3F0QX

Staphylococcus aureus dihydrofolate reductase complexed with nadph and 2,4-diamino-5-[3-(3-methoxy-5-(2,6-dimethylphenyl)phenyl)but-1-ynyl]-6-methylpyrimidine
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
157
structure length
157
Chain Sequence
TLSILVAHDLQRVIGFENQLPWHLPNDLKHVKKLSTGHTLVMGRKTFESIGKPLPNRRNVVLTSDTSFNVEGVDVIHSIEDIYQLPGHVFIFGGQTLFEEMIDKVDDMYITVIEGKFRGDTFFPPYTFEDWEVASSVEGKLDEKNTIPHTFLHLIRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Predicting resistance mutations using protein design algorithms.
pubmed doi rcsb
molecule keywords Trimethoprim-sensitive dihydrofolate reductase
molecule tags Oxidoreductase
source organism Staphylococcus aureus rf122
total genus 39
structure length 157
sequence length 157
ec nomenclature ec 1.5.1.3: Dihydrofolate reductase.
pdb deposition date 2008-10-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.430.10 Alpha Beta 3-Layer(aba) Sandwich Dihydrofolate Reductase, subunit A Dihydrofolate Reductase, subunit A 3f0qX00
4KM0A 1DRAA 3M08A 1RX1A 2ANOA 1DR1A 1RC4A 3NZCX 3FS6A 1S3WA 1OHKA 3TQBA 3QG2A 1RA8A 4KL9A 3ROAA 2D0KA 4I13A 3I8AX 4P3QA 4P68A 4H97A 5HVBA 2HXVA 4KJKA 6DFRA 1HFQA 3D80A 1J3IA 3EEMA 4RGCA 3M09A 4M6JA 2JYBA 4KY4A 5JG0X 3CSEA 1HFRA 2W3MA 1DRHA 4KD7A 4PSYA 2CD2A 4CD2A 1LY4A 3F91A 1DR7A 3JTWA 3NZBX 1DR5A 3QLXA 3IROA 3K45A 4LEKX 1DAJA 2H2QA 4KJLA 1RF7A 2L28A 3IX9A 4H96A 3FL8A 3FREX 4IXED 3SRWX 1DLSA 1RX3A 3HJ3A 1HFPA 1DLRA 1LY3A 4LAHX 1S3YA 1RX7A 1J3JA 4Q0DA 5HQYA 3JWKA 1U71A 1IA2A 3SA1A 3FQFA 1DISA 4DP3A 1DRBA 2BLCA 3SR5X 5CC9A 3OCHA 3UM5A 1RA3A 3DRCA 1RG7A 3QLWA 3TQAA 3NZ6X 3SRRX 1RH3A 1DG5A 3FYWX 3RO9A 4NX7A 1YHOA 1QZFA 1VJ3A 4XT8A 2W3WA 3GYFA 1TDRA 5HUIA 4G3MA 5ECXA 3K74A 3JW5A 3QLZA 3FY9X 3HBBA 5HPBA 3FY8X 1MVSA 3QYOA 3CLBA 3JVXA 1J3KA 1OHJA 3EX8A 3KY8A 3GHVA 4XE6X 3NXYA 1DHFA 1S3VA 4KNEA 3L3RA 4DPDA 4DFRA 1PD9A 1RB2A 7DFRA 1E26A 3DGAA 3IRMA 2ZZAA 4G8ZX 2BLBA 3FL9A 5HT4A 1RA2A 3NZDA 1DYHA 1IA3A 3QYLA 2W3BA 4LAGX 1M79A 2O7PA 1RX8A 3F8YA 5FDAA 4X5JA 3NZ9X 5JA3A 5U26A 5U27A 4KY8A 1M7AA 2AZNA 3SQYX 1DYRA 3Q1HA 3JWCA 4KAKA 3DFRA 1D1GA 4QLEA 4FGGA 3QFXA 4Q0EA 5HT5A 4XT7A 1RA1A 1RB3A 4X5GA 1U72A 4XRBA 3F0VX 4QHVA 4HA9A 5E8QA 4KLXA 3NXOA 4PDJA 2W9HA 3FQCA 2W3AA 3TD8A 2FZIA 3QL3A 4X5FA 4G95A 4ELBA 4QJZD 4H95A 4NX6A 3FRBX 4PTHA 3S7AA 4EJ1A 4GH8A 2HQPA 1DDSA 4FHBA 3QLRA 4PSTA 4ELGA 2OBCA 3DAUA 1U70A 4ELFA 1DG7A 3KFYA 3DG8A 4M6KA 2ITHA 3KGYA 3N0HA 3NXRA 5HVEA 1JOLA 3I3RA 1CD2A 4EILA 3NXVA 8DFRA 1DR6A 3FRAX 1RA9A 4H98A 3R33A 3GI2A 1DF7A 4X5HA 3F0XX 3F8ZA 3FRFX 2W9SA 4KEBA 4KYAA 3NU0A 1DHIA 5HF2X 3QLSA 4M2XA 4EIGA 2P4GA 3CL9A 3F0QX 2W9TA 3NTZA 3QLYA 4XT5A 2GD9A 4ELHA 3DL5A 2XW7A 