3F0IA

Arsenate reductase from vibrio cholerae.
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
119
structure length
119
Chain Sequence
SNAMSVVIYHNPKCSKSRETLALLENQGIAPQVIKYLETSPSVEELKRLYQQLGLNEVRAMMRCKEELYKELNLGDSQLSDDALFAAMAEHPKLIERPIVVCNGQARHGRPPEQVLEIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Arsenate reductase
publication title X-ray crystal structure of Arsenate reductase from Vibrio cholerae.
rcsb
source organism Vibrio cholerae
molecule tags Oxidoreductase
total genus 32
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03960 ArsC ArsC family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3f0iA00
4KUNA 2H6YA 1UVZA 3U6VA 3ZITA 2MMAA 1BX9A 3DXBA 4WEYA 4J57E 3RPNA 1QFNA 4NHZA 2IL3A 1GUKA 1A24A 5LNKe 1PSQA 4HUAA 4RQRA 1ZCPA 2WRTA 1HNAA 2H6ZA 3HZ8A 4X1UA 4BVXA 2QSIA 1VF1A 1QMVA 3HA9A 2DBCA 2KHPA 6GSTA 3EU3A 1KTEA 2X8CA 3IAS2 2DJKA 4YQVA 3CRTA 3GTUA 3HVSA 1X5EA 1T1VA 3TOUA 4PUFC 4EDYA 1QK8A 10GSA 5DBQA 3L9VA 4ZBAA 1AAZA 5B8AA 2G2QA 3ZFBA 3A5WA 1HNBA 4DSRA 2R3XA 4MP4A 5EPFA 2X8HA 4K1FA 2LNSA 1GULA 4BWSA 2X64A 2YV9A 2IIYA 2I3YA 3IE3A 4GWRA 4XRAA 1A0FA 2L4CA 4XCSA 3MNGA 5B7CA 1Z7RA 4AJ8A 4J2FA 1TRWA 4ACSA 1SD9A 4XS1A 1EP8A 4PGTA 1R7HA 4NPBA 3QAWA 4KW6A 4GSTA 1GUMA 1AUCA 2F9SA 4F0CA 1HQOA 4MZWA 1FAAA 1WPIA 1ZL9A 2O85A 3GX8A 2P31A 3C1SA 4WETA 2DIZA 4HQZA 3DRNA 1J08A 4PNFA 3RHBA 3FR9A 3ZIJA 4QQ7A 4Q5QA 4IKHA 2VOCA 1XVQA 1WP0A 3GH9A 4EF0A 1AIUA 5JWOB 2ZNMA 5ABRA 3QDNA 4JU5A 4ZIJA 4ZL9A 1K0OA 4MMMA 3W8JA 2JU5A 4ECIA 1PMTA 1ABAA 3ME8A 1GTUA 2H74A 4OWYA 2H71A 3J7Yb 2H01A 1T4ZA 3KP9A 2GSSA 2IWTA 3KMNA 2V41A 5HFKA 3GYKA 3PGTA 3G9BA 2R37A 4KCAA 1YKAA 3KH9A 2CZ3A 1Z6NA 4KB3A 3IPZA 3P7XA 5DVBA 2DJ1A 1HD2A 3WT1A 5IOXA 2IPAA 1G6WA 2HZEA 1XWGA 1OC9B 1XWBA 4XS6A 1GNEA 4G9HA 2PN8A 2O89A 2GQMA 2XC2A 3LGCA 3QAGA 1O8XA 2YOIA 5CRDA 1MDKA 1B48A 5G30A 2MBSA 3KEBA 5J3RA 4IELA 2OKAA 5ECRB 2IMDA 2YV7A 1AW9A 2L5OA 1G0TA 5JCWA 3GTUB 4POBA 2M46A 4J56E 3CMIA 1QUWA 2VLTA 5EL8A 1Q4JA 5JWRB 2AJQB 1B9YC 4XS4A 2C0EA 1G6YA 3D0ZA 2VCZA 3TKPA 1J9BA 5COHA 2GGTA 1JZOA 4JEDA 3KGKA 4IGJA 2FA4A 4POKA 1OC3A 5D9VA 1X5CA 2ON7A 1XOBA 2OE0A 1LBKA 2AV4A 3RBTA 1FW1A 1X0RA 3ZL5A 5D96A 2HXKA 4MF7A 2BJXA 1UA5A 2WFCA 2DJ0A 2MMZA 1QGVA 2HRNA 2ZCTA 4BWQA 4IP1A 1TXXA 3ZLPA 3HVVA 1JHBA 1TU7A 5GSSA 1BG5A 1JZWA 2B5XA 1V9WA 1QQ2A 1XW9A 2NTOA 1ACVA 2HYXA 2JADA 2OE3A 5D73A 2GT6A 5C00A 5IMAA 3BBYA 4ULXA 2LQQA 1YY7A 1TK0B 4OFTA 2J23A 3F9UA 5IO0A 1SK1A 1XW6A 2JL4A 2GLRA 2TRCP 2HE3A 5H5SA 1JZDA 2FNOA 1ZYQB 3D22A 4KAEA 3ZRDA 1ERVA 1PX7A 6GSSA 3QFAC 2LJAA 2P0GA 13GSA 2PVQA 4LLRA 4ECBA 5GSTA 4GLTA 1V2AA 4MA9A 4EE0A 2DC5A 1Z7PA 5KEJA 2H75A 4DSSB 1EP7A 5KN0A 1A2JA 1XW5A 2H66A 4FYUA 1Q98A 4G19A 1TKDB 3KMOA 3GA4A 4IJIA 3O76A 2VD1A 3TJBA 1LJRA 1ZOFA 2GSQA 4PQHA 3NIVA 3ISOA 1B8XA 3F4RA 2CVKA 3AY8A 3I69A 3KXOA 3GSTA 4ISDA 4ZILA 3HXSA 3KP8A 3KTLA 1Z3EA 2WZ9A 3A2XA 4ZL7A 1TK5B 2OA7A 2E2MA 1OC8A 5IMCA 4NXIA 3TJKA 1MD4A 3FR6A 1PL2A 2N5BA 5B6MA 1M7TA 3APQA 2LNTA 2FHEA 3HD5A 5AISA 4IJ3A 2GT5A 4ZB6A 5D8IA 3HDCA 5H5QA 3PR8A 3DKSA 3P90A 1O6JA 5ECLB 5FWGA 4TR1B 4WBRD 4CDOA 2C0FA 3TRXA 3F8UA 3D4MA 2IN3A 5AGYA 2AHEA 3FR3A 1PN9A 2C8UA 5G2ZA 6GSXA 1GNWA 5IPHA 4NV5A 1TOFA 1EWXA 3GFKA 3GIXA 3HY2A 2EIOA 3E3EA 4ZXGA 4X43A 4XRDA 2CQ9A 2GQLA 4WF4A 1GLPA 1GP1A 1KBNA 2M72A 5ENUA 1VGLA 2C80A 2E7PA 3DYRA 3UBKA 5CAXA 4CHSA 2WB9A 2YNXA 2LEGA 1SENA 1T7PB 5D93A 3O3TA 4K7OA 1NSWA 2B6MA 5IM9A 2IFQB 1BYEA 4K9ZA 2OBKA 1OE7A 3QR6A 3TKSC 1JZRA 2HZFA 4RI6A 5EY6A 3GNJA 4K0NA 4RUVA 3HJPA 5CRGA 2EC4A 1T4YA 1SKSB 16GSA 3TKRA 5HQPA 2GDRA 4YQMA 5E4WA 1C72A 4ID0A 3E0UA 2M80A 2PVOC 2VIMA 3FY7A 2WGRA 1SYXA 5IO2A 1J0FA 1I5GA 1M2AA 1Z9HA 2AYTA 1OC9A 3UVTA 2PUKC 1PKZA 4TR3A 2XHFA 3HKRA 2DJ2A 2H0HA 4RQXA 4WR5A 2LSTA 1PA3A 4HJ2A 4KE3A 4JBBA 1N8JA 5ECOB 1SJ6A 2AB6A 2HT9A 4MDCA 5IMVA 3ERFA 1CQHA 1NHOA 3F3RA 2FGXA 4ZBDA 2IMKA 2V2GA 4KA0A 3L9UA 1FHEA 4LA1A 4JR6A 1GTIA 2O8VB 3F3QA 1X9WB 2YPMA 2ALBA 3JCML 1SU9A 1YKCA 4XHMA 5JCGA 2FWHA 2KP2A 2LTKA 5J4UA 1X9MB 2WS2A 1FOVA 1ON4A 4Z7XA 3A3TA 2AAWA 1GSSA 3EMPA 1A2LA 4IW9A 1BJXA 1THOA 1XPVA 2GTUA 3D4TA 4EKZA 1NHYA 3VK9A 1X5DA 3L4NA 4JR4A 1DBYA 19GSA 4TXOA 4JZQA 2C3TA 1TP9A 3EURA 3IK9A 2V1MA 5DDLA 1GTAA 1R5PA 4MLYA 1F3AA 2LV3A 2LQOA 3VWVA 1HYUA 1NM3A 2L57A 1ZYEA 3ZVJA 4MF5A 4AJ7A 2R2JA 3I9V2 2GVPA 3GURA 5CP1A 4IBPA 3TCOA 3FK8A 4ML1A 3GKXA 4V2LA 5ELAA 4PXOA 1Z5YE 5D9XA 3QCPA 2PMTA 3W6GA 3HZ4A 3FZ4A 1K0MA 1Y25A 3C8EA 3QFBC 4EC0A 3R2QA 1SKWB 1GUHA 22GSA 4D73B 4ECCA 3TJJA 2XBIA 5CO3A 1AQXA 4TR4A 4TR0A 4EDZA 3ZVJD 2A4VA 3QD9A 2N5FA 5IQYA 2OADA 3KD0A 1K3YA 4GSNA 2V32A 4DSSA 5AIVA 4LL4B 3FYGA 1S3AA 1YEPA 2XPEA 5GZZB 4AF2A 4EVMA 1F6MC 2H72A 1K0BA 5CREA 9GSSA 2VCTA 4G2EA 1A23A 1CQGA 3VPQA 2FWFA 4GXZA 4V2NA 2KUCA 2HRFA 3GHAA 2CZ2A 3H79A 3RDWA 3L0HA 1V58A 3VLNA 1WOUA 1EZKA 4H86A 2V6OA 1V57A 3UMAA 2B7JA 3A2VA 3HCZA 4KX4A 5D9TA 1O81A 1PL1A 4EO3A 5HR2A 1IYHA 4Q5RA 5ECHB 3EU4A 3K8NA 1FVJA 3ZTLA 4QL9A 2L59A 2DJ3A 2HNLA 1H75A 2I1UA 3GKNA 2OJLA 1WJKA 3GL3A 4O5RA 4TOPA 3C71A 3UBLA 1NW2A 1XZOA 2H1BA 2B7KA 3RPPA 4LMWA 5F0GA 1U3IA 1YDKA 3DIEA 4MJAA 3SBCA 2QGVA 3CSJA 2EIRA 3GKKA 5KN3A 4TR1A 1K3OA 4ZBBA 3S9FA 4NV2A 3L78A 1URMA 5HR1A 1MEKA 4MCUA 3TKSE 2I4AA 4MJEA 1R26A 3IHQA 5DCHA 5DJLA 4TXOB 1WE0A 4PNGA 1OKTA 5CYYA 1JFUA 2X99A 1M0UA 4KGIA 2H19A 4FIWA 4G10A 3LQ7A 2B5YA 2KP1A 2GS3A 4I8BA 1O85A 3WGXA 3VWUA 1O73A 4YAPA 4NHWA 2RIIA 4WR4A 3V1WA 4I2UA 6GSVA 2VL9A 3DEXA 4ILFA 1LU4A 2D2ZA 3ZIVA 5FT3A 5ID2B 2JZSA 4OO4A 3C1RA 4MJBA 4KCEA 1T3BA 1V40A 3UEMA 2N5AA 5JCUA 4MPFA 4HJMA 3A2WA 5KN1A 4TVEA 3IV4A 2IFQA 1A0RP 5G5EA 2KOKA 5DAKB 1N2AA 3QOUA 2YN1A 3OR5A 3DWVA 3MDKA 1AXDA 4NMUA 3IAM2 4OCEA 1M9AA 4IS0A 3FZ5A 5DJMA 3F6DA 3U5RE 3VI7A 2REMA 3VURA 3KZQA 8GSSA 1ERWA 4OFMA 3GKMA 5A5KA 5INYA 4HU9A 2RM5A 3G7YA 4FO5A 4HZ2A 3QMXA 2NDOA 2CX4A 2JACA 1EGOA 3EVIA 2LS5A 2H0IA 2B1KA 2PU9C 3WT2A 3KM6A 2MZCA 1K0AA 2HSHA 3IDVA 2C0DA 4JE1A 2YZUA 2RM6A 3M9JA 2FCHA 3C7MA 3H8QA 3US3A 2NVLA 5IMFA 4Q5NA 1OYJA 2BMXA 4EXJA 1W89A 2LRTA 3M9KA 1RW1A 2VM1A 1DE2A 4MABA 2YWMA 1A8YA 4GSSA 5G1KA 1EEJA 4EUYA 3IOSA 4ZL8A 1SJZA 2YANA 3LORA 3KTBA 2EIQA 3EINA 3UIWA 3LYKA 5G31A 4TN8A 5DQYA 1SJIA 3ZYWA 3KH7A 3HHVA 4PX1A 3GN3A 2E2GA 1SL2B 1TRSA 4PQIA 2I81A 4POLA 5EVOA 4AJ6A 1K0DA 2K9FA 3LXTA 2VUPA 5J9CA 2VCVA 3VFIA 1SL1B 4OCFA 4N10A 1S3CA 1ZGNA 1RK4A 5H5RA 7GSSA 3TOTA 1FVKA 2X8GA 4K8MA 1Z6MA 4O92A 1ML6A 4HI7A 3F4SA 5ECSA 1EEMA 14GSA 4CW9A 4LMVA 5LD0A 2CX3A 4WKWA 5F05A 2RLIA 1TDIA 1ST9A 4MH3A 2OE1A 2CVBA 3HVXA 5GAPD 4GTUA 3N9JA 3NZNA 4L5LA 3O6TA 5ELGA 1EGRA 3BCIA 2VL2C 4D73A 2DLXA 1V98A 3DVXA 3PINA 5G1LA 2GSTA 2FUG2 1A8LA 4ECJA 1DE1A 2VCQA 3BCKA 1GSQA 3RHCA 2L6CA 2YWNA 1OAZA 5IPGA 3UAPA 2VO4A 2JSYA 4LL1B 2XPDA 3BD2A 12GSA 1PX6A 2H76A 2YCDA 4I6XA 1VF3A 4Q5FA 4OFNA 2WULA 2HSYA 1ERUA 2R6KA 2ZUPA 1OE8A 4GRFA 2HFDA 2GZZA 4PURA 5IOWA 3MSZA 5AN1A 2IMFA 1GSFA 2DSAA 4MJCA 2L5LA 4L0UA 4F03A 2LJKA 2H6XA 3ED3A 2RUEA 3QPMA 2XBQA 3LSZA 2MMOA 4K2DA 5E59A 3M8NA 1FB0A 1XVWA 1YF0A 5CNWA 3Q19A 2K6VA 2C1YA 1KEBA 3GX0A 1QXHA 1U88A 4BVYA 1K0CA 3HJOA 4OO5A 1TJDA 2BTOT 3LYPA 4FYCA 1XIYA 2VM2A 3GV1A 2LRNA 3D5JA 1YQ1A 1YF1A 5CRWA 4HU7A 5LCZA 4HQSA 3LFLA 4KSOA 2HLSA 18GSA 1F3BA 3ZZXA 6GSUA 4L5OA 5G5FA 3RAZA 1PKWA 4IQAA 5J5NA 5L71A 4MZCA 4WBJA 1PQNA 2CV4A 1VF4A 4L8EA 2FWEA 3DGQA 3N5OA 2E0QA 2FA8A 2GSRA 2PERA 2L4QA 1DSBA 3D21A 3FRCA 1F2EA 1F37A 2HI7A 5IIZA 3ME7A 2K18A 2PBJA 5ECMB 3PH9A 1E6BA 4N0VA 2YZHA 3EYTA 3LWAA 4NWYA 1XBSA 4AGSA 2YJHA 4F82A 2B3SA 3ERGA 3LG6A 3FHKA 4TXVA 5ID2A 4GQFA 1W4VA 5J41A 1H4OA 4V1Ap 2MYGA 5KN2A 1TRUA 4KDXA 2F51A 1I9DA 5DAKA 3GMFA 3FZAA 2K8SA 3TGZA 2K8VA 4V1Ag 11GSA 1U87A 2ES7A 1PD21 1A2MA 3IR4A 3TB2A 3H4KA 4TRXA 2R5GA 3H1NA 2GZYA 2VD0A 2VLVA 3Q74A 3UL3A 2JSZA 3CSIA 3CTFA 4HDEA 4IN0A 3CTGA 4PUAA 2VLUA 5DQSA 1XXUA 3C73A 2VCXA 4TW5A 2CT6A 3KCMA 2DJJA 2H8LA 3F4TA 1GTBA 1S3DA 4I97A 4O7HA 4E8EA 1BQ7A 4IVFA 3IK7A 2QC7A 1SK2A 4DEJA 1JLVA 1AQWA 3VWWA 3WGEA 1YJ6A 4MK3A 1B9XC 4PQ1A 2VL3A 3TUEA 1RQMA 4OD7A 2LKUA 2B1LA 2PPTA 4HEA2 2OBIA 1TTZA 3P8WA 3IRAA 2WCIA 1BAYA 3UJ1A 2B5EA 1SYRA 4E8HA 5HR0A 2WJUA 3E9JB 2H30A 3TDGA 3HJMA 3FEUA 4IHUA 2F8AA 5JWQB 4KDYA 1GWCA 2PGTA 2Z9SA 1FG4A 2H70A 3NOFA 3Q18A 5HR3A 4K7NA 2CVDA 2JZRA 3VI5A 4KSMA 3TRQA 2VL2A 2AUVA 2VCWA 2H1AA 4I2TA 4N11A 4K6XA 2PWJA 4V2MA 4MH2A 3FW2A 3EMXA 1TU8A 3P2AA 1R4WA 4F9ZA 1EV9A 2NBSA 5AIXA 3TKSA 1FO5A 1O7UA 2YJ7A 6GSWA 2GQKA 3UARA 1XWAA 2YWOA 1XOAA 4IP6A 4GF0A 3J7Yk 6GSYA 20GSA 3TKQA 2F8FA 1M9BA 1WIKA 5J9BA 1THXA 3I6AA 1MD3A 1XWKA 5A4VA 3GRXA 1GSDA 4KDUA 2P5RA 4N0ZA 2VAFA 2MMNA 1JLWA 4POMA 3GSSA 5DALA 3HYPA 4DSQA 2RUFA 3LXZA 1TK8B 3EE2A 1TI3A 4ZB9A 2TIRA 2OACA 4XIHA 3DD3A 2C0GA 2DIYA 2H73A 5ECPB 1IYIA 2A2RA 5B8BA 3CRUA 2TRXA 1GSUA 2CAIA 4DVCA 1SL0B 1O8WA 5A4WA 1HNCA 3IBHA 4FH8A 1X9SB 3G7IA 5A4UA 2LJRA 2FY6A 1ZMAA 3ZREA 3W8SA 1GRXA 2YP6A 1U3AA 1G7EA 4HZ4A 5ECKB 5IMDA 1ILOA 2I9HA 4BA7A 1U6TA 3APOA 4ZB8A 2O87A 3GL5A 4YQUA 4YH2A 4P3YB 2F3MA 3CYNA 1YEXA 2J9HA 3F6FA 3Q6OA 2H1GA 3KIJA 2LUSA 3MAKA 5FHIA 1AC1A 1K3LA 1BEDA 1M99A 1TRVA 3EWLA 3ZMKA 5ECIB 2DMMA 2NPBA 1E2YA 3FZ9A 4HOJA 4EL1A 1GSYA 5IMZA 2HZEB 4GQCA 1MDIA 3H93A 2DMLA 1WWJA 3WYWA 3ERWA 4MPGA 2LRCA 2IMEA 1UC7A 1XFLA 3L9SA 2FWGA 3G7JA 1KNGA 1F9MA 5CRHA 1T00A 5C04A 3CSHA 3I43A 1T8EB 1M2DA 4I5QA 3IC4A 1K0NA 1EOGA 2O7KA 3WGDA 2KLXA 3UVHA 1SKRB 1MDJA 1GSEA 1WMJA 5HFGA 3GH6A 1TI1A 3M3MA 2WDUA 5ECQB 1WRYA 4L0WA 4OMVA 1Y6EA 4KNDA 1XWCA 3F63A 2FD3A 4QL7A 1B4PA 3TJFA 4XS4B 2P5QA 4GCIA 5HFIA 5ECNB 4TKYA 2ON5A 2C4JA 3WD6A 3ZFLA 2H1DA 3IA1A 4WXTA 4BPYA 1MTCA 1SK0A 1XCCA 4RI7A 1ZZYA 2G0FA 1SD8A 1UN2A 2IJYA 5DCGA 3KJYA 1B4QA 4XTSA 2C3QA 5GAND 1R5AA 4O32A 2MBTA 1TW9A 3BJ5A 2IMIA 4BL7A 3VPTA 4MZBA 4K7IA 4N30A 2V6KA 3DVWA 1USBA 3LJRA 4KH7A 2C3NA 1G7OA 5F07A 3TJGA 4HS1A 2A2SA 4F2IA 2L6DA 2YWIA 3UOMA 5DALB 2JZTA 3FKFA 1GL8A 3EC3A 1OVNA 2R4VA 3CXGA 4NAXA 4YAVA 1FB6A 1GH2A 1GLQA 4MF6A 3M1GA 1M2BA 4FYBA 3APSA 5B6NA 4ML6A 3F0IA 3MWHA 3DMLA 3SWLA 1VRSD 3GUSA 1PRXA 2GZPA 4K0GA 3VWXA 4F0BA 1AQVA 3IXRA 1EOHA 1VF2A 3TRPA 3D6IA 3LEFA 3BOAA 4IQ1A 1PGTA 2CA8A 17GSA 2H0GA 3M0FA 2FLSA 4WF5A 4X0XA 5F8BA 5D9WA 1EV4A 1YZXA 4JRRA 2QKEA 1DUGA 2CAQA 1OKDA 3CBUA 1ERTA 5F06A 3ZMLA 3QAVA
