3F15A

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor (s)-n-(2,3-dihydroxypropyl)-4-methoxy-n-(2-nitroso-2-oxoethyl)benzenesulfonamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Exploring the subtleties of drug-receptor interactions: the case of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3f15A00
3KHIA 3LK8A 5BPAA 1ROSA 3V96B 5CXAA 1D8FA 1XFYA 3G5CA 1CXVA 4PKUA 5B5OA 2MLRA 3G42A 1UTTA 1A85A 1CGLA 1BKCE 1S4BP 3N2VA 3TS4A 1GO7P 1D5JA 3B2ZA 5L7FA 3AIGA 1GE7A 2JIHA 4PKSA 2JT6A 3LE9A 5JMYA 4GUYA 2CLTA 1SRPA 2FV9A 1KUGA 1RM8A 4DPEA 2OY4A 1CAQA 2WOAA 1QIAA 3LEAA 4ON1A 1OM6A 4WF6A 2XS3A 3SHIA 1CK7A 1G4KA 1BKCI 4H3XA 3ZUKA 4A3WA 2DW2A 4WK7A 5I43A 5D3CA 1XFXA 4L6TA 5H8XA 3F17A 1SLNA 3E8RA 4XM8A 4FXYP 3TSKA 2X3CA 4GF1A 1JH1A 1GO8P 3B8ZA 3KMEA 1QIBA 1FLSA 5LABA 2Y6CA 3ELMA 1JAOA 3HB2P 5D1SA 1YP1A 3I7GA 2PJTA 3KEJA 1KUHA 3UVCA 1XFWA 2W13A 1BUVM 1XUDA 2CKIA 1UMTA 3DNGA 1QICA 2OXZA 4A7BA 3F16A 3U1RA 4HX3A 2POJA 3USNA 3KMCA 1UTZA 4XBHA 3VTGA 5CUHA 1BUDA 3WV2A 4DF9A 1KUIA 3TT4A 1IAEA 2QPJA 1WNIA 4GR0A 5BOTA 1SATA 2W14A 2MZEA 4L63A 3N2UA 1G49A 4FVLA 1QUAA 1ZVXA 2XS4A 3LILA 4JQGA 1JJ9A 2AIGP 1GE5A 1YOUA 1HFCA 3OHLA 4DD8A 1PWUA 5D2BA 1BIWA 2X7MA 1IACA 1FBLA 2OXWA 1JIWP 2MZIA 4WZVA 1ZTQA 2RJPA 1Q3AA 4AYKA 1XURA 1CGEA 2WO8A 4JP4A 1KUKA 1JANA 3OHOA 5D1UA 1EAKA 2HU6A 3HY9A 4AXQA 3HY7A 2K9CA 3EDZA 2Z2DA 4GQLA 3LKAA 3DWBA 4WKIA 1OS2A 2D1OA 5I12A 3LQBA 1ZS0A 2O3EA 1QJIA 1IADA 1SMPA 4G9LA 1OO9A 3LIKA 4H30A 3DSLA 4H84A 4CTHA 1IABA 2Y6DA 5D7WA 4JIJA 2AYKA 2O36A 1R1JA 1OMJA 3F1AA 1AKLA 1BQQM 4GWNA 1QJJA 1L6JA 2DDFA 1ND1A 2OVXA 4H82A 1JAPA 1CQRA 1GXDA 2X3AA 3BA0A 2DW1A 4PKRA 3VI1A 3LGPA 3LUMA 1ZP5A 3DPEA 2OW2A 1MMRA 3GBOA 1I1IP 3LJGA 4H49A 1D7XA 3LIRA 1K7QA 1IAGA 4PKQA 3TVCA 4XM6A 3ZXHA 2J83A 3L0VA 4HMAA 2X3BA 4H2EA 3LMCA 4I35A 1G12A 1MMBA 1R1HA 1BKCA 1PWWA 1JIZA 3F18A 2W15A 3EDHA 3Q2GA 2V4BA 2WO9A 4QKZA 5D1TA 5I4OA 4AIGA 4JPAA 3WV1A 1B8YA 4ILWD 3I7IA 2JSDA 1PWPA 1PWQA 3KEKA 3EHYA 1I76A 456CA 1XFZA 3KECA 1SU3A 4GWMA 1SLMA 1A86A 4ZR5A 2D1NA 1R55A 4PKTA 4JA1A 4Q1LA 3RTTA 2YIGA 3AYKA 4XM7A 1HV5A 1JKYA 1USNA 3F15A 3KRYA 1BZSA 3WV3A 4EFSA 3P1VA 3RTSA 1HTDA 4I03A 3ZVSA 3HDBA 5B5PA 3F19A 966CA 2E2DA 2ERPA 1GE6A 1O0QA 1XFUA 2OW1A 1XUCA 1O0TA 2K2GA 2E3XA 2RJQA 1JK3A 2L0RA 4H76A 2USNA 2DDYA 1UMSA 1MMQA 1KUFA 2OY2A 5CZMA 4FU4A 5I0LA 1G9KA 2A8HA 2OZRA 3L0TA 1D8MA 3EDIA 3LJTA 1C8TA 3DPFA 2OI0A 1HOVA 4GR8A 4L19A 2YB9A 1OS9A 4AUOA 3K7NA 1Y93A 4H1QA 2FV5A 1CGFA 1ATLA 5L79A 1J7NA 2KRJA 4DV8A 2N8RA 1IAAA 1XFVA 1MMPA 1GKCA 1UEAA 1AYKA 1C3IA 2JNPA 2OW0A 2I47A 3MA2A 2W0DA 4WKEA 3O2XA 1JAQA 1K7IA 3LJZA 1EB6A 2ERQA 4PKVA 2OVZA 2OXUA 3HBUP 1DMTA 3DL1A 3HBVP 5BOYA 4IUWA 1YCMA 1AF0A 3EHXA 3B92A 4FXQA 3EDGA 4J4MA 1K7GA 1H71P 2JT5A 4G0DA 1RMZA 1EUBA 1R54A 1DTHA 1BM6A 1HY7A 1MNCA 1BSWA 1FM1A 3AYUA 2W12A 3LQ0A 2OW9A 3HYGA 3EWJA 1Y8JA 1PWVA 2MLSA 5I3MA 2TCLA 3CKIA 1BQOA 1Z3JA 3KWVC 3HDAP 1KAPP 3LUNA 3P24A 1ASTA 1CIZA 4PKWA 3K7LA 4XCTA 1HFSA 1KBCA 2SRTA 2DW0A 1Y0VA 4GR3A 3Q2HA 4IN9A 1I73A 1C7KA 2EROA 2MZHA 1ZXVA 4R3VA 1OM7A 1B3DA 5I2ZA 4IJOA 1YQYA 1OM8A 1R1IA 1G05A 1GKDA 3O64A 1ZXCA 3NX7A 2J0TA 830CA
