3F13A

Crystal structure of putative nudix hydrolase family member from chromobacterium violaceum
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
146
structure length
142
Chain Sequence
b'RLPSDLARRATAIIEMPDGVLVTASRYNLPGGKANRGELRSQALIREIREETGLRINSMLYLFDHITPFNAHKVYLCIAGQPKPQNEIERIALVSSPDTDMDLFVEGRAILRRYARLRNEETAKGEALRALLGLARYIAKVD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative nudix hydrolase family member
publication title Crystal structure of putative nudix hydrolase family member from Chromobacterium violaceum
rcsb
source organism Chromobacterium violaceum
molecule tags Hydrolase
total genus 43
structure length 142
sequence length 146
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00293 NUDIX NUDIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.79.10 Alpha Beta Alpha-Beta Complex Nucleoside Triphosphate Pyrophosphohydrolase Nucleoside Triphosphate Pyrophosphohydrolase 3f13A00
5FSOA 1PPWA 1KHZA 5ANVA 3EXQA 1OW2A 4KG3A 3RH7A 1IRYA 3I9XA 5DD4A 3X0PA 4ICKA 1NQYA 1V8RA 3HYQA 3MDGA 3X0SA 3FJYA 3MGMA 1PPXA 2YVMA 1V8LA 3X0QA 3X0JA 3J7Ye 5C7QA 2GB5A 2R5WA 2A8SA 2KDWA 5IW4A 3EF5A 3KVHA 1SJYA 3DUPA 4YPHA 3GZ5A 3F13A 1V8WA 1XSAA 2GT4A 3MDIA 3EEUA 5IW5A 2J8QA 4IJXA 1V8SA 5FSIA 2ICJA 5GHOA 3O6ZA 3FSPA 1K2EA 2PQVA 5GHIA 3GRNA 1NQZA 1MR2A 2XSQA 3X0RA 4ZG0A 3SONA 4JZVA 5C7TA 2QKMB 5GHQA 3X0IA 1U20A 4MPOA 2A6TA 3P5TA 1V8YA 4ILQA 1V8TA 2B2KA 5ANTA 3X0NA 5LPGA 1JKNA 3COUA 1JRKA 1PUNA 3AC9A 2O5FA 3X0MA 1VHGA 5ISYA 1RRQA 5DDGA 1VIQA 3X0KA 3A6SA 2DHOA 4C9WA 5HZXA 3QSJA 3O69A 2GT2A 1R67A 2G73A 3GZ8A 5CFJA 4YPRA 3Q2SA 1KT9A 3DKUA 4JZUA 1I9AA 3BHOA 2YVOA 4C9XA 5BS6A 3P6YA 1G0SA 3F6AA 2JVBA 5GHPA 3FCMA 2G74A 4S2VA 1SOIA 2A8RA 3N77A 3ZR0A 3E57A 3MCFA 1VK6A 1NFZA 1QVJA 1V8UA 2W4EA 3A6VA 3Q1PA 1MK1A 3BM4A 1RYAA 5GHJA 3SHDA 3H95A 4K6EA 2FVVA 1SU2A 2A8PA 2A8TA 3Q91A 1V8MA 3ACAA 3X0LA 1MP2A 1VCDA 2B0VA 2YVNA 3FFUA 2I8UA 1PUSA 3HHJA 2ICKA 4JZSA 1X51A 3R03A 3N9UA 5I8UA 1VRLA 5ANSA 3GWYA 3Q93A 1GA7A 1MQEA 4NFXA 4KYXA 2RRKA 1V8NA 