chains in the Genus database with same CATH superfamily
4KUNA 2H6YA 1UVZA 3U6VA 3ZITA 2MMAA 1BX9A 3DXBA 4WEYA 4J57E 3RPNA 1QFNA 4NHZA 2IL3A 1GUKA 1A24A 5LNKe 1PSQA 4HUAA 4RQRA 1ZCPA 2WRTA 1HNAA 2H6ZA 3HZ8A 4X1UA 4BVXA 2QSIA 1VF1A 1QMVA 3HA9A 2DBCA 2KHPA 5BRTA 6GSTA 4K5RA 3EU3A 1KTEA 2X8CA 3IAS2 2DJKA 4YQVA 3CRTA 3GTUA 3HVSA 1X5EA 1T1VA 3TOUA 4PUFC 4EDYA 1QK8A 10GSA 5DBQA 3L9VA 4ZBAA 1AAZA 5B8AA 2G2QA 4O5QA 3ZFBA 3A5WA 1HNBA 4DSRA 2R3XA 4MP4A 5EPFA 2X8HA 4K1FA 2LNSA 1GULA 4BWSA 3LW9A 2X64A 2YV9A 2IIYA 2I3YA 3IE3A 4GWRA 4XRAA 1A0FA 2L4CA 4XCSA 3MNGA 5B7CA 1Z7RA 2QA1A 4AJ8A 4J2FA 1TRWA 4ACSA 1SD9A 4XS1A 1EP8A 4PGTA 1R7HA 4NPBA 3QAWA 4KW6A 4GSTA 1GUMA 1AUCA 2F9SA 4F0CA 1HQOA 4MZWA 1FAAA 1WPIA 1ZL9A 2O85A 3GX8A 2P31A 3C1SA 4WETA 2DIZA 4HQZA 3DRNA 1J08A 4PNFA 3RHBA 3FR9A 3ZIJA 4QQ7A 4Q5QA 4IKHA 2VOCA 1XVQA 1WP0A 3GH9A 4EF0A 1AIUA 5JWOB 3PPUA 2ZNMA 5ABRA 3QDNA 4JU5A 4ZIJA 4ZL9A 1K0OA 4MMMA 3W8JA 2JU5A 4ECIA 1PMTA 1ABAA 3ME8A 1GTUA 2H74A 4OWYA 2H71A 3J7Yb 2H01A 1T4ZA 3KP9A 2GSSA 2IWTA 3KMNA 2V41A 1M3JA 5HFKA 3GYKA 3PGTA 3G9BA 2R37A 4KCAA 1YKAA 3KH9A 2CZ3A 1Z6NA 4KB3A 3IPZA 3P7XA 5DVBA 2DJ1A 1HD2A 3WT1A 5IOXA 2IPAA 1G6WA 2HZEA 1XWGA 1OC9B 1XWBA 4XS6A 1GNEA 4G9HA 2PN8A 2O89A 2GQMA 2XC2A 3LGCA 3QAGA 1O8XA 2YOIA 5CRDA 4EIPA 4Z2UA 1MDKA 1B48A 5G30A 2MBSA 3KEBA 5J3RA 4IELA 2OKAA 5ECRB 2IMDA 2YV7A 1AW9A 2L5OA 1G0TA 5JCWA 3GTUB 4POBA 2M46A 4J56E 3CMIA 1QUWA 2VLTA 5EL8A 1Q4JA 5JWRB 2AJQB 1B9YC 4XS4A 2C0EA 1G6YA 3D0ZA 2VCZA 3TKPA 1J9BA 5COHA 2GGTA 1JZOA 4JEDA 3KGKA 4IGJA 2FA4A 4POKA 1OC3A 5D9VA 1X5CA 2ON7A 1XOBA 2OE0A 1LBKA 2AV4A 3RBTA 1FW1A 1X0RA 3ZL5A 5D96A 1ZYPA 2HXKA 4MF7A 2BJXA 1UA5A 2WFCA 2DJ0A 4BIKA 2MMZA 1QGVA 2HRNA 2ZCTA 4BWQA 4IP1A 1TXXA 5KOXA 3ZLPA 3HVVA 1JHBA 1TU7A 5GSSA 1BG5A 1JZWA 2B5XA 1V9WA 1QQ2A 1XW9A 2NTOA 1ACVA 2HYXA 2JADA 2OE3A 5D73A 2GT6A 5C00A 5IMAA 3BBYA 4ULXA 2LQQA 1YY7A 1TK0B 4OFTA 2J23A 3F9UA 5IO0A 1SK1A 1XW6A 2JL4A 2GLRA 2TRCP 2X49A 2HE3A 5H5SA 1JZDA 2FNOA 1ZYQB 3D22A 4KAEA 3ZRDA 4Z2TA 1ERVA 1PX7A 6GSSA 3QFAC 2LJAA 2P0GA 13GSA 2PVQA 4LLRA 4K5SA 4ECBA 5GSTA 4GLTA 1V2AA 4MA9A 4EE0A 2DC5A 1Z7PA 5KEJA 2H75A 4DSSB 1EP7A 5KN0A 1A2JA 1XW5A 2H66A 4FYUA 1Q98A 4G19A 1TKDB 3KMOA 3GA4A 4IJIA 3O76A 2VD1A 3TJBA 1LJRA 1ZOFA 2GSQA 4PQHA 3NIVA 3ISOA 1B8XA 2R0PA 3F4RA 2CVKA 3AY8A 3I69A 3KXOA 3GSTA 4ISDA 4ZILA 3HXSA 3KP8A 3KTLA 1Z3EA 2WZ9A 3A2XA 4ZL7A 1TK5B 2OA7A 2E2MA 1OC8A 5IMCA 4NXIA 3TJKA 1MD4A 3FR6A 1PL2A 2N5BA 5B6MA 1M7TA 3APQA 2LNTA 2FHEA 3HD5A 5AISA 4IJ3A 2GT5A 4ZB6A 5D8IA 3HDCA 5H5QA 3PR8A 3DKSA 3P90A 1O6JA 4G0KA 5ECLB 5FWGA 4TR1B 4WBRD 4CDOA 2C0FA 4X4JA 3TRXA 3F8UA 3D4MA 2IN3A 5AGYA 2AHEA 3FR3A 1PN9A 2C8UA 5G2ZA 6GSXA 1GNWA 5IPHA 4NV5A 1TOFA 1EWXA 3GFKA 3GIXA 3HY2A 2EIOA 3E3EA 4ZXGA 4X43A 4XRDA 2CQ9A 2GQLA 4WF4A 1GLPA 1GP1A 1KBNA 2M72A 5ENUA 1VGLA 2C80A 2E7PA 3DYRA 3UBKA 5CAXA 4CHSA 2WB9A 2YNXA 2LEGA 1SENA 1T7PB 5D93A 3O3TA 4K7OA 1NSWA 2B6MA 3IC8A 5IM9A 3EPTA 2IFQB 1BYEA 4K9ZA 2OBKA 1OE7A 3QR6A 3TKSC 1JZRA 2HZFA 4RI6A 5EY6A 3GNJA 4K0NA 4RUVA 3HJPA 5CRGA 2EC4A 1T4YA 1SKSB 16GSA 3TKRA 5HQPA 2GDRA 4YQMA 4HSCX 5E4WA 1C72A 4ID0A 4MNNA 3E0UA 2M80A 2PVOC 2VIMA 3FY7A 2WGRA 1SYXA 5IO2A 1J0FA 1I5GA 1M2AA 1Z9HA 2AYTA 1OC9A 3UVTA 2PUKC 1PKZA 4TR3A 2XHFA 3HKRA 2DJ2A 2H0HA 4RQXA 4WR5A 2LSTA 1PA3A 4HJ2A 4KE3A 4JBBA 1N8JA 5ECOB 1SJ6A 2AB6A 2HT9A 4MDCA 5IMVA 3ERFA 1CQHA 1NHOA 3F3RA 2FGXA 4ZBDA 2IMKA 2V2GA 4KA0A 3L9UA 1FHEA 4LA1A 4JR6A 1GTIA 2O8VB 3F3QA 1X9WB 2YPMA 2ALBA 3JCML 1SU9A 1YKCA 4XHMA 5JCGA 2FWHA 2KP2A 2LTKA 5J4UA 1X9MB 2WS2A 1FOVA 1ON4A 4Z7XA 3A3TA 2AAWA 1GSSA 3EMPA 1A2LA 4IW9A 1BJXA 1THOA 1XPVA 2GTUA 3D4TA 4EKZA 1NHYA 3VK9A 1X5DA 3L4NA 4JR4A 1DBYA 19GSA 4TXOA 4JZQA 2C3TA 1TP9A 3EURA 3IK9A 2V1MA 5DDLA 1GTAA 1R5PA 4MLYA 1F3AA 2LV3A 2LQOA 3VWVA 1HYUA 1NM3A 2L57A 1ZYEA 3ZVJA 4MF5A 4AJ7A 2R2JA 3I9V2 2GVPA 3GURA 5CP1A 4IBPA 3TCOA 3FK8A 4ML1A 3GKXA 4V2LA 5ELAA 4PXOA 1Z5YE 5D9XA 3QCPA 2PMTA 3W6GA 3HZ4A 3FZ4A 1K0MA 1Y25A 3C8EA 3QFBC 4EC0A 3R2QA 1SKWB 1GUHA 2UZ8A 22GSA 4D73B 4ECCA 3TJJA 2XBIA 5CO3A 1AQXA 4TR4A 4TR0A 4EDZA 3ZVJD 2A4VA 3QD9A 2N5FA 5IQYA 2OADA 3KD0A 1K3YA 4GSNA 2V32A 4DSSA 5AIVA 4LL4B 3FYGA 1S3AA 4K2XA 1YEPA 2XPEA 5GZZB 4AF2A 4EVMA 1F6MC 2H72A 1K0BA 5CREA 9GSSA 2VCTA 4G2EA 1A23A 1CQGA 1S3RA 2FWFA 3VPQA 4GXZA 4V2NA 2KUCA 2HRFA 3GHAA 2CZ2A 3H79A 3RDWA 3L0HA 1V58A 3VLNA 1WOUA 1EZKA 4H86A 2V6OA 1V57A 3UMAA 2B7JA 3A2VA 3HCZA 4KX4A 1ZYNA 5D9TA 1O81A 1PL1A 4EO3A 5HR2A 1IYHA 4Q5RA 5ECHB 3EU4A 3K8NA 1FVJA 3ZTLA 4QL9A 2L59A 2DJ3A 2HNLA 1H75A 2I1UA 3HVNA 4BVYB 3GKNA 2OJLA 1WJKA 3GL3A 4O5RA 4TOPA 3C71A 3UBLA 1NW2A 2X4AA 1XZOA 2H1BA 2B7KA 3RPPA 4LMWA 5F0GA 1U3IA 1YDKA 3DIEA 4MJAA 3SBCA 2QGVA 3CSJA 2EIRA 3GKKA 5KN3A 4TR1A 1K3OA 4USSA 4ZBBA 3S9FA 4NV2A 3L78A 1URMA 5HR1A 1MEKA 4MCUA 3TKSE 2I4AA 4MJEA 1R26A 3IHQA 5DCHA 5DJLA 4TXOB 1WE0A 4PNGA 1OKTA 5CYYA 1JFUA 2X99A 1M0UA 4KGIA 2H19A 4FIWA 4G10A 3LQ7A 2B5YA 2KP1A 2GS3A 4I8BA 1O85A 3WGXA 3VWUA 1O73A 4YAPA 4NHWA 2RIIA 4WR4A 3V1WA 4I2UA 6GSVA 4CY6A 2VL9A 3DEXA 4ILFA 1LU4A 2D2ZA 3ZIVA 5FT3A 3MYDA 5ID2B 2JZSA 4OO4A 3C1RA 4MJBA 4KCEA 1T3BA 1V40A 3UEMA 4KF9A 2N5AA 5JCUA 4MPFA 4HJMA 4A5PA 3A2WA 5KN1A 4TVEA 3IV4A 2IFQA 1A0RP 5G5EA 2KOKA 5DAKB 1N2AA 3QOUA 2YN1A 3OR5A 3DWVA 3MDKA 1AXDA 4NMUA 3IAM2 4OCEA 1M9AA 4IS0A 3FZ5A 5DJMA 3F6DA 3U5RE 3VI7A 2REMA 3VURA 3KZQA 8GSSA 1ERWA 4OFMA 3GKMA 5A5KA 5INYA 4HU9A 2RM5A 3G7YA 4FO5A 4HZ2A 3QMXA 2NDOA 2CX4A 2HSMA 2JACA 1EGOA 3EVIA 2LS5A 2H0IA 2B1KA 2PU9C 3WT2A 3KM6A 2MZCA 1K0AA 2HSHA 3IDVA 2C0DA 4JE1A 2YZUA 2RM6A 3M9JA 2FCHA 3C7MA 3H8QA 3US3A 2NVLA 5IMFA 4Q5NA 1OYJA 2BMXA 4EXJA 1W89A 2LRTA 3M9KA 1RW1A 2VM1A 1DE2A 4MABA 2YWMA 4YKFA 1A8YA 4GSSA 5G1KA 1EEJA 4EUYA 3IOSA 4ZL8A 2HRKA 1SJZA 2YANA 3LORA 3KTBA 2EIQA 3EINA 3UIWA 3LYKA 5G31A 4TN8A 5DQYA 1SJIA 3ZYWA 3KH7A 3HHVA 4PX1A 3GN3A 2E2GA 1SL2B 1TRSA 4PQIA 2I81A 4POLA 5EVOA 4AJ6A 1K0DA 2K9FA 3LXTA 2VUPA 5J9CA 2VCVA 3VFIA 1SL1B 4OCFA 4N10A 1S3CA 1ZGNA 1RK4A 5H5RA 7GSSA 3TOTA 1FVKA 2X8GA 4K8MA 1Z6MA 4O92A 1ML6A 4HI7A 3F4SA 4FQUA 5ECSA 1EEMA 14GSA 4CW9A 4LMVA 5LD0A 2CX3A 4WKWA 5F05A 2RLIA 1TDIA 1ST9A 2A2PA 4MH3A 2OE1A 2CVBA 3HVXA 5GAPD 4GTUA 3N9JA 3NZNA 4L5LA 3O6TA 5ELGA 1EGRA 3BCIA 2VL2C 4D73A 2DLXA 1V98A 3DVXA 3PINA 5G1LA 2GSTA 2FUG2 1A8LA 4ECJA 1DE1A 2VCQA 3BCKA 1GSQA 3RHCA 2L6CA 2YWNA 1OAZA 5IPGA 3UAPA 2VO4A 2JSYA 4LL1B 2XPDA 3BD2A 12GSA 1PX6A 2H76A 3R3EA 2YCDA 4I6XA 1VF3A 4Q5FA 4OFNA 2WULA 2HSYA 1ERUA 2R6KA 2ZUPA 1OE8A 4GRFA 2HFDA 2GZZA 4PURA 5IOWA 3MSZA 5AN1A 2IMFA 1GSFA 2DSAA 4MJCA 2L5LA 4L0UA 4F03A 2LJKA 2H6XA 3ED3A 2RUEA 3QPMA 2XBQA 3LSZA 2MMOA 4K2DA 4PTSA 5E59A 3M8NA 1FB0A 1XVWA 1YF0A 5CNWA 3Q19A 2K6VA 2C1YA 1KEBA 3GX0A 1QXHA 1U88A 4BVYA 1K0CA 3HJOA 4OO5A 1TJDA 2BTOT 3LYPA 4FYCA 1XIYA 2VM2A 3GV1A 2LRNA 3D5JA 1YQ1A 1YF1A 5CRWA 4HU7A 5LCZA 4HQSA 3LFLA 4KSOA 2HLSA 18GSA 1F3BA 3ZZXA 6GSUA 5BMUA 4L5OA 1FOHA 5G5FA 3RAZA 1PKWA 4IQAA 5J5NA 5L71A 4MZCA 4WBJA 1PQNA 2CV4A 2DKIA 4G0LA 1VF4A 4L8EA 2FWEA 3DGQA 3N5OA 2E0QA 2FA8A 2GSRA 2PERA 2L4QA 1DSBA 4YKGA 3D21A 3FRCA 1F2EA 1F37A 2HI7A 5IIZA 3ME7A 2R0CA 2K18A 2PBJA 5ECMB 3PH9A 1E6BA 4N0VA 2YZHA 1XG8A 3EYTA 3LWAA 4NWYA 4BL7B 1XBSA 4AGSA 2YJHA 4F82A 2B3SA 3ERGA 3LG6A 3FHKA 4TXVA 5ID2A 4GQFA 1W4VA 5J41A 1H4OA 4V1Ap 4EIQA 2MYGA 5KN2A 1TRUA 4KDXA 2F51A 1I9DA 5DAKA 3GMFA 3FZAA 2K8SA 2QA2A 3TGZA 2K8VA 4V1Ag 11GSA 1U87A 2ES7A 1PD21 1A2MA 3IR4A 3TB2A 3H4KA 4TRXA 2R5GA 3H1NA 2GZYA 2VD0A 2VLVA 3Q74A 2R0GA 3UL3A 3MIXA 3CQFA 2JSZA 3CSIA 3CTFA 4HDEA 4IN0A 3CTGA 4PUAA 2VLUA 5DQSA 1XXUA 3C73A 2VCXA 4TW5A 2CT6A 3KCMA 2DJJA 2H8LA 3F4TA 1GTBA 2DKHA 1S3DA 4I97A 4O7HA 4E8EA 1BQ7A 4IVFA 3IK7A 2QC7A 1SK2A 4DEJA 1JLVA 1AQWA 3VWWA 3WGEA 1YJ6A 4MK3A 1B9XC 4PQ1A 1PN0A 2VL3A 3TUEA 1RQMA 4OD7A 2LKUA 2B1LA 2PPTA 4HEA2 2OBIA 1TTZA 3P8WA 3IRAA 2WCIA 1BAYA 3UJ1A 2B5EA 4BVXB 1SYRA 4E8HA 5HR0A 2WJUA 3E9JB 2H30A 3TDGA 3HJMA 3FEUA 4IHUA 2F8AA 5JWQB 4KDYA 1GWCA 2PGTA 2Z9SA 3Q18A 1FG4A 2H70A 3NOFA 5HR3A 4K7NA 2CVDA 2JZRA 3VI5A 4KSMA 3TRQA 2VL2A 2AUVA 2VCWA 2H1AA 4I2TA 4N11A 4K6XA 2PWJA 4V2MA 4MH2A 3FW2A 3EMXA 1TU8A 3P2AA 1R4WA 4F9ZA 1EV9A 2NBSA 5AIXA 3TKSA 1FO5A 1O7UA 5KOWA 2YJ7A 6GSWA 2GQKA 3UARA 1XWAA 2YWOA 1XOAA 4IP6A 4GF0A 3J7Yk 6GSYA 20GSA 3TKQA 2F8FA 1M9BA 1WIKA 5J9BA 1THXA 3I6AA 1MD3A 1XWKA 5A4VA 3GRXA 1GSDA 4KDUA 2P5RA 1M3IA 4N0ZA 2VAFA 2MMNA 1JLWA 4POMA 3GSSA 5DALA 3HYPA 4DSQA 2RUFA 3LXZA 1TK8B 3EE2A 1TI3A 4ZB9A 2TIRA 2OACA 4XIHA 3DD3A 2C0GA 2DIYA 