3F19A

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor 4-fluoro-n-(2-nitroso-2-oxoethyl)benzenesulfonamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
b'GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Exploring the subtleties of drug-receptor interactions: the case of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3f19A00
2ERPA 1BSWA 5CXAA 3K7NA 3AYUA 2CKIA 2HU6A 1EB6A 4JP4A 3LMCA 4QKZA 3EDGA 4JQGA 2E2DA 1ZVXA 4GF1A 2I47A 1QIAA 4PKWA 1KUGA 3ZXHA 1JANA 2A8HA 1JJ9A 3TVCA 1O0QA 2J0TA 2W14A 5B5PA 3B8ZA 3G5CA 1CAQA 1YOUA 3L0VA 1JKYA 1KUIA 1KBCA 1ND1A 3DPEA 3F15A 2PJTA 1PWWA 2JNPA 4G9LA 3V96B 3KEKA 2DDFA 4ZR5A 4I03A 3LGPA 1JK3A 830CA 4XBHA 1JAPA 1UMSA 1BUVM 2OZRA 3AIGA 1KUKA 1R55A 3AYKA 2OXUA 456CA 4PKQA 3KWVC 5D1TA 2W0DA 1G12A 1MNCA 1GO7P 2YIGA 1BUDA 1O0TA 4GQLA 4FVLA 1K7GA 1JIWP 4XM8A 1HTDA 1FLSA 1CGLA 2O3EA 3LJGA 3LK8A 2D1OA 4L6TA 4JPAA 1QIBA 5I0LA 3TS4A 5I4OA 3TSKA 3E8RA 2W13A 2DDYA 3L0TA 1OM8A 4A3WA 1K7IA 1IAEA 3F16A 4PKTA 1ASTA 1RMZA 3KEJA 1XURA 1CXVA 1B3DA 2OY2A 3OHLA 5L79A 3EWJA 4FU4A 2XS4A 3EDIA 2DW2A 1ZXCA 2MZHA 4J4MA 1C3IA 1G05A 1HFCA 3HDBA 1XFUA 2YB9A 1PWUA 3LILA 5D3CA 4A7BA 4G0DA 2WOAA 1FBLA 4WKIA 1R1IA 3LIRA 3CKIA 4Q1LA 3SHIA 2CLTA 3F18A 3KECA 3I7IA 1G4KA 1BM6A 1YP1A 3DL1A 3O2XA 3LJTA 4XCTA 1SLNA 1A85A 3HDAP 2OW1A 2SRTA 1XFXA 3LQ0A 2MLRA 3HYGA 3UVCA 1JAOA 3U1RA 2QPJA 2X3CA 4GWNA 3OHOA 5I12A 3ELMA 5BOYA 4GR8A 2FV5A 1Z3JA 1OS9A 2WO9A 1Y93A 2MZEA 3HY7A 1CGFA 1EAKA 2MLSA 3EDZA 3LJZA 2J83A 4DPEA 4GUYA 3HBUP 1K7QA 2OI0A 4CTHA 2L0RA 1H71P 5H8XA 2DW1A 1XFWA 1PWQA 3GBOA 1C8TA 3B2ZA 1HY7A 4XM6A 3EDHA 3VI1A 3P24A 5JMYA 2OVZA 3WV3A 1BIWA 1D8MA 3BA0A 1OO9A 1OMJA 3DWBA 3I7GA 3F1AA 3O64A 3K7LA 1OM7A 5D7WA 1ZXVA 4DF9A 1QJIA 4H30A 2W12A 1QJJA 1G9KA 1XFYA 1PWVA 3HY9A 4GWMA 4FXQA 4WZVA 3B92A 1B8YA 2Z2DA 4AUOA 1AF0A 3KHIA 1BZSA 1S4BP 3HBVP 1YQYA 5BPAA 2RJQA 3ZVSA 3WV1A 2K9CA 3TT4A 1DTHA 1D8FA 4JA1A 3RTTA 1ZP5A 1SU3A 1ROSA 4EFSA 4GR3A 3HB2P 1MMRA 1SRPA 1GE5A 4L19A 4IN9A 1MMPA 1R54A 2X3AA 4XM7A 2OW0A 1ZTQA 4PKVA 3F19A 1SATA 2DW0A 1UEAA 4JIJA 4R3VA 3Q2GA 4DD8A 2AIGP 2EROA 1MMBA 2JIHA 4DV8A 4PKRA 1A86A 4H84A 2ERQA 3LKAA 1Y8JA 2OY4A 2KRJA 1QUAA 3ZUKA 1D5JA 1FM1A 2O36A 1IACA 1CIZA 2TCLA 2JT6A 966CA 1DMTA 1CGEA 1ATLA 2XS3A 1AYKA 3LIKA 3EHXA 1J7NA 1XUDA 1R1JA 3DPFA 2V4BA 1IABA 3N2UA 3KMCA 1JIZA 2N8RA 4WF6A 5BOTA 4AYKA 2MZIA 1GXDA 1GKDA 2Y6CA 5D1UA 1GE6A 1Y0VA 1XFZA 1OM6A 3WV2A 3LQBA 3EHYA 2OVXA 2K2GA 2W15A 4ILWD 1L6JA 1KAPP 4PKSA 5I2ZA 2OXWA 4H1QA 5B5OA 1IADA 5D1SA 1SMPA 2OW9A 1UMTA 1GKCA 2USNA 1KUFA 1KUHA 4H82A 3F17A 4H76A 1RM8A 3VTGA 1OS2A 3LE9A 2OXZA 4FXYP 4AXQA 2AYKA 1UTTA 2OW2A 1IAGA 2FV9A 1JAQA 2X7MA 1WNIA 1XUCA 4WK7A 1BKCA 4HMAA 1C7KA 1CQRA 3LUNA 3G42A 3DNGA 1CK7A 1PWPA 1G49A 