3F12B

Germline v-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
223
structure length
199
Chain Sequence
b'VQLVESGGGVVQPGRSLRLSCAASGFTFSSYGMHWVRQAPGKGLEWVAVISYDGSNKYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAKDGSGLLDYWGQGTLVTVSFKGPSVFPLATAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSQTYICNVNHKPSNTKVDKKVE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M2J1 Fab
molecule tags Immune system
source organism Homo sapiens
publication title Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus.
pubmed doi rcsb
total genus 32
structure length 199
sequence length 223
chains with identical sequence D
ec nomenclature
pdb deposition date 2008-10-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f12B02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3f12B01
1FBIL 2YR3A 4GKNB 3KPTA 4FQIL 4M6ML 1CD9B 2P8MB 2EDRA 4JPVH 2B4CH 3DX6A 3KXFA 3CH1A 1NAMB 3IDUA 4ZTPH 2P43B 4Z7VB 1MREL 1VFUA 2DYPA 4X6BA 4Q6IC 3QUML 4H20H 3HMXH 5I1DB 3MV8D 3QQ4B 3FN9A 1DBKH 5GGSY 2ZG3A 3MMEB 1NUFA 1CFSA 1J12A 4TVPH 5E8NB 4BFBD 1C12B 2CR6A 1AO7A 5LQBL 4U0QB 3S88H 4M5ZL 1YQVL 3STBA 4XWGL 3QXDA 4LBEB 3L9RB 1EGJA 5IW1A 3FO1A 1VFAB 1IGIL 4HKXB 5KVFL 3L1OH 2VQ1B 2A9ML 1X5FA 3G5ZB 4NN5B 5D2NE 1T1WB 4QOKE 1RZJL 2LFGA 4M3JA 4QXGH 2R1WA 4O2FB 3A6OA 3QCTL 3OJVC 5L9DL 4XP4H 4GKZB 1IBGL 1UGNA 2NY2D 3VDAA 1C5CH 3DSFH 1FVCA 4YK4C 4PLJD 1GYAA 3FB5A 5DEGA 4WGWB 1FSKC 2A73A 3TO2A 2NCMA 3PWNA 4P3WA 4H88H 4YXLL 4OFKA 1YJDL 3NH7H 5FGBA 5C9JA 2CD0A 4EUPG 1C8PA 1N0LA 1S5HA 1IGYB 4JREB 4D9QE 6FABL 1MI5D 5C0GB 4Z7UF 4WU7B 5ISZA 4Q2ZB 3W0WE 1CFTA 4LLUA 2ZG2A 3P4MA 1FFPB 5CKGA 4UILL 1JK8A 5F6IC 3OHXA 3THMH 3ZYZA 1TLKA 3UTZA 1TMCB 5FKAB 1F3JA 3VFPB 4CW1A 3JWDH 4DVBA 1QFHA 1HSBA 4DAGL 4KAQL 2F53E 35C8H 1RAMA 1E6OL 2P24B 2HJKB 4ALAL 1TZIA 2ICWB 3U7WL 1VFAA 4CRPA 5INDA 1KB9K 3QWRA 4NJ9L 3HUJB 4M4RA 3EYFA 5L8JB 1ZLVK 5GRJL 4JFDD 4M93B 2ADJB 2CKBB 4KWUA 1NGZB 3VXSE 3GNMH 5ESVA 5AEAA 2EZ0D 4XAKD 1XGQA 1RUAH 1RZ8B 4HKJB 2ERJC 3H9SE 2HTLC 5DSCB 2BSTB 5L6YH 3IAGC 4WI3A 1XF5B 2ARJQ 2CDGA 4OZGE 1QLFB 5HHQB 3D69B 1IGTA 5FOJA 1DVFB 4GW4B 3U79A 5IW1B 5JO5B 4PPTA 3VXPB 3WJLC 3JSSA 1ORQA 3TCLA 2F54E 1W8NA 5H37H 3TYFB 4WY7H 5D2LE 3PABA 1CDJA 4PRNB 3LPFA 3P30L 1Q8MA 1VACA 3DVNA 5DD0L 3O6FC 1YEIH 4EOWH 4I4WB 3U9PH 3DGCR 4LBEA 4ODHL 4UIMB 1AXSB 2NY3B 4QHNA 1HHHA 3ARPA 3PGFH 1IEAA 4XP5L 1Z9LA 4KKCD 4P5KB 3K4AA 3AREB 3KR3L 4RFEB 4V1DD 3NZHL 4W4NA 4JFPB 4WUUE 3QIBA 5DQ9B 4JDVB 1P5UA 1KN4H 1VFMA 4HEME 3A67L 4XTRC 4J8RA 3BN9D 4HMEA 5CEZD 2WNGA 3PGCA 5IVZB 3U4BL 1RZGB 2CKNA 1CD1B 4APQC 4PGEB 5DJXB 3KGRA 5LG1A 1NGZA 2BOBA 4OM0H 1A7RH 4P5MB 1EHAA 1ZVHA 1AGEA 3V6FA 5C70A 1MRFH 5I8OH 1A9EA 3VI3F 4KVNH 4YQXL 5BVJB 3CLEH 4JN1L 2APBA 3LSOB 2Q76A 1IGFL 3O11A 1E4XH 4ODHH 1FAKT 1UM6H 5E9DB 5K9KA 4FTVB 4YK4B 2H32B 1MLCA 3MLTA 3U0PA 3VFNA 5EUKB 4CMHC 1XCTA 4M1GL 2FGZA 4JFDA 3RKDC 5E7BA 3D3VB 4GUPA 2EDDA 3QNZB 5HYEA 4HXAH 5ALBH 4LSVL 4GJTB 1KIUA 2X40A 4EIGB 1RUAL 2ARJB 2BCKB 5I1GH 4WIQA 2VN4A 5EO9B 1CE1H 3OZ9H 3MROB 1ZOXA 4KUCF 1UM4H 5EU6B 5JW3L 4NKDA 5C0FB 5JLZA 1YEDA 1ETZA 3BXNA 4JPWL 1XCQA 5KSBB 1U93B 4OZHF 3K0WA 2EYRB 4RFNC 1VCAA 3BZFB 4DAGH 4YZFF 4DGVL 2AJVL 1ITCA 5DI8B 4YDLC 3GSNH 5JOPE 4XVJL 1LE9B 4HWBA 3BKJH 3B2VL 5HSFA 4XMPL 2BP3A 1SM3L 2R15A 5C71A 4QCIA 4O51A 1AJ7L 3BOVA 3FN0H 2GSIB 2ZCHH 4MAYA 4WHDA 2XT1B 4WCYL 5E2WL 1OGAD 1M7DA 4K3JL 3HG1D 3C60D 2B20A 4XPFH 5KOVC 2MKLC 3KLHD 4ENEC 5E4EC 1BVLB 4CADA 1ZLVH 1NGQL 3FFCA 4ONHA 1MH5B 4BSWA 3RJDA 1JWUB 4Y19D 5TE6H 2V6HA 4DOHB 2MTPA 1PX3A 5BV7L 2ARJA 2FL5B 3HMWH 3O4LB 1G7PB 1SEQH 3QEUA 4ZD3L 4TRPL 1AC0A 5EZLA 5KSVA 4O2EB 2J8UF 3VH8B 4DKAA 4ZO6A 2OP4H 4OJFH 5IMOB 1S7SB 4NKDB 2XZCL 5C0NC 1FAIL 4M00A 1QFPA 3BXNB 3R06A 4TUOA 4YXKL 5FF6B 3LHPH 4C56B 5EO9A 3TA3D 2QADD 3RUGE 1OGTA 2RAMA 4PJ7E 1MRCL 4PJ5B 2CRIA 2LVCA 5D1QB 3TO4A 2ZUUA 4WEBH 1F13A 4EUPA 1IAMA 1UWEH 3H8NA 43C9B 3T3PF 2VLKB 4JPVL 2EKSA 5F88B 2Q86B 2Z35A 2Z8VC 4Q6YA 5JW5A 1TIUA 1N6VA 3IDIA 4J1UA 3W2DH 5FECA 2IQAA 4OQTH 4OZHA 2AS5M 3LB6C 3MLZL 3ZDXE 1N5YH 3SPVB 1JI1A 4BZ2L 4J4PA 3MLVL 3MA9L 3MGOB 3BE1L 5F7EH 1XCQB 2XQYK 4YX2L 4UDUB 2IANB 5JHDE 1HCFX 5DS8B 1H3UA 4PJBB 3T0EA 1BJ8A 2AKRB 4I18A 5H35A 4LVOC 4Z7OF 5I71C 1VADA 3QUZD 3JWDL 4FG6D 2QQLH 2NY5H 4I9WE 3SDCD 2Z31C 1F6AA 1XF2B 4OD1L 5ID1B 2YK1L 3FOLA 1QBLL 3CFJB 2EYTB 4Y4FB 5HHXH 1LO0L 1OOAA 3BZDA 4PTUB 4LNVA 3MRBA 3IDJB 1X7QB 4MJ2A 2FHBA 5J12C 1F42A 1KT2A 4Y2DB 3D3VA 2W92A 5AAMA 2PCPB 4OLZL 4ELME 1PLGL 4K3DH 4F9LC 4H88L 4MNHB 3B4NA 3QNXA 1G1CA 2HT4D 4KVNL 4LSSL 4JFZH 4TVPE 4FXKB 3S98A 3MZGB 3FQWB 5C6WH 1U0QA 1TCMA 5J13C 1KCRL 4NKIH 1R24A 3RZCD 1FIGL 3X3GL 5DLMH 4KU1A 2LTQB 1AIFB 2JCCF 4RQQA 4A6YH 5K93A 3BO8A 5IFJB 5GRVL 4IOSD 5HY9A 1G9MH 1JGLL 3K2UL 5H35B 3WNPA 1MQKH 4G3YL 2XQBH 1C5DA 1T66C 5I1LA 1NGPH 3CFIC 3TBYA 1NCAL 1I7UB 2PW2B 5D8JL 1BOGB 1BX2A 3BPNC 1MNUH 1HQ4A 5EOCL 1QFUH 4BKLA 3ZKXC 4QRRA 1U8HB 4LSPH 1D6VL 4OGXH 4P23B 4AEEA 1PEWA 4WV1A 1HNFA 5C08E 1HHJB 4EZMA 1JZ4A 1D3CA 5C07E 5IFAL 43C9A 3O2WH 4LAQH 3JV5A 3UAJD 1VPOL 2EDHA 4ZSOA 4FQXA 4WFHD 3T8XB 4FQCH 