2H73A 5ECPB 1IYIA 2A2RA 5B8BA 3CRUA 2TRXA 1GSUA 2CAIA 4DVCA 1SL0B 1O8WA 5A4WA 1HNCA 3IBHA 4FH8A 1X9SB 3G7IA 5A4UA 2LJRA 3IHGA 2FY6A 1ZMAA 3ZREA 3W8SA 1GRXA 2YP6A 1U3AA 2HRAA 1G7EA 4HZ4A 5ECKB 5IMDA 1ILOA 2I9HA 4BA7A 1U6TA 3APOA 4ZB8A 2O87A 3GL5A 4YQUA 4YH2A 4P3YB 2F3MA 3CYNA 1YEXA 2J9HA 3F6FA 3Q6OA 2H1GA 3KIJA 2LUSA 3MAKA 5FHIA 1AC1A 1K3LA 1BEDA 1M99A 1TRVA 3EWLA 3ZMKA 5ECIB 2DMMA 2NPBA 1E2YA 3FZ9A 4HOJA 4EL1A 1GSYA 5IMZA 2HZEB 4GQCA 1MDIA 3H93A 2DMLA 4CY8A 1WWJA 3WYWA 3ERWA 4MPGA 2LRCA 2IMEA 1UC7A 1XFLA 3L9SA 2FWGA 3G7JA 1KNGA 1F9MA 5CRHA 1T00A 5C04A 3CSHA 3I43A 1T8EB 1M2DA 4I5QA 3IC4A 1K0NA 1EOGA 2O7KA 3WGDA 2KLXA 3UVHA 1SKRB 1MDJA 1GSEA 1WMJA 5HFGA 3GH6A 1TI1A 3M3MA 2WDUA 5ECQB 1WRYA 4L0WA 4OMVA 1Y6EA 4KNDA 1XWCA 3F63A 2FD3A 4QL7A 1B4PA 3TJFA 4XS4B 2P5QA 4GCIA 5HFIA 5ECNB 3FMWA 4TKYA 2ON5A 2C4JA 3A5IA 3WD6A 3ZFLA 2H1DA 3IA1A 4WXTA 4BPYA 1MTCA 1SK0A 1XCCA 4RI7A 1ZZYA 2G0FA 1SD8A 1UN2A 2IJYA 5DCGA 2A4HA 3KJYA 1B4QA 4XTSA 2C3QA 5GAND 1R5AA 4O32A 2MBTA 1TW9A 3BJ5A 2IMIA 4BL7A 3VPTA 4MZBA 4K7IA 4N30A 2V6KA 4Z2RA 3DVWA 1USBA 3LJRA 4KH7A 2C3NA 1G7OA 5F07A 3TJGA 4HS1A 2A2SA 4F2IA 2L6DA 2YWIA 3UOMA 5DALB 2JZTA 3FKFA 1GL8A 3EC3A 1OVNA 1PFOA 2R4VA 3CXGA 4NAXA 4YAVA 1FB6A 1GH2A 1GLQA 4ICYA 4MF6A 3M1GA 4G0IA 1M2BA 4FYBA 3APSA 5B6NA 4ML6A 3F0IA 3MWHA 3DMLA 3SWLA 1VRSD 3GUSA 1PRXA 2GZPA 4O5UA 4K0GA 3VWXA 4F0BA 1AQVA 3IXRA 1EOHA 1VF2A 3TRPA 3D6IA 3LEFA 3BOAA 4IQ1A 1PGTA 2CA8A 17GSA 2H0GA 3M0FA 2FLSA 4WF5A 4X0XA 5F8BA 5D9WA 1EV4A 1YZXA 4JRRA 2QKEA 1DUGA 2CAQA 1OKDA 3CBUA 1ERTA 5F06A 3ZMLA 3QAVA
chains in the Genus database with same CATH topology
4KUNA 2H6YA 1UVZA 3U6VA 3ZITA 2MMAA 1BX9A 3DXBA 4WEYA 4J57E 3RPNA 1QFNA 4NHZA 2IL3A 1GUKA 1A24A 5LNKe 1PSQA 4HUAA 4RQRA 1ZCPA 2WRTA 1HNAA 2H6ZA 3HZ8A 4X1UA 4BVXA 2QSIA 1VF1A 1QMVA 3HA9A 2DBCA 2KHPA 5BRTA 6GSTA 4K5RA 3EU3A 1KTEA 2X8CA 3IAS2 2DJKA 4YQVA 3CRTA 3GTUA 3HVSA 1X5EA 1T1VA 3TOUA 4PUFC 4EDYA 1QK8A 10GSA 5DBQA 3L9VA 4ZBAA 1AAZA 5B8AA 2G2QA 4O5QA 3ZFBA 3A5WA 1HNBA 4DSRA 2R3XA 4MP4A 5EPFA 2X8HA 4K1FA 2LNSA 1GULA 4BWSA 3LW9A 2X64A 2YV9A 2IIYA 2I3YA 3IE3A 4GWRA 4XRAA 1A0FA 2L4CA 4XCSA 3MNGA 5B7CA 1Z7RA 2QA1A 4AJ8A 4J2FA 1TRWA 4ACSA 1SD9A 4XS1A 1EP8A 4PGTA 1R7HA 4NPBA 3QAWA 4KW6A 4GSTA 1GUMA 1AUCA 2F9SA 4F0CA 1HQOA 4MZWA 1FAAA 1WPIA 1ZL9A 2O85A 3GX8A 2P31A 3C1SA 4WETA 2DIZA 4HQZA 3DRNA 1J08A 4PNFA 3RHBA 3FR9A 3ZIJA 4QQ7A 4Q5QA 4IKHA 2VOCA 1XVQA 1WP0A 3GH9A 4EF0A 1AIUA 5JWOB 3PPUA 2ZNMA 5ABRA 3QDNA 4JU5A 4ZIJA 4ZL9A 1K0OA 4MMMA 3W8JA 2JU5A 4ECIA 1PMTA 1ABAA 3ME8A 1GTUA 2H74A 4OWYA 2H71A 3J7Yb 2H01A 1T4ZA 3KP9A 2GSSA 2IWTA 3KMNA 2V41A 5HFKA 3GYKA 3PGTA 3G9BA 2R37A 4KCAA 1YKAA 3KH9A 2CZ3A 1Z6NA 4KB3A 3IPZA 3P7XA 5DVBA 2DJ1A 1HD2A 3WT1A 5IOXA 2IPAA 1G6WA 2HZEA 1XWGA 1OC9B 1XWBA 4XS6A 1GNEA 4G9HA 2PN8A 2O89A 2GQMA 2XC2A 3LGCA 3QAGA 1O8XA 2YOIA 5CRDA 4EIPA 4Z2UA 1MDKA 1B48A 5G30A 2MBSA 3KEBA 5J3RA 4IELA 2OKAA 5ECRB 2IMDA 2YV7A 1AW9A 2L5OA 1G0TA 5JCWA 3GTUB 4POBA 2M46A 4J56E 3CMIA 1QUWA 2VLTA 5EL8A 1Q4JA 5JWRB 2AJQB 1B9YC 4XS4A 2C0EA 1G6YA 3D0ZA 2VCZA 3TKPA 1J9BA 5COHA 2GGTA 1JZOA 4JEDA 3KGKA 4IGJA 2FA4A 4POKA 1OC3A 5D9VA 1X5CA 2ON7A 1XOBA 2OE0A 1LBKA 2AV4A 3RBTA 1FW1A 1X0RA 3ZL5A 5D96A 1ZYPA 2HXKA 4MF7A 2BJXA 1UA5A 2WFCA 2DJ0A 2MMZA 1QGVA 2HRNA 2ZCTA 4BWQA 4IP1A 1TXXA 5KOXA 3ZLPA 3HVVA 1JHBA 1TU7A 5GSSA 1BG5A 1JZWA 2B5XA 1V9WA 1QQ2A 1XW9A 2NTOA 1ACVA 2HYXA 2JADA 2OE3A 5D73A 2GT6A 5C00A 5IMAA 3BBYA 4ULXA 2LQQA 1YY7A 1TK0B 4OFTA 2J23A 3F9UA 5IO0A 1SK1A 1XW6A 2JL4A 2GLRA 2TRCP 2X49A 2HE3A 5H5SA 1JZDA 2FNOA 1ZYQB 3D22A 4KAEA 3ZRDA 4Z2TA 1ERVA 1PX7A 6GSSA 3QFAC 2LJAA 2P0GA 13GSA 2PVQA 4LLRA 4K5SA 4ECBA 5GSTA 4GLTA 1V2AA 4MA9A 4EE0A 2DC5A 1Z7PA 5KEJA 2H75A 4DSSB 1EP7A 5KN0A 1A2JA 1XW5A 2H66A 4FYUA 1Q98A 4G19A 1TKDB 3KMOA 3GA4A 4IJIA 3O76A 2VD1A 3TJBA 1LJRA 1ZOFA 2GSQA 4PQHA 3NIVA 3ISOA 1B8XA 2R0PA 3F4RA 2CVKA 3AY8A 3I69A 3KXOA 3GSTA 4ISDA 4ZILA 3HXSA 3KP8A 3KTLA 1Z3EA 2WZ9A 3A2XA 4ZL7A 1TK5B 2OA7A 2E2MA 1OC8A 5IMCA 4NXIA 3TJKA 1MD4A 3FR6A 1PL2A 2N5BA 5B6MA 1M7TA 3APQA 2LNTA 2FHEA 3HD5A 5AISA 4IJ3A 2GT5A 4ZB6A 5D8IA 3HDCA 5H5QA 3PR8A 3DKSA 3P90A 1O6JA 4G0KA 5ECLB 5FWGA 4TR1B 4WBRD 4CDOA 2C0FA 4X4JA 3TRXA 3F8UA 3D4MA 2IN3A 5AGYA 2AHEA 3FR3A 1PN9A 2C8UA 5G2ZA 6GSXA 1GNWA 5IPHA 4NV5A 1TOFA 1EWXA 3GFKA 3GIXA 3HY2A 2EIOA 3E3EA 4ZXGA 4X43A 4XRDA 2CQ9A 2GQLA 4WF4A 1GLPA 1GP1A 1KBNA 2M72A 5ENUA 1VGLA 2C80A 2E7PA 3DYRA 3UBKA 5CAXA 4CHSA 2WB9A 2YNXA 2LEGA 1SENA 1T7PB 5D93A 3O3TA 4K7OA 1NSWA 2B6MA 3IC8A 5IM9A 3EPTA 2IFQB 1BYEA 4K9ZA 2OBKA 1OE7A 3QR6A 3TKSC 1JZRA 2HZFA 4RI6A 5EY6A 3GNJA 4K0NA 4RUVA 3HJPA 5CRGA 2EC4A 1T4YA 1SKSB 16GSA 3TKRA 5HQPA 2GDRA 4YQMA 5E4WA 1C72A 4ID0A 4MNNA 3E0UA 2M80A 2PVOC 2VIMA 3FY7A 2WGRA 1SYXA 5IO2A 1J0FA 1I5GA 1M2AA 1Z9HA 2AYTA 1OC9A 3UVTA 2PUKC 1PKZA 4TR3A 2XHFA 3HKRA 2DJ2A 2H0HA 4RQXA 4WR5A 2LSTA 1PA3A 4HJ2A 4KE3A 4JBBA 1N8JA 5ECOB 1SJ6A 2AB6A 2HT9A 4MDCA 5IMVA 3ERFA 1CQHA 1NHOA 3F3RA 2FGXA 4ZBDA 2IMKA 2V2GA 4KA0A 3L9UA 1FHEA 4LA1A 4JR6A 1GTIA 2O8VB 3F3QA 1X9WB 2YPMA 2ALBA 3JCML 1SU9A 1YKCA 4XHMA 5JCGA 2FWHA 2KP2A 2LTKA 5J4UA 1X9MB 2WS2A 1FOVA 1ON4A 4Z7XA 3A3TA 2AAWA 1GSSA 3EMPA 1A2LA 4IW9A 1BJXA 1THOA 1XPVA 2GTUA 3D4TA 4EKZA 1NHYA 3VK9A 1X5DA 3L4NA 4JR4A 1DBYA 19GSA 4TXOA 4JZQA 2C3TA 1TP9A 3EURA 3IK9A 2V1MA 5DDLA 1GTAA 1R5PA 4MLYA 1F3AA 2LV3A 2LQOA 3VWVA 1HYUA 1NM3A 2L57A 1ZYEA 3ZVJA 4MF5A 4AJ7A 2R2JA 3I9V2 2GVPA 3GURA 5CP1A 4IBPA 3TCOA 3FK8A 4ML1A 3GKXA 4V2LA 5ELAA 4PXOA 1Z5YE 5D9XA 3QCPA 2PMTA 3W6GA 3HZ4A 3FZ4A 1K0MA 1Y25A 3C8EA 3QFBC 4EC0A 3R2QA 1SKWB 1GUHA 2UZ8A 22GSA 4D73B 4ECCA 3TJJA 2XBIA 5CO3A 1AQXA 4TR4A 4TR0A 4EDZA 3ZVJD 2A4VA 3QD9A 2N5FA 5IQYA 2OADA 3KD0A 1K3YA 4GSNA 2V32A 4DSSA 5AIVA 4LL4B 3FYGA 1S3AA 4K2XA 1YEPA 2XPEA 5GZZB 4AF2A 4EVMA 1F6MC 2H72A 1K0BA 5CREA 9GSSA 2VCTA 4G2EA 1A23A 1CQGA 3VPQA 2FWFA 4GXZA 4V2NA 2KUCA 2HRFA 3GHAA 2CZ2A 3H79A 3RDWA 3L0HA 1V58A 3VLNA 1WOUA 1EZKA 4H86A 2V6OA 1V57A 3UMAA 2B7JA 3A2VA 3HCZA 4KX4A 1ZYNA 5D9TA 1O81A 1PL1A 4EO3A 5HR2A 1IYHA 4Q5RA 5ECHB 3EU4A 3K8NA 1FVJA 3ZTLA 4QL9A 2L59A 2DJ3A 2HNLA 1H75A 2I1UA 4BVYB 3GKNA 2OJLA 1WJKA 3GL3A 4O5RA 4TOPA 3C71A 3UBLA 1NW2A 2X4AA 1XZOA 2H1BA 2B7KA 3RPPA 4LMWA 5F0GA 1U3IA 1YDKA 3DIEA 4MJAA 3SBCA 2QGVA 3CSJA 2EIRA 3GKKA 5KN3A 4TR1A 1K3OA 4USSA 4ZBBA 3S9FA 4NV2A 3L78A 1URMA 5HR1A 1MEKA 4MCUA 3TKSE 2I4AA 4MJEA 1R26A 3IHQA 5DCHA 5DJLA 4TXOB 1WE0A 4PNGA 1OKTA 5CYYA 1JFUA 2X99A 1M0UA 4KGIA 2H19A 4FIWA 4G10A 3LQ7A 2B5YA 2KP1A 2GS3A 4I8BA 1O85A 3WGXA 3VWUA 1O73A 4YAPA 4NHWA 2RIIA 4WR4A 3V1WA 4I2UA 6GSVA 4CY6A 2VL9A 3DEXA 4ILFA 1LU4A 2D2ZA 3ZIVA 5FT3A 3MYDA 5ID2B 2JZSA 4OO4A 3C1RA 4MJBA 4KCEA 1T3BA 1V40A 3UEMA 4KF9A 2N5AA 5JCUA 4MPFA 4HJMA 4A5PA 3A2WA 5KN1A 4TVEA 3IV4A 2IFQA 1A0RP 5G5EA 2KOKA 5DAKB 1N2AA 3QOUA 2YN1A 3OR5A 3DWVA 3MDKA 1AXDA 4NMUA 3IAM2 4OCEA 1M9AA 4IS0A 3FZ5A 5DJMA 3F6DA 3U5RE 3VI7A 2REMA 3VURA 3KZQA 8GSSA 1ERWA 4OFMA 3GKMA 5A5KA 5INYA 4HU9A 2RM5A 3G7YA 4FO5A 4HZ2A 3QMXA 2NDOA 2CX4A 2HSMA 2JACA 1EGOA 3EVIA 2LS5A 2H0IA 2B1KA 2PU9C 3WT2A 3KM6A 2MZCA 1K0AA 2HSHA 3IDVA 2C0DA 4JE1A 2YZUA 2RM6A 3M9JA 2FCHA 3C7MA 3H8QA 3US3A 2NVLA 5IMFA 4Q5NA 1OYJA 2BMXA 4EXJA 1W89A 2LRTA 3M9KA 1RW1A 2VM1A 1DE2A 4MABA 2YWMA 4YKFA 1A8YA 4GSSA 5G1KA 1EEJA 4EUYA 3IOSA 4ZL8A 2HRKA 1SJZA 2YANA 3LORA 3KTBA 2EIQA 3EINA 3UIWA 3LYKA 5G31A 4TN8A 5DQYA 1SJIA 3ZYWA 3KH7A 3HHVA 4PX1A 3GN3A 2E2GA 1SL2B 1TRSA 4PQIA 2I81A 4POLA 5EVOA 4AJ6A 1K0DA 2K9FA 3LXTA 2VUPA 5J9CA 2VCVA 3VFIA 1SL1B 4OCFA 4N10A 1S3CA 1ZGNA 1RK4A 5H5RA 7GSSA 3TOTA 1FVKA 2X8GA 4K8MA 1Z6MA 4O92A 1ML6A 4HI7A 3F4SA 4FQUA 5ECSA 1EEMA 14GSA 4CW9A 4LMVA 5LD0A 2CX3A 4WKWA 5F05A 2RLIA 1TDIA 1ST9A 2A2PA 4MH3A 2OE1A 2CVBA 3HVXA 5GAPD 4GTUA 3N9JA 3NZNA 4L5LA 3O6TA 5ELGA 1EGRA 3BCIA 2VL2C 4D73A 2DLXA 1V98A 3DVXA 3PINA 5G1LA 2GSTA 2FUG2 1A8LA 4ECJA 1DE1A 2VCQA 3BCKA 1GSQA 3RHCA 2L6CA 2YWNA 1OAZA 5IPGA 3UAPA 2VO4A 2JSYA 4LL1B 2XPDA 3BD2A 12GSA 1PX6A 2H76A 3R3EA 2YCDA 4I6XA 1VF3A 4Q5FA 4OFNA 2WULA 2HSYA 1ERUA 2R6KA 2ZUPA 1OE8A 4GRFA 2HFDA 2GZZA 4PURA 5IOWA 3MSZA 5AN1A 2IMFA 1GSFA 2DSAA 4MJCA 2L5LA 4L0UA 4F03A 2LJKA 2H6XA 3ED3A 2RUEA 3QPMA 2XBQA 3LSZA 2MMOA 4K2DA 4PTSA 5E59A 3M8NA 1FB0A 1XVWA 1YF0A 5CNWA 3Q19A 2K6VA 2C1YA 1KEBA 3GX0A 1QXHA 1U88A 4BVYA 1K0CA 3HJOA 4OO5A 1TJDA 2BTOT 3LYPA 4FYCA 1XIYA 2VM2A 3GV1A 2LRNA 3D5JA 1YQ1A 1YF1A 5CRWA 4HU7A 5LCZA 4HQSA 3LFLA 4KSOA 2HLSA 18GSA 1F3BA 3ZZXA 6GSUA 5BMUA 4L5OA 1FOHA 5G5FA 3RAZA 1PKWA 4IQAA 5J5NA 5L71A 4MZCA 4WBJA 1PQNA 2CV4A 2DKIA 4G0LA 1VF4A 4L8EA 2FWEA 3DGQA 3N5OA 2E0QA 2FA8A 2GSRA 2PERA 2L4QA 1DSBA 4YKGA 3D21A 3FRCA 1F2EA 1F37A 2HI7A 5IIZA 3ME7A 2R0CA 2K18A 2PBJA 5ECMB 3PH9A 1E6BA 4N0VA 2YZHA 3EYTA 3LWAA 4NWYA 4BL7B 1XBSA 4AGSA 2YJHA 4F82A 2B3SA 3ERGA 3LG6A 3FHKA 4TXVA 5ID2A 4GQFA 1W4VA 5J41A 1H4OA 4V1Ap 4EIQA 2MYGA 5KN2A 1TRUA 4KDXA 2F51A 1I9DA 5DAKA 3GMFA 3FZAA 2K8SA 2QA2A 3TGZA 2K8VA 4V1Ag 11GSA 1U87A 2ES7A 1PD21 1A2MA 3IR4A 3TB2A 3H4KA 4TRXA 2R5GA 3H1NA 2GZYA 2VD0A 2VLVA 3Q74A 2R0GA 3UL3A 3MIXA 2JSZA 3CSIA 3CTFA 4HDEA 4IN0A 3CTGA 4PUAA 2VLUA 5DQSA 1XXUA 3C73A 2VCXA 4TW5A 2CT6A 3KCMA 2DJJA 2H8LA 3F4TA 1GTBA 2DKHA 1S3DA 4I97A 4O7HA 4E8EA 1BQ7A 4IVFA 3IK7A 2QC7A 1SK2A 4DEJA 1JLVA 1AQWA 3VWWA 3WGEA 1YJ6A 4MK3A 1B9XC 4PQ1A 1PN0A 2VL3A 3TUEA 1RQMA 4OD7A 2LKUA 2B1LA 2PPTA 4HEA2 2OBIA 1TTZA 