5FSLA 1Q33A 1SZ3A 1V8VA 5GHMA 3Q2TA 3Q4IA 3O61A 4S2YA 5GHNA 3A6TA 1XSCA 3O8SA 2O1CA 4DYWA 4JZTA 4N1TA 5FSKA 3BAPA 2CL3A 1Q27A 2DSCA 2O5WA 3CNGA 3L85A 2DSDA 3O52A 2I8TA 3GG6A 4HFQA 1NFSA 1TUMA 4S2WA 1PVFA 2Q9PA 1MUTA 2YVPA 5C8LA 1PUQA 1X84A 2FKBA 1VIUA 1VHZA 1VC9A 1VC8A 2DSBA 2VNQA 2DUKA 3A6UA 1Q54A 1RRSA 3G0QA 3U53A 1F3YA 1HX3A 1HZTA 3ZR1A 3I7UA 4N1UA 2AZWA 4YOQA 4NFWA 3X0OA 1KTGA 3SMDA 3FK9A 4HVYA 1PPVA 2YYHA 2QJTA 3I7VA 4S2XA 5DEQA 3EESA 4KG4A 2QJOA 5FSMA 5DPKA 1G9QA 2A8QA 5ANUA 5ANWA 2B06A 1V8IA 1K26A 2FMLA 2I6KA 2VNPA 5BONA 3GZ6A 3WHWA 5CFIA 4KTBA 1MQWA 1X83A 2KDVA 1XSBA 3OGAA 2PNYA 5FSNA 4V14A 3ID9A
chains in the Genus database with same CATH superfamily
5FSOA 1PPWA 1KHZA 5ANVA 3EXQA 1OW2A 4KG3A 3RH7A 1IRYA 3I9XA 5DD4A 3X0PA 4ICKA 1NQYA 1V8RA 3HYQA 3MDGA 3X0SA 3FJYA 3MGMA 1PPXA 2YVMA 1V8LA 3X0QA 3X0JA 4J7HA 3J7Ye 5C7QA 2GB5A 2R5WA 2A8SA 2KDWA 5IW4A 3EF5A 3KVHA 1SJYA 3DUPA 4YPHA 3GZ5A 3F13A 1V8WA 1XSAA 2GT4A 3MDIA 3EEUA 5IW5A 2J8QA 4IJXA 1V8SA 5FSIA 2ICJA 5GHOA 3O6ZA 3FSPA 2CZRA 1K2EA 2PQVA 5GHIA 3GRNA 1NQZA 1MR2A 2XSQA 3X0RA 4ZG0A 3SONA 4JZVA 5C7TA 2QKMB 5GHQA 3X0IA 1U20A 4MPOA 2A6TA 3P5TA 1V8YA 4ILQA 1V8TA 2B2KA 5ANTA 3X0NA 5LPGA 1JKNA 3COUA 1JRKA 1PUNA 3AC9A 2O5FA 3X0MA 1VHGA 5ISYA 1RRQA 5DDGA 1VIQA 3X0KA 3A6SA 2DHOA 4C9WA 5HZXA 3QSJA 3O69A 2GT2A 1R67A 2G73A 3GZ8A 5CFJA 4YPRA 3Q2SA 1KT9A 3DKUA 4JZUA 1I9AA 3BHOA 2YVOA 4C9XA 5BS6A 3P6YA 1G0SA 3F6AA 2JVBA 5GHPA 3FCMA 2G74A 4S2VA 1SOIA 2A8RA 3N77A 3ZR0A 3E57A 3MCFA 1VK6A 1NFZA 1QVJA 1V8UA 2W4EA 3A6VA 3Q1PA 1MK1A 3BM4A 1RYAA 5GHJA 3SHDA 3H95A 4K6EA 2FVVA 1SU2A 2A8PA 2A8TA 3Q91A 1V8MA 3ACAA 3X0LA 1MP2A 1VCDA 2B0VA 2YVNA 3FFUA 2I8UA 1PUSA 3HHJA 2ICKA 4JZSA 1X51A 3R03A 3N9UA 5I8UA 1VRLA 5ANSA 3GWYA 3Q93A 1GA7A 1MQEA 4NFXA 4KYXA 2RRKA 1V8NA 5FSLA 1Q33A 1SZ3A 1V8VA 5GHMA 3Q2TA 3Q4IA 3O61A 4S2YA 5GHNA 3A6TA 1XSCA 3O8SA 2O1CA 4DYWA 4JZTA 4N1TA 5FSKA 3BAPA 2CL3A 1Q27A 2DSCA 2O5WA 3CNGA 3L85A 2DSDA 3O52A 2I8TA 3GG6A 4HFQA 1NFSA 1TUMA 4S2WA 1PVFA 2Q9PA 1MUTA 2YVPA 5C8LA 1PUQA 1X84A 