3LG4A 4XT6A 1RX6A 3S3VA 1DG8A 3SAIA 1BZFA 4EIZA 4HOFA 1AOEA 1M78A 3IA4A 4ECKA 3FQ0A 3EELA 4XECX 1PDBA 3OAFA 2C2SA 4FGHA 4OSGA 4PTJA 4XT4A 3FRDX 3S9UA 4LAEX 2FZHA 1LUDA 1ZDRA 3JW3A 1KMVA 4M7UA 3TQ8A 3QL0A 4M6LA 2W9GA 1DRFA 3JWFA 3QGTA 2DRCA 4IXFX 3GHWA 4QLFA 1DR2A 4KM2A 1RX5A 4QI9A 3IRNA 5DXVA 3JSUA 3RG9A 2LF1A 1DR4A 3SA2A 4KBNA 3FQVA 3SH2A 3ZPCA 3GHCA 2G6VA 1RD7A 5DFRA 5HI6A 2C2TA 1IA1A 1KLKA 2W3VA 3UM8A 4KJJA 3DATA 1MVTA 3IA5A 4DDRA 4ELEA 2B3ZA 2CIGA 1JUVA 5CCCA 5EAJA 1RX4A 3K47A 1IA4A 4HA7A 4QLGA 4M7VA 5HQZA 3VCOA 4P66A 2ANQA 3FQOA 1RX2A 2INQA 2QK8A 3ZPGA 4KFJA 1DHJA 3DL6A 1DDRA 3NXXA 1DYIA 2FZJA 4DPHA 3EEKA 1DR3A 3FQZA 5HSRA 4PSSA 5ECCA 1RX9A 1DIUA 1PD8A 3EIGA 3F0BX 4OR7A 5HSUA 3NRRA 3F0SX 4HOEA 3F0UX 4P3RA 2BLAA 2BL9A 3E0BA 3JWMA 1S3UA 3SRUX 3K2HA 1SEJA 4Q6AA 3CD2A 2D5NA 4I1NA 4HOGA 4IXGX 3KJRA 4Q67A 3NZAX 1AI9A 3D84X 1AO8A 3FYVX 2DHFA 5HF0X 2KGKA 3SRSX 2HM9A 3SRQX 4X5IA 3INVA 4QJCA 3TQ9A 1KMSA 1RE7A 2OIPA 1DREA 3UM6A 4TU5X 1CZ3A 1VDRA 1BOZA 1JOMA 3EEJA 3NXTA 1DYJA 3KJSA 3SGYA
chains in the Genus database with same CATH superfamily
4KM0A 1DRAA 3M08A 1RX1A 2ANOA 1DR1A 1RC4A 3NZCX 3FS6A 1S3WA 1OHKA 3TQBA 3QG2A 1RA8A 4KL9A 3ROAA 2D0KA 4I13A 3I8AX 4P3QA 4P68A 4H97A 5HVBA 2HXVA 4KJKA 6DFRA 1HFQA 3D80A 1J3IA 3EEMA 4RGCA 3M09A 4M6JA 2JYBA 4KY4A 5JG0X 3CSEA 1HFRA 2W3MA 1DRHA 4KD7A 4PSYA 2CD2A 4CD2A 1LY4A 3F91A 1DR7A 3JTWA 3NZBX 1DR5A 3QLXA 3IROA 3K45A 4LEKX 1DAJA 2H2QA 4KJLA 1RF7A 2L28A 3IX9A 4H96A 3FL8A 3FREX 4IXED 3SRWX 1DLSA 1RX3A 3HJ3A 1HFPA 1DLRA 1LY3A 4LAHX 1S3YA 1RX7A 1J3JA 4Q0DA 5HQYA 3JWKA 1U71A 1IA2A 3SA1A 3FQFA 1DISA 4DP3A 1DRBA 2BLCA 3SR5X 5CC9A 3OCHA 3UM5A 1RA3A 3DRCA 1RG7A 3QLWA 3TQAA 3NZ6X 3SRRX 1RH3A 1DG5A 3FYWX 3RO9A 4NX7A 1YHOA 1QZFA 1VJ3A 4XT8A 2W3WA 3GYFA 1TDRA 5HUIA 4G3MA 5ECXA 3K74A 3JW5A 3QLZA 3FY9X 3HBBA 5HPBA 3FY8X 1MVSA 3QYOA 3CLBA 3JVXA 1J3KA 1OHJA 3EX8A 3KY8A 3GHVA 4XE6X 3NXYA 1DHFA 1S3VA 4KNEA 3L3RA 4DPDA 4DFRA 1PD9A 1RB2A 7DFRA 1E26A 3DGAA 3IRMA 2ZZAA 4G8ZX 2BLBA 3FL9A 5HT4A 1RA2A 3NZDA 1DYHA 1IA3A 3QYLA 2W3BA 4LAGX 1M79A 2O7PA 1RX8A 3F8YA 5FDAA 4X5JA 3NZ9X 5JA3A 5U26A 5U27A 4KY8A 1M7AA 2AZNA 3SQYX 1DYRA 3Q1HA 3JWCA 4KAKA 3DFRA 1D1GA 4QLEA 4FGGA 3QFXA 4Q0EA 5HT5A 4XT7A 1RA1A 1RB3A 4X5GA 1U72A 4XRBA 3F0VX 4QHVA 4HA9A 5E8QA 4KLXA 3NXOA 4PDJA 2W9HA 3FQCA 2W3AA 3TD8A 2FZIA 3QL3A 4X5FA 4G95A 4ELBA 4QJZD 4H95A 4NX6A 3FRBX 4PTHA 3S7AA 4EJ1A 4GH8A 2HQPA 1DDSA 4FHBA 3QLRA 4PSTA 4ELGA 2OBCA 3DAUA 1U70A 4ELFA 1DG7A 3KFYA 3DG8A 4M6KA 2ITHA 3KGYA 3N0HA 3NXRA 5HVEA 1JOLA 3I3RA 1CD2A 4EILA 3NXVA 8DFRA 1DR6A 3FRAX 1RA9A 4H98A 3R33A 3GI2A 1DF7A 4X5HA 3F0XX 3F8ZA 3FRFX 2W9SA 4KEBA 4KYAA 3NU0A 1DHIA 5HF2X 3QLSA 4M2XA 4EIGA 2P4GA 3CL9A 