4I5BA 4Q9QH 1II4E 3MLUL 4U1MB 1BVLA 3C6SA 4LSTH 3CX5J 3BZEB 2UV3A 5HHVL 4PGBA 4HD9A 5KZCD 2ZUWA 4HFUH 4PJIB 4HWEH 1UA6L 2IAMD 3GK8L 3H7BB 4OIIH 4O5LL 3C6LB 5EOTA 1BIIA 3BPCB 4BFGA 2Q87A 1YY8B 3W0WD 1OF2A 4JKWA 1DVFA 2XKNA 4GW4A 1J10A 4O2EA 3CLFH 3MV9E 1UCBL 1E4KA 1X4YA 4ZFZB 3QO1B 3UTQA 3SKUD 3CMGA 1W72A 4LLVA 1K5NB 3O2DL 3G6JF 2ADJA 1YDPA 2CKBA 4OKVA 4FQXD 2WBJC 5J0BA 4DWHA 5CSZB 3S4SG 1HKLH 2FDBP 1MEXH 4ZMAT 35C8L 4J7RA 3B2UC 5EU7E 2VIRB 1XH3A 3UO1H 2HMID 2J7LA 1MEXL 2C3VB 5ITFA 2FHFA 4U6HA 3IDMA 5EZOH 2DQUH 4MMXC 3GSRA 3O2DH 3BGMA 4I3SL 3BD5A 4NUGH 1D6EB 1PY9A 5HXMA 4PGJA 5EUOA 3VWKA 3O4OC 3VD4A 1RMFH 1GGIH 4PJAE 4NHUA 3L3IB 4ZXBC 1MRDL 1EAJA 3IDXL 2JJSC 4JY6B 4QCIB 4JDTL 4EDWL 3P73A 5IQ9B 3GJFK 4MA3A 2VKXA 4XPGH 3KNBB 2HFFA 3B5HA 4G5ZH 4GG8B 4L4TD 5DGRA 4WJ5B 5DJ6A 5C3LD 4QRPA 5CZVL 5DEZA 3ARFB 1DN2A 3EIFA 4WFEE 4CMHB 3TFKC 1GAFL 5DRNA 4P57B 4KJQD 4WUUB 1CG9A 3PJSB 5FGCE 3WFBL 3QQ3B 1I1YA 2NTFB 3O2WL 5KSBF 1RIHH 1AI1H 3CLFL 5CSBA 3G6AA 2YBRA 2YEZA 2PYFB 3AB0B 4HPOH 5D72H 3CZFA 4JG1H 5I18L 2DWDB 1I3UA 3ZL4L 1EZVX 5GXBB 5T5NF 3Q0HA 3V6FB 5TDNA 3ROLB 1E4JA 3QUMA 3BRFA 3QCVH 4ERSH 3INUH 4GUPB 1LO5B 4QT5A 3MQIA 1XT5A 4YHKH 5F8QC 4YBLB 1WSST 1MJ7L 4P2RD 3CVHL 1MCLA 4L8CA 3RUGA 3QIWB 5HGDA 4D0CB 2C1OA 4N0FA 1KJ3L 4GAJH 3P4LA 4UI2A 4JY6A 3WXWH 2BFVL 4LSSH 4DQOH 3EO0A 5CP7B 5EOCH 1AIFA 2PYED 3LZFH 3NPZB 2VITA 2Q7YA 5F89A 4ZFOL 2MCG1 2AXGA 3G5XB 4ZNCD 1O5DT 5F1KC 3LH2L 4NRXB 1JUFB 3M8OH 3O6FB 3FFCD 4LCCA 4TUJA 3REWA 5IQ7L 3MFFA 1RQ5A 4XXDA 5T1KD 1JYXA 4JZNB 1RZKH 1M1SA 1ETZB 3SGKC 4YHML 4F33B 3SGKA 4BSVA 1MVUB 4U0RC 1U8KB 3T0BA 3OXRB 5T3XE 3QP3A 4Y8DC 4XVTH 4KK9C 4POYA 3ARFA 3VGDA 3DURB 2YPVL 3F7RA 5M94B 4MCYA 5AYUL 5F9WB 3SDDC 4R8WL 4YC2C 3SO3C 3STZA 1PKQA 4RX4A 4XXCC 3RTQD 3ULUD 1V8HA 1HSBB 4GQ9L 1N6QH 4HXBL 5LBSH 2L0DA 4BH8A 5TDOA 2AJ3A 5IVXE 2R0WL 2YA0A 4JQVC 3GM0A 3P77A 5A2JH 4OF6A 3GSOA 1QLRB 3GSQB 4ESKA 1T3FA 1WJ3A 4S0TD 5HDBE 1D5MB 2NR6D 2NW2B 3OF6A 3H2WA 1MIML 3RDTD 4HUVA 3T2NH 1WIUA 5CGMA 1RJZA 2AABL 1T22A 3DTXA 4QNPF 2BXYA 1QR1B 3GEWB 1LMKA 4X9HA 1KJMA 4MNGA 5F1OB 1Q38A 5E00B 5GGQL 3W5NA 3F7YB 15C8L 1CFNB 1U8NA 5FYKD 4OT1H 2DQIH 2VLRA 2DN7A 2DQGH 1HNGA 3B9KD 4U1HA 2BSRB 5I1KL 1A6UL 3V5DA 1MFDH 4A6YA 3L3KA 4EKXA 5CCKL 4KZDL 3MV9B 4OZHB 5IESL 4PJFF 3VWJC 1N64L 5DJAA 4ZD3H 3ZKSD 5D7JB 2G60H 2PKDA 4PJ8D 1XGRB 3LQAL 4B7LA 3L3DB 1PW3A 3M45A 1LP9E 3DETD 2K3TA 2VXUH 4JFPA 3CMOL 1IAKB 1BZQK 3AREA 4PJIE 4LPXA 1BQHB 4Y16D 2R29L 5J8OA 5T1KA 1I4FB 4DW2H 1A64A 1T6WA 1RFDH 2YA1A 1G7QA 2W60B 3MRNB 5E70A 1J0YA 4X83A 4LCWE 3CVHB 2DF3A 5CJ8A 3JV0A 1E0OB 5MENA 4MVBD 1G7LB 3U4EA 1KJ2L 3RVVC 1H0DA 4WI9A 4Y4FA 3WHE1 3GIVA 1I8KB 4C54A 4JY5H 1YN7A 3TBSA 4KZDH 5E00A 5CEYB 2IWGA 2J88L 3C9NB 4PV9A 3P4MB 3RGVC 1NCCH 2ZNWA 5D1ZC 2EDEA 2ADIB 1A7OH 3RX7A 5GS2D 3TBVB 4LAJH 2DYPD 4C83A 3QG7L 3RVUC 4XX1G 1TQCB 3AAZB 4LLYA 4LGSB 2F53B 1OARH 3A0OA 1T22B 2XG4A 3OZ9L 3GMRB 3VXQB 4HQQL 4KPHH 3B2VH 3ZKMD 5IG7B 5ALCH 4DK6A 3D18B 3GSXA 5BVPL 3RWDA 1CVRA 1FNGB 1ZSDA 4ELKB 4E9LA 3DXAD 1FVEB 1OAKH 2MQ0A 1J1OL 4KJYB 2K7PA 5DURB 3KYNA 4Q7DA 3QUXC 1EUTA 3Q1SL 2NX5D 1MWAA 4LPTA 3I75A 3NFPB 4Z5RB 1JRHH 4XAWH 1UYWL 2ZOLA 3P9MA 5FB8A 5DZOA 3KPSD 4Y2DC 2IH3A 2XXCB 3LKOB 1EVUA 3TN0C 4F33A 4CJ0A 1BOYA 1I7ZB 2HJFB 3VXNA 4MX7B 4LQ1A 4JE4B 5F3BB 5KJRH 1W0WA 5JOFB 5SX4H 4JO3L 3TYGL 1H5BB 4YHMH 4YUEH 5C09D 1UM5H 2GJ6E 3TT3L 4KDVA 4PBVC 1JGVH 1MQ8A 4N1CA 3EOTL 4LQFH 3ZMRA 3DXAA 2VE6B 3S96A 3PXJA 4R9HA 5HVFB 3M8OL 5E08L 3ZZ1A 3LH2H 3M1BA 3D85A 3PHQB 5F7NC 2ICEA 3L9RA 3MRDA 1QLEL 1JPSL 2Z8WC 1DCLA 4XVUD 4GKSB 2VOTA 3R1GL 2BVOA 5ACZB 4QHUA 2R2BA 3HUJF 4YHZL 4I3GA 2VDRH 4ZAKA 5T1DH 4HS8L 4DFIA 3HRZA 5EC1A 1UEMA 3F6LA 5B38A 1BBJA 5KS9F 3STLB 4DW2L 1D5ZB 2XACC 1XZ0B 2VIRA 5B3NA 2LVEA 5ERWB 5GISL 5D2NC 2ZOKB 1BVKB 4KI1A 4C56E 3RJQB 4LIQL 5BXFA 2OTUA 5JORA 4PLJC 4PLKD 3DVFA 3U0WL 4HGMA 3WFEH 3OV6A 1X5LA 5FB8B 4JFYB 1RU9H 1DQDL 1Y6KR 2HT2C 2WIMA 3QIUB 2V9RA 3RU8H 4UBDD 4RMWA 5KSAD 1YYML 1HXYA 1QRNE 2X10A 4MB5A 1RUKL 1B4JH 5C0BA 2EDWA 4RGMB 1BVZA 4I2XB 5K9QG 3V2AR 4YDIL 1A6AA 2WUCL 3MLRH 3DRTA 5DJ6B 5GGRY 3I02B 4PGCA 2N7BA 1XGYH 3VGAB 1UB5A 2ZZUT 4Y5YC 3O8XD 4PYGA 5KN5B 3MRRB 1UYWH 4AENB 3LIZL 4FN0A 4K8RD 4P9MH 3T2NL 2OR7A 2AQ2A 2MPAH 2QR0A 2ADGB 3I75B 4TNVK 5MP6L 3KYAA 2QSCH 4XPGL 4Z95H 4P99A 5DF0A 3EDKA 3PQYB 3U1SL 4NPYB 4R4BA 2NQCA 1GOHA 4NBZB 4APQD 1J8HD 1UENA 2W9DL 2E6QA 4NQEA 1R5VA 3FQWA 3WL9B 1DVFC 2KZ1B 4JM2A 4DUXA 3SOBH 4EN3A 2B1AL 2XWJB 5H8DA 5C07D 5BZDA 3ARBD 3KHQA 1F3JB 3PDOB 5KSUA 3T3MF 1Q9OA 4Q9CA 3FQXB 3QXAA 5B3JF 1RJLA 3BUYA 4WFFD 3L7FA 3HUJA 5DDHA 4M1DL 1OD9A 4OCXL 2AXFB 4QOKD 4IRJA 4OTXL 3WFCH 1WT5C 3P0YH 4MA1B 4KRPC 1REIA 5DHXB 3FTGB 3I6KA 1ZLWH 1U8NB 4XZUB 1JV5A 3PWVB 5FDYA 1HDMA 3KVQA 4PGDA 4ODVH 4XCFL 5JDSB 3SDAD 4FOMA 4I0PA 4KMTL 1A4KA 2RFXA 1OPGH 1OD7A 3MODL 2AK4B 4KKCC 3P0VL 2HN7A 1INQA 2QKIB 5KS9B 4OI9A 3K81A 3DHMA 1XF5A 1N2RA 2CDGB 2YWYA 4ZUUA 5I16A 4JANB 3G08A 4NSKB 2Z92B 3LS5L 1AGCB 5EIQA 1JWMA 5ICZB 1OW0C 3C5JB 4FQQB 3IDGB 3WL9A 1KLGB 3OKEB 1U42A 1Y0LA 4OIAA 5DFVD 1LD9A 1LO2L 4OGYH 1LP9F 