4L63A 3USNA 4WKEA 1Q3AA 3NX7A 1BQOA 1GO8P 1IAAA 4I35A 1XFVA 1I1IP 1SLMA 1I76A 1BQQM 3MA2A 1AKLA 4H2EA 3Q2HA 1BKCE 2RJPA 3RTSA 5I3MA 2WO8A 1MMQA 2JSDA 5D2BA 5L7FA 3N2VA 3P1VA 2D1NA 3KMEA 3LEAA 1EUBA 1I73A 4GR0A 1HOVA 1UTZA 2POJA 1GE7A 1QICA 4IJOA 4IUWA 1HV5A 2JT5A 5LABA 2Y6DA 5I43A 1USNA 3LUMA 2X3BA 1JH1A 5CZMA 1D7XA 4PKUA 4AIGA 1R1HA 2E3XA 5CUHA 4ON1A 4H3XA 1ZS0A 4HX3A 1YCMA 3DSLA 4H49A 1BKCI 3KRYA 1HFSA
chains in the Genus database with same CATH superfamily
2ERPA 1BSWA 5CXAA 3K7NA 3AYUA 2CKIA 2HU6A 1EB6A 4JP4A 3LMCA 4QKZA 3EDGA 4JQGA 2E2DA 1ZVXA 4GF1A 2I47A 1QIAA 4PKWA 1KUGA 3ZXHA 1JANA 2A8HA 1JJ9A 3TVCA 1O0QA 2J0TA 2W14A 5B5PA 3B8ZA 3G5CA 1CAQA 1YOUA 3L0VA 1JKYA 1KUIA 1KBCA 1ND1A 3DPEA 3F15A 2PJTA 1PWWA 2JNPA 4G9LA 3V96B 3KEKA 2DDFA 4ZR5A 4I03A 3LGPA 1JK3A 830CA 4XBHA 1JAPA 1UMSA 1BUVM 2OZRA 3AIGA 1KUKA 1R55A 3AYKA 2OXUA 456CA 4PKQA 3KWVC 5D1TA 2W0DA 1G12A 1MNCA 1GO7P 2YIGA 1BUDA 1O0TA 4GQLA 4FVLA 1K7GA 1JIWP 4XM8A 1HTDA 1FLSA 1CGLA 2O3EA 3LJGA 3LK8A 2D1OA 4L6TA 4JPAA 1QIBA 5I0LA 3TS4A 5I4OA 3TSKA 3E8RA 2W13A 2DDYA 3L0TA 1OM8A 4A3WA 1K7IA 1IAEA 3F16A 4PKTA 1ASTA 1RMZA 3KEJA 1XURA 1CXVA 1B3DA 2OY2A 3OHLA 5L79A 3EWJA 4FU4A 2XS4A 3EDIA 2DW2A 1ZXCA 2MZHA 4J4MA 1C3IA 1G05A 1HFCA 3HDBA 1XFUA 2YB9A 1PWUA 3LILA 5D3CA 4A7BA 4G0DA 2WOAA 1FBLA 4WKIA 1R1IA 3LIRA 3CKIA 4Q1LA 3SHIA 2CLTA 3F18A 3KECA 3I7IA 1G4KA 1BM6A 1YP1A 3DL1A 3O2XA 3LJTA 4XCTA 1SLNA 1A85A 1TVIA 3HDAP 2OW1A 2SRTA 1XFXA 3LQ0A 2MLRA 3HYGA 3UVCA 1JAOA 3U1RA 2QPJA 2X3CA 4GWNA 3OHOA 5I12A 3ELMA 5BOYA 4GR8A 2FV5A 1Z3JA 1OS9A 2WO9A 1Y93A 2MZEA 3HY7A 1CGFA 1EAKA 2MLSA 3EDZA 3LJZA 2J83A 4DPEA 4GUYA 3HBUP 1K7QA 1XAXA 2OI0A 4CTHA 2L0RA 1H71P 5H8XA 2DW1A 1XFWA 1PWQA 3GBOA 1C8TA 3B2ZA 1HY7A 4XM6A 3EDHA 3VI1A 3P24A 5JMYA 2OVZA 3WV3A 1BIWA 1D8MA 3BA0A 1OO9A 1OMJA 3DWBA 3I7GA 3F1AA 3O64A 3K7LA 1OM7A 5D7WA 1ZXVA 4DF9A 1QJIA 4H30A 2W12A 1QJJA 1G9KA 1XFYA 1PWVA 3HY9A 4GWMA 4FXQA 4WZVA 3B92A 1B8YA 2Z2DA 4AUOA 1AF0A 3KHIA 1BZSA 1S4BP 3HBVP 1YQYA 5BPAA 2RJQA 3ZVSA 3WV1A 2K9CA 3TT4A 1DTHA 1D8FA 4JA1A 3RTTA 1ZP5A 1SU3A 1ROSA 4EFSA 4GR3A 3HB2P 1MMRA 1SRPA 1GE5A 4L19A 4IN9A 1MMPA 1R54A 2X3AA 4XM7A 2OW0A 1ZTQA 4L7AA 4PKVA 3F19A 1SATA 2DW0A 1UEAA 4JIJA 4R3VA 3Q2GA 4DD8A 2AIGP 3DTKA 2EROA 1MMBA 2JIHA 4DV8A 4PKRA 1A86A 1XM5A 4H84A 2ERQA 3LKAA 1Y8JA 2OY4A 2KRJA 1QUAA 3ZUKA 1D5JA 1FM1A 2O36A 1IACA 1CIZA 1OZ9A 2TCLA 2JT6A 966CA 1DMTA 1CGEA 1ATLA 2XS3A 1AYKA 3LIKA 3EHXA 1J7NA 1XUDA 1R1JA 3DPFA 2V4BA 1IABA 3N2UA 3KMCA 1JIZA 2N8RA 4WF6A 5BOTA 3DTEA 4AYKA 2MZIA 1GXDA 1GKDA 2Y6CA 5D1UA 1GE6A 1Y0VA 1XFZA 1OM6A 3WV2A 3LQBA 3EHYA 2OVXA 2K2GA 2W15A 4ILWD 1L6JA 1KAPP 4PKSA 5I2ZA 2OXWA 4H1QA 5B5OA 1IADA 5D1SA 1SMPA 2OW9A 1UMTA 1GKCA 2USNA 1KUFA 1KUHA 4H82A 3F17A 4H76A 1RM8A 