3F0QX 2W9TA 3NTZA 3QLYA 4XT5A 2GD9A 4ELHA 3DL5A 2XW7A 3LG4A 4XT6A 1RX6A 3S3VA 1DG8A 3SAIA 1BZFA 4EIZA 4HOFA 1AOEA 1M78A 3IA4A 4ECKA 3FQ0A 3EELA 4XECX 1PDBA 3OAFA 2C2SA 4FGHA 4OSGA 4PTJA 4XT4A 3FRDX 3S9UA 4LAEX 2FZHA 1LUDA 1ZDRA 3JW3A 1KMVA 4M7UA 3TQ8A 3QL0A 4M6LA 2W9GA 1DRFA 3JWFA 3QGTA 2DRCA 4IXFX 3GHWA 4QLFA 1DR2A 4KM2A 1RX5A 4QI9A 3IRNA 5DXVA 3JSUA 3RG9A 2LF1A 1DR4A 3SA2A 4KBNA 3FQVA 3SH2A 3ZPCA 3GHCA 2G6VA 1RD7A 5DFRA 5HI6A 2C2TA 1IA1A 1KLKA 2W3VA 3UM8A 4KJJA 3DATA 1MVTA 3IA5A 4DDRA 4ELEA 2B3ZA 2CIGA 1JUVA 5CCCA 5EAJA 1RX4A 3K47A 1IA4A 4HA7A 4QLGA 4M7VA 5HQZA 3VCOA 4P66A 2ANQA 3FQOA 1RX2A 2INQA 2QK8A 3ZPGA 4KFJA 1DHJA 3DL6A 1DDRA 3NXXA 1DYIA 2FZJA 4DPHA 3EEKA 1DR3A 3FQZA 5HSRA 4PSSA 5ECCA 1RX9A 1DIUA 1PD8A 3EIGA 3F0BX 4OR7A 5HSUA 3NRRA 3F0SX 4HOEA 3F0UX 4P3RA 2BLAA 2BL9A 3E0BA 3JWMA 1S3UA 3SRUX 3K2HA 1SEJA 4Q6AA 3CD2A 2D5NA 4I1NA 4HOGA 4IXGX 3KJRA 4Q67A 3NZAX 1AI9A 3D84X 1AO8A 3FYVX 2DHFA 5HF0X 2KGKA 3SRSX 2HM9A 3SRQX 4X5IA 3INVA 4QJCA 3TQ9A 1KMSA 1RE7A 2OIPA 1DREA 3UM6A 4TU5X 1CZ3A 1VDRA 1BOZA 1JOMA 3EEJA 3NXTA 1DYJA 3KJSA 3SGYA
chains in the Genus database with same CATH topology
4KM0A 1DRAA 3M08A 1RX1A 2ANOA 1DR1A 1RC4A 3NZCX 3FS6A 1S3WA 1OHKA 3TQBA 3QG2A 1RA8A 4KL9A 3ROAA 2D0KA 4I13A 3I8AX 4P3QA 4P68A 4H97A 5HVBA 2HXVA 4KJKA 6DFRA 1HFQA 3D80A 1J3IA 3EEMA 4RGCA 3M09A 4M6JA 2JYBA 4KY4A 5JG0X 3CSEA 1HFRA 2W3MA 1DRHA 4KD7A 4PSYA 2CD2A 4CD2A 1LY4A 3F91A 1DR7A 3JTWA 3NZBX 1DR5A 3QLXA 3IROA 3K45A 4LEKX 1DAJA 2H2QA 4KJLA 1RF7A 2L28A 3IX9A 4H96A 3FL8A 3FREX 4IXED 3SRWX 1DLSA 1RX3A 3HJ3A 1HFPA 1DLRA 1LY3A 4LAHX 1S3YA 1RX7A 1J3JA 4Q0DA 5HQYA 3JWKA 1U71A 1IA2A 3SA1A 3FQFA 1DISA 4DP3A 1DRBA 2BLCA 3SR5X 5CC9A 3OCHA 3UM5A 1RA3A 3DRCA 1RG7A 3QLWA 3TQAA 3NZ6X 3SRRX 1RH3A 1DG5A 3FYWX 3RO9A 4NX7A 1YHOA 1QZFA 1VJ3A 4XT8A 2W3WA 3GYFA 1TDRA 5HUIA 4G3MA 5ECXA 3K74A 3JW5A 3QLZA 3FY9X 3HBBA 5HPBA 3FY8X 1MVSA 3QYOA 3CLBA 3JVXA 1J3KA 1OHJA 3EX8A 3KY8A 3GHVA 4XE6X 3NXYA 1DHFA 1S3VA 4KNEA 3L3RA 4DPDA 4DFRA 1PD9A 1RB2A 7DFRA 1E26A 3DGAA 3IRMA 2ZZAA 4G8ZX 2BLBA 3FL9A 5HT4A 1RA2A 3NZDA 1DYHA 1IA3A 3QYLA 2W3BA 4LAGX 1M79A 2O7PA 1RX8A 3F8YA 5FDAA 4X5JA 3NZ9X 5JA3A 5U26A 5U27A 4KY8A 1M7AA 2AZNA 3SQYX 1DYRA 3Q1HA 3JWCA 4KAKA 3DFRA 1D1GA 4QLEA 4FGGA 3QFXA 4Q0EA 5HT5A 4XT7A 1RA1A 1RB3A 4X5GA 1U72A 4XRBA 3F0VX 4QHVA 4HA9A 5E8QA 4KLXA 3NXOA 4PDJA 2W9HA 3FQCA 2W3AA 3TD8A 2FZIA 3QL3A 4X5FA 4G95A 4ELBA 4QJZD 4H95A 4NX6A 3FRBX 4PTHA 3S7AA 4EJ1A 4GH8A 2HQPA 1DDSA 4FHBA 3QLRA 4PSTA 4ELGA 2OBCA 3DAUA 1U70A 4ELFA 1DG7A 3KFYA 3DG8A 4M6KA 2ITHA 3KGYA 3N0HA 3NXRA 5HVEA 1JOLA 3I3RA 1CD2A 4EILA 3NXVA 8DFRA 1DR6A 3FRAX 1RA9A 4H98A 3R33A 3GI2A 1DF7A 4X5HA 3F0XX 3F8ZA 3FRFX 2W9SA 4KEBA 4KYAA 