chains in the Genus database with same CATH superfamily
3KHIA 3LK8A 5BPAA 1TVIA 1ROSA 3V96B 5CXAA 1D8FA 1XFYA 3G5CA 1CXVA 4PKUA 3DTIA 5B5OA 2MLRA 3G42A 1UTTA 1A85A 1CGLA 1BKCE 1S4BP 3N2VA 3TS4A 1GO7P 1D5JA 3B2ZA 5L7FA 3AIGA 1GE7A 2JIHA 4PKSA 2JT6A 3LE9A 5JMYA 4GUYA 2CLTA 1SRPA 2FV9A 1KUGA 1RM8A 4DPEA 2OY4A 1CAQA 2WOAA 1QIAA 3LEAA 4ON1A 1OM6A 4WF6A 2XS3A 3SHIA 1CK7A 1G4KA 1BKCI 4H3XA 3ZUKA 4A3WA 2DW2A 4WK7A 5I43A 5D3CA 1XFXA 4L6TA 5H8XA 3F17A 1SLNA 3E8RA 4XM8A 4FXYP 3TSKA 2X3CA 4GF1A 1JH1A 1GO8P 3B8ZA 3KMEA 1QIBA 1FLSA 5LABA 2Y6CA 3ELMA 1JAOA 3HB2P 5D1SA 1YP1A 3I7GA 2PJTA 3KEJA 1KUHA 3UVCA 1XFWA 2W13A 1BUVM 1XUDA 2CKIA 1UMTA 3DTKA 3DNGA 1QICA 2OXZA 4A7BA 3F16A 3U1RA 4HX3A 2POJA 1OZ9A 3USNA 3KMCA 1UTZA 4XBHA 3VTGA 5CUHA 1BUDA 3WV2A 4DF9A 1KUIA 3TT4A 1IAEA 2QPJA 1WNIA 4GR0A 5BOTA 1SATA 2W14A 2MZEA 4L63A 3N2UA 1G49A 1XAXA 4FVLA 1QUAA 1ZVXA 2XS4A 3LILA 4JQGA 1JJ9A 2AIGP 1GE5A 1YOUA 1HFCA 3OHLA 4DD8A 1PWUA 5D2BA 1BIWA 2X7MA 1IACA 1FBLA 2OXWA 1JIWP 2MZIA 4WZVA 1ZTQA 2RJPA 1Q3AA 4AYKA 1XURA 1CGEA 2WO8A 4JP4A 1KUKA 1JANA 3OHOA 5D1UA 1EAKA 2HU6A 3HY9A 4AXQA 3HY7A 2K9CA 3EDZA 2Z2DA 4GQLA 3LKAA 3DWBA 4WKIA 1OS2A 2D1OA 5I12A 3LQBA 1ZS0A 2O3EA 1QJIA 1IADA 1SMPA 4G9LA 1OO9A 3LIKA 4H30A 4L7AA 3DSLA 4H84A 4CTHA 1IABA 2Y6DA 5D7WA 4JIJA 2AYKA 2O36A 1R1JA 1OMJA 3F1AA 1AKLA 1BQQM 4GWNA 1QJJA 1L6JA 2DDFA 1ND1A 2OVXA 4H82A 1JAPA 1CQRA 1GXDA 2X3AA 3BA0A 2DW1A 4PKRA 3VI1A 3LGPA 3LUMA 1ZP5A 3DPEA 2OW2A 2YUFA 1MMRA 3GBOA 1I1IP 3LJGA 4H49A 1D7XA 3LIRA 1K7QA 1IAGA 4PKQA 3TVCA 4XM6A 3ZXHA 2J83A 3L0VA 4HMAA 2X3BA 4H2EA 3LMCA 4I35A 1G12A 1MMBA 1R1HA 1BKCA 1PWWA 1JIZA 3F18A 2W15A 3EDHA 3Q2GA 2V4BA 2WO9A 4QKZA 5D1TA 5I4OA 4AIGA 4JPAA 3WV1A 1B8YA 4ILWD 3I7IA 2JSDA 1PWPA 1PWQA 3KEKA 3EHYA 1I76A 456CA 1XFZA 3KECA 1SU3A 4GWMA 1SLMA 1A86A 4ZR5A 2D1NA 1R55A 4PKTA 4JA1A 4Q1LA 3RTTA 2YIGA 3AYKA 4XM7A 1HV5A 1JKYA 1USNA 3F15A 3KRYA 1BZSA 3WV3A 4EFSA 3P1VA 3RTSA 1HTDA 4I03A 3ZVSA 3HDBA 5B5PA 3F19A 966CA 2E2DA 2ERPA 1GE6A 1O0QA 1XFUA 2OW1A 1XUCA 1O0TA 2K2GA 2E3XA 2RJQA 1JK3A 2L0RA 4H76A 2USNA 2DDYA 1UMSA 1MMQA 1KUFA 2OY2A 5CZMA 4FU4A 5I0LA 1G9KA 2A8HA 2OZRA 3L0TA 1D8MA 3EDIA 3LJTA 1C8TA 3DPFA 2OI0A 1HOVA 4GR8A 4L19A 2YB9A 1OS9A 4AUOA 3K7NA 1Y93A 4H1QA 2FV5A 1CGFA 1ATLA 5L79A 1J7NA 2KRJA 4DV8A 2N8RA 1IAAA 1XFVA 1MMPA 1GKCA 1UEAA 1AYKA 3DTEA 1C3IA 2JNPA 