2FKBA 1VIUA 1VHZA 1VC9A 1VC8A 2DSBA 2VNQA 2DUKA 3A6UA 1Q54A 1RRSA 3G0QA 3U53A 1F3YA 1HX3A 1HZTA 3ZR1A 3I7UA 4N1UA 2AZWA 4YOQA 4J7GA 4NFWA 3X0OA 1KTGA 3SMDA 3FK9A 4HVYA 1PPVA 2YYHA 2QJTA 3I7VA 4S2XA 5DEQA 3EESA 4KG4A 2QJOA 5FSMA 5DPKA 1G9QA 2A8QA 5ANUA 5ANWA 2B06A 1V8IA 1K26A 2FMLA 2I6KA 2VNPA 5BONA 3GZ6A 3WHWA 5CFIA 4KTBA 1MQWA 1X83A 2KDVA 1XSBA 3OGAA 2PNYA 5FSNA 4V14A 3ID9A
chains in the Genus database with same CATH topology
5FSOA 1PPWA 1KHZA 5ANVA 3EXQA 1OW2A 4KG3A 3RH7A 1IRYA 3I9XA 5DD4A 3X0PA 4ICKA 1NQYA 1V8RA 3HYQA 3MDGA 3X0SA 3FJYA 3MGMA 1PPXA 2YVMA 1V8LA 3X0QA 3X0JA 4J7HA 3J7Ye 5C7QA 2GB5A 2R5WA 2A8SA 2KDWA 5IW4A 3EF5A 3KVHA 1SJYA 3DUPA 4YPHA 3GZ5A 3F13A 1V8WA 1XSAA 2GT4A 3MDIA 3EEUA 5IW5A 2J8QA 4IJXA 1V8SA 5FSIA 2ICJA 5GHOA 3O6ZA 3FSPA 2CZRA 1K2EA 2PQVA 5GHIA 3GRNA 1NQZA 1MR2A 2XSQA 3X0RA 4ZG0A 3SONA 4JZVA 5C7TA 2QKMB 5GHQA 3X0IA 1U20A 4MPOA 2A6TA 3P5TA 1V8YA 4ILQA 1V8TA 2B2KA 5ANTA 3X0NA 5LPGA 1JKNA 3COUA 1JRKA 1PUNA 3AC9A 2O5FA 3X0MA 1VHGA 5ISYA 1RRQA 5DDGA 1VIQA 3X0KA 3A6SA 2DHOA 4C9WA 5HZXA 3QSJA 3O69A 2GT2A 1R67A 2G73A 3GZ8A 5CFJA 4YPRA 3Q2SA 1KT9A 3DKUA 4JZUA 1I9AA 3BHOA 2YVOA 4C9XA 5BS6A 3P6YA 1G0SA 3F6AA 2JVBA 5GHPA 3FCMA 2G74A 4S2VA 1SOIA 2A8RA 3N77A 3ZR0A 3E57A 3MCFA 1VK6A 1NFZA 1QVJA 1V8UA 2W4EA 3A6VA 3Q1PA 1MK1A 3BM4A 1RYAA 5GHJA 3SHDA 3H95A 4K6EA 2FVVA 1SU2A 2A8PA 2A8TA 3Q91A 1V8MA 3ACAA 3X0LA 1MP2A 1VCDA 2B0VA 2YVNA 3FFUA 2I8UA 1PUSA 3HHJA 2ICKA 4JZSA 1X51A 3R03A 3N9UA 5I8UA 1VRLA 5ANSA 3GWYA 3Q93A 1GA7A 1MQEA 4NFXA 4KYXA 2RRKA 1V8NA 5FSLA 1Q33A 1SZ3A 1V8VA 5GHMA 3Q2TA 3Q4IA 3O61A 4S2YA 5GHNA 3A6TA 1XSCA 3O8SA 2O1CA 4DYWA 4JZTA 4N1TA 5FSKA 3BAPA 2CL3A 1Q27A 2DSCA 2O5WA 3CNGA 3L85A 2DSDA 3O52A 2I8TA 3GG6A 4HFQA 1NFSA 1TUMA 4S2WA 1PVFA 2Q9PA 1MUTA 2YVPA 5C8LA 1PUQA 1X84A 2FKBA 1VIUA 1VHZA 1VC9A 1VC8A 2DSBA 2VNQA 2DUKA 3A6UA 1Q54A 1RRSA 3G0QA 3U53A 1F3YA 1HX3A 1HZTA 3ZR1A 3I7UA 4N1UA 2AZWA 4YOQA 4J7GA 4NFWA 3X0OA 1KTGA 3SMDA 3FK9A 4HVYA 1PPVA 2YYHA 2QJTA 3I7VA 4S2XA 5DEQA 3EESA 4KG4A 2QJOA 5FSMA 5DPKA 1G9QA 