3NU0A 1DHIA 5HF2X 3QLSA 4M2XA 4EIGA 2P4GA 3CL9A 3F0QX 2W9TA 3NTZA 3QLYA 4XT5A 2GD9A 4ELHA 3DL5A 2XW7A 3LG4A 4XT6A 1RX6A 3S3VA 1DG8A 3SAIA 1BZFA 4EIZA 4HOFA 1AOEA 1M78A 3IA4A 4ECKA 3FQ0A 3EELA 4XECX 1PDBA 3OAFA 2C2SA 4FGHA 4OSGA 4PTJA 4XT4A 3FRDX 3S9UA 4LAEX 2FZHA 1LUDA 1ZDRA 3JW3A 1KMVA 4M7UA 3TQ8A 3QL0A 4M6LA 2W9GA 1DRFA 3JWFA 3QGTA 2DRCA 4IXFX 3GHWA 4QLFA 1DR2A 4KM2A 1RX5A 4QI9A 3IRNA 5DXVA 3JSUA 3RG9A 2LF1A 1DR4A 3SA2A 4KBNA 3FQVA 3SH2A 3ZPCA 3GHCA 2G6VA 1RD7A 5DFRA 5HI6A 2C2TA 1IA1A 1KLKA 2W3VA 3UM8A 4KJJA 3DATA 1MVTA 3IA5A 4DDRA 4ELEA 2B3ZA 2CIGA 1JUVA 5CCCA 5EAJA 1RX4A 3K47A 1IA4A 4HA7A 4QLGA 4M7VA 5HQZA 3VCOA 4P66A 2ANQA 3FQOA 1RX2A 2INQA 2QK8A 3ZPGA 4KFJA 1DHJA 3DL6A 1DDRA 3NXXA 1DYIA 2FZJA 4DPHA 3EEKA 1DR3A 3FQZA 5HSRA 4PSSA 5ECCA 1RX9A 1DIUA 1PD8A 3EIGA 3F0BX 4OR7A 5HSUA 3NRRA 3F0SX 4HOEA 3F0UX 4P3RA 2BLAA 2BL9A 3E0BA 3JWMA 1S3UA 3SRUX 3K2HA 1SEJA 4Q6AA 3CD2A 2D5NA 4I1NA 4HOGA 4IXGX 3KJRA 4Q67A 3NZAX 1AI9A 3D84X 1AO8A 3FYVX 2DHFA 5HF0X 2KGKA 3SRSX 2HM9A 3SRQX 4X5IA 3INVA 4QJCA 3TQ9A 1KMSA 1RE7A 2OIPA 1DREA 3UM6A 4TU5X 1CZ3A 1VDRA 1BOZA 1JOMA 3EEJA 3NXTA 1DYJA 3KJSA 3SGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KM0 A;  1DRA A;  3M08 A;  1RX1 A;  2ANO A;  1DR1 A;  1RC4 A;  3NZC X;  3FS6 A;  1S3W A;  1OHK A;  3TQB A;  3QG2 A;  1RA8 A;  4KL9 A;  3ROA A;  2D0K A;  4I13 A;  3I8A X;  4P3Q A;  4P68 A;  4H97 A;  5HVB A;  2HXV A;  4KJK A;  6DFR A;  1HFQ A;  3D80 A;  1J3I A;  3EEM A;  4RGC A;  3M09 A;  4M6J A;  2JYB A;  4KY4 A;  5JG0 X;  3CSE A;  1HFR A;  2W3M A;  1DRH A;  4KD7 A;  4PSY A;  2CD2 A;  4CD2 A;  1LY4 A;  3F91 A;  1DR7 A;  3JTW A;  3NZB X;  1DR5 A;  3QLX A;  3IRO A;  3K45 A;  4LEK X;  1DAJ A;  2H2Q A;  4KJL A;  1RF7 A;  2L28 A;  3IX9 A;  4H96 A;  3FL8 A;  3FRE X;  4IXE D;  3SRW X;  1DLS A;  1RX3 A;  3HJ3 A;  1HFP A;  1DLR A;  1LY3 A;  4LAH X;  1S3Y A;  1RX7 A;  1J3J A;  4Q0D A;  5HQY A;  3JWK A;  1U71 A;  1IA2 A;  3SA1 A;  3FQF A;  1DIS A;  4DP3 A;  1DRB A;  2BLC A;  3SR5 X;  5CC9 A;  3OCH A;  3UM5 A;  1RA3 A;  3DRC A;  1RG7 A;  3QLW A;  3TQA A;  3NZ6 X;  3SRR X;  1RH3 A;  1DG5 A;  3FYW X;  3RO9 A;  4NX7 A;  1YHO A;  1QZF A;  1VJ3 A;  4XT8 A;  2W3W A;  3GYF A;  1TDR A;  5HUI A;  4G3M A;  5ECX A;  3K74 A;  3JW5 A;  3QLZ A;  3FY9 X;  3HBB A;  5HPB A;  3FY8 X;  1MVS A;  3QYO A;  3CLB A;  3JVX A;  1J3K A;  1OHJ A;  3EX8 A;  3KY8 A;  3GHV A;  4XE6 X;  3NXY A;  1DHF A;  1S3V A;  4KNE A;  3L3R A;  4DPD A;  4DFR A;  1PD9 A;  1RB2 A;  7DFR A;  1E26 A;  3DGA A;  3IRM A;  2ZZA A;  4G8Z X;  2BLB A;  3FL9 A;  5HT4 A;  1RA2 A;  3NZD A;  1DYH A;  1IA3 A;  3QYL A;  2W3B A;  4LAG X;  1M79 A;  2O7P A;  1RX8 A;  3F8Y A;  5FDA A;  4X5J A;  