2OW0A 2I47A 3MA2A 2W0DA 4WKEA 3O2XA 1JAQA 1K7IA 3LJZA 1EB6A 2ERQA 4PKVA 2OVZA 2OXUA 3HBUP 1DMTA 3DL1A 3HBVP 5BOYA 4IUWA 1YCMA 1AF0A 3EHXA 3B92A 4FXQA 3EDGA 4J4MA 1K7GA 1H71P 2JT5A 4G0DA 1RMZA 1EUBA 1R54A 1DTHA 1BM6A 1HY7A 1MNCA 1BSWA 1FM1A 3AYUA 2W12A 3LQ0A 2OW9A 3HYGA 3EWJA 1Y8JA 1PWVA 2MLSA 5I3MA 2TCLA 3CKIA 1BQOA 1Z3JA 3KWVC 3HDAP 1KAPP 3LUNA 3P24A 1ASTA 1CIZA 4PKWA 3K7LA 4XCTA 1HFSA 1KBCA 2SRTA 2DW0A 1Y0VA 4GR3A 3Q2HA 4IN9A 1I73A 1C7KA 2EROA 2MZHA 1XM5A 1ZXVA 4R3VA 1OM7A 1B3DA 5I2ZA 4IJOA 1YQYA 1OM8A 1R1IA 1G05A 1GKDA 3O64A 1ZXCA 3NX7A 2J0TA 830CA
chains in the Genus database with same CATH topology
3KHIA 3LK8A 5BPAA 1ROSA 3V96B 5CXAA 1D8FA 1XFYA 3G5CA 1CXVA 4PKUA 3DTIA 5B5OA 2MLRA 3G42A 1UTTA 1A85A 1CGLA 1BKCE 1S4BP 3N2VA 3TS4A 1GO7P 1D5JA 3B2ZA 5L7FA 3AIGA 1GE7A 2JIHA 4PKSA 2JT6A 3LE9A 5JMYA 4GUYA 2CLTA 1SRPA 2FV9A 1KUGA 1RM8A 4DPEA 2OY4A 1CAQA 2WOAA 1QIAA 3LEAA 4ON1A 1OM6A 4WF6A 2XS3A 3SHIA 1CK7A 1G4KA 1BKCI 4H3XA 3ZUKA 4A3WA 2DW2A 4WK7A 5I43A 5D3CA 1XFXA 4L6TA 5H8XA 3F17A 1SLNA 3E8RA 4XM8A 4FXYP 3TSKA 2X3CA 4GF1A 1JH1A 1GO8P 3B8ZA 3KMEA 1QIBA 1FLSA 5LABA 2Y6CA 3ELMA 1JAOA 3HB2P 5D1SA 1YP1A 3I7GA 2PJTA 3KEJA 1KUHA 3UVCA 1XFWA 2W13A 1BUVM 1XUDA 2CKIA 1UMTA 3DTKA 3DNGA 1QICA 2OXZA 4A7BA 3F16A 3U1RA 4HX3A 2POJA 3USNA 3KMCA 1UTZA 4XBHA 3VTGA 5CUHA 1BUDA 3WV2A 4DF9A 1KUIA 3TT4A 1IAEA 2QPJA 1WNIA 4GR0A 5BOTA 1SATA 2W14A 2MZEA 4L63A 3N2UA 1G49A 4FVLA 1QUAA 1ZVXA 2XS4A 3LILA 4JQGA 1JJ9A 2AIGP 1GE5A 1YOUA 1HFCA 3OHLA 4DD8A 1PWUA 5D2BA 1BIWA 2X7MA 1IACA 1FBLA 2OXWA 1JIWP 2MZIA 4WZVA 1ZTQA 2RJPA 1Q3AA 4AYKA 1XURA 1CGEA 2WO8A 4JP4A 1KUKA 1JANA 3OHOA 5D1UA 1EAKA 2HU6A 3HY9A 4AXQA 3HY7A 2K9CA 3EDZA 2Z2DA 4GQLA 3LKAA 3DWBA 4WKIA 1OS2A 2D1OA 5I12A 3LQBA 1ZS0A 2O3EA 1QJIA 1IADA 1SMPA 4G9LA 1OO9A 3LIKA 4H30A 4L7AA 3DSLA 4H84A 4CTHA 1IABA 2Y6DA 5D7WA 4JIJA 2AYKA 2O36A 1R1JA 1OMJA 3F1AA 1AKLA 1BQQM 4GWNA 1QJJA 1L6JA 2DDFA 1ND1A 2OVXA 4H82A 1JAPA 1CQRA 1GXDA 2X3AA 3BA0A 2DW1A 4PKRA 3VI1A 3LGPA 3LUMA 1ZP5A 3DPEA 2OW2A 2YUFA 1MMRA 3GBOA 1I1IP 3LJGA 4H49A 1D7XA 3LIRA 1K7QA 1IAGA 4PKQA 3TVCA 4XM6A 3ZXHA 2J83A 3L0VA 4HMAA 2X3BA 4H2EA 3LMCA 4I35A 1G12A 1MMBA 1R1HA 1BKCA 1PWWA 1JIZA 3F18A 2W15A 3EDHA 3Q2GA 2V4BA 2WO9A 4QKZA 5D1TA 5I4OA 4AIGA 4JPAA 3WV1A 1B8YA 4ILWD 3I7IA 2JSDA 1PWPA 1PWQA 3KEKA 3EHYA 1I76A 456CA 1XFZA 3KECA 1SU3A 4GWMA 1SLMA 1A86A 4ZR5A 2D1NA 1R55A 4PKTA 4JA1A 4Q1LA 3RTTA 2YIGA 3AYKA 4XM7A 1HV5A 1JKYA 1USNA 3F15A 3KRYA 1BZSA 3WV3A 4EFSA 3P1VA 3RTSA 1HTDA 4I03A 3ZVSA 3HDBA 5B5PA 3F19A 966CA 2E2DA 2ERPA 1GE6A 1O0QA 1XFUA 2OW1A 1XUCA 1O0TA 2K2GA 2E3XA 2RJQA 1JK3A 2L0RA 4H76A 2USNA 2DDYA 1UMSA 1MMQA 1KUFA 2OY2A 5CZMA 4FU4A 5I0LA 1G9KA 2A8HA 2OZRA 3L0TA 1D8MA 3EDIA 3LJTA 1C8TA 3DPFA 2OI0A 1HOVA 