2A8QA 5ANUA 5ANWA 2B06A 1V8IA 1K26A 2FMLA 2I6KA 2VNPA 5BONA 3GZ6A 3WHWA 5CFIA 4KTBA 1MQWA 1X83A 2KDVA 1XSBA 3OGAA 2PNYA 5FSNA 4V14A 3ID9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FSO A;  1PPW A;  1KHZ A;  5ANV A;  3EXQ A;  1OW2 A;  4KG3 A;  3RH7 A;  1IRY A;  3I9X A;  5DD4 A;  3X0P A;  4ICK A;  1NQY A;  1V8R A;  3HYQ A;  3MDG A;  3X0S A;  3FJY A;  3MGM A;  1PPX A;  2YVM A;  1V8L A;  3X0Q A;  3X0J A;  3J7Y e;  5C7Q A;  2GB5 A;  2R5W A;  2A8S A;  2KDW A;  5IW4 A;  3EF5 A;  3KVH A;  1SJY A;  3DUP A;  4YPH A;  3GZ5 A;  3F13 A;  1V8W A;  1XSA A;  2GT4 A;  3MDI A;  3EEU A;  5IW5 A;  2J8Q A;  4IJX A;  1V8S A;  5FSI A;  2ICJ A;  5GHO A;  3O6Z A;  3FSP A;  1K2E A;  2PQV A;  5GHI A;  3GRN A;  1NQZ A;  1MR2 A;  2XSQ A;  3X0R A;  4ZG0 A;  3SON A;  4JZV A;  5C7T A;  2QKM B;  5GHQ A;  3X0I A;  1U20 A;  4MPO A;  2A6T A;  3P5T A;  1V8Y A;  4ILQ A;  1V8T A;  2B2K A;  5ANT A;  3X0N A;  5LPG A;  1JKN A;  3COU A;  1JRK A;  1PUN A;  3AC9 A;  2O5F A;  3X0M A;  1VHG A;  5ISY A;  1RRQ A;  5DDG A;  1VIQ A;  3X0K A;  3A6S A;  2DHO A;  4C9W A;  5HZX A;  3QSJ A;  3O69 A;  2GT2 A;  1R67 A;  2G73 A;  3GZ8 A;  5CFJ A;  4YPR A;  3Q2S A;  1KT9 A;  3DKU A;  4JZU A;  1I9A A;  3BHO A;  2YVO A;  4C9X A;  5BS6 A;  3P6Y A;  1G0S A;  3F6A A;  2JVB A;  5GHP A;  3FCM A;  2G74 A;  4S2V A;  1SOI A;  2A8R A;  3N77 A;  3ZR0 A;  3E57 A;  3MCF A;  1VK6 A;  1NFZ A;  1QVJ A;  1V8U A;  2W4E A;  3A6V A;  3Q1P A;  1MK1 A;  3BM4 A;  1RYA A;  5GHJ A;  3SHD A;  3H95 A;  4K6E A;  2FVV A;  1SU2 A;  2A8P A;  2A8T A;  3Q91 A;  1V8M A;  3ACA A;  3X0L A;  1MP2 A;  1VCD A;  2B0V A;  2YVN A;  3FFU A;  2I8U A;  1PUS A;  3HHJ A;  2ICK A;  4JZS A;  1X51 A;  3R03 A;  3N9U A;  5I8U A;  1VRL A;  5ANS A;  3GWY A;  3Q93 A;  1GA7 A;  1MQE A;  4NFX A;  4KYX A;  2RRK A;  1V8N A;  5FSL A;  1Q33 A;  1SZ3 A;  1V8V A;  5GHM A;  3Q2T A;  3Q4I A;  3O61 A;  4S2Y A;  5GHN A;  3A6T A;  1XSC A;  3O8S A;  2O1C A;  4DYW A;  4JZT A;  4N1T A;  5FSK A;  3BAP A;  2CL3 A;  1Q27 A;  2DSC A;  2O5W A;  3CNG