3VTGA 1OS2A 3LE9A 2OXZA 4FXYP 4AXQA 2AYKA 1UTTA 2OW2A 1IAGA 2FV9A 1JAQA 2X7MA 1WNIA 1XUCA 4WK7A 1BKCA 4HMAA 1C7KA 1CQRA 3LUNA 3G42A 3DNGA 1CK7A 1PWPA 1G49A 4L63A 3USNA 4WKEA 1Q3AA 3NX7A 1BQOA 1GO8P 1IAAA 4I35A 1XFVA 1I1IP 1SLMA 1I76A 1BQQM 3MA2A 1AKLA 4H2EA 3Q2HA 1BKCE 2RJPA 3RTSA 5I3MA 2WO8A 1MMQA 2JSDA 5D2BA 5L7FA 3N2VA 3P1VA 2D1NA 3KMEA 3LEAA 1EUBA 1I73A 4GR0A 1HOVA 1UTZA 2POJA 1GE7A 1QICA 4IJOA 4IUWA 1HV5A 2JT5A 5LABA 2Y6DA 5I43A 1USNA 3LUMA 2X3BA 1JH1A 5CZMA 1D7XA 3DTIA 4PKUA 4AIGA 1R1HA 2YUFA 2E3XA 5CUHA 4ON1A 4H3XA 1ZS0A 4HX3A 1YCMA 3DSLA 4H49A 1BKCI 3KRYA 1HFSA
chains in the Genus database with same CATH topology
2ERPA 1BSWA 5CXAA 3K7NA 3AYUA 2CKIA 2HU6A 1EB6A 4JP4A 3LMCA 4QKZA 3EDGA 4JQGA 2E2DA 1ZVXA 4GF1A 2I47A 1QIAA 4PKWA 1KUGA 3ZXHA 1JANA 2A8HA 1JJ9A 3TVCA 1O0QA 2J0TA 2W14A 5B5PA 3B8ZA 3G5CA 1CAQA 1YOUA 3L0VA 1JKYA 1KUIA 1KBCA 1ND1A 3DPEA 3F15A 2PJTA 1PWWA 2JNPA 4G9LA 3V96B 3KEKA 2DDFA 4ZR5A 4I03A 3LGPA 1JK3A 830CA 4XBHA 1JAPA 1UMSA 1BUVM 2OZRA 3AIGA 1KUKA 1R55A 3AYKA 2OXUA 456CA 4PKQA 3KWVC 5D1TA 2W0DA 1G12A 1MNCA 1GO7P 2YIGA 1BUDA 1O0TA 4GQLA 4FVLA 1K7GA 1JIWP 4XM8A 1HTDA 1FLSA 1CGLA 2O3EA 3LJGA 3LK8A 2D1OA 4L6TA 4JPAA 1QIBA 5I0LA 3TS4A 5I4OA 3TSKA 3E8RA 2W13A 2DDYA 3L0TA 1OM8A 4A3WA 1K7IA 1IAEA 3F16A 4PKTA 1ASTA 1RMZA 3KEJA 1XURA 1CXVA 1B3DA 2OY2A 3OHLA 5L79A 3EWJA 4FU4A 2XS4A 3EDIA 2DW2A 1ZXCA 2MZHA 4J4MA 1C3IA 1G05A 1HFCA 3HDBA 1XFUA 2YB9A 1PWUA 3LILA 5D3CA 4A7BA 4G0DA 2WOAA 1FBLA 4WKIA 1R1IA 3LIRA 3CKIA 4Q1LA 3SHIA 2CLTA 3F18A 3KECA 3I7IA 1G4KA 1BM6A 1YP1A 3DL1A 3O2XA 3LJTA 4XCTA 1SLNA 1A85A 3HDAP 2OW1A 2SRTA 1XFXA 3LQ0A 2MLRA 3HYGA 3UVCA 1JAOA 3U1RA 2QPJA 2X3CA 4GWNA 3OHOA 5I12A 3ELMA 5BOYA 4GR8A 2FV5A 1Z3JA 1OS9A 2WO9A 1Y93A 2MZEA 3HY7A 1CGFA 1EAKA 2MLSA 3EDZA 3LJZA 2J83A 4DPEA 4GUYA 3HBUP 1K7QA 2OI0A 4CTHA 2L0RA 1H71P 5H8XA 2DW1A 1XFWA 1PWQA 3GBOA 1C8TA 3B2ZA 1HY7A 4XM6A 3EDHA 3VI1A 3P24A 5JMYA 2OVZA 3WV3A 1BIWA 1D8MA 3BA0A 1OO9A 1OMJA 3DWBA 3I7GA 3F1AA 3O64A 3K7LA 1OM7A 5D7WA 1ZXVA 4DF9A 1QJIA 4H30A 2W12A 1QJJA 1G9KA 1XFYA 1PWVA 3HY9A 4GWMA 4FXQA 4WZVA 3B92A 1B8YA 2Z2DA 4AUOA 1AF0A 3KHIA 1BZSA 1S4BP 3HBVP 1YQYA 5BPAA 2RJQA 3ZVSA 3WV1A 2K9CA 3TT4A 1DTHA 1D8FA 4JA1A 3RTTA 1ZP5A 1SU3A 1ROSA 4EFSA 4GR3A 3HB2P 1MMRA 1SRPA 1GE5A 4L19A 4IN9A 1MMPA 1R54A 2X3AA 4XM7A 2OW0A 1ZTQA 4L7AA 4PKVA 3F19A 1SATA 2DW0A 1UEAA 4JIJA 4R3VA 3Q2GA 4DD8A 2AIGP 3DTKA 2EROA 1MMBA 2JIHA 4DV8A 4PKRA 1A86A 4H84A 2ERQA 3LKAA 1Y8JA 2OY4A 2KRJA 1QUAA 3ZUKA 1D5JA 1FM1A 2O36A 1IACA 1CIZA 2TCLA 2JT6A 966CA 1DMTA 1CGEA 1ATLA 2XS3A 1AYKA 3LIKA 3EHXA 1J7NA 1XUDA 1R1JA 3DPFA 2V4BA 1IABA 3N2UA 3KMCA 1JIZA 2N8RA 4WF6A 5BOTA 3DTEA 4AYKA 2MZIA 1GXDA 1GKDA 2Y6CA 5D1UA 1GE6A 1Y0VA 1XFZA 1OM6A 3WV2A 3LQBA 3EHYA 