4GR8A 4L19A 2YB9A 1OS9A 4AUOA 3K7NA 1Y93A 4H1QA 2FV5A 1CGFA 1ATLA 5L79A 1J7NA 2KRJA 4DV8A 2N8RA 1IAAA 1XFVA 1MMPA 1GKCA 1UEAA 1AYKA 3DTEA 1C3IA 2JNPA 2OW0A 2I47A 3MA2A 2W0DA 4WKEA 3O2XA 1JAQA 1K7IA 3LJZA 1EB6A 2ERQA 4PKVA 2OVZA 2OXUA 3HBUP 1DMTA 3DL1A 3HBVP 5BOYA 4IUWA 1YCMA 1AF0A 3EHXA 3B92A 4FXQA 3EDGA 4J4MA 1K7GA 1H71P 2JT5A 4G0DA 1RMZA 1EUBA 1R54A 1DTHA 1BM6A 1HY7A 1MNCA 1BSWA 1FM1A 3AYUA 2W12A 3LQ0A 2OW9A 3HYGA 3EWJA 1Y8JA 1PWVA 2MLSA 5I3MA 2TCLA 3CKIA 1BQOA 1Z3JA 3KWVC 3HDAP 1KAPP 3LUNA 3P24A 1ASTA 1CIZA 4PKWA 3K7LA 4XCTA 1HFSA 1KBCA 2SRTA 2DW0A 1Y0VA 4GR3A 3Q2HA 4IN9A 1I73A 1C7KA 2EROA 2MZHA 1ZXVA 4R3VA 1OM7A 1B3DA 5I2ZA 4IJOA 1YQYA 1OM8A 1R1IA 1G05A 1GKDA 3O64A 1ZXCA 3NX7A 2J0TA 830CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KHI A;  3LK8 A;  5BPA A;  1ROS A;  3V96 B;  5CXA A;  1D8F A;  1XFY A;  3G5C A;  1CXV A;  4PKU A;  5B5O A;  2MLR A;  3G42 A;  1UTT A;  1A85 A;  1CGL A;  1BKC E;  1S4B P;  3N2V A;  3TS4 A;  1GO7 P;  1D5J A;  3B2Z A;  5L7F A;  3AIG A;  1GE7 A;  2JIH A;  4PKS A;  2JT6 A;  3LE9 A;  5JMY A;  4GUY A;  2CLT A;  1SRP A;  2FV9 A;  1KUG A;  1RM8 A;  4DPE A;  2OY4 A;  1CAQ A;  2WOA A;  1QIA A;  3LEA A;  4ON1 A;  1OM6 A;  4WF6 A;  2XS3 A;  3SHI A;  1CK7 A;  1G4K A;  1BKC I;  4H3X A;  3ZUK A;  4A3W A;  2DW2 A;  4WK7 A;  5I43 A;  5D3C A;  1XFX A;  4L6T A;  5H8X A;  3F17 A;  1SLN A;  3E8R A;  4XM8 A;  4FXY P;  3TSK A;  2X3C A;  4GF1 A;  1JH1 A;  1GO8 P;  3B8Z A;  3KME A;  1QIB A;  1FLS A;  5LAB A;  2Y6C A;  3ELM A;  1JAO A;  3HB2 P;  5D1S A;  1YP1 A;  3I7G A;  2PJT A;  3KEJ A;  1KUH A;  3UVC A;  1XFW A;  2W13 A;  1BUV M;  1XUD A;  2CKI A;  1UMT A;  3DNG A;  1QIC A;  2OXZ A;  4A7B A;  3F16 A;  3U1R A;  4HX3 A;  2POJ A;  3USN A;  3KMC A;  1UTZ A;  4XBH A;  3VTG A;  5CUH A;  1BUD A;  3WV2 A;  4DF9 A;  1KUI A;  3TT4 A;  1IAE A;  2QPJ A;  1WNI A;  4GR0 A;  5BOT A;  1SAT A;  2W14 A;  2MZE A;  4L63 A;  3N2U A;  1G49 A;  4FVL A;  1QUA A;  1ZVX A;  2XS4 A;  3LIL A;  4JQG A;  1JJ9 A;  2AIG P;  1GE5 A;  1YOU A;  1HFC A;  3OHL A;  4DD8 A;  1PWU A;  5D2B A;  1BIW A;  2X7M A;  1IAC A;  1FBL A;  2OXW A;  1JIW P;  2MZI A;  4WZV A;  1ZTQ A;  2RJP A;  1Q3A A;  4AYK A;  1XUR A;  1CGE A;  2WO8 A;  4JP4 A;  1KUK A;  1JAN A;  3OHO A;  5D1U A;  1EAK A;  2HU6 A;  3HY9 A;  4AXQ A;  3HY7 A;  2K9C A;  3EDZ A;  2Z2D A;  4GQL A;  3LKA A;  3DWB A;  4WKI A;  1OS2 A;  2D1O A;  5I12 A;  3LQB A;  1ZS0 A;  2O3E A;  1QJI A;  1IAD A;  1SMP A;  4G9L A;  1OO9 A;  3LIK A;  4H30 A;  3DSL A;  4H84 A;  4CTH A;  1IAB A;  2Y6D A;  5D7W A;  4JIJ A;  2AYK A;  2O36 A;  1R1J A;  1OMJ A;  3F1A A;  1AKL A;  1BQQ M;  4GWN A;  1QJJ A;  1L6J A;  2DDF A;  1ND1 A;  2OVX A;  4H82 A;  1JAP A;  1CQR A;  1GXD A;  2X3A A;  