A;  3L85 A;  2DSD A;  3O52 A;  2I8T A;  3GG6 A;  4HFQ A;  1NFS A;  1TUM A;  4S2W A;  1PVF A;  2Q9P A;  1MUT A;  2YVP A;  5C8L A;  1PUQ A;  1X84 A;  2FKB A;  1VIU A;  1VHZ A;  1VC9 A;  1VC8 A;  2DSB A;  2VNQ A;  2DUK A;  3A6U A;  1Q54 A;  1RRS A;  3G0Q A;  3U53 A;  1F3Y A;  1HX3 A;  1HZT A;  3ZR1 A;  3I7U A;  4N1U A;  2AZW A;  4YOQ A;  4NFW A;  3X0O A;  1KTG A;  3SMD A;  3FK9 A;  4HVY A;  1PPV A;  2YYH A;  2QJT A;  3I7V A;  4S2X A;  5DEQ A;  3EES A;  4KG4 A;  2QJO A;  5FSM A;  5DPK A;  1G9Q A;  2A8Q A;  5ANU A;  5ANW A;  2B06 A;  1V8I A;  1K26 A;  2FML A;  2I6K A;  2VNP A;  5BON A;  3GZ6 A;  3WHW A;  5CFI A;  4KTB A;  1MQW A;  1X83 A;  2KDV A;  1XSB A;  3OGA A;  2PNY A;  5FSN A;  4V14 A;  3ID9 A; 
#chains in the Genus database with same CATH topology
 5FSO A;  1PPW A;  1KHZ A;  5ANV A;  3EXQ A;  1OW2 A;  4KG3 A;  3RH7 A;  1IRY A;  3I9X A;  5DD4 A;  3X0P A;  4ICK A;  1NQY A;  1V8R A;  3HYQ A;  3MDG A;  3X0S A;  3FJY A;  3MGM A;  1PPX A;  2YVM A;  1V8L A;  3X0Q A;  3X0J A;  4J7H A;  3J7Y e;  5C7Q A;  2GB5 A;  2R5W A;  2A8S A;  2KDW A;  5IW4 A;  3EF5 A;  3KVH A;  1SJY A;  3DUP A;  4YPH A;  3GZ5 A;  3F13 A;  1V8W A;  1XSA A;  2GT4 A;  3MDI A;  3EEU A;  5IW5 A;  2J8Q A;  4IJX A;  1V8S A;  5FSI A;  2ICJ A;  5GHO A;  3O6Z A;  3FSP A;  2CZR A;  1K2E A;  2PQV A;  5GHI A;  3GRN A;  1NQZ A;  1MR2 A;  2XSQ A;  3X0R A;  4ZG0 A;  3SON A;  4JZV A;  5C7T A;  2QKM B;  5GHQ A;  3X0I A;  1U20 A;  4MPO A;  2A6T A;  3P5T A;  1V8Y A;  4ILQ A;  1V8T A;  2B2K A;  5ANT A;  3X0N A;  5LPG A;  1JKN A;  3COU A;  1JRK A;  1PUN A;  3AC9 A;  2O5F A;  3X0M A;  1VHG A;  5ISY A;  1RRQ A;  5DDG A;  1VIQ A;  3X0K A;  3A6S A;  2DHO A;  4C9W A;  5HZX A;  3QSJ A;  3O69 A;  2GT2 A;  1R67 A;  2G73 A;  3GZ8 A;  5CFJ A;  4YPR A;  3Q2S A;  1KT9 A;  3DKU A;  4JZU A;  1I9A A;  3BHO A;  2YVO A;  4C9X A;  5BS6 A;  3P6Y A;  1G0S A;  3F6A A;  2JVB A;  5GHP A;  3FCM A;  2G74 A;  4S2V A;  1SOI A;  2A8R A;  3N77 A;  3ZR0 A;  3E57 A;  3MCF A;  1VK6 A;  1NFZ A;  1QVJ A;  1V8U