1S7UB 2UVEA 2WWKT 1MREH 4OZIB 2BY1A 5ANME 1V7MH 3Q3GB 1ED3A 3JWOC 4U1JB 4GW5A 5FO7A 2HLAB 5DVOA 4PJ5E 3SDAA 3UP1A 5I19L 2H2SC 1NFDF 4PJ7B 2GFBB 5IVZA 3MGTB 1UQSA 3GIZH 4L4JA 1WFOA 3OR7B 1EERB 4QYOA 4HLZG 1QTYT 4LF3A 1IAIH 4DZ8B 1MVUA 3QEQD 4U1SA 2R2EB 4X6BB 4BH8B 3D25B 4HX1A 3FB8B 3KPOA 3QEQE 4JG1L 3BP4A 5TH2A 3O6KH 1NPUA 2FO4A 5MEOA 4P4KB 5T5FH 5D70H 3NIGF 1CS6A 4LMQE 4YEEA 2CUHA 3JV6B 4U6YB 1RY7B 3KYMB 3K2MC 4KI5F 4QEGA 1LO4H 3DV6B 1EXUB 1JF1B 3D1MC 4DN4H 2R4RH 4M1CC 4ORZC 5IHUL 5GGUB 3HAEB 4DOHE 2IPUK 2XY1A 2NPLX 3EDDA 1FNEB 4IRZH 1NGWB 4RDQF 5FKPA 3GMOB 5D7JC 3L6FA 2E9IA 2C7UB 4Y4FC 1CZ8L 5JDSA 5C0ND 4G7YH 1DUYB 4JRYE 2YKLL 3LKNA 4G6JL 4EUPH 5BJTB 2X1OA 2R0LH 1Q0YL 3RUGF 1A1NB 2VUYA 2GK2A 3ULSA 4IRJB 5SWZE 5KSAA 2YRZA 3MJ9A 1J05B 5L2KB 3IVKB 2ZPKH 3GRWH 1YEHH 2A73B 4YXHL 1B6DA 4F57H 2BHUA 5LAXA 2YMXL 3RL1B 2RCSL 3HZVA 1MY5A 4IDJH 2VTFA 1G7IA 2CGRH 4M7LL 4F58L 4APQA 4FQ2H 1HKLL 3RWJA 1YEKH 2XA3A 1BJ1J 1WBYB 1GIGL 1F4HA 1DJSA 3ROOA 1BFVH 4BQ6A 1ORSB 2EDTA 2KDGA 2CUIA 3TIDA 3FRUB 4MA3B 5A40E 2B1AH 2R1XA 2A6IA 5IK3B 3QUYA 4R4BB 1KULA 1CFVH 2I9LB 4OLYL 1UEYA 4ZFOB 4YGVA 3D85B 3PHQA 1RI8A 1LO3L 3VXRB 3NCMA 2BCKA 4PB9H 5T1LA 4KTDH 5ISZB 4FMKA 1GGYA 4OIIL 1OAZH 2VDKH 1DSFH 2YBRB 3KJ6H 1A6ZB 1LNUA 1I8LC 4M03A 4MYWB 4U05A 3TCXA 5EZIL 2W9LA 4H1LA 4YHKL 4IRSD 1JI2A 4NFDA 1HYRC 5HHPB 4DGIL 2HMIC 3SGDH 3PHOA 4X6CE 2VXTL 5I1HL 3BPOB 4NRZB 4X8JA 3D18A 2OI9B 4M48L 4KJPC 2HFFB 5LXGL 4P2CG 2ZCKL 3KPSA 1QRNB 2Z91B 1T0NB 3GSNA 2XWTB 4MXWL 5C0AD 5I73B 2DMKA 1S7SA 2BSED 2FD6L 3GMMA 4Z7UE 3L3HA 4QHLA 2F5AL 4XPHL 5ILTL 4KQ4H 3MCLH 2LAAA 1YYMH 3OJMB 1IMHC 3GB7A 1G9ML 5JOPD 3ALWA 4UT9H 3RHWK 4OKDA 3WFEL 4NWTH 1ORSA 4KZEH 2FB4H 3MRMA 2OI9C 3RP1A 3T3ME 3N06B 3VXQA 4BYHA 1IEHA 5EIIB 2VKWA 4MQTB 1W0WB 5JOFA 3UTPD 5JPMA 5A16B 2JIXB 5C0DA 4WDIB 1ZSDB 4LEXL 5AUMA 5F3BA 3IDYC 4CN4A 3GI8H 3VXRA 3NFNB 4JFDE 1Z9SA 2XICA 5I1JH 4DKEL 4LVEA 4NZUH 3KS0J 4OLZH 4PJGB 5D7KE 5CJOL 5IK3A 1U2HA 5M95B 5L7XH 5C0BD 1ZANH 5F9JB 2EICA 2FIRT 3QFDB 3S36X 3E6HB 1IL1A 3QWOB 3V6ZB 3VXUE 4PJ9D 2H3NA 2VISB 1CU4H 3IXAB 1U92A 2JF1A 2DQFA 1R3JA 2Z8SA 5IMMB 1AKJB 3P0GB 3D0VA 3FRUA 2I5YL 2RBLA 4EI5A 5HYSB 1AHWB 3TZVB 3TM6A 4HWBL 2F15A 2XY2A 2NYYC 5IWLC 1YECL 2X41A 4NUJA 5C0AE 4GAGL 1YY9C 2ATPB 2F58L 4GG8A 4LARL 3TN0B 2R0LL 4NQDE 3LN9A 3SE3C 2BVPA 1OAXH 3RFZC 2LTQC 4Z78A 2F8OA 3MZTA 5F1IA 5EN2A 1WIPA 3P3YA 5IGXH 4G6ML 1WITA 1I7RB 1QSFB 4LVHC 3UPCA 2PO6B 5BJTA 1B0RB 5CEZE 4HUVB 1NMAH 1G0YR 3T0VA 1BOGA 4KJWC 4LK4A 4Y8AA 5F72S 4FZEH 5JXEC 5D7SH 5IB2A 3MUY1 2EDXA 2DIAA 3QHFL 4ONFL 2W0FB 4PJDB 1FLTX 2FGWH 3MJ8B 4WNQA 1AGFB 4OCMC 5MEQA 1CFNA 4ZSOB 3IETA 3MCLL 1Q72H 4ZDHA 5BQ7B 5D70L 3VGAC 3BGAA 1OARL 4P2OB 1G7IB 4NBYB 2XPGA 1I1FB 1EO7A 1K4DA 1QNZH 3UTTE 4FFWC 1GH7A 3FOLB 1T1YB 4NO2A 5CEYA 2ZUQC 5LXGH 2FBOJ 2J6EH 4Z8FL 2PW2A 2ID5A 4G7VH 1QFWL 4NIKB 2LAGB 4JCLA 4QOKA 4S2SA 5BCAA 3L95B 4BQ9A 3MGAA 4L4VB 4QTIH 1KIRA 1JHLL 1MJ8H 3UJIL 5TE4H 4UB0H 4WO4C 3PG2A 3ULUF 4YDKL 4WI8A 2NTSP 1SJHB 4PB0L 2DLEA 2JCCE 2P4AB 3CC5B 5E8EB 1QVOA 1P2CB 3HMWL 4UU9A 2DWEA 2QHRL 3RWHA 3QIBB 1G0DA 4N5ED 5C0JB 5D2NB 3FONB 4PG2C 1X6NA 1BQLH 1S7RA 4MSWA 3WDIA 3NA9L 5EORH 2WBJA 3IF1B 4LSRH 1H15B 2CRZA 3EFFB 1JTPA 3WUZA 3K1KC 3PQYA 4LHUB 1NAKL 2AJUH 4MWFB 2CMRL 3IKCA 4FFYH 1K8DA 5GJSL 5ENWA 1CFSB 2W0FA 5BZDB 4H8WH 2ERJB 3WJJC 5FO9B 3MR9A 2EXWC 4W6WB 1MHPH 3D0LB 3WNMA 3RRQA 5IMOA 2QV2A 5C0CD 4NM4H 3OKOA 4LSDA 2XZAH 3D2UA 2JB5H 1WC7A 5FHBL 5CCKH 2QEJA 4OUUA 5L6YL 4U1KB 1MY7A 5KJRL 2ZPKL 2IF7A 5D93B 5HHOD 2PTTA 2YXMA 4N0CC 1MJUH 1ZGLA 4NP4H 5DDHB 2V5RA 3VXTA 3WSQH 1MCEA 3GSUA 4Y5YA 4N5UA 4Z78B 4N8PA 1QSEA 4O58H 1HK6A 3I6KB 4H1LG 1FYTE 4JDZA 5EBLB 4MA7H 1FH5H 3W0WA 2X4PB 4X6EB 5FIEA 5JW4M 5J1AB 1FN4B 2OL3L 2X1QA 2XOTA 4L3CA 4ZFFA 1F4YL 3KXFD 4TTDC 3SDXF 4YDVB 4QWWC 1LEKB 2EDFA 3G08B 2CLZA 2DRUA 4XC3H 1F3DJ 1OQOA 5EU7C 4U31A 2Z31D 2P7TA 5T3ZE 4N90E 1IL1B 3QWOA 3V6ZA 5E8OB 4N8VG 1JNLH 4Q2ZA 3RGVD 3WEXA 5HVHB 2OR8A 2EYRA 1ZVSB 3P4OA 4OF8A 3DBXA 4E41A 3ULVD 5J12B 3JBG7 3F7QA 1GC1H 1HSAB 3QQ3A 2X9XA 3ULVE 2NXZD 2A6DB 4XBGB 1FAIH 3DUUA 5TQ2H 3U7YH 4PBWD 3T09A 3FFDB 3O4OB 1G6RB 1SY6L 3LEYL 4JM2D 2GJ6A 3B5TA 3QO0B 3DSFL 3CU7A 4JFHE 5A2FA 5IF0A 2QSQA 1WICA 4MNQB 2RR3A 3E2HB 4RRPG 4XI5D 1QSFE 5IBTL 1EBAA 4QHUB 2X7LB 1YPZA 4JJHA 1ZS8B 2A1WH 3L1OL 3L5WA 3ZYIA 4X6FB 4R2GD 1KIPA 5H37G 3UBXI 3HCVB 1CICD 1HHKA 5DJ8B 1U3HC 5JHLH 5E4IA 2G75A 3FO9A 2NY6B 4N0FB 2FL5A 1KYOK 2KH2B 4WHYG 3UPAA 3T0AA 1NMCC 1JWSA 1BQLL 3CXDH 4P46D 2AV7A 2VDRL 4JRYB 4MDIB 4RAVB 3QDMD 2D4FA 5GGTA 2R9HC 1U3HA 3FZUC 3AC0A 3Q5TA 4JDZB 2VXQH 2Y6SC 1QLEH 4I2XA 5FF6A 3QFJE 3R06B 2CLRA 2CRYA 3DBXB 4E41B 1JZ7A 1MHHB 4OZFA 5TGBA 5E08H 2DWDA 2HFGH 4G80A 3BWUC 1DLFL 3O41A 2DKMA 3IKKA 4LQFL 3UDWC 5FEBA 4IRSA 3LEXA 1EJOL 2OTUB 3ZL4H 2OTWA 1WT5A 5HI4D 1D5IL 1F90H 3UXFA 1RIUL 1PJ9A 2WZPD 5TDPA 3I50H 2SEBA 4XHQA 1DR9A 4HLJA 4NNXB 3Q5OA 4P46A 1HILB 4P46C 2FJFA 1WBYA 2DLTA 5E6ZA 2Q76B 2XKUA 1S3KH 4P2RE 5D1XC 2P5ED 4LSVH 5HVGB 4UV7L 1CYGA 5HHPA 3AMLA 5FCUL 3MYZA 5C9KA 2JJUA 2AEPL 4QGTA 3KPRB 4YGVB 1CT8A 2D2OA 4HXBH 5LBSL 