3BA0 A;  2DW1 A;  4PKR A;  3VI1 A;  3LGP A;  3LUM A;  1ZP5 A;  3DPE A;  2OW2 A;  1MMR A;  3GBO A;  1I1I P;  3LJG A;  4H49 A;  1D7X A;  3LIR A;  1K7Q A;  1IAG A;  4PKQ A;  3TVC A;  4XM6 A;  3ZXH A;  2J83 A;  3L0V A;  4HMA A;  2X3B A;  4H2E A;  3LMC A;  4I35 A;  1G12 A;  1MMB A;  1R1H A;  1BKC A;  1PWW A;  1JIZ A;  3F18 A;  2W15 A;  3EDH A;  3Q2G A;  2V4B A;  2WO9 A;  4QKZ A;  5D1T A;  5I4O A;  4AIG A;  4JPA A;  3WV1 A;  1B8Y A;  4ILW D;  3I7I A;  2JSD A;  1PWP A;  1PWQ A;  3KEK A;  3EHY A;  1I76 A;  456C A;  1XFZ A;  3KEC A;  1SU3 A;  4GWM A;  1SLM A;  1A86 A;  4ZR5 A;  2D1N A;  1R55 A;  4PKT A;  4JA1 A;  4Q1L A;  3RTT A;  2YIG A;  3AYK A;  4XM7 A;  1HV5 A;  1JKY A;  1USN A;  3F15 A;  3KRY A;  1BZS A;  3WV3 A;  4EFS A;  3P1V A;  3RTS A;  1HTD A;  4I03 A;  3ZVS A;  3HDB A;  5B5P A;  3F19 A;  966C A;  2E2D A;  2ERP A;  1GE6 A;  1O0Q A;  1XFU A;  2OW1 A;  1XUC A;  1O0T A;  2K2G A;  2E3X A;  2RJQ A;  1JK3 A;  2L0R A;  4H76 A;  2USN A;  2DDY A;  1UMS A;  1MMQ A;  1KUF A;  2OY2 A;  5CZM A;  4FU4 A;  5I0L A;  1G9K A;  2A8H A;  2OZR A;  3L0T A;  1D8M A;  3EDI A;  3LJT A;  1C8T A;  3DPF A;  2OI0 A;  1HOV A;  4GR8 A;  4L19 A;  2YB9 A;  1OS9 A;  4AUO A;  3K7N A;  1Y93 A;  4H1Q A;  2FV5 A;  1CGF A;  1ATL A;  5L79 A;  1J7N A;  2KRJ A;  4DV8 A;  2N8R A;  1IAA A;  1XFV A;  1MMP A;  1GKC A;  1UEA A;  1AYK A;  1C3I A;  2JNP A;  2OW0 A;  2I47 A;  3MA2 A;  2W0D A;  4WKE A;  3O2X A;  1JAQ A;  1K7I A;  3LJZ A;  1EB6 A;  2ERQ A;  4PKV A;  2OVZ A;  2OXU A;  3HBU P;  1DMT A;  3DL1 A;  3HBV P;  5BOY A;  4IUW A;  1YCM A;  1AF0 A;  3EHX A;  3B92 A;  4FXQ A;  3EDG A;  4J4M A;  1K7G A;  1H71 P;  2JT5 A;  4G0D A;  1RMZ A;  1EUB A;  1R54 A;  1DTH A;  1BM6 A;  1HY7 A;  1MNC A;  1BSW A;  1FM1 A;  3AYU A;  2W12 A;  3LQ0 A;  2OW9 A;  3HYG A;  3EWJ A;  1Y8J A;  1PWV A;  2MLS A;  5I3M A;  2TCL A;  3CKI A;  1BQO A;  1Z3J A;  3KWV C;  3HDA P;  1KAP P;  3LUN A;  3P24 A;  1AST A;  1CIZ A;  4PKW A;  3K7L A;  4XCT A;  1HFS A;  1KBC A;  2SRT A;  2DW0 A;  1Y0V A;  4GR3 A;  3Q2H A;  4IN9 A;  1I73 A;  1C7K A;  2ERO A;  2MZH A;  1ZXV A;  4R3V A;  1OM7 A;  1B3D A;  5I2Z A;  4IJO A;  1YQY A;  1OM8 A;  1R1I A;  1G05 A;  1GKD A;  3O64 A;  1ZXC A;  3NX7 A;  2J0T A;  830C A; 
#chains in the Genus database with same CATH topology
 3KHI A;  3LK8 A;  5BPA A;  1TVI A;  1ROS A;  3V96 B;  5CXA A;  1D8F A;  1XFY A;  3G5C A;  1CXV A;  4PKU A;  3DTI A;  5B5O A;  2MLR A;  3G42 A;  1UTT A;  1A85 A;  1CGL A;  1BKC E;  1S4B P;  3N2V A;  3TS4 A;  1GO7 P;  1D5J A;  3B2Z A;  5L7F A;  3AIG A;  1GE7 A;  2JIH A;  4PKS A;  2JT6 A;  3LE9 A;  5JMY A;  4GUY A;  2CLT A;  1SRP A;  2FV9 A;  1KUG A;  1RM8 A;  4DPE A;  2OY4 A;  1CAQ A;  2WOA A;  1QIA A;  3LEA A;  4ON1 