3P8WA 3IRAA 2WCIA 1BAYA 3UJ1A 2B5EA 4BVXB 1SYRA 4E8HA 5HR0A 2WJUA 3E9JB 2H30A 3TDGA 3HJMA 3FEUA 4IHUA 2F8AA 5JWQB 4KDYA 1GWCA 2PGTA 2Z9SA 3Q18A 1FG4A 2H70A 3NOFA 5HR3A 4K7NA 2CVDA 2JZRA 3VI5A 4KSMA 3TRQA 2VL2A 2AUVA 2VCWA 2H1AA 4I2TA 4N11A 4K6XA 2PWJA 4V2MA 4MH2A 3FW2A 3EMXA 1TU8A 3P2AA 1R4WA 4F9ZA 1EV9A 2NBSA 5AIXA 3TKSA 1FO5A 1O7UA 5KOWA 2YJ7A 6GSWA 2GQKA 3UARA 1XWAA 2YWOA 1XOAA 4IP6A 4GF0A 3J7Yk 6GSYA 20GSA 3TKQA 2F8FA 1M9BA 1WIKA 5J9BA 1THXA 3I6AA 1MD3A 1XWKA 5A4VA 3GRXA 1GSDA 4KDUA 2P5RA 4N0ZA 2VAFA 2MMNA 1JLWA 4POMA 3GSSA 5DALA 3HYPA 4DSQA 2RUFA 3LXZA 1TK8B 3EE2A 1TI3A 4ZB9A 2TIRA 2OACA 4XIHA 3DD3A 2C0GA 2DIYA 2H73A 5ECPB 1IYIA 2A2RA 5B8BA 3CRUA 2TRXA 1GSUA 2CAIA 4DVCA 1SL0B 1O8WA 5A4WA 1HNCA 3IBHA 4FH8A 1X9SB 3G7IA 5A4UA 2LJRA 3IHGA 2FY6A 1ZMAA 3ZREA 3W8SA 1GRXA 2YP6A 1U3AA 2HRAA 1G7EA 4HZ4A 5ECKB 5IMDA 1ILOA 2I9HA 4BA7A 1U6TA 3APOA 4ZB8A 2O87A 3GL5A 4YQUA 4YH2A 4P3YB 2F3MA 3CYNA 1YEXA 2J9HA 3F6FA 3Q6OA 2H1GA 3KIJA 2LUSA 3MAKA 5FHIA 1AC1A 1K3LA 1BEDA 1M99A 1TRVA 3EWLA 3ZMKA 5ECIB 2DMMA 2NPBA 1E2YA 3FZ9A 4HOJA 4EL1A 1GSYA 5IMZA 2HZEB 4GQCA 1MDIA 3H93A 2DMLA 4CY8A 1WWJA 3WYWA 3ERWA 4MPGA 2LRCA 2IMEA 1UC7A 1XFLA 3L9SA 2FWGA 3G7JA 1KNGA 1F9MA 5CRHA 1T00A 5C04A 3CSHA 3I43A 1T8EB 1M2DA 4I5QA 3IC4A 1K0NA 1EOGA 2O7KA 3WGDA 2KLXA 3UVHA 1SKRB 1MDJA 1GSEA 1WMJA 5HFGA 3GH6A 1TI1A 3M3MA 2WDUA 5ECQB 1WRYA 4L0WA 4OMVA 1Y6EA 4KNDA 1XWCA 3F63A 2FD3A 4QL7A 1B4PA 3TJFA 4XS4B 2P5QA 4GCIA 5HFIA 5ECNB 3FMWA 4TKYA 2ON5A 2C4JA 3A5IA 3WD6A 3ZFLA 2H1DA 3IA1A 4WXTA 4BPYA 1MTCA 1SK0A 1XCCA 4RI7A 1ZZYA 2G0FA 1SD8A 1UN2A 2IJYA 5DCGA 2A4HA 3KJYA 1B4QA 4XTSA 2C3QA 5GAND 1R5AA 4O32A 2MBTA 1TW9A 3BJ5A 2IMIA 4BL7A 3VPTA 4MZBA 4K7IA 4N30A 2V6KA 4Z2RA 3DVWA 1USBA 3LJRA 4KH7A 2C3NA 1G7OA 5F07A 3TJGA 4HS1A 2A2SA 4F2IA 2L6DA 2YWIA 3UOMA 5DALB 2JZTA 3FKFA 1GL8A 3EC3A 1OVNA 2R4VA 3CXGA 4NAXA 4YAVA 1FB6A 1GH2A 1GLQA 4ICYA 4MF6A 3M1GA 4G0IA 1M2BA 4FYBA 3APSA 5B6NA 4ML6A 3F0IA 3MWHA 3DMLA 3SWLA 1VRSD 3GUSA 1PRXA 2GZPA 4O5UA 4K0GA 3VWXA 4F0BA 1AQVA 3IXRA 1EOHA 1VF2A 3TRPA 3D6IA 3LEFA 3BOAA 4IQ1A 1PGTA 2CA8A 17GSA 2H0GA 3M0FA 2FLSA 4WF5A 4X0XA 5F8BA 5D9WA 1EV4A 1YZXA 4JRRA 2QKEA 1DUGA 2CAQA 1OKDA 3CBUA 1ERTA 5F06A 3ZMLA 3QAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KUN A;  2H6Y A;  1UVZ A;  3U6V A;  3ZIT A;  2MMA A;  1BX9 A;  3DXB A;  4WEY A;  4J57 E;  3RPN A;  1QFN A;  4NHZ A;  2IL3 A;  1GUK A;  1A24 A;  5LNK e;  1PSQ A;  4HUA A;  4RQR A;  1ZCP A;  2WRT A;  1HNA A;  2H6Z A;  3HZ8 A;  4X1U A;  4BVX A;  2QSI A;  1VF1 A;  1QMV A;  3HA9 A;  2DBC A;  2KHP A;  6GST A;  3EU3 A;  1KTE A;  2X8C A;  3IAS 2;  2DJK A;  4YQV A;  3CRT A;  3GTU A;  3HVS A;  1X5E A;  1T1V A;  3TOU A;  4PUF C;  4EDY A;  1QK8 A;  10GS A;  5DBQ A;  3L9V A;  4ZBA A;  1AAZ A;  5B8A A;  2G2Q A;  3ZFB A;  3A5W A;  1HNB A;  4DSR A;  2R3X A;  4MP4 A;  5EPF A;  2X8H A;  4K1F A;  2LNS A;  1GUL A;  4BWS A;  2X64 A;  2YV9 A;  2IIY A;  2I3Y A;  3IE3 A;  4GWR A;  4XRA A;  1A0F A;  2L4C A;  4XCS A;  3MNG A;  5B7C A;  1Z7R A;  4AJ8 A;  4J2F A;  1TRW A;  4ACS A;  1SD9 A;  4XS1 A;  1EP8 A;  4PGT A;  1R7H A;  4NPB A;  3QAW A;  4KW6 A;  4GST A;  1GUM A;  1AUC A;  2F9S A;  4F0C A;  1HQO A;  4MZW A;  1FAA A;  1WPI A;  1ZL9 A;  2O85 A;  3GX8 A;  2P31 A;  3C1S A;  4WET A;  2DIZ A;  4HQZ A;  3DRN A;  1J08 A;  4PNF A;  3RHB A;  3FR9 A;  3ZIJ A;  4QQ7 A;  4Q5Q A;  4IKH A;  2VOC A;  1XVQ A;  1WP0 A;  3GH9 A;  4EF0 A;  1AIU A;  5JWO B;  2ZNM A;  5ABR A;  3QDN A;  4JU5 A;  4ZIJ A;  4ZL9 A;  1K0O A;  4MMM A;  3W8J A;  2JU5 A;  4ECI A;  1PMT A;  1ABA A;  3ME8 A;  1GTU A;  2H74 A;  4OWY A;  2H71 A;  3J7Y b;  2H01 A;  1T4Z A;  3KP9 A;  2GSS A;  2IWT A;  3KMN A;  2V41 A;  5HFK A;  3GYK A;  3PGT A;  3G9B A;  2R37 A;  4KCA A;  1YKA A;  3KH9 A;  2CZ3 A;  1Z6N A;  4KB3 A;  3IPZ A;  3P7X A;  5DVB A;  2DJ1 A;  1HD2 A;  3WT1 A;  5IOX A;  2IPA A;  1G6W A;  2HZE A;  1XWG A;  1OC9 B;  1XWB A;  4XS6 A;  1GNE A;  4G9H A;  2PN8 A;  2O89 A;  2GQM A;  2XC2 A;  3LGC A;  3QAG A;  1O8X A;  2YOI A;  5CRD A;  1MDK A;  1B48 A;  5G30 A;  2MBS A;  3KEB A;  5J3R A;  4IEL A;  2OKA A;  5ECR B;  2IMD A;  2YV7 A;  1AW9 A;  2L5O A;  1G0T A;  5JCW A;  3GTU B;  4POB A;  2M46 A;  4J56 E;  3CMI A;  1QUW A;  2VLT A;  5EL8 A;  1Q4J A;  5JWR B;  2AJQ B;  1B9Y C;  4XS4 A;  2C0E A;  1G6Y A;  3D0Z A;  2VCZ A;  3TKP A;  1J9B A;  5COH A;  2GGT A;  1JZO A;  4JED A;  3KGK A;  4IGJ A;  2FA4 A;  4POK A;  1OC3 A;  5D9V A;  1X5C A;  2ON7 A;  1XOB A;  2OE0 A;  1LBK A;  2AV4 A;  3RBT A;  1FW1 A;  1X0R A;  3ZL5 A;  5D96 A;  2HXK A;  4MF7 A;  2BJX A;  1UA5 A;  2WFC A;  2DJ0 A;  2MMZ A;  1QGV A;  2HRN A;  2ZCT A;  4BWQ A;  4IP1 A;  1TXX A;  3ZLP A;  3HVV A;  1JHB A;  1TU7 A;  5GSS A;  1BG5 A;  1JZW A;  2B5X A;  1V9W A;  1QQ2 A;  1XW9 A;  2NTO A;  1ACV A;  2HYX A;  2JAD A;  2OE3 A;  5D73 A;  2GT6 A;  5C00 A;  5IMA A;  3BBY A;  4ULX A;  2LQQ A;  1YY7 A;  1TK0 B;  4OFT A;  2J23 A;  3F9U A;  5IO0 A;  1SK1 A;  1XW6 A;  2JL4 A;  2GLR A;  2TRC P;  2HE3 A;  5H5S A;  1JZD A;  2FNO A;  1ZYQ B;  3D22 A;  4KAE A;  3ZRD A;  1ERV A;  1PX7 A;  6GSS A;  3QFA C;  2LJA A;  2P0G A;  13GS A;  2PVQ A;  4LLR A;  4ECB A;  5GST A;  4GLT A;  1V2A A;  4MA9 A;  4EE0 A;  2DC5 A;  1Z7P A;  5KEJ A;  2H75 A;  4DSS B;  1EP7 A;  5KN0 A;  1A2J A;  1XW5 A;  2H66 A;  4FYU A;  1Q98 A;  4G19 A;  1TKD B;  3KMO A;  3GA4 A;  4IJI A;  3O76 A;  2VD1 A;  3TJB A;  1LJR A;  1ZOF A;  2GSQ A;  4PQH A;  3NIV A;  3ISO A;  1B8X A;  3F4R A;  2CVK A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ISD A;  4ZIL A;  3HXS A;  3KP8 A;  3KTL A;  1Z3E A;  2WZ9 A;  3A2X A;  4ZL7 A;  1TK5 B;  2OA7 A;  2E2M A;  1OC8 A;  5IMC A;  4NXI A;  3TJK A;  1MD4 A;  3FR6 A;  1PL2 A;  2N5B A;  5B6M A;  1M7T A;  3APQ A;  2LNT A;  2FHE A;  3HD5 A;  5AIS A;  4IJ3 A;  2GT5 A;  4ZB6 A;  5D8I A;  3HDC A;  5H5Q A;  3PR8 A;  3DKS A;  3P90 A;  1O6J A;  5ECL B;  5FWG A;  4TR1 B;  4WBR D;  4CDO A;  2C0F A;  3TRX A;  3F8U A;  3D4M A;  2IN3 A;  5AGY A;  2AHE A;  3FR3 A;  1PN9 A;  2C8U A;  5G2Z A;  6GSX A;  1GNW A;  5IPH A;  4NV5 A;  1TOF A;  1EWX A;  3GFK A;  3GIX A;  3HY2 A;  2EIO A;  3E3E A;  4ZXG A;  4X43 A;  4XRD A;  2CQ9 A;  2GQL A;  4WF4 A;  1GLP A;  1GP1 A;  1KBN A;  2M72 A;  5ENU A;  1VGL A;  2C80 A;  2E7P A;  3DYR A;  3UBK A;  5CAX A;  4CHS A;  2WB9 A;  2YNX A;  2LEG A;  1SEN A;  1T7P B;  5D93 A;  3O3T A;  4K7O A;  1NSW A;  2B6M A;  5IM9 A;  2IFQ B;  1BYE A;  4K9Z A;  2OBK A;  1OE7 A;  3QR6 A;  3TKS C;  1JZR A;  2HZF A;  4RI6 A;  5EY6 A;  3GNJ A;  4K0N A;  4RUV A;  3HJP A;  5CRG A;  2EC4 A;  1T4Y A;  1SKS B;  16GS A;  3TKR A;  5HQP A;  2GDR A;  4YQM A;  5E4W A;  1C72 A;  4ID0 A;  3E0U A;  2M80 A;  2PVO C;  2VIM A;  3FY7 A;  2WGR A;  1SYX A;  5IO2 A;  1J0F A;  1I5G A;  1M2A A;  1Z9H A;  2AYT A;  1OC9 A;  3UVT A;  2PUK C;  1PKZ A;  4TR3 A;  2XHF A;  3HKR A;  2DJ2 A;  2H0H A;  4RQX A;  4WR5 A;  2LST A;  1PA3 A;  4HJ2 A;  4KE3 A;  4JBB A;  1N8J A;  5ECO B;  1SJ6 A;  2AB6 A;  2HT9 A;  4MDC A;  5IMV A;  3ERF A;  1CQH A;  1NHO A;  3F3R A;  2FGX A;  4ZBD A;  2IMK A;  2V2G A;  4KA0 A;  3L9U A;  1FHE A;  4LA1 A;  4JR6 A;  1GTI A;  2O8V B;  3F3Q A;  1X9W B;  2YPM A;  2ALB A;  3JCM L;  1SU9 A;  1YKC A;  4XHM A;  5JCG A;  2FWH A;  2KP2 A;  2LTK A;  5J4U A;  1X9M B;  2WS2 A;  1FOV A;  1ON4 A;  4Z7X A;  3A3T A;  2AAW A;  1GSS A;  3EMP A;  1A2L A;  4IW9 A;  1BJX A;  1THO A;  1XPV A;  2GTU A;  3D4T A;  4EKZ A;  1NHY A;  3VK9 A;  1X5D A;  3L4N A;  4JR4 A;  1DBY A;  19GS A;  4TXO A;  4JZQ A;  2C3T A;  1TP9 A;  3EUR A;  3IK9 A;  2V1M A;  5DDL A;  1GTA A;  1R5P A;  4MLY A;  1F3A A;  2LV3 A;  2LQO A;  3VWV A;  1HYU A;  1NM3 A;  2L57 A;  1ZYE A;  3ZVJ A;  4MF5 A;  4AJ7 A;  2R2J A;  3I9V 2;  2GVP A;  3GUR A;  5CP1 A;  4IBP A;  3TCO A;  3FK8 A;  4ML1 A;  3GKX A;  4V2L A;  5ELA A;  4PXO A;  1Z5Y E;  5D9X A;  3QCP A;  2PMT A;  3W6G A;  3HZ4 A;  3FZ4 A;  1K0M A;  1Y25 A;  3C8E A;  3QFB C;  4EC0 A;  3R2Q A;  1SKW B;  1GUH A;  22GS A;  4D73 B;  4ECC A;  3TJJ A;  2XBI A;  5CO3 A;  1AQX A;  4TR4 A;  4TR0 A;  4EDZ A;  3ZVJ D;  2A4V A;  3QD9 A;  2N5F A;  5IQY A;  2OAD A;  3KD0 A;  1K3Y A;  4GSN A;  2V32 A;  4DSS A;  5AIV A;  4LL4 B;  3FYG A;  1S3A A;  1YEP A;  2XPE A;  5GZZ B;  4AF2 A;  4EVM A;  1F6M C;  2H72 A;  1K0B A;  5CRE A;  9GSS A;  2VCT A;  4G2E A;  1A23 A;  1CQG A;  3VPQ A;  2FWF A;  4GXZ A;  4V2N A;  2KUC A;  2HRF A;  3GHA A;  2CZ2 A;  3H79 A;  3RDW A;  3L0H A;  1V58 A;  3VLN A;  1WOU A;  1EZK A;  4H86 A;  2V6O A;  1V57 A;  3UMA A;  2B7J A;  3A2V A;  3HCZ A;  4KX4 A;  5D9T A;  1O81 A;  1PL1 A;  4EO3 A;  5HR2 A;  1IYH A;  4Q5R A;  5ECH B;  3EU4 A;  3K8N A;  1FVJ A;  3ZTL A;  4QL9 A;  2L59 A;  2DJ3 A;  2HNL A;  1H75 A;  2I1U A;  3GKN A;  2OJL A;  1WJK A;  3GL3 A;  4O5R A;  4TOP A;  3C71 A;  3UBL A;  1NW2 A;  1XZO A;  2H1B A;  2B7K A;  3RPP A;  4LMW A;  5F0G A;  1U3I A;  1YDK A;  3DIE A;  4MJA A;  3SBC A;  2QGV A;  3CSJ A;  2EIR A;  3GKK A;  5KN3 A;  4TR1 A;  1K3O A;  4ZBB A;  3S9F A;  4NV2 A;  3L78 A;  1URM A;  5HR1 A;  1MEK A;  4MCU A;  3TKS E;  2I4A A;  4MJE A;  1R26 A;  3IHQ A;  5DCH A;  5DJL A;  4TXO B;  1WE0 A;  4PNG A;  1OKT A;  5CYY A;  1JFU A;  2X99 A;  1M0U A;  4KGI A;  2H19 A;  4FIW A;  4G10 A;  3LQ7 A;  2B5Y A;  2KP1 