2OVXA 2K2GA 2W15A 4ILWD 1L6JA 1KAPP 4PKSA 5I2ZA 2OXWA 4H1QA 5B5OA 1IADA 5D1SA 1SMPA 2OW9A 1UMTA 1GKCA 2USNA 1KUFA 1KUHA 4H82A 3F17A 4H76A 1RM8A 3VTGA 1OS2A 3LE9A 2OXZA 4FXYP 4AXQA 2AYKA 1UTTA 2OW2A 1IAGA 2FV9A 1JAQA 2X7MA 1WNIA 1XUCA 4WK7A 1BKCA 4HMAA 1C7KA 1CQRA 3LUNA 3G42A 3DNGA 1CK7A 1PWPA 1G49A 4L63A 3USNA 4WKEA 1Q3AA 3NX7A 1BQOA 1GO8P 1IAAA 4I35A 1XFVA 1I1IP 1SLMA 1I76A 1BQQM 3MA2A 1AKLA 4H2EA 3Q2HA 1BKCE 2RJPA 3RTSA 5I3MA 2WO8A 1MMQA 2JSDA 5D2BA 5L7FA 3N2VA 3P1VA 2D1NA 3KMEA 3LEAA 1EUBA 1I73A 4GR0A 1HOVA 1UTZA 2POJA 1GE7A 1QICA 4IJOA 4IUWA 1HV5A 2JT5A 5LABA 2Y6DA 5I43A 1USNA 3LUMA 2X3BA 1JH1A 5CZMA 1D7XA 3DTIA 4PKUA 4AIGA 1R1HA 2YUFA 2E3XA 5CUHA 4ON1A 4H3XA 1ZS0A 4HX3A 1YCMA 3DSLA 4H49A 1BKCI 3KRYA 1HFSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ERP A;  1BSW A;  5CXA A;  3K7N A;  3AYU A;  2CKI A;  2HU6 A;  1EB6 A;  4JP4 A;  3LMC A;  4QKZ A;  3EDG A;  4JQG A;  2E2D A;  1ZVX A;  4GF1 A;  2I47 A;  1QIA A;  4PKW A;  1KUG A;  3ZXH A;  1JAN A;  2A8H A;  1JJ9 A;  3TVC A;  1O0Q A;  2J0T A;  2W14 A;  5B5P A;  3B8Z A;  3G5C A;  1CAQ A;  1YOU A;  3L0V A;  1JKY A;  1KUI A;  1KBC A;  1ND1 A;  3DPE A;  3F15 A;  2PJT A;  1PWW A;  2JNP A;  4G9L A;  3V96 B;  3KEK A;  2DDF A;  4ZR5 A;  4I03 A;  3LGP A;  1JK3 A;  830C A;  4XBH A;  1JAP A;  1UMS A;  1BUV M;  2OZR A;  3AIG A;  1KUK A;  1R55 A;  3AYK A;  2OXU A;  456C A;  4PKQ A;  3KWV C;  5D1T A;  2W0D A;  1G12 A;  1MNC A;  1GO7 P;  2YIG A;  1BUD A;  1O0T A;  4GQL A;  4FVL A;  1K7G A;  1JIW P;  4XM8 A;  1HTD A;  1FLS A;  1CGL A;  2O3E A;  3LJG A;  3LK8 A;  2D1O A;  4L6T A;  4JPA A;  1QIB A;  5I0L A;  3TS4 A;  5I4O A;  3TSK A;  3E8R A;  2W13 A;  2DDY A;  3L0T A;  1OM8 A;  4A3W A;  1K7I A;  1IAE A;  3F16 A;  4PKT A;  1AST A;  1RMZ A;  3KEJ A;  1XUR A;  1CXV A;  1B3D A;  2OY2 A;  3OHL A;  5L79 A;  3EWJ A;  4FU4 A;  2XS4 A;  3EDI A;  2DW2 A;  1ZXC A;  2MZH A;  4J4M A;  1C3I A;  1G05 A;  1HFC A;  3HDB A;  1XFU A;  2YB9 A;  1PWU A;  3LIL A;  5D3C A;  4A7B A;  4G0D A;  2WOA A;  1FBL A;  4WKI A;  1R1I A;  3LIR A;  3CKI A;  4Q1L A;  3SHI A;  2CLT A;  3F18 A;  3KEC A;  3I7I A;  1G4K A;  1BM6 A;  1YP1 A;  3DL1 A;  3O2X A;  3LJT A;  4XCT A;  1SLN A;  1A85 A;  3HDA P;  2OW1 A;  2SRT A;  1XFX A;  3LQ0 A;  2MLR A;  3HYG A;  3UVC A;  1JAO A;  3U1R A;  2QPJ A;  2X3C A;  4GWN A;  3OHO A;  5I12 A;  3ELM A;  5BOY A;  4GR8 A;  2FV5 A;  1Z3J A;  1OS9 A;  2WO9 A;  1Y93 A;  2MZE A;  3HY7 A;  1CGF A;  1EAK A;  2MLS A;  3EDZ A;  3LJZ A;  2J83 A;  4DPE A;  4GUY A;  3HBU P;  1K7Q A;  2OI0 A;  4CTH A;  2L0R A;  1H71 P;  5H8X A;  2DW1 A;  1XFW A;  1PWQ A;  3GBO A;  1C8T A;  3B2Z A;  1HY7 A;  4XM6 A;  3EDH A;  3VI1 A;  3P24 A;  5JMY A;  2OVZ A;  3WV3 A;  1BIW A;  1D8M A;  3BA0 