A;  1OM6 A;  4WF6 A;  2XS3 A;  3SHI A;  1CK7 A;  1G4K A;  1BKC I;  4H3X A;  3ZUK A;  4A3W A;  2DW2 A;  4WK7 A;  5I43 A;  5D3C A;  1XFX A;  4L6T A;  5H8X A;  3F17 A;  1SLN A;  3E8R A;  4XM8 A;  4FXY P;  3TSK A;  2X3C A;  4GF1 A;  1JH1 A;  1GO8 P;  3B8Z A;  3KME A;  1QIB A;  1FLS A;  5LAB A;  2Y6C A;  3ELM A;  1JAO A;  3HB2 P;  5D1S A;  1YP1 A;  3I7G A;  2PJT A;  3KEJ A;  1KUH A;  3UVC A;  1XFW A;  2W13 A;  1BUV M;  1XUD A;  2CKI A;  1UMT A;  3DTK A;  3DNG A;  1QIC A;  2OXZ A;  4A7B A;  3F16 A;  3U1R A;  4HX3 A;  2POJ A;  1OZ9 A;  3USN A;  3KMC A;  1UTZ A;  4XBH A;  3VTG A;  5CUH A;  1BUD A;  3WV2 A;  4DF9 A;  1KUI A;  3TT4 A;  1IAE A;  2QPJ A;  1WNI A;  4GR0 A;  5BOT A;  1SAT A;  2W14 A;  2MZE A;  4L63 A;  3N2U A;  1G49 A;  1XAX A;  4FVL A;  1QUA A;  1ZVX A;  2XS4 A;  3LIL A;  4JQG A;  1JJ9 A;  2AIG P;  1GE5 A;  1YOU A;  1HFC A;  3OHL A;  4DD8 A;  1PWU A;  5D2B A;  1BIW A;  2X7M A;  1IAC A;  1FBL A;  2OXW A;  1JIW P;  2MZI A;  4WZV A;  1ZTQ A;  2RJP A;  1Q3A A;  4AYK A;  1XUR A;  1CGE A;  2WO8 A;  4JP4 A;  1KUK A;  1JAN A;  3OHO A;  5D1U A;  1EAK A;  2HU6 A;  3HY9 A;  4AXQ A;  3HY7 A;  2K9C A;  3EDZ A;  2Z2D A;  4GQL A;  3LKA A;  3DWB A;  4WKI A;  1OS2 A;  2D1O A;  5I12 A;  3LQB A;  1ZS0 A;  2O3E A;  1QJI A;  1IAD A;  1SMP A;  4G9L A;  1OO9 A;  3LIK A;  4H30 A;  4L7A A;  3DSL A;  4H84 A;  4CTH A;  1IAB A;  2Y6D A;  5D7W A;  4JIJ A;  2AYK A;  2O36 A;  1R1J A;  1OMJ A;  3F1A A;  1AKL A;  1BQQ M;  4GWN A;  1QJJ A;  1L6J A;  2DDF A;  1ND1 A;  2OVX A;  4H82 A;  1JAP A;  1CQR A;  1GXD A;  2X3A A;  3BA0 A;  2DW1 A;  4PKR A;  3VI1 A;  3LGP A;  3LUM A;  1ZP5 A;  3DPE A;  2OW2 A;  2YUF A;  1MMR A;  3GBO A;  1I1I P;  3LJG A;  4H49 A;  1D7X A;  3LIR A;  1K7Q A;  1IAG A;  4PKQ A;  3TVC A;  4XM6 A;  3ZXH A;  2J83 A;  3L0V A;  4HMA A;  2X3B A;  4H2E A;  3LMC A;  4I35 A;  1G12 A;  1MMB A;  1R1H A;  1BKC A;  1PWW A;  1JIZ A;  3F18 A;  2W15 A;  3EDH A;  3Q2G A;  2V4B A;  2WO9 A;  4QKZ A;  5D1T A;  5I4O A;  4AIG A;  4JPA A;  3WV1 A;  1B8Y A;  4ILW D;  3I7I A;  2JSD A;  1PWP A;  1PWQ A;  3KEK A;  3EHY A;  1I76 A;  456C A;  1XFZ A;  3KEC A;  1SU3 A;  4GWM A;  1SLM A;  1A86 A;  4ZR5 A;  2D1N A;  1R55 A;  4PKT A;  4JA1 A;  4Q1L A;  3RTT A;  2YIG A;  3AYK A;  4XM7 A;  1HV5 A;  1JKY A;  1USN A;  3F15 A;  3KRY A;  1BZS A;  3WV3 A;  4EFS A;  3P1V A;  3RTS A;  1HTD A;  4I03 A;  3ZVS A;  3HDB A;  5B5P A;  3F19 A;  966C A;  2E2D A;  2ERP A;  1GE6 A;  1O0Q A;  1XFU A;  2OW1 A;  1XUC A;  1O0T A;  2K2G A;  2E3X A;  2RJQ A;  1JK3 A;  2L0R A;  4H76 A;  2USN A;  2DDY A;  1UMS A;  1MMQ A;  1KUF A;  2OY2 A;  5CZM A;  4FU4 A;  5I0L A;  1G9K A;  2A8H A;  2OZR A;  3L0T A;  1D8M A;  3EDI A;  3LJT A;  1C8T A;  3DPF A;  2OI0 A;  