3NZ9 X;  5JA3 A;  5U26 A;  5U27 A;  4KY8 A;  1M7A A;  2AZN A;  3SQY X;  1DYR A;  3Q1H A;  3JWC A;  4KAK A;  3DFR A;  1D1G A;  4QLE A;  4FGG A;  3QFX A;  4Q0E A;  5HT5 A;  4XT7 A;  1RA1 A;  1RB3 A;  4X5G A;  1U72 A;  4XRB A;  3F0V X;  4QHV A;  4HA9 A;  5E8Q A;  4KLX A;  3NXO A;  4PDJ A;  2W9H A;  3FQC A;  2W3A A;  3TD8 A;  2FZI A;  3QL3 A;  4X5F A;  4G95 A;  4ELB A;  4QJZ D;  4H95 A;  4NX6 A;  3FRB X;  4PTH A;  3S7A A;  4EJ1 A;  4GH8 A;  2HQP A;  1DDS A;  4FHB A;  3QLR A;  4PST A;  4ELG A;  2OBC A;  3DAU A;  1U70 A;  4ELF A;  1DG7 A;  3KFY A;  3DG8 A;  4M6K A;  2ITH A;  3KGY A;  3N0H A;  3NXR A;  5HVE A;  1JOL A;  3I3R A;  1CD2 A;  4EIL A;  3NXV A;  8DFR A;  1DR6 A;  3FRA X;  1RA9 A;  4H98 A;  3R33 A;  3GI2 A;  1DF7 A;  4X5H A;  3F0X X;  3F8Z A;  3FRF X;  2W9S A;  4KEB A;  4KYA A;  3NU0 A;  1DHI A;  5HF2 X;  3QLS A;  4M2X A;  4EIG A;  2P4G A;  3CL9 A;  3F0Q X;  2W9T A;  3NTZ A;  3QLY A;  4XT5 A;  2GD9 A;  4ELH A;  3DL5 A;  2XW7 A;  3LG4 A;  4XT6 A;  1RX6 A;  3S3V A;  1DG8 A;  3SAI A;  1BZF A;  4EIZ A;  4HOF A;  1AOE A;  1M78 A;  3IA4 A;  4ECK A;  3FQ0 A;  3EEL A;  4XEC X;  1PDB A;  3OAF A;  2C2S A;  4FGH A;  4OSG A;  4PTJ A;  4XT4 A;  3FRD X;  3S9U A;  4LAE X;  2FZH A;  1LUD A;  1ZDR A;  3JW3 A;  1KMV A;  4M7U A;  3TQ8 A;  3QL0 A;  4M6L A;  2W9G A;  1DRF A;  3JWF A;  3QGT A;  2DRC A;  4IXF X;  3GHW A;  4QLF A;  1DR2 A;  4KM2 A;  1RX5 A;  4QI9 A;  3IRN A;  5DXV A;  3JSU A;  3RG9 A;  2LF1 A;  1DR4 A;  3SA2 A;  4KBN A;  3FQV A;  3SH2 A;  3ZPC A;  3GHC A;  2G6V A;  1RD7 A;  5DFR A;  5HI6 A;  2C2T A;  1IA1 A;  1KLK A;  2W3V A;  3UM8 A;  4KJJ A;  3DAT A;  1MVT A;  3IA5 A;  4DDR A;  4ELE A;  2B3Z A;  2CIG A;  1JUV A;  5CCC A;  5EAJ A;  1RX4 A;  3K47 A;  1IA4 A;  4HA7 A;  4QLG A;  4M7V A;  5HQZ A;  3VCO A;  4P66 A;  2ANQ A;  3FQO A;  1RX2 A;  2INQ A;  2QK8 A;  3ZPG A;  4KFJ A;  1DHJ A;  3DL6 A;  1DDR A;  3NXX A;  1DYI A;  2FZJ A;  4DPH A;  3EEK A;  1DR3 A;  3FQZ A;  5HSR A;  4PSS A;  5ECC A;  1RX9 A;  1DIU A;  1PD8 A;  3EIG A;  3F0B X;  4OR7 A;  5HSU A;  3NRR A;  3F0S X;  4HOE A;  3F0U X;  4P3R A;  2BLA A;  2BL9 A;  3E0B A;  3JWM A;  1S3U A;  3SRU X;  3K2H A;  1SEJ A;  4Q6A A;  3CD2 A;  2D5N A;  4I1N A;  4HOG A;  4IXG X;  3KJR A;  4Q67 A;  3NZA X;  1AI9 A;  3D84 X;  1AO8 A;  3FYV X;  2DHF A;  5HF0 X;  2KGK A;  3SRS X;  2HM9 A;  3SRQ X;  4X5I A;  3INV A;  4QJC A;  3TQ9 A;  1KMS A;  1RE7 A;  2OIP A;  1DRE A;  3UM6 A;  4TU5 X;  1CZ3 A;  1VDR A;  1BOZ A;  1JOM A;  3EEJ A;  3NXT A;  1DYJ A;  3KJS A;  3SGY A; 
#chains in the Genus database with same CATH topology