5DVMA 4Z7UB 1A7NL 5D7IB 2LU4A 1DN0B 5KSAC 5DC0A 5J6GB 4PP1C 4AMKL 3EW3B 1I1RA 4J8RB 1MLCB 4Z77A 1K3ZA 5HBBA 1JF5A 3MJ7B 3QIWC 3V7MA 2QBWA 5I1IH 4G9FB 4NKMA 1MCBA 2ADFH 3X11B 3QDAA 2HTLD 1XGRA 1IQWH 1IT9H 3QDME 1F90L 1A9EB 1A6TB 2O61A 3HA0A 4QRUA 5KS9E 3QG7H 3DUSA 2NXYB 3NH7L 4JY4B 3ZTNH 5IT2L 2IADB 1GPOH 4U49A 3UO1L 1E28B 1W72B 1A14L 1K4DB 3ABZA 4HS6A 4XBEH 2R2HA 4U6XA 4Z7WB 5J1SC 1KLFA 2WANA 1MCWW 3ARFC 4PRPB 2NY4D 3OAZH 1RK1A 3ZYOA 3QUZB 4LCYA 3U36A 1UT9A 5DR5L 3QQ9C 3DI3B 3FHAA 5EBGA 4MB4A 3CVIH 1JF1A 4L3EB 5I1LB 5AAWA 4HPYL 4U1LB 1I4FA 4X9FA 1NGWA 4RCAA 5FUZL 5DUML 4Z76B 3RNKA 3CMOH 2BNRA 1IAKA 2VDQH 3FQNB 3MRNA 1CGTA 3S35L 2WLYA 3ARDA 5FM5M 1XEDA 4Q74A 1FNFA 3S37H 3WNLA 1I9IH 4J2XA 2P46B 1YEGL 3EHBC 3PV6B 3L3KB 5CJXC 3GJEA 5B3JE 1T03H 3MLYL 1JP5A 4WHYH 2DQGL 2N7AA 3VXPA 1T5WB 3SCMB 1NGPL 3QEQA 3O45B 3ORJA 4R3SB 2A83A 5C08A 3BH8A 4YFLI 3IU3A 4PJ7A 5BS0E 2NY0D 2AABH 5F6HI 4U6XB 2GEEA 1UZ8A 4OQTA 2VUOA 4JQVA 2Z4QB 4XWOC 3Q6FB 1NUGA 3TN0A 3FQTA 4RIRA 2W60A 4EDWH 3QEHB 1E4WL 2OL3B 1FCCA 2XPGB 2XN9B 3EOAA 1XR8A 4MXVE 4XCYB 1NC4D 1R0AL 2NW3B 4LIQE 3QDGB 4G6AD 4DCQA 4MZ3A 4HT1L 2WM0A 1DEDA 1RMFL 1A7PH 4PJDA 4WU5A 3ESVF 3RPKA 5DMIH 1KNOA 1QFOA 1HQRA 3REWB 1FNSH 4QRPD 1IGTB 3E3QC 3G5VB 2OK0H 3KPPA 1OP9A 5EZLB 4CVZA 5AYUH 3EO9L 1OSZB 1ZT7B 3PXHA 3QPXL 1CBVH 2IJ0C 3BHBB 1R3IL 4NO3A 2CK0H 2RCSH 4RMUA 4LCCC 3T0EB 5EC2A 2Z91A 1IQDA 1A7QH 1A6PA 5CBEA 1DBAH 5JHDB 5F7YC 3GRWL 2B39A 1EGJH 1DBML 4LHJB 3UMTA 1MCKA 4YHNA 1F11A 4RAUB 5GS0C 3K46A 4HUKB 4Y1AD 1GSMA 1JPFB 3QI9C 4HWZA 1NGXB 1PGRB 1V3MA 1F4AA 3KLHC 3DYOA 2XWBA 3ARZA 1CR9H 1U8IA 1FL5A 2AAVA 3HZKB 3NCBB 3LZFL 5E99L 1U8PB 1MLBB 2JLLA 1IM3A 3B9KC 3BP6A 1QO3B 3MOBL 4KK6C 4OLVH 2J5LC 4P49A 3VXMA 1Z2KA 4K3EH 2QHRH 3MRHB 4Z6AT 4XCCH 3REVB 1S8DB 3BVNB 3KAAA 3LRHA 1OHQA 3N1QC 4HDIB 5IW6B 2VN7A 4FFVD 4X98A 4XPHH 5DHVB 5JIIA 4H25B 2HG5A 2QSVA 1JHLH 2V7HA 4WHTA 4B7IA 5KN5A 1BBJB 5KSBA 2NY1C 4KKBC 4MNQE 3INUL 3STLA 4IHOA 4AEIH 3BI9X 1LNUB 2AEQL 4JB9L 5I18H 3DIFA 4QRRE 2E7HA 5MEPB 5DFWH 4MQXD 3CZJA 1Z9MA 1G7JA 3CFBB 3WFHA 1AI1L 3S5LG 2X42A 4GKOA 3QI9A 4UQ3A 5IHZA 3MV7A 3SGEI 3MRIB 4PP2A 2FGWL 4JN2B 4FQHA 1DUYA 3WFZA 4G42A 1KCRH 1ITBB 2JIXA 4JLRB 1FZKA 4ONFH 2IPUG 2Y06L 3OJDA 4RZCB 1TVBA 4XNUH 4D2NA 4Y4HA 4FZEL 4HWZB 4ODUB 4JRXD 3D39E 5GJTH 3WN5C 4CGTA 4OCYL 3ZDYE 2XWBB 2FX9H 4Q9BA 1IM9D 4X99B 5HYIA 1B3JA 3BW9A 5F96L 2IQ9H 3IDXH 2HJLA 3HN3A 1B88A 1KTDB 3QFJA 1T5XA 4X4MA 2P8MA 3BPNB 2BSSA 4QXTA 1I3GL 2F58H 4PGBB 4UDTB 3MRHA 3NOIA 1OTUD 5EIVA 1KB5B 1GOFA 2EEDA 3WSQL 3EYSH 3I84A 4HIXL 1MJUL 3RY6A 3QUZC 2OQJB 4I9WD 3WO4B 3BKYH 4UT7H 4TULL 1NUNB 3QSKB 4Y19E 4XNMA 3BKYL 4YLQT 3L3JA 3RIAK 1RZKL 1KPUB 4JFEE 4WV1B 5J11B 2EDYA 1QQDB 4K94C 1QSED 4YR6B 2DQTH 3RKDD 3VFOB 4YZFE 1Q0YH 1NFIB 5FA4B 1PQZA 3TBSB 2EE3A 1A21A 1M7XA 3MA9H 1YN6B 1UM4L 2CMRH 5IBUG 3GSVB 2X4SA 1RD6A 3TVMA 5IJKA 2Z93A 1FV1A 1J0HA 1QO3A 3VG0H 1ND0A 2NW3A 4EI5C 1KIPB 3MLSL 3V95A 4PJXB 3OKDA 2R0ZL 4YHLH 2HFEA 2H26B 2D0HA 2NY2C 4I77H 4L29A 4ZFGL 5IEKB 5BMFL 3PWPB 3UTQB 3U6RB 4LCUB 2H1PL 4FQ1L 3LKRA 4DZ8A 5A2KH 4R90L 5I74C 5L2JB 1UACH 2Z92A 2CJUH 3MRCA 1JGDA 3AS3A 5T33H 4POUB 4U1HB 2IFFL 3NACL 2LV4A 3ARVA 5FO8B 1N8ZA 1M7IA 5CBEB 3HE6B 3D3VD 4M7ZC 2BNRE 2M26A 3G6JB 2EEAA 2ESVB 1CQYA 4K7PX 4YHNB 2VDNL 1EPFA 1F58H 1KIRB 4GXUN 3JTTB 4HIJA 2V2TB 1KLGA 1L0QA 4XRCB 1KPRB 2FIKB 4U1JA 1MPAH 2FZ3A 3CD4A 1RHHB 1A8JH 1I3RA 4XNZB 1J1XL 1DQML 4ZXBD 5D2NA 5EBMA 3VXTB 5IMKA 4MLSA 4K9EC 3BPLC 3L6FB 4K3EL 4WFFE 3TBTB 4DGIH 3PWNB 3QHFH 4PRDA 1UACL 5D7SL 3QXVA 4NNPL 4DGYH 3HE6C 2V5YA 4RBPH 4FQ1H 5J1AA 4TSAL 3LEVH 3ULUH 3IJYB 1ACYL 5IKCB 1OT2A 3AROA 4GOSA 4BA8A 5DC4B 5E2UL 1XF4A 3O3EA 5FKAA 2APFA 1C7SA 3TFKD 1GHFL 5MI0B 3SQOL 4AEHL 5D2LB 5LWYL 5HDOA 1YUHB 2DWEB 5BW7A 1FFOA 3ARQA 1D9KA 1ODAA 2E9WA 4U1KA 3PIQB 5GQBA 3VWJB 2ZUQB 1S7RB 4NQDB 1HEZA 4WY7L 3TBYB 2P8LA 4K07A 2EH8H 3MJ6A 1A6AB 2BVUA 3MV8E 3FL7A 2JE8A 3D5OF 1D5XB 3H9HB 5F93C 1QP1A 2E9JA 1W2KT 4OV6F 4LCUA 4TULH 1FLRH 5JW3H 4KROD 4JZNA 2NY7L 3CGTA 4LEOA 5ITBL 1CTOA 2IALA 3HUJE 4PFEA 2K7QA 4WFGE 1PKOA 1SEBB 4MNGE 5C0EA 3TIEB 4IS6B 5E7FA 2BERA 4ZOAA 4YFEA 5BRZB 2G5BB 3RWFB 5IJKC 1FIEA 4I0PC 4PJEA 4LEXH 3FQNA 3NCYS 4JFQA 3LRSB 4XTRD 4EVNA 2W38A 2G2RB 1KTDA 5JXAH 1NBVH 2CXKA 4LVNB 4KHTH 4JZJB 1FZMB 5F71A 4S0SD 1RJYA 1WTGT 4L3EA 4Y4KC 3S8WA 3B83A 4LCCB 4TUJB 1NCDH 4POZC 1AHWC 3TZVC 2UYLA 1I1AD 1JUFA 2DJUA 2HRPL 1MHEA 4GRWB 4RWYH 4HIJB 1U8OA 1S7WB 3S4SB 3MRFA 2X1WL 1FORH 1L6ZA 1QSZA 4PLOB 3ZTJG 1T03L 1ZAGA 4RFOL 2LU3A 3DXAB 2I26N 3BUYB 3VJ6B 3KJ4B 5EZJB 3MBEA 5IF0B 1T4KA 3UDWA 2WWMC 5I6XC 3T2PA 3DV4A 1DLHB 3AVEA 4EN3B 4AY0A 4MGXA 3U4BH 3NZ8A 4CVXA 2JELL 3WFDL 5KG9B 2HT4C 3CFDB 1RZIA 3KPSB 1K2DA 1JGUL 2LE9A 3U0WH 2Y07H 1VFBA 4GLRI 3PWPE 3ZKQD 4X0KB 1T1ZA 1RZJH 4QXGL 1XAUA 4PD4K 4DN3H 5JOEA 2APWA 3FRPG 4TQEL 1FNLA 4LHUG 4PB9L 4LPUA 5B8CB 3LD8C 1DUZA 3MUZ1 2O5ZH 2XIDA 2N1KA 2H2SD 3EJJX 2EYSB 5C3TA 1T66D 4HLZH 1T7WA 2FECI 3H9SD 2ED9A 1FGNL 5DK2A 1BD2D 4JAMA 3MBED 2FEDD 4OCSL 5B39A 4R6UA 3VXSD 3LAFA 1BIHA 1KACB 3RBGA 3IS0X 4WUUA 1J8HA 3LDBC 2XTLA 