A;  2GS3 A;  4I8B A;  1O85 A;  3WGX A;  3VWU A;  1O73 A;  4YAP A;  4NHW A;  2RII A;  4WR4 A;  3V1W A;  4I2U A;  6GSV A;  2VL9 A;  3DEX A;  4ILF A;  1LU4 A;  2D2Z A;  3ZIV A;  5FT3 A;  5ID2 B;  2JZS A;  4OO4 A;  3C1R A;  4MJB A;  4KCE A;  1T3B A;  1V40 A;  3UEM A;  2N5A A;  5JCU A;  4MPF A;  4HJM A;  3A2W A;  5KN1 A;  4TVE A;  3IV4 A;  2IFQ A;  1A0R P;  5G5E A;  2KOK A;  5DAK B;  1N2A A;  3QOU A;  2YN1 A;  3OR5 A;  3DWV A;  3MDK A;  1AXD A;  4NMU A;  3IAM 2;  4OCE A;  1M9A A;  4IS0 A;  3FZ5 A;  5DJM A;  3F6D A;  3U5R E;  3VI7 A;  2REM A;  3VUR A;  3KZQ A;  8GSS A;  1ERW A;  4OFM A;  3GKM A;  5A5K A;  5INY A;  4HU9 A;  2RM5 A;  3G7Y A;  4FO5 A;  4HZ2 A;  3QMX A;  2NDO A;  2CX4 A;  2JAC A;  1EGO A;  3EVI A;  2LS5 A;  2H0I A;  2B1K A;  2PU9 C;  3WT2 A;  3KM6 A;  2MZC A;  1K0A A;  2HSH A;  3IDV A;  2C0D A;  4JE1 A;  2YZU A;  2RM6 A;  3M9J A;  2FCH A;  3C7M A;  3H8Q A;  3US3 A;  2NVL A;  5IMF A;  4Q5N A;  1OYJ A;  2BMX A;  4EXJ A;  1W89 A;  2LRT A;  3M9K A;  1RW1 A;  2VM1 A;  1DE2 A;  4MAB A;  2YWM A;  1A8Y A;  4GSS A;  5G1K A;  1EEJ A;  4EUY A;  3IOS A;  4ZL8 A;  1SJZ A;  2YAN A;  3LOR A;  3KTB A;  2EIQ A;  3EIN A;  3UIW A;  3LYK A;  5G31 A;  4TN8 A;  5DQY A;  1SJI A;  3ZYW A;  3KH7 A;  3HHV A;  4PX1 A;  3GN3 A;  2E2G A;  1SL2 B;  1TRS A;  4PQI A;  2I81 A;  4POL A;  5EVO A;  4AJ6 A;  1K0D A;  2K9F A;  3LXT A;  2VUP A;  5J9C A;  2VCV A;  3VFI A;  1SL1 B;  4OCF A;  4N10 A;  1S3C A;  1ZGN A;  1RK4 A;  5H5R A;  7GSS A;  3TOT A;  1FVK A;  2X8G A;  4K8M A;  1Z6M A;  4O92 A;  1ML6 A;  4HI7 A;  3F4S A;  5ECS A;  1EEM A;  14GS A;  4CW9 A;  4LMV A;  5LD0 A;  2CX3 A;  4WKW A;  5F05 A;  2RLI A;  1TDI A;  1ST9 A;  4MH3 A;  2OE1 A;  2CVB A;  3HVX A;  5GAP D;  4GTU A;  3N9J A;  3NZN A;  4L5L A;  3O6T A;  5ELG A;  1EGR A;  3BCI A;  2VL2 C;  4D73 A;  2DLX A;  1V98 A;  3DVX A;  3PIN A;  5G1L A;  2GST A;  2FUG 2;  1A8L A;  4ECJ A;  1DE1 A;  2VCQ A;  3BCK A;  1GSQ A;  3RHC A;  2L6C A;  2YWN A;  1OAZ A;  5IPG A;  3UAP A;  2VO4 A;  2JSY A;  4LL1 B;  2XPD A;  3BD2 A;  12GS A;  1PX6 A;  2H76 A;  2YCD A;  4I6X A;  1VF3 A;  4Q5F A;  4OFN A;  2WUL A;  2HSY A;  1ERU A;  2R6K A;  2ZUP A;  1OE8 A;  4GRF A;  2HFD A;  2GZZ A;  4PUR A;  5IOW A;  3MSZ A;  5AN1 A;  2IMF A;  1GSF A;  2DSA A;  4MJC A;  2L5L A;  4L0U A;  4F03 A;  2LJK A;  2H6X A;  3ED3 A;  2RUE A;  3QPM A;  2XBQ A;  3LSZ A;  2MMO A;  4K2D A;  5E59 A;  3M8N A;  1FB0 A;  1XVW A;  1YF0 A;  5CNW A;  3Q19 A;  2K6V A;  2C1Y A;  1KEB A;  3GX0 A;  1QXH A;  1U88 A;  4BVY A;  1K0C A;  3HJO A;  4OO5 A;  1TJD A;  2BTO T;  3LYP A;  4FYC A;  1XIY A;  2VM2 A;  3GV1 A;  2LRN A;  3D5J A;  1YQ1 A;  1YF1 A;  5CRW A;  4HU7 A;  5LCZ A;  4HQS A;  3LFL A;  4KSO A;  2HLS A;  18GS A;  1F3B A;  3ZZX A;  6GSU A;  4L5O A;  5G5F A;  3RAZ A;  1PKW A;  4IQA A;  5J5N A;  5L71 A;  4MZC A;  4WBJ A;  1PQN A;  2CV4 A;  1VF4 A;  4L8E A;  2FWE A;  3DGQ A;  3N5O A;  2E0Q A;  2FA8 A;  2GSR A;  2PER A;  2L4Q A;  1DSB A;  3D21 A;  3FRC A;  1F2E A;  1F37 A;  2HI7 A;  5IIZ A;  3ME7 A;  2K18 A;  2PBJ A;  5ECM B;  3PH9 A;  1E6B A;  4N0V A;  2YZH A;  3EYT A;  3LWA A;  4NWY A;  1XBS A;  4AGS A;  2YJH A;  4F82 A;  2B3S A;  3ERG A;  3LG6 A;  3FHK A;  4TXV A;  5ID2 A;  4GQF A;  1W4V A;  5J41 A;  1H4O A;  4V1A p;  2MYG A;  5KN2 A;  1TRU A;  4KDX A;  2F51 A;  1I9D A;  5DAK A;  3GMF A;  3FZA A;  2K8S A;  3TGZ A;  2K8V A;  4V1A g;  11GS A;  1U87 A;  2ES7 A;  1PD2 1;  1A2M A;  3IR4 A;  3TB2 A;  3H4K A;  4TRX A;  2R5G A;  3H1N A;  2GZY A;  2VD0 A;  2VLV A;  3Q74 A;  3UL3 A;  2JSZ A;  3CSI A;  3CTF A;  4HDE A;  4IN0 A;  3CTG A;  4PUA A;  2VLU A;  5DQS A;  1XXU A;  3C73 A;  2VCX A;  4TW5 A;  2CT6 A;  3KCM A;  2DJJ A;  2H8L A;  3F4T A;  1GTB A;  1S3D A;  4I97 A;  4O7H A;  4E8E A;  1BQ7 A;  4IVF A;  3IK7 A;  2QC7 A;  1SK2 A;  4DEJ A;  1JLV A;  1AQW A;  3VWW A;  3WGE A;  1YJ6 A;  4MK3 A;  1B9X C;  4PQ1 A;  2VL3 A;  3TUE A;  1RQM A;  4OD7 A;  2LKU A;  2B1L A;  2PPT A;  4HEA 2;  2OBI A;  1TTZ A;  3P8W A;  3IRA A;  2WCI A;  1BAY A;  3UJ1 A;  2B5E A;  1SYR A;  4E8H A;  5HR0 A;  2WJU A;  3E9J B;  2H30 A;  3TDG A;  3HJM A;  3FEU A;  4IHU A;  2F8A A;  5JWQ B;  4KDY A;  1GWC A;  2PGT A;  2Z9S A;  1FG4 A;  2H70 A;  3NOF A;  3Q18 A;  5HR3 A;  4K7N A;  2CVD A;  2JZR A;  3VI5 A;  4KSM A;  3TRQ A;  2VL2 A;  2AUV A;  2VCW A;  2H1A A;  4I2T A;  4N11 A;  4K6X A;  2PWJ A;  4V2M A;  4MH2 A;  3FW2 A;  3EMX A;  1TU8 A;  3P2A A;  1R4W A;  4F9Z A;  1EV9 A;  2NBS A;  5AIX A;  3TKS A;  1FO5 A;  1O7U A;  2YJ7 A;  6GSW A;  2GQK A;  3UAR A;  1XWA A;  2YWO A;  1XOA A;  4IP6 A;  4GF0 A;  3J7Y k;  6GSY A;  20GS A;  3TKQ A;  2F8F A;  1M9B A;  1WIK A;  5J9B A;  1THX A;  3I6A A;  1MD3 A;  1XWK A;  5A4V A;  3GRX A;  1GSD A;  4KDU A;  2P5R A;  4N0Z A;  2VAF A;  2MMN A;  1JLW A;  4POM A;  3GSS A;  5DAL A;  3HYP A;  4DSQ A;  2RUF A;  3LXZ A;  1TK8 B;  3EE2 A;  1TI3 A;  4ZB9 A;  2TIR A;  2OAC A;  4XIH A;  3DD3 A;  2C0G A;  2DIY A;  2H73 A;  5ECP B;  1IYI A;  2A2R A;  5B8B A;  3CRU A;  2TRX A;  1GSU A;  2CAI A;  4DVC A;  1SL0 B;  1O8W A;  5A4W A;  1HNC A;  3IBH A;  4FH8 A;  1X9S B;  3G7I A;  5A4U A;  2LJR A;  2FY6 A;  1ZMA A;  3ZRE A;  3W8S A;  1GRX A;  2YP6 A;  1U3A A;  1G7E A;  4HZ4 A;  5ECK B;  5IMD A;  1ILO A;  2I9H A;  4BA7 A;  1U6T A;  3APO A;  4ZB8 A;  2O87 A;  3GL5 A;  4YQU A;  4YH2 A;  4P3Y B;  2F3M A;  3CYN A;  1YEX A;  2J9H A;  3F6F A;  3Q6O A;  2H1G A;  3KIJ A;  2LUS A;  3MAK A;  5FHI A;  1AC1 A;  1K3L A;  1BED A;  1M99 A;  1TRV A;  3EWL A;  3ZMK A;  5ECI B;  2DMM A;  2NPB A;  1E2Y A;  3FZ9 A;  4HOJ A;  4EL1 A;  1GSY A;  5IMZ A;  2HZE B;  4GQC A;  1MDI A;  3H93 A;  2DML A;  1WWJ A;  3WYW A;  3ERW A;  4MPG A;  2LRC A;  2IME A;  1UC7 A;  1XFL A;  3L9S A;  2FWG A;  3G7J A;  1KNG A;  1F9M A;  5CRH A;  1T00 A;  5C04 A;  3CSH A;  3I43 A;  1T8E B;  1M2D A;  4I5Q A;  3IC4 A;  1K0N A;  1EOG A;  2O7K A;  3WGD A;  2KLX A;  3UVH A;  1SKR B;  1MDJ A;  1GSE A;  1WMJ A;  5HFG A;  3GH6 A;  1TI1 A;  3M3M A;  2WDU A;  5ECQ B;  1WRY A;  4L0W A;  4OMV A;  1Y6E A;  4KND A;  1XWC A;  3F63 A;  2FD3 A;  4QL7 A;  1B4P A;  3TJF A;  4XS4 B;  2P5Q A;  4GCI A;  5HFI A;  5ECN B;  4TKY A;  2ON5 A;  2C4J A;  3WD6 A;  3ZFL A;  2H1D A;  3IA1 A;  4WXT A;  4BPY A;  1MTC A;  1SK0 A;  1XCC A;  4RI7 A;  1ZZY A;  2G0F A;  1SD8 A;  1UN2 A;  2IJY A;  5DCG A;  3KJY A;  1B4Q A;  4XTS A;  2C3Q A;  5GAN D;  1R5A A;  4O32 A;  2MBT A;  1TW9 A;  3BJ5 A;  2IMI A;  4BL7 A;  3VPT A;  4MZB A;  4K7I A;  4N30 A;  2V6K A;  3DVW A;  1USB A;  3LJR A;  4KH7 A;  2C3N A;  1G7O A;  5F07 A;  3TJG A;  4HS1 A;  2A2S A;  4F2I A;  2L6D A;  2YWI A;  3UOM A;  5DAL B;  2JZT A;  3FKF A;  1GL8 A;  3EC3 A;  1OVN A;  2R4V A;  3CXG A;  4NAX A;  4YAV A;  1FB6 A;  1GH2 A;  1GLQ A;  4MF6 A;  3M1G A;  1M2B A;  4FYB A;  3APS A;  5B6N A;  4ML6 A;  3F0I A;  3MWH A;  3DML A;  3SWL A;  1VRS D;  3GUS A;  1PRX A;  2GZP A;  4K0G A;  3VWX A;  4F0B A;  1AQV A;  3IXR A;  1EOH A;  1VF2 A;  3TRP A;  3D6I A;  3LEF A;  3BOA A;  4IQ1 A;  1PGT A;  2CA8 A;  17GS A;  2H0G A;  3M0F A;  2FLS A;  4WF5 A;  4X0X A;  5F8B A;  5D9W A;  1EV4 A;  1YZX A;  4JRR A;  2QKE A;  1DUG A;  2CAQ A;  1OKD A;  3CBU A;  1ERT A;  5F06 A;  3ZML A;  3QAV A; 
#chains in the Genus database with same CATH topology
 4KUN A;  2H6Y A;  1UVZ A;  3U6V A;  3ZIT A;  2MMA A;  1BX9 A;  3DXB A;  4WEY A;  4J57 E;  3RPN A;  1QFN A;  4NHZ A;  2IL3 A;  1GUK A;  1A24 A;  5LNK e;  1PSQ A;  4HUA A;  4RQR A;  1ZCP A;  2WRT A;  1HNA A;  2H6Z A;  3HZ8 A;  4X1U A;  4BVX A;  2QSI A;  1VF1 A;  1QMV A;  3HA9 A;  2DBC A;  2KHP A;  5BRT A;  6GST A;  4K5R A;  3EU3 A;  1KTE A;  2X8C A;  3IAS 2;  2DJK A;  4YQV A;  3CRT A;  3GTU A;  3HVS A;  1X5E A;  1T1V A;  3TOU A;  4PUF C;  4EDY A;  1QK8 A;  10GS A;  5DBQ A;  3L9V A;  4ZBA A;  1AAZ A;  5B8A A;  2G2Q A;  4O5Q A;  3ZFB A;  3A5W A;  1HNB A;  4DSR A;  2R3X A;  4MP4 A;  5EPF A;  2X8H A;  4K1F A;  2LNS A;  1GUL A;  4BWS A;  3LW9 A;  2X64 A;  2YV9 A;  2IIY A;  2I3Y A;  3IE3 A;  4GWR A;  4XRA A;  1A0F A;  2L4C A;  4XCS A;  3MNG A;  5B7C A;  1Z7R A;  2QA1 A;  4AJ8 A;  4J2F A;  1TRW A;  4ACS A;  1SD9 A;  4XS1 A;  1EP8 A;  4PGT A;  1R7H A;  4NPB A;  3QAW A;  4KW6 A;  4GST A;  1GUM A;  1AUC A;  2F9S A;  4F0C A;  1HQO A;  4MZW A;  1FAA A;  1WPI A;  1ZL9 A;  2O85 A;  3GX8 A;  2P31 A;  3C1S A;  4WET A;  2DIZ A;  4HQZ A;  3DRN A;  1J08 A;  4PNF A;  3RHB A;  3FR9 A;  3ZIJ A;  4QQ7 A;  4Q5Q A;  4IKH A;  2VOC A;  1XVQ A;  1WP0 A;  3GH9 A;  4EF0 A;  1AIU A;  5JWO B;  3PPU A;  2ZNM A;  5ABR A;  3QDN A;  4JU5 A;  4ZIJ A;  4ZL9 A;  1K0O A;  4MMM A;  3W8J A;  2JU5 A;  4ECI A;  1PMT A;  1ABA A;  3ME8 A;  1GTU A;  2H74 A;  4OWY A;  2H71 A;  3J7Y b;  2H01 A;  1T4Z A;  3KP9 A;  2GSS A;  2IWT A;  3KMN A;  2V41 A;  1M3J A;  5HFK A;  3GYK A;  3PGT A;  3G9B A;  2R37 A;  4KCA A;  1YKA A;  3KH9 A;  2CZ3 A;  1Z6N A;  4KB3 A;  3IPZ A;  3P7X A;  5DVB A;  2DJ1 A;  1HD2 A;  3WT1 A;  5IOX A;  2IPA A;  1G6W A;  2HZE A;  1XWG A;  1OC9 B;  1XWB A;  4XS6 A;  1GNE A;  4G9H A;  2PN8 A;  2O89 A;  2GQM A;  2XC2 A;  3LGC A;  3QAG A;  1O8X A;  2YOI A;  5CRD A;  4EIP A;  4Z2U A;  1MDK A;  1B48 A;  5G30 A;  2MBS A;  3KEB A;  5J3R A;  4IEL A;  2OKA A;  5ECR B;  2IMD A;  2YV7 A;  1AW9 A;  2L5O A;  