1HOV A;  4GR8 A;  4L19 A;  2YB9 A;  1OS9 A;  4AUO A;  3K7N A;  1Y93 A;  4H1Q A;  2FV5 A;  1CGF A;  1ATL A;  5L79 A;  1J7N A;  2KRJ A;  4DV8 A;  2N8R A;  1IAA A;  1XFV A;  1MMP A;  1GKC A;  1UEA A;  1AYK A;  3DTE A;  1C3I A;  2JNP A;  2OW0 A;  2I47 A;  3MA2 A;  2W0D A;  4WKE A;  3O2X A;  1JAQ A;  1K7I A;  3LJZ A;  1EB6 A;  2ERQ A;  4PKV A;  2OVZ A;  2OXU A;  3HBU P;  1DMT A;  3DL1 A;  3HBV P;  5BOY A;  4IUW A;  1YCM A;  1AF0 A;  3EHX A;  3B92 A;  4FXQ A;  3EDG A;  4J4M A;  1K7G A;  1H71 P;  2JT5 A;  4G0D A;  1RMZ A;  1EUB A;  1R54 A;  1DTH A;  1BM6 A;  1HY7 A;  1MNC A;  1BSW A;  1FM1 A;  3AYU A;  2W12 A;  3LQ0 A;  2OW9 A;  3HYG A;  3EWJ A;  1Y8J A;  1PWV A;  2MLS A;  5I3M A;  2TCL A;  3CKI A;  1BQO A;  1Z3J A;  3KWV C;  3HDA P;  1KAP P;  3LUN A;  3P24 A;  1AST A;  1CIZ A;  4PKW A;  3K7L A;  4XCT A;  1HFS A;  1KBC A;  2SRT A;  2DW0 A;  1Y0V A;  4GR3 A;  3Q2H A;  4IN9 A;  1I73 A;  1C7K A;  2ERO A;  2MZH A;  1XM5 A;  1ZXV A;  4R3V A;  1OM7 A;  1B3D A;  5I2Z A;  4IJO A;  1YQY A;  1OM8 A;  1R1I A;  1G05 A;  1GKD A;  3O64 A;  1ZXC A;  3NX7 A;  2J0T A;  830C A; 
#chains in the Genus database with same CATH homology
 3KHI A;  3LK8 A;  5BPA A;  1ROS A;  3V96 B;  5CXA A;  1D8F A;  1XFY A;  3G5C A;  1CXV A;  4PKU A;  3DTI A;  5B5O A;  2MLR A;  3G42 A;  1UTT A;  1A85 A;  1CGL A;  1BKC E;  1S4B P;  3N2V A;  3TS4 A;  1GO7 P;  1D5J A;  3B2Z A;  5L7F A;  3AIG A;  1GE7 A;  2JIH A;  4PKS A;  2JT6 A;  3LE9 A;  5JMY A;  4GUY A;  2CLT A;  1SRP A;  2FV9 A;  1KUG A;  1RM8 A;  4DPE A;  2OY4 A;  1CAQ A;  2WOA A;  1QIA A;  3LEA A;  4ON1 A;  1OM6 A;  4WF6 A;  2XS3 A;  3SHI A;  1CK7 A;  1G4K A;  1BKC I;  4H3X A;  3ZUK A;  4A3W A;  2DW2 A;  4WK7 A;  5I43 A;  5D3C A;  1XFX A;  4L6T A;  5H8X A;  3F17 A;  1SLN A;  3E8R A;  4XM8 A;  4FXY P;  3TSK A;  2X3C A;  4GF1 A;  1JH1 A;  1GO8 P;  3B8Z A;  3KME A;  1QIB A;  1FLS A;  5LAB A;  2Y6C A;  3ELM A;  1JAO A;  3HB2 P;  5D1S A;  1YP1 A;  3I7G A;  2PJT A;  3KEJ A;  1KUH A;  3UVC A;  1XFW A;  2W13 A;  1BUV M;  1XUD A;  2CKI A;  1UMT A;  3DTK A;  3DNG A;  1QIC A;  2OXZ A;  4A7B A;  3F16 A;  3U1R A;  4HX3 A;  2POJ A;  3USN A;  3KMC A;  1UTZ A;  4XBH A;  3VTG A;  5CUH A;  1BUD A;  3WV2 A;  4DF9 A;  1KUI A;  3TT4 A;  1IAE A;  2QPJ A;  1WNI A;  4GR0 A;  5BOT A;  1SAT A;  2W14 A;  2MZE A;  4L63 A;  3N2U A;  1G49 A;  4FVL A;  1QUA A;  1ZVX A;  2XS4 A;  3LIL A;  4JQG A;  1JJ9 A;  2AIG P;  1GE5 A;  1YOU A;  1HFC A;  3OHL A;  4DD8 A;  1PWU A;  5D2B A;  1BIW A;  2X7M A;  1IAC A;  1FBL A;  2OXW A;  1JIW P;  2MZI A;  4WZV A;  1ZTQ A;  2RJP A;  1Q3A A;  4AYK A;  1XUR A;  1CGE A;  2WO8 A;  4JP4 A;  1KUK A;  1JAN A;  3OHO A;  5D1U A;  1EAK A;  2HU6 A;  3HY9 A;  4AXQ A;  3HY7 A;  2K9C A;  