A;  1OO9 A;  1OMJ A;  3DWB A;  3I7G A;  3F1A A;  3O64 A;  3K7L A;  1OM7 A;  5D7W A;  1ZXV A;  4DF9 A;  1QJI A;  4H30 A;  2W12 A;  1QJJ A;  1G9K A;  1XFY A;  1PWV A;  3HY9 A;  4GWM A;  4FXQ A;  4WZV A;  3B92 A;  1B8Y A;  2Z2D A;  4AUO A;  1AF0 A;  3KHI A;  1BZS A;  1S4B P;  3HBV P;  1YQY A;  5BPA A;  2RJQ A;  3ZVS A;  3WV1 A;  2K9C A;  3TT4 A;  1DTH A;  1D8F A;  4JA1 A;  3RTT A;  1ZP5 A;  1SU3 A;  1ROS A;  4EFS A;  4GR3 A;  3HB2 P;  1MMR A;  1SRP A;  1GE5 A;  4L19 A;  4IN9 A;  1MMP A;  1R54 A;  2X3A A;  4XM7 A;  2OW0 A;  1ZTQ A;  4PKV A;  3F19 A;  1SAT A;  2DW0 A;  1UEA A;  4JIJ A;  4R3V A;  3Q2G A;  4DD8 A;  2AIG P;  2ERO A;  1MMB A;  2JIH A;  4DV8 A;  4PKR A;  1A86 A;  4H84 A;  2ERQ A;  3LKA A;  1Y8J A;  2OY4 A;  2KRJ A;  1QUA A;  3ZUK A;  1D5J A;  1FM1 A;  2O36 A;  1IAC A;  1CIZ A;  2TCL A;  2JT6 A;  966C A;  1DMT A;  1CGE A;  1ATL A;  2XS3 A;  1AYK A;  3LIK A;  3EHX A;  1J7N A;  1XUD A;  1R1J A;  3DPF A;  2V4B A;  1IAB A;  3N2U A;  3KMC A;  1JIZ A;  2N8R A;  4WF6 A;  5BOT A;  4AYK A;  2MZI A;  1GXD A;  1GKD A;  2Y6C A;  5D1U A;  1GE6 A;  1Y0V A;  1XFZ A;  1OM6 A;  3WV2 A;  3LQB A;  3EHY A;  2OVX A;  2K2G A;  2W15 A;  4ILW D;  1L6J A;  1KAP P;  4PKS A;  5I2Z A;  2OXW A;  4H1Q A;  5B5O A;  1IAD A;  5D1S A;  1SMP A;  2OW9 A;  1UMT A;  1GKC A;  2USN A;  1KUF A;  1KUH A;  4H82 A;  3F17 A;  4H76 A;  1RM8 A;  3VTG A;  1OS2 A;  3LE9 A;  2OXZ A;  4FXY P;  4AXQ A;  2AYK A;  1UTT A;  2OW2 A;  1IAG A;  2FV9 A;  1JAQ A;  2X7M A;  1WNI A;  1XUC A;  4WK7 A;  1BKC A;  4HMA A;  1C7K A;  1CQR A;  3LUN A;  3G42 A;  3DNG A;  1CK7 A;  1PWP A;  1G49 A;  4L63 A;  3USN A;  4WKE A;  1Q3A A;  3NX7 A;  1BQO A;  1GO8 P;  1IAA A;  4I35 A;  1XFV A;  1I1I P;  1SLM A;  1I76 A;  1BQQ M;  3MA2 A;  1AKL A;  4H2E A;  3Q2H A;  1BKC E;  2RJP A;  3RTS A;  5I3M A;  2WO8 A;  1MMQ A;  2JSD A;  5D2B A;  5L7F A;  3N2V A;  3P1V A;  2D1N A;  3KME A;  3LEA A;  1EUB A;  1I73 A;  4GR0 A;  1HOV A;  1UTZ A;  2POJ A;  1GE7 A;  1QIC A;  4IJO A;  4IUW A;  1HV5 A;  2JT5 A;  5LAB A;  2Y6D A;  5I43 A;  1USN A;  3LUM A;  2X3B A;  1JH1 A;  5CZM A;  1D7X A;  4PKU A;  4AIG A;  1R1H A;  2E3X A;  5CUH A;  4ON1 A;  4H3X A;  1ZS0 A;  4HX3 A;  1YCM A;  3DSL A;  4H49 A;  1BKC I;  3KRY A;  1HFS A; 
#chains in the Genus database with same CATH topology
 2ERP A;  1BSW A;  5CXA A;  3K7N A;  3AYU A;  2CKI A;  2HU6 A;  1EB6 A;  4JP4 A;  3LMC A;  4QKZ A;  3EDG A;  4JQG A;  2E2D A;  1ZVX A;  4GF1 A;  2I47 A;  1QIA A;  4PKW A;  1KUG A;  3ZXH A;  1JAN A;  2A8H A;  1JJ9 A;  3TVC A;  1O0Q A;  2J0T A;  2W14 A;  5B5P A;  3B8Z A;  3G5C A;  1CAQ A;  1YOU A;  3L0V A;  1JKY A;  1KUI A;  1KBC A;  1ND1 A;  3DPE A;  3F15 A;  2PJT A;  1PWW A;  2JNP A;  4G9L A;  3V96 B;  