1G0T A;  5JCW A;  3GTU B;  4POB A;  2M46 A;  4J56 E;  3CMI A;  1QUW A;  2VLT A;  5EL8 A;  1Q4J A;  5JWR B;  2AJQ B;  1B9Y C;  4XS4 A;  2C0E A;  1G6Y A;  3D0Z A;  2VCZ A;  3TKP A;  1J9B A;  5COH A;  2GGT A;  1JZO A;  4JED A;  3KGK A;  4IGJ A;  2FA4 A;  4POK A;  1OC3 A;  5D9V A;  1X5C A;  2ON7 A;  1XOB A;  2OE0 A;  1LBK A;  2AV4 A;  3RBT A;  1FW1 A;  1X0R A;  3ZL5 A;  5D96 A;  1ZYP A;  2HXK A;  4MF7 A;  2BJX A;  1UA5 A;  2WFC A;  2DJ0 A;  4BIK A;  2MMZ A;  1QGV A;  2HRN A;  2ZCT A;  4BWQ A;  4IP1 A;  1TXX A;  5KOX A;  3ZLP A;  3HVV A;  1JHB A;  1TU7 A;  5GSS A;  1BG5 A;  1JZW A;  2B5X A;  1V9W A;  1QQ2 A;  1XW9 A;  2NTO A;  1ACV A;  2HYX A;  2JAD A;  2OE3 A;  5D73 A;  2GT6 A;  5C00 A;  5IMA A;  3BBY A;  4ULX A;  2LQQ A;  1YY7 A;  1TK0 B;  4OFT A;  2J23 A;  3F9U A;  5IO0 A;  1SK1 A;  1XW6 A;  2JL4 A;  2GLR A;  2TRC P;  2X49 A;  2HE3 A;  5H5S A;  1JZD A;  2FNO A;  1ZYQ B;  3D22 A;  4KAE A;  3ZRD A;  4Z2T A;  1ERV A;  1PX7 A;  6GSS A;  3QFA C;  2LJA A;  2P0G A;  13GS A;  2PVQ A;  4LLR A;  4K5S A;  4ECB A;  5GST A;  4GLT A;  1V2A A;  4MA9 A;  4EE0 A;  2DC5 A;  1Z7P A;  5KEJ A;  2H75 A;  4DSS B;  1EP7 A;  5KN0 A;  1A2J A;  1XW5 A;  2H66 A;  4FYU A;  1Q98 A;  4G19 A;  1TKD B;  3KMO A;  3GA4 A;  4IJI A;  3O76 A;  2VD1 A;  3TJB A;  1LJR A;  1ZOF A;  2GSQ A;  4PQH A;  3NIV A;  3ISO A;  1B8X A;  2R0P A;  3F4R A;  2CVK A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ISD A;  4ZIL A;  3HXS A;  3KP8 A;  3KTL A;  1Z3E A;  2WZ9 A;  3A2X A;  4ZL7 A;  1TK5 B;  2OA7 A;  2E2M A;  1OC8 A;  5IMC A;  4NXI A;  3TJK A;  1MD4 A;  3FR6 A;  1PL2 A;  2N5B A;  5B6M A;  1M7T A;  3APQ A;  2LNT A;  2FHE A;  3HD5 A;  5AIS A;  4IJ3 A;  2GT5 A;  4ZB6 A;  5D8I A;  3HDC A;  5H5Q A;  3PR8 A;  3DKS A;  3P90 A;  1O6J A;  4G0K A;  5ECL B;  5FWG A;  4TR1 B;  4WBR D;  4CDO A;  2C0F A;  4X4J A;  3TRX A;  3F8U A;  3D4M A;  2IN3 A;  5AGY A;  2AHE A;  3FR3 A;  1PN9 A;  2C8U A;  5G2Z A;  6GSX A;  1GNW A;  5IPH A;  4NV5 A;  1TOF A;  1EWX A;  3GFK A;  3GIX A;  3HY2 A;  2EIO A;  3E3E A;  4ZXG A;  4X43 A;  4XRD A;  2CQ9 A;  2GQL A;  4WF4 A;  1GLP A;  1GP1 A;  1KBN A;  2M72 A;  5ENU A;  1VGL A;  2C80 A;  2E7P A;  3DYR A;  3UBK A;  5CAX A;  4CHS A;  2WB9 A;  2YNX A;  2LEG A;  1SEN A;  1T7P B;  5D93 A;  3O3T A;  4K7O A;  1NSW A;  2B6M A;  3IC8 A;  5IM9 A;  3EPT A;  2IFQ B;  1BYE A;  4K9Z A;  2OBK A;  1OE7 A;  3QR6 A;  3TKS C;  1JZR A;  2HZF A;  4RI6 A;  5EY6 A;  3GNJ A;  4K0N A;  4RUV A;  3HJP A;  5CRG A;  2EC4 A;  1T4Y A;  1SKS B;  16GS A;  3TKR A;  5HQP A;  2GDR A;  4YQM A;  4HSC X;  5E4W A;  1C72 A;  4ID0 A;  4MNN A;  3E0U A;  2M80 A;  2PVO C;  2VIM A;  3FY7 A;  2WGR A;  1SYX A;  5IO2 A;  1J0F A;  1I5G A;  1M2A A;  1Z9H A;  2AYT A;  1OC9 A;  3UVT A;  2PUK C;  1PKZ A;  4TR3 A;  2XHF A;  3HKR A;  2DJ2 A;  2H0H A;  4RQX A;  4WR5 A;  2LST A;  1PA3 A;  4HJ2 A;  4KE3 A;  4JBB A;  1N8J A;  5ECO B;  1SJ6 A;  2AB6 A;  2HT9 A;  4MDC A;  5IMV A;  3ERF A;  1CQH A;  1NHO A;  3F3R A;  2FGX A;  4ZBD A;  2IMK A;  2V2G A;  4KA0 A;  3L9U A;  1FHE A;  4LA1 A;  4JR6 A;  1GTI A;  2O8V B;  3F3Q A;  1X9W B;  2YPM A;  2ALB A;  3JCM L;  1SU9 A;  1YKC A;  4XHM A;  5JCG A;  2FWH A;  2KP2 A;  2LTK A;  5J4U A;  1X9M B;  2WS2 A;  1FOV A;  1ON4 A;  4Z7X A;  3A3T A;  2AAW A;  1GSS A;  3EMP A;  1A2L A;  4IW9 A;  1BJX A;  1THO A;  1XPV A;  2GTU A;  3D4T A;  4EKZ A;  1NHY A;  3VK9 A;  1X5D A;  3L4N A;  4JR4 A;  1DBY A;  19GS A;  4TXO A;  4JZQ A;  2C3T A;  1TP9 A;  3EUR A;  3IK9 A;  2V1M A;  5DDL A;  1GTA A;  1R5P A;  4MLY A;  1F3A A;  2LV3 A;  2LQO A;  3VWV A;  1HYU A;  1NM3 A;  2L57 A;  1ZYE A;  3ZVJ A;  4MF5 A;  4AJ7 A;  2R2J A;  3I9V 2;  2GVP A;  3GUR A;  5CP1 A;  4IBP A;  3TCO A;  3FK8 A;  4ML1 A;  3GKX A;  4V2L A;  5ELA A;  4PXO A;  1Z5Y E;  5D9X A;  3QCP A;  2PMT A;  3W6G A;  3HZ4 A;  3FZ4 A;  1K0M A;  1Y25 A;  3C8E A;  3QFB C;  4EC0 A;  3R2Q A;  1SKW B;  1GUH A;  2UZ8 A;  22GS A;  4D73 B;  4ECC A;  3TJJ A;  2XBI A;  5CO3 A;  1AQX A;  4TR4 A;  4TR0 A;  4EDZ A;  3ZVJ D;  2A4V A;  3QD9 A;  2N5F A;  5IQY A;  2OAD A;  3KD0 A;  1K3Y A;  4GSN A;  2V32 A;  4DSS A;  5AIV A;  4LL4 B;  3FYG A;  1S3A A;  4K2X A;  1YEP A;  2XPE A;  5GZZ B;  4AF2 A;  4EVM A;  1F6M C;  2H72 A;  1K0B A;  5CRE A;  9GSS A;  2VCT A;  4G2E A;  1A23 A;  1CQG A;  1S3R A;  2FWF A;  3VPQ A;  4GXZ A;  4V2N A;  2KUC A;  2HRF A;  3GHA A;  2CZ2 A;  3H79 A;  3RDW A;  3L0H A;  1V58 A;  3VLN A;  1WOU A;  1EZK A;  4H86 A;  2V6O A;  1V57 A;  3UMA A;  2B7J A;  3A2V A;  3HCZ A;  4KX4 A;  1ZYN A;  5D9T A;  1O81 A;  1PL1 A;  4EO3 A;  5HR2 A;  1IYH A;  4Q5R A;  5ECH B;  3EU4 A;  3K8N A;  1FVJ A;  3ZTL A;  4QL9 A;  2L59 A;  2DJ3 A;  2HNL A;  1H75 A;  2I1U A;  3HVN A;  4BVY B;  3GKN A;  2OJL A;  1WJK A;  3GL3 A;  4O5R A;  4TOP A;  3C71 A;  3UBL A;  1NW2 A;  2X4A A;  1XZO A;  2H1B A;  2B7K A;  3RPP A;  4LMW A;  5F0G A;  1U3I A;  1YDK A;  3DIE A;  4MJA A;  3SBC A;  2QGV A;  3CSJ A;  2EIR A;  3GKK A;  5KN3 A;  4TR1 A;  1K3O A;  4USS A;  4ZBB A;  3S9F A;  4NV2 A;  3L78 A;  1URM A;  5HR1 A;  1MEK A;  4MCU A;  3TKS E;  2I4A A;  4MJE A;  1R26 A;  3IHQ A;  5DCH A;  5DJL A;  4TXO B;  1WE0 A;  4PNG A;  1OKT A;  5CYY A;  1JFU A;  2X99 A;  1M0U A;  4KGI A;  2H19 A;  4FIW A;  4G10 A;  3LQ7 A;  2B5Y A;  2KP1 A;  2GS3 A;  4I8B A;  1O85 A;  3WGX A;  3VWU A;  1O73 A;  4YAP A;  4NHW A;  2RII A;  4WR4 A;  3V1W A;  4I2U A;  6GSV A;  4CY6 A;  2VL9 A;  3DEX A;  4ILF A;  1LU4 A;  2D2Z A;  3ZIV A;  5FT3 A;  3MYD A;  5ID2 B;  2JZS A;  4OO4 A;  3C1R A;  4MJB A;  4KCE A;  1T3B A;  1V40 A;  3UEM A;  4KF9 A;  2N5A A;  5JCU A;  4MPF A;  4HJM A;  4A5P A;  3A2W A;  5KN1 A;  4TVE A;  3IV4 A;  2IFQ A;  1A0R P;  5G5E A;  2KOK A;  5DAK B;  1N2A A;  3QOU A;  2YN1 A;  3OR5 A;  3DWV A;  3MDK A;  1AXD A;  4NMU A;  3IAM 2;  4OCE A;  1M9A A;  4IS0 A;  3FZ5 A;  5DJM A;  3F6D A;  3U5R E;  3VI7 A;  2REM A;  3VUR A;  3KZQ A;  8GSS A;  1ERW A;  4OFM A;  3GKM A;  5A5K A;  5INY A;  4HU9 A;  2RM5 A;  3G7Y A;  4FO5 A;  4HZ2 A;  3QMX A;  2NDO A;  2CX4 A;  2HSM A;  2JAC A;  1EGO A;  3EVI A;  2LS5 A;  2H0I A;  2B1K A;  2PU9 C;  3WT2 A;  3KM6 A;  2MZC A;  1K0A A;  2HSH A;  3IDV A;  2C0D A;  4JE1 A;  2YZU A;  2RM6 A;  3M9J A;  2FCH A;  3C7M A;  3H8Q A;  3US3 A;  2NVL A;  5IMF A;  4Q5N A;  1OYJ A;  2BMX A;  4EXJ A;  1W89 A;  2LRT A;  3M9K A;  1RW1 A;  2VM1 A;  1DE2 A;  4MAB A;  2YWM A;  4YKF A;  1A8Y A;  4GSS A;  5G1K A;  1EEJ A;  4EUY A;  3IOS A;  4ZL8 A;  2HRK A;  1SJZ A;  2YAN A;  3LOR A;  3KTB A;  2EIQ A;  3EIN A;  3UIW A;  3LYK A;  5G31 A;  4TN8 A;  5DQY A;  1SJI A;  3ZYW A;  3KH7 A;  3HHV A;  4PX1 A;  3GN3 A;  2E2G A;  1SL2 B;  1TRS A;  4PQI A;  2I81 A;  4POL A;  5EVO A;  4AJ6 A;  1K0D A;  2K9F A;  3LXT A;  2VUP A;  5J9C A;  2VCV A;  3VFI A;  1SL1 B;  4OCF A;  4N10 A;  1S3C A;  1ZGN A;  1RK4 A;  5H5R A;  7GSS A;  3TOT A;  1FVK A;  2X8G A;  4K8M A;  1Z6M A;  4O92 A;  1ML6 A;  4HI7 A;  3F4S A;  4FQU A;  5ECS A;  1EEM A;  14GS A;  4CW9 A;  4LMV A;  5LD0 A;  2CX3 A;  4WKW A;  5F05 A;  2RLI A;  1TDI A;  1ST9 A;  2A2P A;  4MH3 A;  2OE1 A;  2CVB A;  3HVX A;  5GAP D;  4GTU A;  3N9J A;  3NZN A;  4L5L A;  3O6T A;  5ELG A;  1EGR A;  3BCI A;  2VL2 C;  4D73 A;  2DLX A;  1V98 A;  3DVX A;  3PIN A;  5G1L A;  2GST A;  2FUG 2;  1A8L A;  4ECJ A;  1DE1 A;  2VCQ A;  3BCK A;  1GSQ A;  3RHC A;  2L6C A;  2YWN A;  1OAZ A;  5IPG A;  3UAP A;  2VO4 A;  2JSY A;  4LL1 B;  2XPD A;  3BD2 A;  12GS A;  1PX6 A;  2H76 A;  3R3E A;  2YCD A;  4I6X A;  1VF3 A;  4Q5F A;  4OFN A;  2WUL A;  2HSY A;  1ERU A;  2R6K A;  2ZUP A;  1OE8 A;  4GRF A;  2HFD A;  2GZZ A;  4PUR A;  5IOW A;  3MSZ A;  5AN1 A;  2IMF A;  1GSF A;  2DSA A;  4MJC A;  2L5L A;  4L0U A;  4F03 A;  2LJK A;  2H6X A;  3ED3 A;  2RUE A;  3QPM A;  2XBQ A;  3LSZ A;  2MMO A;  4K2D A;  4PTS A;  5E59 A;  3M8N A;  1FB0 A;  1XVW A;  1YF0 A;  5CNW A;  3Q19 A;  2K6V A;  2C1Y A;  1KEB A;  3GX0 A;  1QXH A;  1U88 A;  4BVY A;  1K0C A;  3HJO A;  4OO5 A;  1TJD A;  2BTO T;  3LYP A;  4FYC A;  1XIY A;  2VM2 A;  3GV1 A;  2LRN A;  3D5J A;  1YQ1 A;  1YF1 A;  5CRW A;  4HU7 A;  5LCZ A;  4HQS A;  3LFL A;  4KSO A;  2HLS A;  18GS A;  1F3B A;  3ZZX A;  6GSU A;  5BMU A;  4L5O A;  1FOH A;  5G5F A;  3RAZ A;  1PKW A;  4IQA A;  5J5N A;  5L71 A;  4MZC A;  4WBJ A;  1PQN A;  2CV4 A;  2DKI A;  4G0L A;  1VF4 A;  4L8E A;  2FWE A;  3DGQ A;  3N5O A;  2E0Q A;  2FA8 A;  2GSR A;  2PER A;  2L4Q A;  1DSB A;  4YKG A;  3D21 A;  3FRC A;  1F2E A;  1F37 A;  2HI7 A;  5IIZ A;  3ME7 A;  2R0C A;  2K18 A;  2PBJ A;  5ECM B;  3PH9 A;  1E6B A;  4N0V A;  2YZH A;  1XG8 A;  3EYT A;  3LWA A;  4NWY A;  4BL7 B;  1XBS A;  4AGS A;  2YJH A;  4F82 A;  2B3S A;  3ERG A;  3LG6 A;  3FHK A;  4TXV A;  5ID2 A;  4GQF A;  1W4V A;  5J41 A;  1H4O A;  4V1A p;  4EIQ A;  2MYG A;  5KN2 A;  1TRU A;  4KDX A;  2F51 A;  1I9D A;  5DAK A;  3GMF A;  3FZA A;  2K8S A;  2QA2 A;  3TGZ A;  2K8V A;  4V1A g;  11GS A;  1U87 A;  2ES7 A;  1PD2 1;  1A2M A;  3IR4 A;  3TB2 A;  3H4K A;  4TRX A;  2R5G A;  3H1N A;  2GZY A;  2VD0 A;  2VLV A;  3Q74 A;  2R0G A;  3UL3 A;  3MIX A;  3CQF A;  2JSZ A;  3CSI A;  3CTF A;  4HDE A;  4IN0 A;  3CTG A;  4PUA A;  2VLU A;  5DQS A;  1XXU A;  3C73 A;  2VCX A;  4TW5 A;  2CT6 A;  3KCM A;  2DJJ A;  2H8L A;  3F4T A;  1GTB A;  