5AUMB 4R4FH 4RAHA 2EC9U 1A14H 1NFDE 4F58H 1T7XA 4P4KC 1KIQB 4JM2C 3EOTH 4TUKH 5EIIA 4PRBB 5BRZE 1C08B 5BOPA 1CIUA 3LEXB 1NDMA 1M05B 1NEZG 1RUQL 2P42B 5I8EA 1V7NL 4F7EB 1A7QL 4Z0XA 4O00A 3WIIH 4ZO7A 4IS6A 4E5XA 1P7KB 1BHGA 2BRRL 3BZFA 5F1SA 5FV1L 1SJEA 3OKNB 3VE0A 3G04A 4O02H 1CBVL 1LQSR 1B9ZA 1L0XA 2YUZA 3C60C 3EO9H 4QY8B 5DD6A 5EC2B 2AJYL 5IB4A 3TBVA 1RIVH 4JFEA 3WS6C 1CZ8H 4OF7A 3MRFB 3QIUD 3DX7A 1JNLL 1I1AA 1NMCB 1MIMH 4OQTL 5GGVH 4HT1H 2VQTA 3VDBA 3I6LD 5ICYA 1I1CA 4NN5C 1BREA 4P23D 4J4PC 1V7NH 4FG6C 1HSAA 1S3KL 5E03A 3SDDA 2EDNA 1ROWA 3ESUF 1FDLH 1IAII 3AUVA 1RULH 4PIRF 3O8XB 3DV6A 4X4XA 1K85A 1S7TA 2O5XH 4KKAC 1Y18B 2KQNA 3PV7A 4PV8B 5FYKE 1YN7B 4HAGA 5DYOB 4PRBA 4MB3A 2W65A 4LDLB 1YJDH 4PTTA 4WHTB 4UOJA 3S36L 5BS0D 1HE7A 3MA7A 4LLDB 3BEWA 2E7BA 2ATKB 4LL9A 4GRMB 4HIIA 1A7RL 3N0PB 5CBAB 5IVXF 5MI0C 2QQQA 4M62H 1YMHA 3QCTH 1GZQB 3VA2C 3WUWG 2MJWA 4X4ZA 1J05A 1MHPL 3MUHL 4PUBL 1HXMA 1ZK9A 1WZ1L 2VDQL 2EO9A 3LB6D 4Q9RH 4U3CA 5I74B 1NC2D 1S78C 7FABH 3WS3A 1EZVY 4X80L 3SBWC 1LE5B 4ODWB 1L9NA 1YQVH 4U1LA 1QVOB 4LFHG 4HUXB 4G8EB 3GMLB 4KJPD 1SJHA 5I0DA 3Q48A 5JZ7D 3DX8B 3ARGD 2IANE 3UPRA 4ELMF 4HS8H 4Y4HC 1BF8A 5GGVY 3P0VH 5C0JA 1EEYA 3D87B 2YPKB 4MAYD 1OPGL 1NCNA 3IU4L 3SDAB 2XYCA 1MCRA 5E2VL 4LRNL 2HP4A 3AU1B 3PDDA 4EBQH 3EO1B 1AGEB 1WQVT 3BKJL 3N85H 1WCQA 3IKCB 1OB1B 4XBEL 1NANI 3K8KA 3UJIH 4P4KA 4HK3J 1H15A 5JXAL 3EYVB 1QFWH 1Z3GH 1A3RH 3MSPA 4JM4L 5MERA 4JRXE 2GUOB 2VDLL 3WNOA 4JZOA 4WI7A 5B4MD 1H3GA 1I85A 3CAFA 4Y19A 2YPLA 4GBXB 3WHXA 3ARFD 4XNXL 1INDH 3MV8A 4CNIB 1U3HD 2NY2B 1FE8L 4U7MA 5FDWB 5AZ2L 5GSVB 5HPOA 1JBJA 5I1IL 1SVZA 3GJFH 2UWEE 4HS3B 4JO4H 3PL6D 2CKBH 3QA3A 4PV8A 1XR8B 1BFTA 3GJEB 1NQBA 4OCWL 3MOAH 5D71L 4G5ZL 5EU5B 4PJ9C 5DJCB 3SKJL 1PG7H 4PJHA 4OM1H 1PG7X 2Y36H 1AXSA 3JTSA 4ONGL 3W39B 1ZXQA 1CFQA 2A83B 4LPYA 4HKZB 5C08B 2ESVA 4PJCE 3LIZH 3C2SA 4Y5VB 3ZDZE 1MRDH 3QHTC 4L8SC 2J3SA 5C0IA 2GTZB 2XTJE 4MJIE 1W0VB 3EO1A 4K7FA 3L5XL 1TQCC 3TBTA 4AENA 4BZ1L 4F7MB 3SQOH 4AEHH 1YMMD 3IFLH 3WLBA 4JHAL 3ARED 5DD6B 5CZKA 1N5AA 4YHPA 4NPYA 3GHBH 1M71A 3WHXB 2HLFD 3RU8L 1KENL 2AXGB 4M8QA 1AFVL 3DETC 3PUCA 3QXAB 4ZYKB 3W11C 4R2GC 2C1PB 3E6HA 5SV3A 1C5CL 1KTLA 1HH6A 5E6YA 3A67H 5CEXB 4KQ3H 3HI5L 2AXFA 4KK5C 3MRRA 1C5BH 2XWJA 5HGAA 1KJ2H 5D1XA 1FZJB 2FYYA 5F1NA 3WNKA 2Y5TB 3T04D 4LASL 3F12B 5I1EH 4R26H 5FA3A 3AU1A 4P3DA 2EE6A 3B3IA 5EU6E 3SEPA 3CSGA 1T7VA 3QWRD 4OLUH 1KCKA 2GCYA 4O5LH 1TPXB 3TC9A 4FP8L 3PWVA 3VW3L 3LN4A 2WBJD 3ARBC 4MA8H 4UINL 3HCVA 3FRPA 5E9DD 4UZGA 5ADPH 1KG0B 4DGYL 2B1HL 3TH4T 4NNPH 2IGFL 4AK1A 1CL7I 3UTSE 2HT2D 1VFOA 1TETH 3T65B 1MJ8L 2VRAA 4TSCH 1RJLB 3RVXD 2E8YA 1KCUH 2GITB 5CP3H 2E7LC 8FABB 5I2IB 3VW3H 2YD1A 5DEFB 1FC1A 3NAAH 2OBGA 3F62A 4JFFB 4PJ5A 5D1ZA 2APXA 1A6UH 5ISZD 5DEGB 3VFGL 5TQ2L 3U7YL 4M6NH 2QJDA 3RL2B 4HJJH 2DJSA 5J6HB 3KPSE 1CE6B 4OI7A 4LRIC 3T0EE 2QHLA 2X1XR 4FQHB 1JHTA 4Z7UA 5D7IE 3TJEL 3IFOA 5CJBA 2BDNL 4LFHD 4HZAA 1E6OH 2GK0A 5DZNA 4ALAH 3NFNA 4PJIF 2EECA 1YNTA 1KGCD 5ICXA 3MLXH 4LHQB 5CAYB 4RWHA 5DT1L 4PJEE 1OP5K 3ZO0A 3VD5A 2AVGA 3NGBB 1J0KA 2DI7A 4QXTB 1U93A 2V17L 4JFZL 1S9XB 1EFXD 1YEDB 3THML 4NHUB 1F4YH 2D7QA 4PRHD 3EYUH 2ZOKA 1CDBA 1CDHA 1J8HE 1UH4A 1CD0A 2ORBH 3CPLA 1OSPL 3VG0L 5IEHB 3DV4B 4K23H 2F74A 1NFDA 1CXHA 4OZFH 4QT5B 4YFLF 1EO8L 4GLRH 1T83A 4WEMB 3OSKA 1OGAB 4O58L 4CVWA 2HVKB 2FYYB 2IH1B 2V5MA 3PWLB 1NLDL 3S96B 4TOYH 2YPVH 3EYUL 4IDJL 4I18C 3G6AB 2XKSA 5CEXA 3KPOB 5E6ID 5HD8D 1TZGL 3MOAL 3N50A 4E41E 5JR1L 3BQUA 3SE3A 3T4YB 4XNUL 5HYJB 1LK3L 3WMSA 1O0VA 1ZTXL 2VWEE 1WLHA 3CFDA 3D0LA 2A9MH 3K8LA 2OYPA 5E6IA 3DO3A 1TCRB 2V2XA 4P9HH 4NJAH 1UH2A 4K2UH 5AD0B 4NQTA 5FHAH 5DC9B 4I4WA 2VDLH 1E4KC 4OGAC 5I0ZA 4IJ3B 1B0GA 1Y6MR 1AO7D 3LKOA 3PABB 2E27L 1IEAB 3BP5B 4NWTL 1OTUC 1XF4B 4S1SH 3NA4A 3WEXB 3CXHK 4HZLA 2EH7L 4PJFE 3N85L 1UKTA 3HMXL 1SBBA 3ROOB 4PB0H 3S35X 1B4RA 2IMNA 4AQOA 2BK8A 2PTVA 1F4WL 1HHJA 3HNTH 5DSCA 2YHGA 1MFNA 2CLVA 2H2PD 3N1FC 3QIBC 1SYSB 5I1CL 3C5SA 3UYRL 5DJDB 3WD5H 5DURD 1RHHA 3DGGA 3EYOB 5HI5D 8CGTA 3QJHB 1SJVA 1MJJA 4L8DA 5K9QI 4HCRA 5LVEA 5I75B 3V52L 3LS4L 2OP4L 2DIBA 2AJZB 4XAKE 4FQLL 3VGEA 3VXUA 4S1DC 1U8MB 3I6GB 3LVEA 1SEQL 3QFJD 3K1DA 4FZ8L 4QHKJ 4B0MM 4OGYL 5KVGH 2MCPL 2FX7H 1WV7T 3AFLA 1OAZL 4P2OD 3G6JE 1HHIA 1IGCH 2H9GB 3RDTC 3SJVB 4D8PA 5K59F 3SKNB 3U46A 4MLIA 2BY2A 4L4TE 2JCCA 5EWIH 5L0QC 4P2RA 4ZPTB 3SE9H 5IMKB 4Y4FD 4JVWA 1HEZB 2YUXA 4X7TB 4IIQB 2P8LB 2VXVH 1OCWH 1X5AA 1KFAL 3HTLX 4XCYA 5D7LE 1X7QA 1S7UA 1OAQH 3E3QE 4NCC1 5DQDL 2XN9A 3EOAB 4LARH 1ZGLB 1NCWL 4NO0A 5C86A 2ORBL 2DI8A 4FQ2L 2AK1H 3WUWB 3TNMA 2K1MA 1AD9B 3VRJA 1KEGL 5F8RC 4JFHD 3T0WA 3LRGA 5DJZB 4UNTA 5EU3B 5IB1B 3ET9F 1HZHL 3X3FH 4RMVA 1P84J 2ZUTA 3S7GA 1YEHL 1J86A 2VC2L 2VO5A 1N3NB 4PRAB 3VI4F 2DICA 4B5EA 4ZNEA 3DNKA 2VISA 5KS9A 4AM0B 1JYWA 4Z7VE 2A2QT 3BEWB 2ED8A 3OHXB 4L1HA 4H0GA 2XNAB 4G6JH 2IBBA 4TTGA 1T89C 4N8VA 2VH5H 4EI6B 2BMKB 3O41B 2DQCL 4HMCA 2EIZA 4L8BA 5CWSA 2KQMA 4DKEH 2EC9T 3QCUL 4CKVX 3ULVL 4JKPL 1FZOB 1LD9B 3NTCH 4RISH 4UIKL 3KDMA 5D7KD 3O2VH 3QJHA 1VEOA 5CMAA 1MIEL 1WZLA 4H5SA 2DLHA 3HI1A 3O3DA 