A;  2W4E A;  3A6V A;  3Q1P A;  1MK1 A;  3BM4 A;  1RYA A;  5GHJ A;  3SHD A;  3H95 A;  4K6E A;  2FVV A;  1SU2 A;  2A8P A;  2A8T A;  3Q91 A;  1V8M A;  3ACA A;  3X0L A;  1MP2 A;  1VCD A;  2B0V A;  2YVN A;  3FFU A;  2I8U A;  1PUS A;  3HHJ A;  2ICK A;  4JZS A;  1X51 A;  3R03 A;  3N9U A;  5I8U A;  1VRL A;  5ANS A;  3GWY A;  3Q93 A;  1GA7 A;  1MQE A;  4NFX A;  4KYX A;  2RRK A;  1V8N A;  5FSL A;  1Q33 A;  1SZ3 A;  1V8V A;  5GHM A;  3Q2T A;  3Q4I A;  3O61 A;  4S2Y A;  5GHN A;  3A6T A;  1XSC A;  3O8S A;  2O1C A;  4DYW A;  4JZT A;  4N1T A;  5FSK A;  3BAP A;  2CL3 A;  1Q27 A;  2DSC A;  2O5W A;  3CNG A;  3L85 A;  2DSD A;  3O52 A;  2I8T A;  3GG6 A;  4HFQ A;  1NFS A;  1TUM A;  4S2W A;  1PVF A;  2Q9P A;  1MUT A;  2YVP A;  5C8L A;  1PUQ A;  1X84 A;  2FKB A;  1VIU A;  1VHZ A;  1VC9 A;  1VC8 A;  2DSB A;  2VNQ A;  2DUK A;  3A6U A;  1Q54 A;  1RRS A;  3G0Q A;  3U53 A;  1F3Y A;  1HX3 A;  1HZT A;  3ZR1 A;  3I7U A;  4N1U A;  2AZW A;  4YOQ A;  4J7G A;  4NFW A;  3X0O A;  1KTG A;  3SMD A;  3FK9 A;  4HVY A;  1PPV A;  2YYH A;  2QJT A;  3I7V A;  4S2X A;  5DEQ A;  3EES A;  4KG4 A;  2QJO A;  5FSM A;  5DPK A;  1G9Q A;  2A8Q A;  5ANU A;  5ANW A;  2B06 A;  1V8I A;  1K26 A;  2FML A;  2I6K A;  2VNP A;  5BON A;  3GZ6 A;  3WHW A;  5CFI A;  4KTB A;  1MQW A;  1X83 A;  2KDV A;  1XSB A;  3OGA A;  2PNY A;  5FSN A;  4V14 A;  3ID9 A; 
#chains in the Genus database with same CATH homology
 5FSO A;  1PPW A;  1KHZ A;  5ANV A;  3EXQ A;  1OW2 A;  4KG3 A;  3RH7 A;  1IRY A;  3I9X A;  5DD4 A;  3X0P A;  4ICK A;  1NQY A;  1V8R A;  3HYQ A;  3MDG A;  3X0S A;  3FJY A;  3MGM A;  1PPX A;  2YVM A;  1V8L A;  3X0Q A;  3X0J A;  4J7H A;  3J7Y e;  5C7Q A;  2GB5 A;  2R5W A;  2A8S A;  2KDW A;  5IW4 A;  3EF5 A;  3KVH A;  1SJY A;  3DUP A;  4YPH A;  3GZ5 A;  3F13 A;  1V8W A;  1XSA A;  2GT4 A;  3MDI A;  3EEU A;  5IW5 A;  2J8Q A;  4IJX A;  1V8S A;  5FSI A;  2ICJ A;  5GHO A;  3O6Z A;  3FSP A;  2CZR A;  1K2E A;  2PQV A;  5GHI A;  3GRN A;  1NQZ A;  1MR2 A;  2XSQ A;  3X0R A;  4ZG0 A;  3SON A;  4JZV A;  