2DKH A;  1S3D A;  4I97 A;  4O7H A;  4E8E A;  1BQ7 A;  4IVF A;  3IK7 A;  2QC7 A;  1SK2 A;  4DEJ A;  1JLV A;  1AQW A;  3VWW A;  3WGE A;  1YJ6 A;  4MK3 A;  1B9X C;  4PQ1 A;  1PN0 A;  2VL3 A;  3TUE A;  1RQM A;  4OD7 A;  2LKU A;  2B1L A;  2PPT A;  4HEA 2;  2OBI A;  1TTZ A;  3P8W A;  3IRA A;  2WCI A;  1BAY A;  3UJ1 A;  2B5E A;  4BVX B;  1SYR A;  4E8H A;  5HR0 A;  2WJU A;  3E9J B;  2H30 A;  3TDG A;  3HJM A;  3FEU A;  4IHU A;  2F8A A;  5JWQ B;  4KDY A;  1GWC A;  2PGT A;  2Z9S A;  3Q18 A;  1FG4 A;  2H70 A;  3NOF A;  5HR3 A;  4K7N A;  2CVD A;  2JZR A;  3VI5 A;  4KSM A;  3TRQ A;  2VL2 A;  2AUV A;  2VCW A;  2H1A A;  4I2T A;  4N11 A;  4K6X A;  2PWJ A;  4V2M A;  4MH2 A;  3FW2 A;  3EMX A;  1TU8 A;  3P2A A;  1R4W A;  4F9Z A;  1EV9 A;  2NBS A;  5AIX A;  3TKS A;  1FO5 A;  1O7U A;  5KOW A;  2YJ7 A;  6GSW A;  2GQK A;  3UAR A;  1XWA A;  2YWO A;  1XOA A;  4IP6 A;  4GF0 A;  3J7Y k;  6GSY A;  20GS A;  3TKQ A;  2F8F A;  1M9B A;  1WIK A;  5J9B A;  1THX A;  3I6A A;  1MD3 A;  1XWK A;  5A4V A;  3GRX A;  1GSD A;  4KDU A;  2P5R A;  1M3I A;  4N0Z A;  2VAF A;  2MMN A;  1JLW A;  4POM A;  3GSS A;  5DAL A;  3HYP A;  4DSQ A;  2RUF A;  3LXZ A;  1TK8 B;  3EE2 A;  1TI3 A;  4ZB9 A;  2TIR A;  2OAC A;  4XIH A;  3DD3 A;  2C0G A;  2DIY A;  2H73 A;  5ECP B;  1IYI A;  2A2R A;  5B8B A;  3CRU A;  2TRX A;  1GSU A;  2CAI A;  4DVC A;  1SL0 B;  1O8W A;  5A4W A;  1HNC A;  3IBH A;  4FH8 A;  1X9S B;  3G7I A;  5A4U A;  2LJR A;  3IHG A;  2FY6 A;  1ZMA A;  3ZRE A;  3W8S A;  1GRX A;  2YP6 A;  1U3A A;  2HRA A;  1G7E A;  4HZ4 A;  5ECK B;  5IMD A;  1ILO A;  2I9H A;  4BA7 A;  1U6T A;  3APO A;  4ZB8 A;  2O87 A;  3GL5 A;  4YQU A;  4YH2 A;  4P3Y B;  2F3M A;  3CYN A;  1YEX A;  2J9H A;  3F6F A;  3Q6O A;  2H1G A;  3KIJ A;  2LUS A;  3MAK A;  5FHI A;  1AC1 A;  1K3L A;  1BED A;  1M99 A;  1TRV A;  3EWL A;  3ZMK A;  5ECI B;  2DMM A;  2NPB A;  1E2Y A;  3FZ9 A;  4HOJ A;  4EL1 A;  1GSY A;  5IMZ A;  2HZE B;  4GQC A;  1MDI A;  3H93 A;  2DML A;  4CY8 A;  1WWJ A;  3WYW A;  3ERW A;  4MPG A;  2LRC A;  2IME A;  1UC7 A;  1XFL A;  3L9S A;  2FWG A;  3G7J A;  1KNG A;  1F9M A;  5CRH A;  1T00 A;  5C04 A;  3CSH A;  3I43 A;  1T8E B;  1M2D A;  4I5Q A;  3IC4 A;  1K0N A;  1EOG A;  2O7K A;  3WGD A;  2KLX A;  3UVH A;  1SKR B;  1MDJ A;  1GSE A;  1WMJ A;  5HFG A;  3GH6 A;  1TI1 A;  3M3M A;  2WDU A;  5ECQ B;  1WRY A;  4L0W A;  4OMV A;  1Y6E A;  4KND A;  1XWC A;  3F63 A;  2FD3 A;  4QL7 A;  1B4P A;  3TJF A;  4XS4 B;  2P5Q A;  4GCI A;  5HFI A;  5ECN B;  3FMW A;  4TKY A;  2ON5 A;  2C4J A;  3A5I A;  3WD6 A;  3ZFL A;  2H1D A;  3IA1 A;  4WXT A;  4BPY A;  1MTC A;  1SK0 A;  1XCC A;  4RI7 A;  1ZZY A;  2G0F A;  1SD8 A;  1UN2 A;  2IJY A;  5DCG A;  2A4H A;  3KJY A;  1B4Q A;  4XTS A;  2C3Q A;  5GAN D;  1R5A A;  4O32 A;  2MBT A;  1TW9 A;  3BJ5 A;  2IMI A;  4BL7 A;  3VPT A;  4MZB A;  4K7I A;  4N30 A;  2V6K A;  4Z2R A;  3DVW A;  1USB A;  3LJR A;  4KH7 A;  2C3N A;  1G7O A;  5F07 A;  3TJG A;  4HS1 A;  2A2S A;  4F2I A;  2L6D A;  2YWI A;  3UOM A;  5DAL B;  2JZT A;  3FKF A;  1GL8 A;  3EC3 A;  1OVN A;  1PFO A;  2R4V A;  3CXG A;  4NAX A;  4YAV A;  1FB6 A;  1GH2 A;  1GLQ A;  4ICY A;  4MF6 A;  3M1G A;  4G0I A;  1M2B A;  4FYB A;  3APS A;  5B6N A;  4ML6 A;  3F0I A;  3MWH A;  3DML A;  3SWL A;  1VRS D;  3GUS A;  1PRX A;  2GZP A;  4O5U A;  4K0G A;  3VWX A;  4F0B A;  1AQV A;  3IXR A;  1EOH A;  1VF2 A;  3TRP A;  3D6I A;  3LEF A;  3BOA A;  4IQ1 A;  1PGT A;  2CA8 A;  17GS A;  2H0G A;  3M0F A;  2FLS A;  4WF5 A;  4X0X A;  5F8B A;  5D9W A;  1EV4 A;  1YZX A;  4JRR A;  2QKE A;  1DUG A;  2CAQ A;  1OKD A;  3CBU A;  1ERT A;  5F06 A;  3ZML A;  3QAV A; 
#chains in the Genus database with same CATH homology
 4KUN A;  2H6Y A;  1UVZ A;  3U6V A;  3ZIT A;  2MMA A;  1BX9 A;  3DXB A;  4WEY A;  4J57 E;  3RPN A;  1QFN A;  4NHZ A;  2IL3 A;  1GUK A;  1A24 A;  5LNK e;  1PSQ A;  4HUA A;  4RQR A;  1ZCP A;  2WRT A;  1HNA A;  2H6Z A;  3HZ8 A;  4X1U A;  4BVX A;  2QSI A;  1VF1 A;  1QMV A;  3HA9 A;  2DBC A;  2KHP A;  5BRT A;  6GST A;  4K5R A;  3EU3 A;  1KTE A;  2X8C A;  3IAS 2;  2DJK A;  4YQV A;  3CRT A;  3GTU A;  3HVS A;  1X5E A;  1T1V A;  3TOU A;  4PUF C;  4EDY A;  1QK8 A;  10GS A;  5DBQ A;  3L9V A;  4ZBA A;  1AAZ A;  5B8A A;  2G2Q A;  4O5Q A;  3ZFB A;  3A5W A;  1HNB A;  4DSR A;  2R3X A;  4MP4 A;  5EPF A;  2X8H A;  4K1F A;  2LNS A;  1GUL A;  4BWS A;  3LW9 A;  2X64 A;  2YV9 A;  2IIY A;  2I3Y A;  3IE3 A;  4GWR A;  4XRA A;  1A0F A;  2L4C A;  4XCS A;  3MNG A;  5B7C A;  1Z7R A;  2QA1 A;  4AJ8 A;  4J2F A;  1TRW A;  4ACS A;  1SD9 A;  4XS1 A;  1EP8 A;  4PGT A;  1R7H A;  4NPB A;  3QAW A;  4KW6 A;  4GST A;  1GUM A;  1AUC A;  2F9S A;  4F0C A;  1HQO A;  4MZW A;  1FAA A;  1WPI A;  1ZL9 A;  2O85 A;  3GX8 A;  2P31 A;  3C1S A;  4WET A;  2DIZ A;  4HQZ A;  3DRN A;  1J08 A;  4PNF A;  3RHB A;  3FR9 A;  3ZIJ A;  4QQ7 A;  4Q5Q A;  4IKH A;  2VOC A;  1XVQ A;  1WP0 A;  3GH9 A;  4EF0 A;  1AIU A;  5JWO B;  3PPU A;  2ZNM A;  5ABR A;  3QDN A;  4JU5 A;  4ZIJ A;  4ZL9 A;  1K0O A;  4MMM A;  3W8J A;  2JU5 A;  4ECI A;  1PMT A;  1ABA A;  3ME8 A;  1GTU A;  2H74 A;  4OWY A;  2H71 A;  3J7Y b;  2H01 A;  1T4Z A;  3KP9 A;  2GSS A;  2IWT A;  3KMN A;  2V41 A;  5HFK A;  3GYK A;  3PGT A;  3G9B A;  2R37 A;  4KCA A;  1YKA A;  3KH9 A;  2CZ3 A;  1Z6N A;  4KB3 A;  3IPZ A;  3P7X A;  5DVB A;  2DJ1 A;  1HD2 A;  3WT1 A;  5IOX A;  2IPA A;  1G6W A;  2HZE A;  1XWG A;  1OC9 B;  1XWB A;  4XS6 A;  1GNE A;  4G9H A;  2PN8 A;  2O89 A;  2GQM A;  2XC2 A;  3LGC A;  3QAG A;  1O8X A;  2YOI A;  5CRD A;  4EIP A;  4Z2U A;  1MDK A;  1B48 A;  5G30 A;  2MBS A;  3KEB A;  5J3R A;  4IEL A;  2OKA A;  5ECR B;  2IMD A;  2YV7 A;  1AW9 A;  2L5O A;  1G0T A;  5JCW A;  3GTU B;  4POB A;  2M46 A;  4J56 E;  3CMI A;  1QUW A;  2VLT A;  5EL8 A;  1Q4J A;  5JWR B;  2AJQ B;  1B9Y C;  4XS4 A;  2C0E A;  1G6Y A;  3D0Z A;  2VCZ A;  3TKP A;  1J9B A;  5COH A;  2GGT A;  1JZO A;  4JED A;  3KGK A;  4IGJ A;  2FA4 A;  4POK A;  1OC3 A;  5D9V A;  1X5C A;  2ON7 A;  1XOB A;  2OE0 A;  1LBK A;  2AV4 A;  3RBT A;  1FW1 A;  1X0R A;  3ZL5 A;  5D96 A;  1ZYP A;  2HXK A;  4MF7 A;  2BJX A;  1UA5 A;  2WFC A;  2DJ0 A;  2MMZ A;  1QGV A;  2HRN A;  2ZCT A;  4BWQ A;  4IP1 A;  1TXX A;  5KOX A;  3ZLP A;  3HVV A;  1JHB A;  1TU7 A;  5GSS A;  1BG5 A;  1JZW A;  2B5X A;  1V9W A;  1QQ2 A;  1XW9 A;  2NTO A;  1ACV A;  2HYX A;  2JAD A;  2OE3 A;  5D73 A;  2GT6 A;  5C00 A;  5IMA A;  3BBY A;  4ULX A;  2LQQ A;  1YY7 A;  1TK0 B;  4OFT A;  2J23 A;  3F9U A;  5IO0 A;  1SK1 A;  1XW6 A;  2JL4 A;  2GLR A;  2TRC P;  2X49 A;  2HE3 A;  5H5S A;  1JZD A;  2FNO A;  1ZYQ B;  3D22 A;  4KAE A;  3ZRD A;  4Z2T A;  1ERV A;  1PX7 A;  6GSS A;  3QFA C;  2LJA A;  2P0G A;  13GS A;  2PVQ A;  4LLR A;  4K5S A;  4ECB A;  5GST A;  4GLT A;  1V2A A;  4MA9 A;  4EE0 A;  2DC5 A;  1Z7P A;  5KEJ A;  2H75 A;  4DSS B;  1EP7 A;  5KN0 A;  1A2J A;  1XW5 A;  2H66 A;  4FYU A;  1Q98 A;  4G19 A;  1TKD B;  3KMO A;  3GA4 A;  4IJI A;  3O76 A;  2VD1 A;  3TJB A;  1LJR A;  1ZOF A;  2GSQ A;  4PQH A;  3NIV A;  3ISO A;  1B8X A;  2R0P A;  3F4R A;  2CVK A;  3AY8 A;  3I69 A;  3KXO A;  3GST A;  4ISD A;  4ZIL A;  3HXS A;  3KP8 A;  3KTL A;  1Z3E A;  2WZ9 A;  3A2X A;  4ZL7 A;  1TK5 B;  2OA7 A;  2E2M A;  1OC8 A;  5IMC A;  4NXI A;  3TJK A;  1MD4 A;  3FR6 A;  1PL2 A;  2N5B A;  5B6M A;  1M7T A;  3APQ A;  2LNT A;  2FHE A;  3HD5 A;  5AIS A;  4IJ3 A;  2GT5 A;  4ZB6 A;  5D8I A;  3HDC A;  5H5Q A;  3PR8 A;  3DKS A;  3P90 A;  1O6J A;  4G0K A;  5ECL B;  5FWG A;  4TR1 B;  4WBR D;  4CDO A;  2C0F A;  4X4J A;  3TRX A;  3F8U A;  3D4M A;  2IN3 A;  5AGY A;  2AHE A;  3FR3 A;  1PN9 A;  2C8U A;  5G2Z A;  6GSX A;  1GNW A;  5IPH A;  4NV5 A;  1TOF A;  1EWX A;  3GFK A;  3GIX A;  3HY2 A;  2EIO A;  3E3E A;  4ZXG A;  4X43 A;  4XRD A;  2CQ9 A;  2GQL A;  4WF4 A;  1GLP A;  1GP1 A;  1KBN A;  2M72 A;  5ENU A;  1VGL A;  2C80 A;  2E7P A;  3DYR A;  3UBK A;  5CAX A;  4CHS A;  2WB9 A;  2YNX A;  2LEG A;  1SEN A;  1T7P B;  5D93 A;  3O3T A;  4K7O A;  1NSW A;  2B6M A;  3IC8 A;  5IM9 A;  3EPT A;  2IFQ B;  1BYE A;  4K9Z A;  2OBK A;  1OE7 A;  3QR6 A;  3TKS C;  1JZR A;  2HZF A;  4RI6 A;  5EY6 A;  3GNJ A;  4K0N A;  4RUV A;  3HJP A;  5CRG A;  2EC4 A;  1T4Y A;  1SKS B;  16GS A;  3TKR A;  5HQP A;  2GDR A;  4YQM A;  5E4W A;  1C72 A;  4ID0 A;  4MNN A;  3E0U A;  2M80 A;  2PVO C;  2VIM A;  3FY7 A;  2WGR A;  1SYX A;  5IO2 A;  1J0F A;  1I5G A;  1M2A A;  1Z9H A;  2AYT A;  1OC9 A;  3UVT A;  2PUK C;  1PKZ A;  4TR3 A;  2XHF A;  3HKR A;  2DJ2 A;  2H0H A;  4RQX A;  4WR5 A;  2LST A;  1PA3 A;  4HJ2 A;  4KE3 A;  4JBB A;  1N8J A;  5ECO B;  1SJ6 A;  2AB6 A;  2HT9 A;  4MDC A;  5IMV A;  3ERF A;  1CQH A;  1NHO A;  3F3R A;  2FGX A;  4ZBD A;  2IMK A;  2V2G A;  4KA0 A;  3L9U A;  1FHE A;  4LA1 A;  4JR6 A;  1GTI A;  2O8V B;  3F3Q A;  1X9W B;  2YPM A;  2ALB A;  3JCM L;  1SU9 A;  1YKC A;  4XHM A;  5JCG A;  2FWH A;  2KP2 A;  2LTK A;  5J4U A;  1X9M B;  2WS2 A;  1FOV A;  1ON4 A;  4Z7X A;  3A3T A;  2AAW A;  1GSS A;  3EMP A;  1A2L A;  4IW9 A;  1BJX A;  1THO A;  1XPV A;  2GTU A;  3D4T A;  4EKZ A;  1NHY A;  3VK9 A;  1X5D A;  3L4N A;  4JR4 A;  1DBY A;  19GS A;  4TXO A;  4JZQ A;  2C3T A;  1TP9 A;  3EUR A;  3IK9 A;  2V1M A;  5DDL A;  1GTA A;  1R5P A;  4MLY A;  1F3A A;  2LV3 A;  2LQO A;  3VWV A;  1HYU A;  1NM3 A;  2L57 A;  