 4KM0 A;  1DRA A;  3M08 A;  1RX1 A;  2ANO A;  1DR1 A;  1RC4 A;  3NZC X;  3FS6 A;  1S3W A;  1OHK A;  3TQB A;  3QG2 A;  1RA8 A;  4KL9 A;  3ROA A;  2D0K A;  4I13 A;  3I8A X;  4P3Q A;  4P68 A;  4H97 A;  5HVB A;  2HXV A;  4KJK A;  6DFR A;  1HFQ A;  3D80 A;  1J3I A;  3EEM A;  4RGC A;  3M09 A;  4M6J A;  2JYB A;  4KY4 A;  5JG0 X;  3CSE A;  1HFR A;  2W3M A;  1DRH A;  4KD7 A;  4PSY A;  2CD2 A;  4CD2 A;  1LY4 A;  3F91 A;  1DR7 A;  3JTW A;  3NZB X;  1DR5 A;  3QLX A;  3IRO A;  3K45 A;  4LEK X;  1DAJ A;  2H2Q A;  4KJL A;  1RF7 A;  2L28 A;  3IX9 A;  4H96 A;  3FL8 A;  3FRE X;  4IXE D;  3SRW X;  1DLS A;  1RX3 A;  3HJ3 A;  1HFP A;  1DLR A;  1LY3 A;  4LAH X;  1S3Y A;  1RX7 A;  1J3J A;  4Q0D A;  5HQY A;  3JWK A;  1U71 A;  1IA2 A;  3SA1 A;  3FQF A;  1DIS A;  4DP3 A;  1DRB A;  2BLC A;  3SR5 X;  5CC9 A;  3OCH A;  3UM5 A;  1RA3 A;  3DRC A;  1RG7 A;  3QLW A;  3TQA A;  3NZ6 X;  3SRR X;  1RH3 A;  1DG5 A;  3FYW X;  3RO9 A;  4NX7 A;  1YHO A;  1QZF A;  1VJ3 A;  4XT8 A;  2W3W A;  3GYF A;  1TDR A;  5HUI A;  4G3M A;  5ECX A;  3K74 A;  3JW5 A;  3QLZ A;  3FY9 X;  3HBB A;  5HPB A;  3FY8 X;  1MVS A;  3QYO A;  3CLB A;  3JVX A;  1J3K A;  1OHJ A;  3EX8 A;  3KY8 A;  3GHV A;  4XE6 X;  3NXY A;  1DHF A;  1S3V A;  4KNE A;  3L3R A;  4DPD A;  4DFR A;  1PD9 A;  1RB2 A;  7DFR A;  1E26 A;  3DGA A;  3IRM A;  2ZZA A;  4G8Z X;  2BLB A;  3FL9 A;  5HT4 A;  1RA2 A;  3NZD A;  1DYH A;  1IA3 A;  3QYL A;  2W3B A;  4LAG X;  1M79 A;  2O7P A;  1RX8 A;  3F8Y A;  5FDA A;  4X5J A;  3NZ9 X;  5JA3 A;  5U26 A;  5U27 A;  4KY8 A;  1M7A A;  2AZN A;  3SQY X;  1DYR A;  3Q1H A;  3JWC A;  4KAK A;  3DFR A;  1D1G A;  4QLE A;  4FGG A;  3QFX A;  4Q0E A;  5HT5 A;  4XT7 A;  1RA1 A;  1RB3 A;  4X5G A;  1U72 A;  4XRB A;  3F0V X;  4QHV A;  4HA9 A;  5E8Q A;  4KLX A;  3NXO A;  4PDJ A;  2W9H A;  3FQC A;  2W3A A;  3TD8 A;  2FZI A;  3QL3 A;  4X5F A;  4G95 A;  4ELB A;  4QJZ D;  4H95 A;  4NX6 A;  3FRB X;  4PTH A;  3S7A A;  4EJ1 A;  4GH8 A;  2HQP A;  1DDS A;  4FHB A;  3QLR A;  4PST A;  4ELG A;  2OBC A;  3DAU A;  1U70 A;  4ELF A;  1DG7 A;  3KFY A;  3DG8 A;  4M6K A;  2ITH A;  3KGY A;  3N0H A;  3NXR A;  5HVE A;  1JOL A;  3I3R A;  1CD2 A;  4EIL A;  3NXV A;  8DFR A;  1DR6 A;  3FRA X;  1RA9 A;  4H98 A;  3R33 A;  3GI2 A;  1DF7 A;  4X5H A;  3F0X X;  3F8Z A;  3FRF X;  2W9S A;  4KEB A;  4KYA A;  3NU0 A;  1DHI A;  5HF2 X;  3QLS A;  4M2X A;  4EIG A;  2P4G A;  3CL9 A;  3F0Q X;  2W9T A;  3NTZ A;  3QLY A;  4XT5 A;  2GD9 A;  4ELH A;  3DL5 A;  2XW7 A;  3LG4 A;  4XT6 A;  1RX6 A;  3S3V A;  1DG8 A;  3SAI A;  1BZF A;  4EIZ A;  4HOF A;  1AOE A;  1M78 A;  3IA4 A;  4ECK A;  3FQ0 A;  3EEL A;  4XEC X;  1PDB A;  3OAF A;  2C2S A;  4FGH A;  4OSG A;  4PTJ A;  4XT4 A;  3FRD X;  3S9U A;  4LAE X;  2FZH A;  1LUD A;  1ZDR A;  3JW3 A;  1KMV A;  4M7U A;  3TQ8 A;  3QL0 