3OTTA 4QXUL 2JCCB 3RZCC 3RX5A 4RX4D 4CDGC 4M02A 4Z7NF 3QEGH 5JPNB 1SYSA 5E5MB 5DXWA 2X44D 5HHVH 2AW2A 3PGDA 4NKMB 4G8FA 2YPLB 4GBXA 5IR1B 4JG0H 3HNVL 5KZCB 4JREC 1CLYH 4HKXA 4IJ3C 4YXKH 3IJHB 3FTGA 3KPLA 2A74B 1UWGL 3QEUB 3DX6B 1Z5LA 3KXFB 4LAQL 5IW3A 1OTTC 5DI8A 3F5WA 4GRLD 4ORGB 4JO2L 1S9YA 5GS0H 3IETB 5SWZD 2VDPH 4O2CB 4F7EA 3TESA 3TNNB 5DR5H 4TVSa 4LCWD 3S37L 3MJ8A 4RGOL 4WNQB 4YDJA 3O6LH 4I1NB 4I0PD 4X80H 3X11A 1LO2H 4D0CA 3RIFK 4Y5VC 4PJ7F 2A6KA 3F58H 2EDQA 1UXWA 32C2B 2B5IC 4FMFA 5DMGC 1G6RL 1QSFA 3KJ6L 1NDGB 3SDYL 5CUSH 4HV8B 1DQLL 4HKBA 5B21A 4JN2A 4RGOH 4ZO8A 4GKNA 5D4QA 4KH2A 4ODSH 4NQXB 3O6FA 3CFCH 5J9PB 4XP1L 3ARSA 2ZSVB 3BDBA 4A2MA 1OAYH 2ARWA 2W91A 1JMXA 1I9JL 1GGIL 1VEMA 1WUNT 2ESVE 3G9VA 4PJCA 3RWGA 3U9PL 4X99A 1OQXA 2YRLA 4FFWD 1CDCA 3O9WB 2H45A 3VGGA 3P30H 1C08A 5DD0H 2IAMB 5IOPB 3BESR 1ACZA 4D0DB 1NCDL 5E8NA 3UBXA 2DD8H 5CHNB 4NQSA 4Q0XH 1TTUA 5D1XB 4MJ6B 5KBNC 3TH2T 1YN6A 1FYTB 1QBML 4HCRL 1WBZB 1Q9LB 1U95A 4JAMB 2R2CA 1EIBA 4KHXL 5K9KB 2B2XH 3EDEA 1IEBA 2VNCA 3OPZH 2EO1A 4O4YL 4J6RL 3MRKB 5F9OL 4FQPA 3RAJL 5A2LH 2ICEB 4JFDB 4DUVA 1UXWB 4V1DE 3QXUA 4YX2H 3JV4A 5INCA 5A3ID 2K9UA 4JHZA 4TN9A 4YHOH 2AJYH 1MCWM 3DMMD 1TXKA 2PO6C 1MCNA 3RQ3A 4OZGA 1HI6B 4DCQB 2X89D 3HS0A 3I85A 3N1PC 8FABA 5I2IA 5CGYC 5GGSB 1ADQH 1TVHB 2D0GA 1T6VN 3BUTA 3BT2H 4XP9L 4YBQC 4EXPX 4JFEB 1SYVA 3WIIL 4JFFA 4D9RE 4EN3C 3IT8D 2AP2A 4N0RA 1EAPB 1KELH 1Z5LB 4Z0BH 1DDHB 1B90A 2W0PA 3ROLA 4NC1E 4TUKL 3O9WA 1U58B 3QXWA 3E0GA 1I9RL 4IDLA 2UZIL 1UXSB 4FQJL 2WP3O 1NDGA 1Z6JT 1MFBH 2M1KA 2BNRD 1VACB 3DVNB 4L4TB 5GS1C 3H9YA 2YSSA 1EJOH 3V5KB 5TQ0H 3SE9L 4N9OB 4PGEA 3QPQD 2PTTB 1G9EA 2FEEI 3VMPA 4D9LH 7FABL 1CGUA 3OAUL 1BLNB 4FHBD 2PW1A 4MAUL 2I07B 2OM5A 1IBGH 5HYQA 2GY5A 2F8VA 4TTDD 5CGYD 1NFKA 3MRGB 4IRJD 2V2TA 4JDVA 1FIGH 3X3GH 5T1LB 5T1KB 5L2KD 1J1XH 1I8MB 4LCIH 2DBLL 1U8JA 4HBQA 1DP0A 3RNKB 1DVFD 2DM2A 3CDGA 3LS4H 5J56B 4JQXC 1A4JB 1QZ1A 1J8KA 3VXMB 5DJXA 3SBWA 5DK0A 1SBSH 2BHYA 5IKCA 2DTML 1ONQB 1D5XA 4OLWH 3C08H 4MJ4A 3PP3K 2IFFH 4R7DB 4PRDB 1FORL 1TNMA 3BZEA 4NKOB 2YD2A 4PJFB 4JHWL 3MJGX 2GYSA 3TWCL 4X4YA 3C6LA 4YDLB 1IFHL 3TNNA 5GRVK 2HN7B 1FVDB 4XCEA 2EH7H 3D39D 1K5NA 3U4AA 1FFOB 3P0YL 3O2VL 4UIKH 1QPPA 4NO0B 4S1QH 3BH8B 3QZWA 3SKOA 4HEPG 1T1XB 2DQJL 1VGKB 3TA3A 4AH2B 2J6EA 5IROA 1GC1L 3SDDD 2DQCH 3MREB 4K2UL 5GSRA 4I0CC 4W6XB 3W9DA 2FR4A 1NBZB 1NCBL 3MLVH 2R1WB 4O2FA 3BGFC 3WN5A 4I3RH 4D3CH 5HYJE 2R8SL 3R0NA 1FQ9C 5DJAB 5E94A 2VSCA 3OGCA 4PG2A 4JM2F 4XPBH 2RFXB 3CSBA 5HGAB 3UTSD 3ECBB 4H26A 3W39A 5DRZA 3NIDE 5JW4R 4PY8J 4PJGE 1PYWA 1WAAE 2HLAA 2VLRB 4UT7L 5F7KC 4MXQD 2GTZA 2AGJH 5F9DC 3FO2A 2X2YA 4NZRH 4G8GE 1CFTB 4LLUB 3KWWB 4AG4H 4R4FL 3FT3B 1MJJB 2VLKE 4PJFA 1BQHG 1Z9OA 3UX9B 5C2UB 5EFIA 4F3FA 4MJIA 4QRSB 4R7DA 5EU5A 1XGYL 1K8IA 1MCOL 4M5YH 3H7LA 5JIPA 3JVGC 5FGRA 1CXLA 5ADOH 4XVTL 3BEVA 1QPXA 3BSZL 3QDMA 4ZNEE 4EI5D 5C0IB 5FA4A 5KTEH 1AO7E 1KPVA 3C5ZA 4Z7NE 5DT1H 5J6GA 1G7HA 5GGTL 3IFPA 2PXYB 4C59B 4AL8H 3SE8H 1P84K 2FLRT 2ZKHH 3CZFB 1BM3L 4PREB 1U8MA 4N9GA 1DE4A 1ND0B 2GTWA 4YAQA 5GS1B 4MAUH 5C0CE 2X9YA 1F4XL 2VLRE 3TVMB 4HUUA 2XV6B 3B9KB 1KN4L 4QRUB 2A0LC 1HINL 4WTXA 4G7VL 1AKJD 3BWAB 3UC0L 1FG2A 4PP1D 1U6AL 2DYPB 4X98B 5DHVA 3MBEC 1MCJA 4D8PB 3GHEL 3U82B 2QQNH 1N4XL 3GO1H 4PS4H 4GBXC 2Z35B 5JW5B 1JGDB 1F4WH 2R9HD 4JPKH 2G60L 1R3KA 4FS0A 4H0HB 5FECB 2OR9H 1U8LB 4B41A 1XR9B 2AXJA 3OB0K 3TVMC 3BAEL 1E27B 5F7LB 4UOW0 3G5XA 4OLVL 3L3OB 5I1KH 3STZB 1A6VL 2HVKA 3LPWA 1MFAH 3DUSB 4EUPB 5CD3A 1CDYA 4HIHB 3SGJA 3V4VH 2J6EL 4KVCL 4Z8FH 4GW1A 4WUKH 3F65A 1RK0A 1PAMA 4YHLL 1S78D 2C5DC 3MRCB 1ES0B 2V2WB 2V7NB 3MFFB 5I9QB 3DROB 5KSBE 4Y4KB 2QLVB 3OX8A 3X14A 2Q6WA 4ODUA 5KVDH 2Y72A 4FNLH 1P7QB 3WFBH 5SWZA 1UFUA 1CF8H 3TPUB 4PRPE 3G04B 5EA0L 1L6XA 5ITBH 3P9MB 1NSNL 1CVSC 4KI5E 1F97A 4ZS7L 2MFNA 1JRHL 4H1LH 3QRGH 5I30H 2VITB 1QACA 2B2XL 3IAQA 4URTB 3PF2A 4NZTH 2QQKH 4MS8C 2XXMB 3VE0B 1X44A 1RVFH 4EXKA 4PJ5D 5IEHA 2E7MA 2BJMH 1N6QL 2DBJA 2GJZA 5JUEH 1Z0MA 1DL7H 4Y2DD 2IC2A 1XF3A 3D3VE 1EBPA 3ZE1F 2I24N 1JHKL 3V9FA 1P53A 3FAWA 1D5ZA 1B0WA 2I9TA 4MA1C 4GG6B 3QNYB 1OAYL 1R0AH 4FTVE 4HWBH 3CFCL 2P5WA 1AY1H 2CH8A 3GMQA 4ZAKB 5F96H 3HC4H 4ODSL 3S37X 1FSKB 4ONGH 3QIUA 2VZOA 1ACYH 2R56H 3MXWL 1T0NA 43CAB 3ES6B 4P5TA 1TQBB 1BFOB 4NRZA 4JY5L 3V7AG 1MAJA 5EUKA 2F54D 3GRWA 4Y4KA 3H9SA 3MLTB 2OXGA 1EMTH 1ZWIB 1G7LA 1B2WH 2AV7B 4WI5A 3EJZD 3VFGH 2VDPL 1A9BB 3V52H 2WSKA 1AD0A 1LEGA 1F58L 3C6SB 2H8PA 1MAMH 3UEZA 2F54A 4HK3N 3GB7B 1I75A 2M8XA 5D7LD 1AH1A 3MV7E 3P4OB 1FC2D 2VXTH 3FOMB 3OKLA 3L3OA 1BBDH 3GSUB 2FB4L 3M17A 4F2MA 3FB7B 1FRGL 4YBHA 4QHNB 3GI9L 4ISVB 4NZJA 4JR9L 3UCRA 4BKLB 3WXVH 5FUZH 4ZPVB 3KPPB 1Q94A 3K4DA 2GJ6B 2CDFA 1I8KA 2AK4E 1FG9C 2DQEL 5MEOB 1FZMA 1N6UA 3UZEA 4KK5D 4YDVA 5EB9A 1LEKA 4PY7A 1R5WA 1U6AH 2VLLA 3PL6C 1BD2E 3T1FB 4EJ1C 5FHAL 3RTQC 5CLTA 4YIQB 4WWKB 4G3YH 1MQKL 4L4VE 3S5LA 2OCFD 5DMJB 3O9WC 1WAAF 4WHCA 1IRAY 1BQHA 1PG7W 1F8TH 3OMZA 1UH3A 5CP3A 5C0BE 4KTEL 4LP5A 1OF2B 3LDBB 3HLAA 4IIQA 2WV3A 5FDWA 4OZ4B 5LCVL 2NY3C 1SHMA 4BM7A 5GSRB 2YZ8A 3O4LD 1KJVA 1LK3H 1AQKH 