3KEK A;  2DDF A;  4ZR5 A;  4I03 A;  3LGP A;  1JK3 A;  830C A;  4XBH A;  1JAP A;  1UMS A;  1BUV M;  2OZR A;  3AIG A;  1KUK A;  1R55 A;  3AYK A;  2OXU A;  456C A;  4PKQ A;  3KWV C;  5D1T A;  2W0D A;  1G12 A;  1MNC A;  1GO7 P;  2YIG A;  1BUD A;  1O0T A;  4GQL A;  4FVL A;  1K7G A;  1JIW P;  4XM8 A;  1HTD A;  1FLS A;  1CGL A;  2O3E A;  3LJG A;  3LK8 A;  2D1O A;  4L6T A;  4JPA A;  1QIB A;  5I0L A;  3TS4 A;  5I4O A;  3TSK A;  3E8R A;  2W13 A;  2DDY A;  3L0T A;  1OM8 A;  4A3W A;  1K7I A;  1IAE A;  3F16 A;  4PKT A;  1AST A;  1RMZ A;  3KEJ A;  1XUR A;  1CXV A;  1B3D A;  2OY2 A;  3OHL A;  5L79 A;  3EWJ A;  4FU4 A;  2XS4 A;  3EDI A;  2DW2 A;  1ZXC A;  2MZH A;  4J4M A;  1C3I A;  1G05 A;  1HFC A;  3HDB A;  1XFU A;  2YB9 A;  1PWU A;  3LIL A;  5D3C A;  4A7B A;  4G0D A;  2WOA A;  1FBL A;  4WKI A;  1R1I A;  3LIR A;  3CKI A;  4Q1L A;  3SHI A;  2CLT A;  3F18 A;  3KEC A;  3I7I A;  1G4K A;  1BM6 A;  1YP1 A;  3DL1 A;  3O2X A;  3LJT A;  4XCT A;  1SLN A;  1A85 A;  1TVI A;  3HDA P;  2OW1 A;  2SRT A;  1XFX A;  3LQ0 A;  2MLR A;  3HYG A;  3UVC A;  1JAO A;  3U1R A;  2QPJ A;  2X3C A;  4GWN A;  3OHO A;  5I12 A;  3ELM A;  5BOY A;  4GR8 A;  2FV5 A;  1Z3J A;  1OS9 A;  2WO9 A;  1Y93 A;  2MZE A;  3HY7 A;  1CGF A;  1EAK A;  2MLS A;  3EDZ A;  3LJZ A;  2J83 A;  4DPE A;  4GUY A;  3HBU P;  1K7Q A;  1XAX A;  2OI0 A;  4CTH A;  2L0R A;  1H71 P;  5H8X A;  2DW1 A;  1XFW A;  1PWQ A;  3GBO A;  1C8T A;  3B2Z A;  1HY7 A;  4XM6 A;  3EDH A;  3VI1 A;  3P24 A;  5JMY A;  2OVZ A;  3WV3 A;  1BIW A;  1D8M A;  3BA0 A;  1OO9 A;  1OMJ A;  3DWB A;  3I7G A;  3F1A A;  3O64 A;  3K7L A;  1OM7 A;  5D7W A;  1ZXV A;  4DF9 A;  1QJI A;  4H30 A;  2W12 A;  1QJJ A;  1G9K A;  1XFY A;  1PWV A;  3HY9 A;  4GWM A;  4FXQ A;  4WZV A;  3B92 A;  1B8Y A;  2Z2D A;  4AUO A;  1AF0 A;  3KHI A;  1BZS A;  1S4B P;  3HBV P;  1YQY A;  5BPA A;  2RJQ A;  3ZVS A;  3WV1 A;  2K9C A;  3TT4 A;  1DTH A;  1D8F A;  4JA1 A;  3RTT A;  1ZP5 A;  1SU3 A;  1ROS A;  4EFS A;  4GR3 A;  3HB2 P;  1MMR A;  1SRP A;  1GE5 A;  4L19 A;  4IN9 A;  1MMP A;  1R54 A;  2X3A A;  4XM7 A;  2OW0 A;  1ZTQ A;  4L7A A;  4PKV A;  3F19 A;  1SAT A;  2DW0 A;  1UEA A;  4JIJ A;  4R3V A;  3Q2G A;  4DD8 A;  2AIG P;  3DTK A;  2ERO A;  1MMB A;  2JIH A;  4DV8 A;  4PKR A;  1A86 A;  1XM5 A;  4H84 A;  2ERQ A;  3LKA A;  1Y8J A;  2OY4 A;  2KRJ A;  1QUA A;  3ZUK A;  1D5J A;  1FM1 A;  2O36 A;  1IAC A;  1CIZ A;  1OZ9 A;  2TCL A;  2JT6 A;  966C A;  1DMT A;  1CGE A;  1ATL A;  2XS3 A;  1AYK A;  3LIK A;  3EHX A;  1J7N A;  1XUD A;  1R1J A;  3DPF A;  2V4B A;  1IAB A;  3N2U A;  3KMC A;  1JIZ A;  2N8R A;  4WF6 A;  5BOT A;  3DTE A;  4AYK A;  2MZI A;  1GXD A;  1GKD A;  2Y6C A;  5D1U A;  1GE6 A;  1Y0V A;  1XFZ A;  1OM6 A;  3WV2 A;  3LQB A;  3EHY A;  