A;  4M6L A;  2W9G A;  1DRF A;  3JWF A;  3QGT A;  2DRC A;  4IXF X;  3GHW A;  4QLF A;  1DR2 A;  4KM2 A;  1RX5 A;  4QI9 A;  3IRN A;  5DXV A;  3JSU A;  3RG9 A;  2LF1 A;  1DR4 A;  3SA2 A;  4KBN A;  3FQV A;  3SH2 A;  3ZPC A;  3GHC A;  2G6V A;  1RD7 A;  5DFR A;  5HI6 A;  2C2T A;  1IA1 A;  1KLK A;  2W3V A;  3UM8 A;  4KJJ A;  3DAT A;  1MVT A;  3IA5 A;  4DDR A;  4ELE A;  2B3Z A;  2CIG A;  1JUV A;  5CCC A;  5EAJ A;  1RX4 A;  3K47 A;  1IA4 A;  4HA7 A;  4QLG A;  4M7V A;  5HQZ A;  3VCO A;  4P66 A;  2ANQ A;  3FQO A;  1RX2 A;  2INQ A;  2QK8 A;  3ZPG A;  4KFJ A;  1DHJ A;  3DL6 A;  1DDR A;  3NXX A;  1DYI A;  2FZJ A;  4DPH A;  3EEK A;  1DR3 A;  3FQZ A;  5HSR A;  4PSS A;  5ECC A;  1RX9 A;  1DIU A;  1PD8 A;  3EIG A;  3F0B X;  4OR7 A;  5HSU A;  3NRR A;  3F0S X;  4HOE A;  3F0U X;  4P3R A;  2BLA A;  2BL9 A;  3E0B A;  3JWM A;  1S3U A;  3SRU X;  3K2H A;  1SEJ A;  4Q6A A;  3CD2 A;  2D5N A;  4I1N A;  4HOG A;  4IXG X;  3KJR A;  4Q67 A;  3NZA X;  1AI9 A;  3D84 X;  1AO8 A;  3FYV X;  2DHF A;  5HF0 X;  2KGK A;  3SRS X;  2HM9 A;  3SRQ X;  4X5I A;  3INV A;  4QJC A;  3TQ9 A;  1KMS A;  1RE7 A;  2OIP A;  1DRE A;  3UM6 A;  4TU5 X;  1CZ3 A;  1VDR A;  1BOZ A;  1JOM A;  3EEJ A;  3NXT A;  1DYJ A;  3KJS A;  3SGY A; 
#chains in the Genus database with same CATH homology
 4KM0 A;  1DRA A;  3M08 A;  1RX1 A;  2ANO A;  1DR1 A;  1RC4 A;  3NZC X;  3FS6 A;  1S3W A;  1OHK A;  3TQB A;  3QG2 A;  1RA8 A;  4KL9 A;  3ROA A;  2D0K A;  4I13 A;  3I8A X;  4P3Q A;  4P68 A;  4H97 A;  5HVB A;  2HXV A;  4KJK A;  6DFR A;  1HFQ A;  3D80 A;  1J3I A;  3EEM A;  4RGC A;  3M09 A;  4M6J A;  2JYB A;  4KY4 A;  5JG0 X;  3CSE A;  1HFR A;  2W3M A;  1DRH A;  4KD7 A;  4PSY A;  2CD2 A;  4CD2 A;  1LY4 A;  3F91 A;  1DR7 A;  3JTW A;  3NZB X;  1DR5 A;  3QLX A;  3IRO A;  3K45 A;  4LEK X;  1DAJ A;  2H2Q A;  4KJL A;  1RF7 A;  2L28 A;  3IX9 A;  4H96 A;  3FL8 A;  3FRE X;  4IXE D;  3SRW X;  1DLS A;  1RX3 A;  3HJ3 A;  1HFP A;  1DLR A;  1LY3 A;  4LAH X;  1S3Y A;  1RX7 A;  1J3J A;  4Q0D A;  5HQY A;  3JWK A;  1U71 A;  1IA2 A;  3SA1 A;  3FQF A;  1DIS A;  4DP3 A;  1DRB A;  2BLC A;  3SR5 X;  5CC9 A;  3OCH A;  3UM5 A;  1RA3 A;  3DRC A;  1RG7 A;  3QLW A;  3TQA A;  3NZ6 X;  3SRR X;  1RH3 A;  1DG5 A;  3FYW X;  3RO9 A;  4NX7 A;  1YHO A;  1QZF A;  1VJ3 A;  4XT8 A;  2W3W A;  3GYF A;  1TDR A;  5HUI A;  4G3M A;  5ECX A;  3K74 A;  3JW5 A;  3QLZ A;  3FY9 X;  3HBB A;  5HPB A;  3FY8 X;  1MVS A;  3QYO A;  3CLB A;  3JVX A;  1J3K A;  1OHJ A;  3EX8 A;  3KY8 A;  3GHV A;  4XE6 X;  3NXY A;  1DHF A;  1S3V A;  4KNE A;  3L3R A;  4DPD A;  4DFR A;  1PD9 A;  1RB2 A;  7DFR A;  1E26 A;  3DGA A;  3IRM A;  2ZZA A;  4G8Z X;  2BLB A;  3FL9 A;  5HT4 A;  1RA2 A;  3NZD A;  