5C7T A;  2QKM B;  5GHQ A;  3X0I A;  1U20 A;  4MPO A;  2A6T A;  3P5T A;  1V8Y A;  4ILQ A;  1V8T A;  2B2K A;  5ANT A;  3X0N A;  5LPG A;  1JKN A;  3COU A;  1JRK A;  1PUN A;  3AC9 A;  2O5F A;  3X0M A;  1VHG A;  5ISY A;  1RRQ A;  5DDG A;  1VIQ A;  3X0K A;  3A6S A;  2DHO A;  4C9W A;  5HZX A;  3QSJ A;  3O69 A;  2GT2 A;  1R67 A;  2G73 A;  3GZ8 A;  5CFJ A;  4YPR A;  3Q2S A;  1KT9 A;  3DKU A;  4JZU A;  1I9A A;  3BHO A;  2YVO A;  4C9X A;  5BS6 A;  3P6Y A;  1G0S A;  3F6A A;  2JVB A;  5GHP A;  3FCM A;  2G74 A;  4S2V A;  1SOI A;  2A8R A;  3N77 A;  3ZR0 A;  3E57 A;  3MCF A;  1VK6 A;  1NFZ A;  1QVJ A;  1V8U A;  2W4E A;  3A6V A;  3Q1P A;  1MK1 A;  3BM4 A;  1RYA A;  5GHJ A;  3SHD A;  3H95 A;  4K6E A;  2FVV A;  1SU2 A;  2A8P A;  2A8T A;  3Q91 A;  1V8M A;  3ACA A;  3X0L A;  1MP2 A;  1VCD A;  2B0V A;  2YVN A;  3FFU A;  2I8U A;  1PUS A;  3HHJ A;  2ICK A;  4JZS A;  1X51 A;  3R03 A;  3N9U A;  5I8U A;  1VRL A;  5ANS A;  3GWY A;  3Q93 A;  1GA7 A;  1MQE A;  4NFX A;  4KYX A;  2RRK A;  1V8N A;  5FSL A;  1Q33 A;  1SZ3 A;  1V8V A;  5GHM A;  3Q2T A;  3Q4I A;  3O61 A;  4S2Y A;  5GHN A;  3A6T A;  1XSC A;  3O8S A;  2O1C A;  4DYW A;  4JZT A;  4N1T A;  5FSK A;  3BAP A;  2CL3 A;  1Q27 A;  2DSC A;  2O5W A;  3CNG A;  3L85 A;  2DSD A;  3O52 A;  2I8T A;  3GG6 A;  4HFQ A;  1NFS A;  1TUM A;  4S2W A;  1PVF A;  2Q9P A;  1MUT A;  2YVP A;  5C8L A;  1PUQ A;  1X84 A;  2FKB A;  1VIU A;  1VHZ A;  1VC9 A;  1VC8 A;  2DSB A;  2VNQ A;  2DUK A;  3A6U A;  1Q54 A;  1RRS A;  3G0Q A;  3U53 A;  1F3Y A;  1HX3 A;  1HZT A;  3ZR1 A;  3I7U A;  4N1U A;  2AZW A;  4YOQ A;  4J7G A;  4NFW A;  3X0O A;  1KTG A;  3SMD A;  3FK9 A;  4HVY A;  1PPV A;  2YYH A;  2QJT A;  3I7V A;  4S2X A;  5DEQ A;  3EES A;  4KG4 A;  2QJO A;  5FSM A;  5DPK A;  1G9Q A;  2A8Q A;  5ANU A;  5ANW A;  2B06 A;  1V8I A;  1K26 A;  2FML A;  2I6K A;  2VNP A;  5BON A;  3GZ6 A;  3WHW A;  5CFI A;  4KTB A;  1MQW A;  1X83 A;  2KDV A;  1XSB A;  3OGA A;  2PNY A;  5FSN A;  4V14 A;  3ID9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...