2OVX A;  2K2G A;  2W15 A;  4ILW D;  1L6J A;  1KAP P;  4PKS A;  5I2Z A;  2OXW A;  4H1Q A;  5B5O A;  1IAD A;  5D1S A;  1SMP A;  2OW9 A;  1UMT A;  1GKC A;  2USN A;  1KUF A;  1KUH A;  4H82 A;  3F17 A;  4H76 A;  1RM8 A;  3VTG A;  1OS2 A;  3LE9 A;  2OXZ A;  4FXY P;  4AXQ A;  2AYK A;  1UTT A;  2OW2 A;  1IAG A;  2FV9 A;  1JAQ A;  2X7M A;  1WNI A;  1XUC A;  4WK7 A;  1BKC A;  4HMA A;  1C7K A;  1CQR A;  3LUN A;  3G42 A;  3DNG A;  1CK7 A;  1PWP A;  1G49 A;  4L63 A;  3USN A;  4WKE A;  1Q3A A;  3NX7 A;  1BQO A;  1GO8 P;  1IAA A;  4I35 A;  1XFV A;  1I1I P;  1SLM A;  1I76 A;  1BQQ M;  3MA2 A;  1AKL A;  4H2E A;  3Q2H A;  1BKC E;  2RJP A;  3RTS A;  5I3M A;  2WO8 A;  1MMQ A;  2JSD A;  5D2B A;  5L7F A;  3N2V A;  3P1V A;  2D1N A;  3KME A;  3LEA A;  1EUB A;  1I73 A;  4GR0 A;  1HOV A;  1UTZ A;  2POJ A;  1GE7 A;  1QIC A;  4IJO A;  4IUW A;  1HV5 A;  2JT5 A;  5LAB A;  2Y6D A;  5I43 A;  1USN A;  3LUM A;  2X3B A;  1JH1 A;  5CZM A;  1D7X A;  3DTI A;  4PKU A;  4AIG A;  1R1H A;  2YUF A;  2E3X A;  5CUH A;  4ON1 A;  4H3X A;  1ZS0 A;  4HX3 A;  1YCM A;  3DSL A;  4H49 A;  1BKC I;  3KRY A;  1HFS A; 
#chains in the Genus database with same CATH homology
 2ERP A;  1BSW A;  5CXA A;  3K7N A;  3AYU A;  2CKI A;  2HU6 A;  1EB6 A;  4JP4 A;  3LMC A;  4QKZ A;  3EDG A;  4JQG A;  2E2D A;  1ZVX A;  4GF1 A;  2I47 A;  1QIA A;  4PKW A;  1KUG A;  3ZXH A;  1JAN A;  2A8H A;  1JJ9 A;  3TVC A;  1O0Q A;  2J0T A;  2W14 A;  5B5P A;  3B8Z A;  3G5C A;  1CAQ A;  1YOU A;  3L0V A;  1JKY A;  1KUI A;  1KBC A;  1ND1 A;  3DPE A;  3F15 A;  2PJT A;  1PWW A;  2JNP A;  4G9L A;  3V96 B;  3KEK A;  2DDF A;  4ZR5 A;  4I03 A;  3LGP A;  1JK3 A;  830C A;  4XBH A;  1JAP A;  1UMS A;  1BUV M;  2OZR A;  3AIG A;  1KUK A;  1R55 A;  3AYK A;  2OXU A;  456C A;  4PKQ A;  3KWV C;  5D1T A;  2W0D A;  1G12 A;  1MNC A;  1GO7 P;  2YIG A;  1BUD A;  1O0T A;  4GQL A;  4FVL A;  1K7G A;  1JIW P;  4XM8 A;  1HTD A;  1FLS A;  1CGL A;  2O3E A;  3LJG A;  3LK8 A;  2D1O A;  4L6T A;  4JPA A;  1QIB A;  5I0L A;  3TS4 A;  5I4O A;  3TSK A;  3E8R A;  2W13 A;  2DDY A;  3L0T A;  1OM8 A;  4A3W A;  1K7I A;  1IAE A;  3F16 A;  4PKT A;  1AST A;  1RMZ A;  3KEJ A;  1XUR A;  1CXV A;  1B3D A;  2OY2 A;  3OHL A;  5L79 A;  3EWJ A;  4FU4 A;  2XS4 A;  3EDI A;  2DW2 A;  1ZXC A;  2MZH A;  4J4M A;  1C3I A;  1G05 A;  1HFC A;  3HDB A;  1XFU A;  2YB9 A;  1PWU A;  3LIL A;  5D3C A;  4A7B A;  4G0D A;  2WOA A;  1FBL A;  4WKI A;  1R1I A;  3LIR A;  3CKI A;  4Q1L A;  3SHI A;  2CLT A;  3F18 A;  3KEC A;  3I7I A;  1G4K A;  1BM6 A;  1YP1 A;  3DL1 A;  3O2X A;  3LJT A;  4XCT A;  1SLN A;  1A85 A;  3HDA P;  2OW1 A;  2SRT A;  1XFX A;  3LQ0 A;  2MLR A;  3HYG A;  3UVC A;  1JAO A;  3U1R A;  2QPJ A;  2X3C A;  4GWN A;  3OHO A;  5I12 A;  3ELM A;  