1DYH A;  1IA3 A;  3QYL A;  2W3B A;  4LAG X;  1M79 A;  2O7P A;  1RX8 A;  3F8Y A;  5FDA A;  4X5J A;  3NZ9 X;  5JA3 A;  5U26 A;  5U27 A;  4KY8 A;  1M7A A;  2AZN A;  3SQY X;  1DYR A;  3Q1H A;  3JWC A;  4KAK A;  3DFR A;  1D1G A;  4QLE A;  4FGG A;  3QFX A;  4Q0E A;  5HT5 A;  4XT7 A;  1RA1 A;  1RB3 A;  4X5G A;  1U72 A;  4XRB A;  3F0V X;  4QHV A;  4HA9 A;  5E8Q A;  4KLX A;  3NXO A;  4PDJ A;  2W9H A;  3FQC A;  2W3A A;  3TD8 A;  2FZI A;  3QL3 A;  4X5F A;  4G95 A;  4ELB A;  4QJZ D;  4H95 A;  4NX6 A;  3FRB X;  4PTH A;  3S7A A;  4EJ1 A;  4GH8 A;  2HQP A;  1DDS A;  4FHB A;  3QLR A;  4PST A;  4ELG A;  2OBC A;  3DAU A;  1U70 A;  4ELF A;  1DG7 A;  3KFY A;  3DG8 A;  4M6K A;  2ITH A;  3KGY A;  3N0H A;  3NXR A;  5HVE A;  1JOL A;  3I3R A;  1CD2 A;  4EIL A;  3NXV A;  8DFR A;  1DR6 A;  3FRA X;  1RA9 A;  4H98 A;  3R33 A;  3GI2 A;  1DF7 A;  4X5H A;  3F0X X;  3F8Z A;  3FRF X;  2W9S A;  4KEB A;  4KYA A;  3NU0 A;  1DHI A;  5HF2 X;  3QLS A;  4M2X A;  4EIG A;  2P4G A;  3CL9 A;  3F0Q X;  2W9T A;  3NTZ A;  3QLY A;  4XT5 A;  2GD9 A;  4ELH A;  3DL5 A;  2XW7 A;  3LG4 A;  4XT6 A;  1RX6 A;  3S3V A;  1DG8 A;  3SAI A;  1BZF A;  4EIZ A;  4HOF A;  1AOE A;  1M78 A;  3IA4 A;  4ECK A;  3FQ0 A;  3EEL A;  4XEC X;  1PDB A;  3OAF A;  2C2S A;  4FGH A;  4OSG A;  4PTJ A;  4XT4 A;  3FRD X;  3S9U A;  4LAE X;  2FZH A;  1LUD A;  1ZDR A;  3JW3 A;  1KMV A;  4M7U A;  3TQ8 A;  3QL0 A;  4M6L A;  2W9G A;  1DRF A;  3JWF A;  3QGT A;  2DRC A;  4IXF X;  3GHW A;  4QLF A;  1DR2 A;  4KM2 A;  1RX5 A;  4QI9 A;  3IRN A;  5DXV A;  3JSU A;  3RG9 A;  2LF1 A;  1DR4 A;  3SA2 A;  4KBN A;  3FQV A;  3SH2 A;  3ZPC A;  3GHC A;  2G6V A;  1RD7 A;  5DFR A;  5HI6 A;  2C2T A;  1IA1 A;  1KLK A;  2W3V A;  3UM8 A;  4KJJ A;  3DAT A;  1MVT A;  3IA5 A;  4DDR A;  4ELE A;  2B3Z A;  2CIG A;  1JUV A;  5CCC A;  5EAJ A;  1RX4 A;  3K47 A;  1IA4 A;  4HA7 A;  4QLG A;  4M7V A;  5HQZ A;  3VCO A;  4P66 A;  2ANQ A;  3FQO A;  1RX2 A;  2INQ A;  2QK8 A;  3ZPG A;  4KFJ A;  1DHJ A;  3DL6 A;  1DDR A;  3NXX A;  1DYI A;  2FZJ A;  4DPH A;  3EEK A;  1DR3 A;  3FQZ A;  5HSR A;  4PSS A;  5ECC A;  1RX9 A;  1DIU A;  1PD8 A;  3EIG A;  3F0B X;  4OR7 A;  5HSU A;  3NRR A;  3F0S X;  4HOE A;  3F0U X;  4P3R A;  2BLA A;  2BL9 A;  3E0B A;  3JWM A;  1S3U A;  3SRU X;  3K2H A;  1SEJ A;  4Q6A A;  3CD2 A;  2D5N A;  4I1N A;  4HOG A;  4IXG X;  3KJR A;  4Q67 A;  3NZA X;  1AI9 A;  3D84 X;  1AO8 A;  3FYV X;  2DHF A;  5HF0 X;  2KGK A;  3SRS X;  2HM9 A;  3SRQ X;  4X5I A;  3INV A;  4QJC A;  3TQ9 A;  1KMS A;  1RE7 A;  2OIP A;  1DRE A;  3UM6 A;  4TU5 X;  1CZ3 A;  1VDR A;  1BOZ A;  1JOM A;  3EEJ A;  3NXT A;  1DYJ A;  3KJS A;  3SGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...