JA 3IC5A 2O3UA 2NXJA 4FIZA 4FS8A 4FYHA 4AULA 1SUCA 1TW2A 1TYEB 3TUZC 3GLIE 4UCXA 2D8AA 4N6GA 1F2UB 2HZBA 1SHKA 2FDXA 3L4BC 4PHTA 3E3OA 5CGQB 3WBJA 3PDJA 4Z9XA 2HXGA 4M0KA 1JEAA 3ESCA 1Y8ZA 5DMXA 4JB2A 1Y8QA 2MJLA 3VHLB 3PVSA 2ZUTA 4JXJA 2O8CA 1FUIA 1OPRA 2X77A 4BFZA 2HGZA 4DRXA 1NXXA 3G2QA 5FFNA 5CBPA 1AY0A 4HWRA 4QU5A 3OEYA 1KZ7B 1CP2A 2JZOA 2G1JA 3RWBA 1IWPB 3CZQA 2IHBA 4N01A 4OI4A 4ZO7A 3TKYA 3WKEA 3UYLA 1A4XA 3AUJB 2ZI5A 1FTNA 3DBIA 4DE5A 2YMMA 1SHZA 4P08A 1H94A 1RXUA 5C7LO 5JDIC 1IXYA 2C95A 3NDRA 1WIWA 3UGQA 2I0FA 4QBFA 4YAEA 1D1TA 2X76A 2OHVA 3JALA 5JAPA 4GOMD 5A5DA 2XNKA 4BNXA 5LZ4A 4DDWA 5IJAA 4J3NA 5HJ7A 4RD6A 3ZY3A 1K3TA 4F92B 4LSWA 3KX2A 5C1PA 2WD8A 1VHTA 2ZB7A 1GFWA 3KZOA 3N5KA 1K4K