1ZYE A;  3ZVJ A;  4MF5 A;  4AJ7 A;  2R2J A;  3I9V 2;  2GVP A;  3GUR A;  5CP1 A;  4IBP A;  3TCO A;  3FK8 A;  4ML1 A;  3GKX A;  4V2L A;  5ELA A;  4PXO A;  1Z5Y E;  5D9X A;  3QCP A;  2PMT A;  3W6G A;  3HZ4 A;  3FZ4 A;  1K0M A;  1Y25 A;  3C8E A;  3QFB C;  4EC0 A;  3R2Q A;  1SKW B;  1GUH A;  2UZ8 A;  22GS A;  4D73 B;  4ECC A;  3TJJ A;  2XBI A;  5CO3 A;  1AQX A;  4TR4 A;  4TR0 A;  4EDZ A;  3ZVJ D;  2A4V A;  3QD9 A;  2N5F A;  5IQY A;  2OAD A;  3KD0 A;  1K3Y A;  4GSN A;  2V32 A;  4DSS A;  5AIV A;  4LL4 B;  3FYG A;  1S3A A;  4K2X A;  1YEP A;  2XPE A;  5GZZ B;  4AF2 A;  4EVM A;  1F6M C;  2H72 A;  1K0B A;  5CRE A;  9GSS A;  2VCT A;  4G2E A;  1A23 A;  1CQG A;  3VPQ A;  2FWF A;  4GXZ A;  4V2N A;  2KUC A;  2HRF A;  3GHA A;  2CZ2 A;  3H79 A;  3RDW A;  3L0H A;  1V58 A;  3VLN A;  1WOU A;  1EZK A;  4H86 A;  2V6O A;  1V57 A;  3UMA A;  2B7J A;  3A2V A;  3HCZ A;  4KX4 A;  1ZYN A;  5D9T A;  1O81 A;  1PL1 A;  4EO3 A;  5HR2 A;  1IYH A;  4Q5R A;  5ECH B;  3EU4 A;  3K8N A;  1FVJ A;  3ZTL A;  4QL9 A;  2L59 A;  2DJ3 A;  2HNL A;  1H75 A;  2I1U A;  4BVY B;  3GKN A;  2OJL A;  1WJK A;  3GL3 A;  4O5R A;  4TOP A;  3C71 A;  3UBL A;  1NW2 A;  2X4A A;  1XZO A;  2H1B A;  2B7K A;  3RPP A;  4LMW A;  5F0G A;  1U3I A;  1YDK A;  3DIE A;  4MJA A;  3SBC A;  2QGV A;  3CSJ A;  2EIR A;  3GKK A;  5KN3 A;  4TR1 A;  1K3O A;  4USS A;  4ZBB A;  3S9F A;  4NV2 A;  3L78 A;  1URM A;  5HR1 A;  1MEK A;  4MCU A;  3TKS E;  2I4A A;  4MJE A;  1R26 A;  3IHQ A;  5DCH A;  5DJL A;  4TXO B;  1WE0 A;  4PNG A;  1OKT A;  5CYY A;  1JFU A;  2X99 A;  1M0U A;  4KGI A;  2H19 A;  4FIW A;  4G10 A;  3LQ7 A;  2B5Y A;  2KP1 A;  2GS3 A;  4I8B A;  1O85 A;  3WGX A;  3VWU A;  1O73 A;  4YAP A;  4NHW A;  2RII A;  4WR4 A;  3V1W A;  4I2U A;  6GSV A;  4CY6 A;  2VL9 A;  3DEX A;  4ILF A;  1LU4 A;  2D2Z A;  3ZIV A;  5FT3 A;  3MYD A;  5ID2 B;  2JZS A;  4OO4 A;  3C1R A;  4MJB A;  4KCE A;  1T3B A;  1V40 A;  3UEM A;  4KF9 A;  2N5A A;  5JCU A;  4MPF A;  4HJM A;  4A5P A;  3A2W A;  5KN1 A;  4TVE A;  3IV4 A;  2IFQ A;  1A0R P;  5G5E A;  2KOK A;  5DAK B;  1N2A A;  3QOU A;  2YN1 A;  3OR5 A;  3DWV A;  3MDK A;  1AXD A;  4NMU A;  3IAM 2;  4OCE A;  1M9A A;  4IS0 A;  3FZ5 A;  5DJM A;  3F6D A;  3U5R E;  3VI7 A;  2REM A;  3VUR A;  3KZQ A;  8GSS A;  1ERW A;  4OFM A;  3GKM A;  5A5K A;  5INY A;  4HU9 A;  2RM5 A;  3G7Y A;  4FO5 A;  4HZ2 A;  3QMX A;  2NDO A;  2CX4 A;  2HSM A;  2JAC A;  1EGO A;  3EVI A;  2LS5 A;  2H0I A;  2B1K A;  2PU9 C;  3WT2 A;  3KM6 A;  2MZC A;  1K0A A;  2HSH A;  3IDV A;  2C0D A;  4JE1 A;  2YZU A;  2RM6 A;  3M9J A;  2FCH A;  3C7M A;  3H8Q A;  3US3 A;  2NVL A;  5IMF A;  4Q5N A;  1OYJ A;  2BMX A;  4EXJ A;  1W89 A;  2LRT A;  3M9K A;  1RW1 A;  2VM1 A;  1DE2 A;  4MAB A;  2YWM A;  4YKF A;  1A8Y A;  4GSS A;  5G1K A;  1EEJ A;  4EUY A;  3IOS A;  4ZL8 A;  2HRK A;  1SJZ A;  2YAN A;  3LOR A;  3KTB A;  2EIQ A;  3EIN A;  3UIW A;  3LYK A;  5G31 A;  4TN8 A;  5DQY A;  1SJI A;  3ZYW A;  3KH7 A;  3HHV A;  4PX1 A;  3GN3 A;  2E2G A;  1SL2 B;  1TRS A;  4PQI A;  2I81 A;  4POL A;  5EVO A;  4AJ6 A;  1K0D A;  2K9F A;  3LXT A;  2VUP A;  5J9C A;  2VCV A;  3VFI A;  1SL1 B;  4OCF A;  4N10 A;  1S3C A;  1ZGN A;  1RK4 A;  5H5R A;  7GSS A;  3TOT A;  1FVK A;  2X8G A;  4K8M A;  1Z6M A;  4O92 A;  1ML6 A;  4HI7 A;  3F4S A;  4FQU A;  5ECS A;  1EEM A;  14GS A;  4CW9 A;  4LMV A;  5LD0 A;  2CX3 A;  4WKW A;  5F05 A;  2RLI A;  1TDI A;  1ST9 A;  2A2P A;  4MH3 A;  2OE1 A;  2CVB A;  3HVX A;  5GAP D;  4GTU A;  3N9J A;  3NZN A;  4L5L A;  3O6T A;  5ELG A;  1EGR A;  3BCI A;  2VL2 C;  4D73 A;  2DLX A;  1V98 A;  3DVX A;  3PIN A;  5G1L A;  2GST A;  2FUG 2;  1A8L A;  4ECJ A;  1DE1 A;  2VCQ A;  3BCK A;  1GSQ A;  3RHC A;  2L6C A;  2YWN A;  1OAZ A;  5IPG A;  3UAP A;  2VO4 A;  2JSY A;  4LL1 B;  2XPD A;  3BD2 A;  12GS A;  1PX6 A;  2H76 A;  3R3E A;  2YCD A;  4I6X A;  1VF3 A;  4Q5F A;  4OFN A;  2WUL A;  2HSY A;  1ERU A;  2R6K A;  2ZUP A;  1OE8 A;  4GRF A;  2HFD A;  2GZZ A;  4PUR A;  5IOW A;  3MSZ A;  5AN1 A;  2IMF A;  1GSF A;  2DSA A;  4MJC A;  2L5L A;  4L0U A;  4F03 A;  2LJK A;  2H6X A;  3ED3 A;  2RUE A;  3QPM A;  2XBQ A;  3LSZ A;  2MMO A;  4K2D A;  4PTS A;  5E59 A;  3M8N A;  1FB0 A;  1XVW A;  1YF0 A;  5CNW A;  3Q19 A;  2K6V A;  2C1Y A;  1KEB A;  3GX0 A;  1QXH A;  1U88 A;  4BVY A;  1K0C A;  3HJO A;  4OO5 A;  1TJD A;  2BTO T;  3LYP A;  4FYC A;  1XIY A;  2VM2 A;  3GV1 A;  2LRN A;  3D5J A;  1YQ1 A;  1YF1 A;  5CRW A;  4HU7 A;  5LCZ A;  4HQS A;  3LFL A;  4KSO A;  2HLS A;  18GS A;  1F3B A;  3ZZX A;  6GSU A;  5BMU A;  4L5O A;  1FOH A;  5G5F A;  3RAZ A;  1PKW A;  4IQA A;  5J5N A;  5L71 A;  4MZC A;  4WBJ A;  1PQN A;  2CV4 A;  2DKI A;  4G0L A;  1VF4 A;  4L8E A;  2FWE A;  3DGQ A;  3N5O A;  2E0Q A;  2FA8 A;  2GSR A;  2PER A;  2L4Q A;  1DSB A;  4YKG A;  3D21 A;  3FRC A;  1F2E A;  1F37 A;  2HI7 A;  5IIZ A;  3ME7 A;  2R0C A;  2K18 A;  2PBJ A;  5ECM B;  3PH9 A;  1E6B A;  4N0V A;  2YZH A;  3EYT A;  3LWA A;  4NWY A;  4BL7 B;  1XBS A;  4AGS A;  2YJH A;  4F82 A;  2B3S A;  3ERG A;  3LG6 A;  3FHK A;  4TXV A;  5ID2 A;  4GQF A;  1W4V A;  5J41 A;  1H4O A;  4V1A p;  4EIQ A;  2MYG A;  5KN2 A;  1TRU A;  4KDX A;  2F51 A;  1I9D A;  5DAK A;  3GMF A;  3FZA A;  2K8S A;  2QA2 A;  3TGZ A;  2K8V A;  4V1A g;  11GS A;  1U87 A;  2ES7 A;  1PD2 1;  1A2M A;  3IR4 A;  3TB2 A;  3H4K A;  4TRX A;  2R5G A;  3H1N A;  2GZY A;  2VD0 A;  2VLV A;  3Q74 A;  2R0G A;  3UL3 A;  3MIX A;  2JSZ A;  3CSI A;  3CTF A;  4HDE A;  4IN0 A;  3CTG A;  4PUA A;  2VLU A;  5DQS A;  1XXU A;  3C73 A;  2VCX A;  4TW5 A;  2CT6 A;  3KCM A;  2DJJ A;  2H8L A;  3F4T A;  1GTB A;  2DKH A;  1S3D A;  4I97 A;  4O7H A;  4E8E A;  1BQ7 A;  4IVF A;  3IK7 A;  2QC7 A;  1SK2 A;  4DEJ A;  1JLV A;  1AQW A;  3VWW A;  3WGE A;  1YJ6 A;  4MK3 A;  1B9X C;  4PQ1 A;  1PN0 A;  2VL3 A;  3TUE A;  1RQM A;  4OD7 A;  2LKU A;  2B1L A;  2PPT A;  4HEA 2;  2OBI A;  1TTZ A;  3P8W A;  3IRA A;  2WCI A;  1BAY A;  3UJ1 A;  2B5E A;  4BVX B;  1SYR A;  4E8H A;  5HR0 A;  2WJU A;  3E9J B;  2H30 A;  3TDG A;  3HJM A;  3FEU A;  4IHU A;  2F8A A;  5JWQ B;  4KDY A;  1GWC A;  2PGT A;  2Z9S A;  3Q18 A;  1FG4 A;  2H70 A;  3NOF A;  5HR3 A;  4K7N A;  2CVD A;  2JZR A;  3VI5 A;  4KSM A;  3TRQ A;  2VL2 A;  2AUV A;  2VCW A;  2H1A A;  4I2T A;  4N11 A;  4K6X A;  2PWJ A;  4V2M A;  4MH2 A;  3FW2 A;  3EMX A;  1TU8 A;  3P2A A;  1R4W A;  4F9Z A;  1EV9 A;  2NBS A;  5AIX A;  3TKS A;  1FO5 A;  1O7U A;  5KOW A;  2YJ7 A;  6GSW A;  2GQK A;  3UAR A;  1XWA A;  2YWO A;  1XOA A;  4IP6 A;  4GF0 A;  3J7Y k;  6GSY A;  20GS A;  3TKQ A;  2F8F A;  1M9B A;  1WIK A;  5J9B A;  1THX A;  3I6A A;  1MD3 A;  1XWK A;  5A4V A;  3GRX A;  1GSD A;  4KDU A;  2P5R A;  4N0Z A;  2VAF A;  2MMN A;  1JLW A;  4POM A;  3GSS A;  5DAL A;  3HYP A;  4DSQ A;  2RUF A;  3LXZ A;  1TK8 B;  3EE2 A;  1TI3 A;  4ZB9 A;  2TIR A;  2OAC A;  4XIH A;  3DD3 A;  2C0G A;  2DIY A;  2H73 A;  5ECP B;  1IYI A;  2A2R A;  5B8B A;  3CRU A;  2TRX A;  1GSU A;  2CAI A;  4DVC A;  1SL0 B;  1O8W A;  5A4W A;  1HNC A;  3IBH A;  4FH8 A;  1X9S B;  3G7I A;  5A4U A;  2LJR A;  3IHG A;  2FY6 A;  1ZMA A;  3ZRE A;  3W8S A;  1GRX A;  2YP6 A;  1U3A A;  2HRA A;  1G7E A;  4HZ4 A;  5ECK B;  5IMD A;  1ILO A;  2I9H A;  4BA7 A;  1U6T A;  3APO A;  4ZB8 A;  2O87 A;  3GL5 A;  4YQU A;  4YH2 A;  4P3Y B;  2F3M A;  3CYN A;  1YEX A;  2J9H A;  3F6F A;  3Q6O A;  2H1G A;  3KIJ A;  2LUS A;  3MAK A;  5FHI A;  1AC1 A;  1K3L A;  1BED A;  1M99 A;  1TRV A;  3EWL A;  3ZMK A;  5ECI B;  2DMM A;  2NPB A;  1E2Y A;  3FZ9 A;  4HOJ A;  4EL1 A;  1GSY A;  5IMZ A;  2HZE B;  4GQC A;  1MDI A;  3H93 A;  2DML A;  4CY8 A;  1WWJ A;  3WYW A;  3ERW A;  4MPG A;  2LRC A;  2IME A;  1UC7 A;  1XFL A;  3L9S A;  2FWG A;  3G7J A;  1KNG A;  1F9M A;  5CRH A;  1T00 A;  5C04 A;  3CSH A;  3I43 A;  1T8E B;  1M2D A;  4I5Q A;  3IC4 A;  1K0N A;  1EOG A;  2O7K A;  3WGD A;  2KLX A;  3UVH A;  1SKR B;  1MDJ A;  1GSE A;  1WMJ A;  5HFG A;  3GH6 A;  1TI1 A;  3M3M A;  2WDU A;  5ECQ B;  1WRY A;  4L0W A;  4OMV A;  1Y6E A;  4KND A;  1XWC A;  3F63 A;  2FD3 A;  4QL7 A;  1B4P A;  3TJF A;  4XS4 B;  2P5Q A;  4GCI A;  5HFI A;  5ECN B;  3FMW A;  4TKY A;  2ON5 A;  2C4J A;  3A5I A;  3WD6 A;  3ZFL A;  2H1D A;  3IA1 A;  4WXT A;  4BPY A;  1MTC A;  1SK0 A;  1XCC A;  4RI7 A;  1ZZY A;  2G0F A;  1SD8 A;  1UN2 A;  2IJY A;  5DCG A;  2A4H A;  3KJY A;  1B4Q A;  4XTS A;  2C3Q A;  5GAN D;  1R5A A;  4O32 A;  2MBT A;  1TW9 A;  3BJ5 A;  2IMI A;  4BL7 A;  3VPT A;  4MZB A;  4K7I A;  4N30 A;  2V6K A;  4Z2R A;  3DVW A;  1USB A;  3LJR A;  4KH7 A;  2C3N A;  1G7O A;  5F07 A;  3TJG A;  4HS1 A;  2A2S A;  4F2I A;  2L6D A;  2YWI A;  3UOM A;  5DAL B;  2JZT A;  3FKF A;  1GL8 A;  3EC3 A;  1OVN A;  2R4V A;  3CXG A;  4NAX A;  4YAV A;  1FB6 A;  1GH2 A;  1GLQ A;  4ICY A;  4MF6 A;  3M1G A;  4G0I A;  1M2B A;  4FYB A;  3APS A;  5B6N A;  4ML6 A;  3F0I A;  3MWH A;  3DML A;  3SWL A;  1VRS D;  3GUS A;  1PRX A;  2GZP A;  4O5U A;  4K0G A;  3VWX A;  4F0B A;  1AQV A;  3IXR A;  1EOH A;  1VF2 A;  3TRP A;  3D6I A;  3LEF A;  3BOA A;  4IQ1 A;  1PGT A;  2CA8 A;  17GS A;  2H0G A;  3M0F A;  2FLS A;  4WF5 A;  4X0X A;  5F8B A;  5D9W A;  1EV4 A;  1YZX A;  4JRR A;  2QKE A;  1DUG A;  2CAQ A;  1OKD A;  3CBU A;  1ERT A;  5F06 A;  3ZML A;  3QAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...