5BOY A;  4GR8 A;  2FV5 A;  1Z3J A;  1OS9 A;  2WO9 A;  1Y93 A;  2MZE A;  3HY7 A;  1CGF A;  1EAK A;  2MLS A;  3EDZ A;  3LJZ A;  2J83 A;  4DPE A;  4GUY A;  3HBU P;  1K7Q A;  2OI0 A;  4CTH A;  2L0R A;  1H71 P;  5H8X A;  2DW1 A;  1XFW A;  1PWQ A;  3GBO A;  1C8T A;  3B2Z A;  1HY7 A;  4XM6 A;  3EDH A;  3VI1 A;  3P24 A;  5JMY A;  2OVZ A;  3WV3 A;  1BIW A;  1D8M A;  3BA0 A;  1OO9 A;  1OMJ A;  3DWB A;  3I7G A;  3F1A A;  3O64 A;  3K7L A;  1OM7 A;  5D7W A;  1ZXV A;  4DF9 A;  1QJI A;  4H30 A;  2W12 A;  1QJJ A;  1G9K A;  1XFY A;  1PWV A;  3HY9 A;  4GWM A;  4FXQ A;  4WZV A;  3B92 A;  1B8Y A;  2Z2D A;  4AUO A;  1AF0 A;  3KHI A;  1BZS A;  1S4B P;  3HBV P;  1YQY A;  5BPA A;  2RJQ A;  3ZVS A;  3WV1 A;  2K9C A;  3TT4 A;  1DTH A;  1D8F A;  4JA1 A;  3RTT A;  1ZP5 A;  1SU3 A;  1ROS A;  4EFS A;  4GR3 A;  3HB2 P;  1MMR A;  1SRP A;  1GE5 A;  4L19 A;  4IN9 A;  1MMP A;  1R54 A;  2X3A A;  4XM7 A;  2OW0 A;  1ZTQ A;  4L7A A;  4PKV A;  3F19 A;  1SAT A;  2DW0 A;  1UEA A;  4JIJ A;  4R3V A;  3Q2G A;  4DD8 A;  2AIG P;  3DTK A;  2ERO A;  1MMB A;  2JIH A;  4DV8 A;  4PKR A;  1A86 A;  4H84 A;  2ERQ A;  3LKA A;  1Y8J A;  2OY4 A;  2KRJ A;  1QUA A;  3ZUK A;  1D5J A;  1FM1 A;  2O36 A;  1IAC A;  1CIZ A;  2TCL A;  2JT6 A;  966C A;  1DMT A;  1CGE A;  1ATL A;  2XS3 A;  1AYK A;  3LIK A;  3EHX A;  1J7N A;  1XUD A;  1R1J A;  3DPF A;  2V4B A;  1IAB A;  3N2U A;  3KMC A;  1JIZ A;  2N8R A;  4WF6 A;  5BOT A;  3DTE A;  4AYK A;  2MZI A;  1GXD A;  1GKD A;  2Y6C A;  5D1U A;  1GE6 A;  1Y0V A;  1XFZ A;  1OM6 A;  3WV2 A;  3LQB A;  3EHY A;  2OVX A;  2K2G A;  2W15 A;  4ILW D;  1L6J A;  1KAP P;  4PKS A;  5I2Z A;  2OXW A;  4H1Q A;  5B5O A;  1IAD A;  5D1S A;  1SMP A;  2OW9 A;  1UMT A;  1GKC A;  2USN A;  1KUF A;  1KUH A;  4H82 A;  3F17 A;  4H76 A;  1RM8 A;  3VTG A;  1OS2 A;  3LE9 A;  2OXZ A;  4FXY P;  4AXQ A;  2AYK A;  1UTT A;  2OW2 A;  1IAG A;  2FV9 A;  1JAQ A;  2X7M A;  1WNI A;  1XUC A;  4WK7 A;  1BKC A;  4HMA A;  1C7K A;  1CQR A;  3LUN A;  3G42 A;  3DNG A;  1CK7 A;  1PWP A;  1G49 A;  4L63 A;  3USN A;  4WKE A;  1Q3A A;  3NX7 A;  1BQO A;  1GO8 P;  1IAA A;  4I35 A;  1XFV A;  1I1I P;  1SLM A;  1I76 A;  1BQQ M;  3MA2 A;  1AKL A;  4H2E A;  3Q2H A;  1BKC E;  2RJP A;  3RTS A;  5I3M A;  2WO8 A;  1MMQ A;  2JSD A;  5D2B A;  5L7F A;  3N2V A;  3P1V A;  2D1N A;  3KME A;  3LEA A;  1EUB A;  1I73 A;  4GR0 A;  1HOV A;  1UTZ A;  2POJ A;  1GE7 A;  1QIC A;  4IJO A;  4IUW A;  1HV5 A;  2JT5 A;  5LAB A;  2Y6D A;  5I43 A;  1USN A;  3LUM A;  2X3B A;  1JH1 A;  5CZM A;  1D7X A;  3DTI A;  4PKU A;  4AIG A;  1R1H A;  2YUF A;  2E3X A;  5CUH A;  4ON1 A;  4H3X A;  1ZS0 A;  4HX3 A;  1YCM A;  3DSL A;  4H49 A;  1BKC I;  3KRY A;  1HFS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...