5ESAA 4F57L 3BZ4B 4IMKC 1ZV5A 1X4ZA 3QBTB 1TZGH 2UY6A 2XI9A 1NEUA 3CFKA 1IQWL 2FO1A 4YE4H 5GSVA 1IGMH 3NBNA 2PO6A 4F9PC 1RZ8A 4HKJA 4G8IA 4JO1H 2H2PC 2Y1VA 5SV4A 5F1IB 1WZKA 3KJ4C 3KYOA 2VLJB 4R2GB 1KV3A 4ZYKA 1BFVL 3RVWD 3N1MC 5DMIL 3C6LD 5DGQA 4HSQA 4M43H 4DEPC 1GGCH 4UQ2B 3TCLB 4F7PB 3DYPA 4K9EH 4RMQA 5BQ7A 3H9ZA 4OM1L 4YO0B 3BRGC 1QBLH 1QKZL 4BK4A 5DD1L 2AEPH 2QQKL 3GDBA 3ZKMC 2V17H 3WLBB 3W81A 1D5BA 2Y7QA 3GBMH 3V6OE 4NNXA 4P46B 4TUOB 5EBWB 3DX9A 1IGCL 3C09B 3MGOA 2GFBA 4HC1A 5I76A 3C2AL 4F7CA 3KPQB 3LKSA 3RNQA 4DTGH 4U3XA 1K8DB 1OW0A 2R2EA 2G2RA 3K80A 1NC4A 3NPSC 4CN6A 1MF2L 3TEUA 3MR9B 5J13B 1IC1A 4QOKB 4S2SB 3MRGA 3L95A 4GW5B 5FO7B 5MHSE 4F2MB 1VENA 3GJFB 5ID1A 4K71B 2YXFA 2MQCA 1R5WB 1URLA 5IBLD 1DTUA 1A6VH 3C6LC 2X70B 5IHUH 3NABL 2WUBL 2UZYB 1YEGH 3IJSA 3QAZC 5DJ2B 3ZE0F 1L9MA 1J87A 3FKUS 4QF1B 3OJ2C 3Q6GL 4UDUA 1KT2B 5TF1H 2UUDH 3Q6GH 2FR4B 1U3YA 4JPKL 4PR5A 4KK9D 1MRCH 3H0TB 1O7SA 3L5JA 3QDJA 1JPGA 5J11C 4K3HA 4IOIA 4JQXA 3CXDL 3MLPA 4PJXA 1FPTL 2A6JB 3WO3B 1JZ2A 1BFOA 5F9WC 3LS5H 2DB8A 2HFEB 1X4XA 3O4LA 4OI8A 3G5YA 4YBLC 3MRJA 1MAML 1K3IA 1J1PL 5INDB 3HI6L 4WUUD 4P48A 2NY0C 5JZ7C 1TZIB 2ICWA 5KSVB 3I6LE 1V7ML 4Y7MA 1MCCA 2X4SB 4MAYC 4NQCB 4KY1L 5EDXA 2VLMD 3CPLB 2PYFA 4NKIL 2Y07L 2DQHH 3RZCB 1F6FB 1EHLL 3OGCB 4LLAA 2ATKA 5CZVH 1FJ1A 2R69L 4OTXH 3WN5B 2OLDA 1SY6H 4G8EA 1QR4A 1VA9A 1UJ3A 2NZIA 4X5LA 3S36H 1XGUB 5E4EB 1ZT4B 4K9EL 3LMJH 2EKJA 4X7SH 4PJGA 2EDJA 3IYLW 2IBZY 4W4OA 4BQ8A 5LGHL 4NQEB 2EXYD 3ZYJA 2OSLB 2ADFL 3K7UA 3V79C 1EAPA 2Q86A 4MJ6A 2P47B 4HV8A 4KKNA 3PHSA 1JHKH 1I85C 2O5YH 3DRQA 2AGJL 4X6FA 5CJQL 3VXRD 2WAHA 3WDHA 4IM8A 1ZGLM 3I9GH 5EZOL 4NUJB 4OSUH 1AQKL 3FFDA 4K8RL 1NBVL 4B53A 4Z95L 3U2SA 2A6DA 2QSCL 3O6FD 4OCWH 1WCBA 3VXOA 2FX8H 5A1AA 3HZYA 3QAZB 1YNTB 1CD1A 1U91A 5AWNH 3BQUB 4QRRD 2E6JA 3NMEA 2YN5A 3MO1A 2DQJH 5T5NG 2WUCH 1TFHA 2OX5A 3EJYD 3LKPA 1YY8A 2BNUA 4WU5B 3GSNB 1RUKH 2XZAL 2IEPA 4WO4A 1AR2A 1FG2B 2KL6A 1UA6H 3SE4C 2EH8L 3A6BH 3RTQB 5LJYH 1S9YB 4JFQB 4UBDC 3WXVL 2UVFA 3ARDD 4WDIA 3S35H 3MLWH 3BMVA 4MX7A 1NH6A 4ELMA 1HYSD 4AYFA 1ZEAH 2YSSB 3UJTL 2G5BA 5CSZA 5JMOC 1XR9A 1DANT 2VXQL 4OKVB 1KYOJ 3EYQC 4PBXA 5FUOL 5LWYH 4RFNB 3MCKA 4WFGD 4FA8A 2JIXD 5BZWA 4OZFB 2VDML 3NCFB 1MFCH 3V4PH 1S7VB 3MV7B 5D6DC 1NC4B 1MNUL 2P8PB 1YNKH 4LU5L 1Q9KA 5FGCB 2Q8AH 4LF3B 3B9EA 4HWNA 3DROA 5EU6D 4DN3L 3T77A 1D6EA 3DO7A 4NZDA 1GJIA 1WEJH 4L9LA 5HHMB 4L9LC 4BH7B 3OX8B 1AR1C 1P6AB 3KYKH 3EBAA 3F7YA 1QA9A 4PUBH 3P73B 5IQ9A 2Q8BL 5IBTH 4GMSH 2EDBA 4AL8L 4YFDB 1HYSC 3EFFA 3KYMA 3ZTNL 1DQTA 1MUJB 3MO1B 4XPFL 4NKQB 5TQ0L 1W0YT 3B8YA 3O81A 5EZJA 4YPGB 3TYGH 3WLWD 3TZVD 1OY3B 2J8OA 4XGZB 2MQ3A 2FO4B 3BSZH 2ZUXA 2JTDA 4ELKA 3HR5A 1JPGB 1ORQB 2NY1D 4KKBD 4MQSB 4JPIB 1I9RH 1IAOB 2ENSA 1OLLA 3ZSSA 1X3DA 2UYLB 3QULB 4ZQKA 4DKFL 1CGSL 4Y1AB 4XNZC 5IVXB 3MRPB 1X9QA 1UQSB 3BP7B 4U4BA 5D1ZB 1JNJA 3CDYA 3BPLB 3RIFF 2DOCA 3AAZA 1FDLL 3BQUC 4HJ0D 5I17A 3CCHB 4TSBH 3BKMH 4CL7A 4XHJD 4P9HC 4U0RB 4X7TA 4XC3L 3VH8G 4N1HB 4OCLC 4JVUA 2E5EA 4LLVB 4J3OC 2DIJA 3NIFF 3M07A 3VG9C 3UZVB 4HQQH 4KPHL 4CDHA 1AXTL 1MFEL 3F6IA 3FB5B 4AM0A 1PYWB 5FM8A 3IS1X 1QFWM 3BIAX 4F9LA 1EUUA 5IHBA 4BFIB 5IV2B 2FNBA 3HB3C 5JO5A 3SPVA 1WBXA 1XMWA 4C56D 4KHXH 3RWIA 1VGKA 3TA3B 5CEZL 2DQTL 4AH2A 4P5KA 4ZPVA 1PSKL 4MD0A 2YS4A 5FGBC 3MREA 4M9OA 4NRYB 5E1AA 1XIWA 2JKXA 2V5SA 3T1FA 3BAEH 3IFNH 3TJHC 4BQBA 2OMNA 3ZE2E 4Z76A 4GT7A 4HF5L 2VLKD 2AK1L 1M71B 2ZCLH 5K9JH 3RVTC 1IGFH 1OAQL 3O45A 3UBXG 5SWSD 4XH2B 3GMNA 5DS8A 5IVXA 2I07A 5HYQB 2QQNL 2HJKA 4XP1H 2APVA 3OKKA 2VXVL 2O26U 1NFIA 3AGVA 1JYVA 4K94L 2DTMH 5E2UH 3UC0H 3GSQA 3QDJE 5JHLL 1U3ZA 4K8RC 4KRLB 3LEVL 5EWIL 1H3WM 4GMSL 5K59E 3ULUE 2W65B 2O5ZL 4KZEL 2XTJB 2GJJA 4MJIB 4QRSA 4WO4D 2CIIA 2OZ4A 2DL2A 2VXUL 3SDXA 4BFEA 4X4XB 3OKDB 4YBQD 5EO1A 4WWKA 4Y2OA 5C09B 3GMPA 5C0CB 3VRLE 4HFWA 3OR6A 5CD5D 1QRNA 4J3XA 5ILTH 5DA4A 3HC0B 5GZOD 5I17B 3MRLB 2JELH 3WFDH 2VSDA 4LLDA 1T3FB 1VADB 4AIZA 2C4FT 2PN5A 4M61A 1HN1A 2ZCKH 4JB9H 4OLXH 3NCJL 4XNMB 2V9QA 2R23A 2IPTL 2CDEA 5K9OB 4K7PH 4P59L 1S9WA 3B6SA 1OL0A 1N8ZB 2ZJSL 2EE2A 3EAKA 5I76B 4PTUA 1WFUA 2L7UA 4FQJH 1ZHBB 4AG4L 1A47A 3UPRB 1C1EH 2BHZA 2OTPA 3PP4L 4F7PA 3ZKXB 2VXSL 5E8PB 2VZ3A 2Y5EA 4WWKC 4M6MH 3GMMB 4WV1C 2R0ZH 2DDQH 5D5ME 5EUOB 2X4UA 5F7DA 3ULVH 3SCMC 2MHAA 4RGND 4UMGA 5FXCH 3QI9D 1Q9OB 4BH7A 1LDPH 1HI6A 4HW6A 3OF6D 2ADGA 3HG1B 1RZIB 4YHOL 3JWNC 2D31B 2A0LD 2WIIB 1FFRA 4NJ9H 3SKNA 2QSTA 4Z7VA 1KUMA 3OAYH 4DTGL 1YECH 2EC8A 5ACLA 5HHOB 1LE5A 4S1QL 1GVIA 5C7XH 2Q20A 3IB4A 1S9KC 4Z77B 1JZ5A 1MHEB 3C60A 3RHWF 4GMTL 2MKWA 3BKML 3MRKA 3HZKA 4MD4B 3QNYA 1H8SA 4GS7B 4HIXH 2HAZA 4N0YH 1ZVYA 4GRLA 1XCTB 1MCQA 4GFTB 4PJ8A 4NQSB 1KSRA 5FYJL 1JZ6A 2AK4D 5IJVA 1KFAH 4J3WA 2YKLH 5IW6A 1N26A 2B5IB 4R8WH 3LCYA 3TT1H 1FGNH 1S8DA 1ZE3C 3BVNA 3ZE1E 5KANI 4CVXB 4H25A 1DQJB 3RY5A 1YC8A 4NO5B 5D1QD 5MEND 3KLAA 2PR4H 3DLQR 1QOKA 1DQQA 1F3DH 2P5WE 4DN4L 3GSWA 1BWMA 5DHVH 5E8DL 3DVGA 3VGHA 3WIHA 1HH9B 3QHZH 2J2ZA 3VXME 5C07B 3JUYA 3O4LE 3O3UN 1J18A 1UJ3B 3SDYH 3DIFB 5IQ7H 2YUWA 4YNYA 5CP7A 4QRTB 2IAMC 4ZUSA 5KAQG 5ANMA 