3EDZ A;  2Z2D A;  4GQL A;  3LKA A;  3DWB A;  4WKI A;  1OS2 A;  2D1O A;  5I12 A;  3LQB A;  1ZS0 A;  2O3E A;  1QJI A;  1IAD A;  1SMP A;  4G9L A;  1OO9 A;  3LIK A;  4H30 A;  4L7A A;  3DSL A;  4H84 A;  4CTH A;  1IAB A;  2Y6D A;  5D7W A;  4JIJ A;  2AYK A;  2O36 A;  1R1J A;  1OMJ A;  3F1A A;  1AKL A;  1BQQ M;  4GWN A;  1QJJ A;  1L6J A;  2DDF A;  1ND1 A;  2OVX A;  4H82 A;  1JAP A;  1CQR A;  1GXD A;  2X3A A;  3BA0 A;  2DW1 A;  4PKR A;  3VI1 A;  3LGP A;  3LUM A;  1ZP5 A;  3DPE A;  2OW2 A;  2YUF A;  1MMR A;  3GBO A;  1I1I P;  3LJG A;  4H49 A;  1D7X A;  3LIR A;  1K7Q A;  1IAG A;  4PKQ A;  3TVC A;  4XM6 A;  3ZXH A;  2J83 A;  3L0V A;  4HMA A;  2X3B A;  4H2E A;  3LMC A;  4I35 A;  1G12 A;  1MMB A;  1R1H A;  1BKC A;  1PWW A;  1JIZ A;  3F18 A;  2W15 A;  3EDH A;  3Q2G A;  2V4B A;  2WO9 A;  4QKZ A;  5D1T A;  5I4O A;  4AIG A;  4JPA A;  3WV1 A;  1B8Y A;  4ILW D;  3I7I A;  2JSD A;  1PWP A;  1PWQ A;  3KEK A;  3EHY A;  1I76 A;  456C A;  1XFZ A;  3KEC A;  1SU3 A;  4GWM A;  1SLM A;  1A86 A;  4ZR5 A;  2D1N A;  1R55 A;  4PKT A;  4JA1 A;  4Q1L A;  3RTT A;  2YIG A;  3AYK A;  4XM7 A;  1HV5 A;  1JKY A;  1USN A;  3F15 A;  3KRY A;  1BZS A;  3WV3 A;  4EFS A;  3P1V A;  3RTS A;  1HTD A;  4I03 A;  3ZVS A;  3HDB A;  5B5P A;  3F19 A;  966C A;  2E2D A;  2ERP A;  1GE6 A;  1O0Q A;  1XFU A;  2OW1 A;  1XUC A;  1O0T A;  2K2G A;  2E3X A;  2RJQ A;  1JK3 A;  2L0R A;  4H76 A;  2USN A;  2DDY A;  1UMS A;  1MMQ A;  1KUF A;  2OY2 A;  5CZM A;  4FU4 A;  5I0L A;  1G9K A;  2A8H A;  2OZR A;  3L0T A;  1D8M A;  3EDI A;  3LJT A;  1C8T A;  3DPF A;  2OI0 A;  1HOV A;  4GR8 A;  4L19 A;  2YB9 A;  1OS9 A;  4AUO A;  3K7N A;  1Y93 A;  4H1Q A;  2FV5 A;  1CGF A;  1ATL A;  5L79 A;  1J7N A;  2KRJ A;  4DV8 A;  2N8R A;  1IAA A;  1XFV A;  1MMP A;  1GKC A;  1UEA A;  1AYK A;  3DTE A;  1C3I A;  2JNP A;  2OW0 A;  2I47 A;  3MA2 A;  2W0D A;  4WKE A;  3O2X A;  1JAQ A;  1K7I A;  3LJZ A;  1EB6 A;  2ERQ A;  4PKV A;  2OVZ A;  2OXU A;  3HBU P;  1DMT A;  3DL1 A;  3HBV P;  5BOY A;  4IUW A;  1YCM A;  1AF0 A;  3EHX A;  3B92 A;  4FXQ A;  3EDG A;  4J4M A;  1K7G A;  1H71 P;  2JT5 A;  4G0D A;  1RMZ A;  1EUB A;  1R54 A;  1DTH A;  1BM6 A;  1HY7 A;  1MNC A;  1BSW A;  1FM1 A;  3AYU A;  2W12 A;  3LQ0 A;  2OW9 A;  3HYG A;  3EWJ A;  1Y8J A;  1PWV A;  2MLS A;  5I3M A;  2TCL A;  3CKI A;  1BQO A;  1Z3J A;  3KWV C;  3HDA P;  1KAP P;  3LUN A;  3P24 A;  1AST A;  1CIZ A;  4PKW A;  3K7L A;  4XCT A;  1HFS A;  1KBC A;  2SRT A;  2DW0 A;  1Y0V A;  4GR3 A;  3Q2H A;  4IN9 A;  1I73 A;  1C7K A;  2ERO A;  2MZH A;  1ZXV A;  4R3V A;  1OM7 A;  1B3D A;  5I2Z A;  4IJO A;  1YQY A;  1OM8 A;  1R1I A;  1G05 A;  1GKD A;  3O64 A;  1ZXC A;  3NX7 A;  2J0T A;  830C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...