3VXSA 4PG9A 4IHOB 1G7JB 2IPKA 3CFBA 3WFHB 1WF5A 2WIIA 5JW4Q 4M6AA 5GGRB 3TPKA 4LDOB 2WK2A 4OCRL 1CTNA 1CXEA 4NBXB 2IAND 3QUXB 4MNQD 4U6HB 3NZHH 2C3GA 4QRQB 4Y4HB 2VB5A 5DRNB 4M8QB 3O3DB 4TVPL 1QNZL 5DJYA 1NKRA 4PP2B 2KKQA 2VLME 1Q72L 4WJ5A 4X7DC 2Y6SD 2BOBB 1JPST 3IJHA 1BGXH 1JPTL 1YJDC 4MJ5B 4DFHA 1MJ7H 5AZEH 4XXCA 2IGFH 2WUBH 2A74A 1K4CB 4JANA 4R90H 3BT2L 4P3DB 5C6PB 1FBIH 3ARUA 5HHNA 2CIIB 3L7EA 3B9AA 5HI3C 2EDKA 3DRQB 3MX0A 3KPRD 1FO0A 1KLUB 3RA7L 3VI3E 1XGPA 4YHIA 3RY6C 1H0DB 3PGDB 1G9NL 3WIFA 4U2ZA 3WJJA 1TJIH 7CGTA 4W68A 5DZLA 4O9HH 3FQTB 4RIRB 3HC0A 5ETUB 1YMMA 1QLFA 1UZ8B 1T1XA 4GAGH 1TENA 3BKCH 3QZWB 5TJWK 3C8KA 5T1MA 2ADIA 4UT6L 2J8UB 4J6RH 2B4CC 4GSDH 5DJ0B 3S9DB 4RQQB 4C83B 5GZNC 5J3HD 5DD1H 3VWKD 2EEBA 1HQRB 2ICWJ 4P4KD 1NBQA 1U8HA 1RHFA 3FB8A 3RGVA 3ECBA 2FLBT 4G9FE 3ULSB 2FECL 5KSAB 2W9EL 5IB1A 4HUWB 4GSDL 3BD3A 1IT9L 5DQJA 3OWEA 4X6EA 3B9DA 2RHEA 1G9MC 3HPLA 3HZVB 5DEFA 1F2QA 4GAFB 5EPMB 1P4BH 4V2CB 1CQKA 3T8XA 3CXHJ 4PJ9A 2W9DH 5DVLA 3GI8L 5GGUA 4X4ME 3F7VB 1OCWL 3MYJA 3SKOB 2BJML 2GY7B 5I75C 1RZGA 1DQLH 3FO2B 3FQUB 4PJGF 4GRWE 2HKFH 3KG5A 3NIGE 3SDCA 1R6VA 1WK0A 2MPAL 2BNQD 2UZXB 3O3AB 3AS2A 5FO8A 2BC4A 1FNAA 4JPIA 4P23C 4N5EC 3JVGA 5C92A 1NJ9B 1DBBL 2FX7L 3W5MA 4XXDB 3ETBF 3P11H 4HBCH 5EBMB 3D9AH 1NCUA 3CVHA 4HJJL 1KC5L 4C4KO 5KVFH 2NZ9D 3IJSB 4I48A 1DEEB 1IILE 4MQ7A 5MHSD 1NMBL 2VZ1A 1D5IH 3JZ7A 4JO2H 3GGWA 2L7JA 3ULVC 3OQ3B 3OGOE 3Q6FA 1OB1A 4AEIL 1A3RL 4JM4H 4MCYB 1R5VB 2GKIA 4F15B 3CCHA 2WWMD 1KJMB 1MCFA 3MNZB 4MNGB 3DURA 5C2BL 2GHWB 2OMBA 2HFGL 3UJJH 2DLFH 3KXFE 4M7LT 5HPMB 1FO0B 2B8OT 4CAGA 3RWEA 3RVXC 3FQXA 5J7CC 1HHGB 3MRPA 4FQCL 1C12A 4IOFC 2XG5A 3QUMH 4H20L 4L4TA 3PDOA 5EC1B 1LK2A 3BEVB 1F02I 4U33A 3RIAF 2D0FA 2PXYC 2W1NA 3MV8B 2W0KA 5E5UB 5FYKU 3ZHLA 3EHBD 5ACMA 1MIEH 2UUDK 4M9PA 2XN9D 1N4XH 3GO1L 5IROC 4LASH 1I7TA 4ZUWA 2NMSA 1JIBA 3S97C 5T3XL 4IRSB 3WHE0 3BH9B 4OFIA 1W72L 4CJ1A 2XZQH 4L1DA 4XB7A 4G80B 1DFBH 3CFKB 2OJZH 1HWHB 4XNYH 1I8MA 1YEKL 2A1WL 3FT4A 1UJTA 1T0PB 4XT1C 5DJYB 1JGEB 4UAOC 2F9BT 1A02N 1N2RB 4ZUUB 1EGJL 4NOBA 5CIPH 3HPJA 1OLZA 4ETQA 4J23A 2OTWB 3OBAA 3UBXB 5IFHL 2OJEB 1WBXB 1WGOA 1CFBA 4HIEA 2VZSA 1U41A 3V0VB 3ZT5A 5TDPB 1MCIA 3C09C 4HGWA 3KLDA 4I0KA 4LSQL 3KPMB 4U2YA 5IMMA 5IB5A 3OAZK 2X89A 3CFEA 2FJGA 2FBJL 3TT1L 1B0RA 1MI5B 5BO1L 3C60B 2OQJA 1TQBC 4P5TC 4Y16B 3DMMA 1KXVC 1FNSL 5HI4C 3MBXL 3O0RH 3HE7A 3U2SB 1G7PA 3R8BB 3WIFB 4K23L 3QIUC 2YEZB 1CGXA 1EK3A 4X0KA 3BGFB 4X9BA 2A77H 3KPRA 4KRPB 5HYSG 4XI5C 4PJAB 5E9DE 2D7TL 1QFWI 3GSVA 1RZ7H 5DVNA 2V7HB 5BVPH 2NY3D 4KGJA 3PP4H 4NQCE 5DD5H 3JWOL 4AZ8A 1ZLSH 3HRZB 1EEQA 5KAQF 4JO4L 5F9JA 4P5TB 4Y16C 4UTBL 5E2TH 5KVEL 4HWUA 1HWGB 3O6MH 4X7EC 3GM8A 1IC7H 4OLEA 4U1NB 1ZHNA 3ILQC 4MZ2A 3T0ED 4Z5RA 1F6LL 2JJTC 1KG0A 1MI5E 3PGCB 4ODXA 4S10A 4I13B 3NCJH 5I8EB 5F44A 1K2DB 2P7TB 3BIBX 4KRNA 4YDIH 3A6CL 2EXWD 4HMDA 4XP6L 3C8HA 4GH7B 4GQPH 4HGWB 1Q1JL 3NAAL 4PY7B 1R3LB 1T83C 3NN8B 4OZGF 1SJXA 5DMYA 1OWWA 3MXVL 3EUUA 4H8WL 4WEBL 2HLFC 3BW9B 5CMAB 1L7TL 1R3HA 4XBGA 1QSFD 1FNGA 3RWCB 3BDYL 3DMMB 5IG7A 4AT6B 1GC1C 2AJSL 3CIQA 5CWSB 2C1PA 5FOBB 2X4UB 3IFOB 4JLRA 4OLUL 3NFPA 5C08D 1X5KA 1J0JA 3MCG1 2UWEF 2XNAA 1CI5A 3KPLB 3QQ9D 5T3ZL 4YWGL 1P4LA 4EEEA 3VGFA 3CJJA 4M6OH 1T5WA 3SCMA 1OM3H 2X4TB 1KB5H 2W59A 3EJYC 3R1GH 3VD3A 2R1XB 1DBMH 3KHOA 3WE6B 1N64H 1ZTXH 3MROA 5BV7H 2O93L 5IESH 1AP2B 2EIZB 4L8BB 5H94B 4X8JB 4N90D 1IGJA 4H5SB 3LY6A 4M1DH 4OCXH 4QTHA 1YNLL 4J3TA 3F5WB 3OKYA 1PZUB 2DQIL 1NGYB 5DHYB 4Y5XC 3HE7B 2JB6A 2N4IA 4ZSOE 4YPJA 2RB8A 4HH9B 4KXZH 2VLJE 2AJXL 3QDJD 4X9IA 3U0PB 4BZ1H 1IKNA 5AG8A 4LKXB 4PY8I 1VB9A 1RZFH 3WBDA 3MV9D 3HKFA 3JWOH 5CD3B 4YGAB 3NPSB 4AMKH 4ETYA 1H3VA 1D9KD 4M7KL 1JE6A 1DQJA 4UNVA 4XAWL 3EZJB 2C7UA 4AQ1B 5JMRA 1EA9C 5F7MC 1ZA3B 4XP9H 4UQ2A 1VKXA 4GW1B 4R97C 5FA3B 3MLXL 3QDGA 3BISA 2A77L 5BRZA 5JW4N 3VFUA 3GJFA 3ZT6A 3MV9A 1FN4A 5FCUH 1W8OA 4PJEB 1R24B 1FH5L 1BWWA 5DVKA 3JTTA 4P2QD 2WW8A 5D9SB 5JIKA 2X4OA 2VDOL 4GXUM 3RWIB 4BSVB 2BXZA 2H9GA 5ESAB 4NP4L 3TYFA 2J5LB 4N8CL 4NO3B 3KPMA 3DUHA 5HJ3A 3E6FB 4PV9B 1SMAA 1PBYA 4PJBE 4JM2B 3DX9B 5IFHH 3H3PH 4OM0L 1HQ4B 4M4PA 2Q6WB 4WUKL 1RUQH 1ED3B 1I7UA 2W07A 4TSBL 4F7CB 3EYVA 4XRCA 1VGEL 3GMNB 4JZJC 1KNOB 5FUCE 1CU4L 4JFFE 4WFED 5T3XD 4DKDC 4BUHA 2FH6A 3W11D 1KPVB 3C5ZB 4NWUH 1WEJL 4S11A 2F19L 3VJ6A 2XZQL 4U1IA 3BHBA 1H3PH 1UM6L 5D1QA 3UTSB 3IFPB 2HVJB 4NRYA 5E1AB 1EEYB 1P5VA 4UNUA 3FCTA 4PS4L 2ILLA 4N0UE 4DQOL 1MRFL 5I8OL 1AGDA 2BFVH 4RGMC 2PUQT 5HDLA 1FNHA 3RY4A 4IMLA 2AK4A 1U3JA 4JRYD 1NAMA 3RGVB 2BVTA 3NCCB 1IKFL 3SO5A 4OGAD 1G7MB 4Y19B 3U46B 4GG6F 4K3GA 3V5KA 1MHCB 2LU7A 3CVHH 3HAEA 4KDWA 2XQYG 3H6JA 4KK6D 4Y5VA 5SX4I 1T20B 5HDQL 1NGYA 1L7TH 3VDCA 2CXGA 1OTSD 2J8UA 1BM3H 1IKNC 3MXVH 1YUHA 3TV3L 3V5DB 3FJTA 3T2QA 4G6KL 2JJSA 1I1FA 3OKEA 1GPOL 1DQMH 1A1OB 3W9EB 4JGJA 2VQ1A 5A43C 1T0MB 3L5IA 2AKRA 2CLRB 1K9TA 3CX5K 4NN7C 4NSKA 1EVTC 4G43A 1JNNH 3HFMH 5CILL 1UC6A 5HYJA 4RWYL 3IDGA 3O3AA 2PYEE 2D9CA 3SDCB 1AGFA 4N1EA 5DA0B 1GZPA 5C0RH 4JG0L 3VU2A 4PRAA 4S1RL 1TTGA 4L4VD 4WU7A 2PF6A 3SGEH 2I27N 4L5FH 4H0IA 2PETA