3F19A

Crystal structure of the catalytic domain of human mmp12 complexed with the inhibitor 4-fluoro-n-(2-nitroso-2-oxoethyl)benzenesulfonamide
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
158
structure length
158
Chain Sequence
GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFSKINTGMADILVVFARGAHGDDHAFDGKGGILAHAFGPGSGIGGDAHFDEDEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Macrophage metalloelastase
publication title Exploring the subtleties of drug-receptor interactions: the case of matrix metalloproteinases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 44
structure length 158
sequence length 158
ec nomenclature ec 3.4.24.65: Macrophage elastase.
pdb deposition date 2008-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00413 Peptidase_M10 Matrixin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 3f19A00
2X3AA 2E2DA 4WF6A 2DW2A 4AUOA 3B2ZA 3VI1A 3LJGA 3F16A 1AF0A 2CKIA 4J4MA 3AYKA 4EFSA 1BM6A 1PWVA 1Y8JA 4AYKA 1XUDA 3EDZA 2WOAA 1YP1A 1JH1A 966CA 1BQQM 1IACA 1QJIA 2W15A 4PKQA 2OXUA 3EHYA 3OHLA 1XFZA 1D5JA 2W12A 2JT5A 3HB2P 1IABA 2RJQA 1BKCA 3LGPA 1GE6A 4HX3A 4JPAA 5CUHA 3LIRA 5JMYA 1L6JA 5B5OA 3BA0A 2OZRA 2JSDA 2XS4A 4PKUA 1MMRA 1ATLA 4DF9A 1XFVA 3DL1A 1K7QA 4IN9A 1GKDA 1UMSA 1BZSA 2JIHA 3KEJA 4XM6A 1B3DA 3N2VA 4Q1LA 1FM1A 3DWBA 3ELMA 3V96B 1I76A 1QIAA 3USNA 4GWNA 3HDAP 4PKSA 1XFXA 3F1AA 5I2ZA 3TVCA 1BSWA 4R3VA 2W0DA 1GO7P 1C3IA 4QKZA 1SLMA 1XURA 3F17A 4ZR5A 2Z2DA 2POJA 2USNA 4I03A 2V4BA 4GUYA 1C8TA 1JKYA 1EB6A 4FXYP 1Q3AA 1IAAA 1MMQA 4H2EA 3G42A 2OW0A 1OM7A 2FV9A 2N8RA 2A8HA 3EHXA 3KMCA 1PWUA 3LQ0A 4GR8A 4H3XA 2Y6CA 1OM8A 1HY7A 3O64A 1H71P 1SU3A 4XBHA 1JIWP 3HDBA 4H82A 5L79A 2MZIA 1USNA 2XS3A 1QUAA 1CIZA 4A7BA 4DPEA 3Q2GA 3F18A 2MZHA 5BPAA 2DDFA 2EROA 1RMZA 1QJJA 3N2UA 3ZXHA 4GQLA 1UTZA 2KRJA 1BKCI 1D8MA 4G0DA 1SATA 2AYKA 3P1VA 2OW1A 1CXVA 1IADA 3F15A 5D3CA 2QPJA 1JAOA 2OW2A 5D2BA 1K7IA 1R54A 5BOTA 2OXZA 3LUMA 5I4OA 5D1TA 1GXDA 1HFCA 1QICA 2MZEA 5B5PA 1GE7A 3G5CA 1KUIA 4JIJA 4PKWA 1B8YA 3HYGA 1G49A 1YCMA 1ND1A 1GO8P 3AYUA 1WNIA 4WKIA 1KUHA 4GF1A 1YOUA 2DW0A 4GR3A 3EWJA 3NX7A 1JANA 2JNPA 2MLSA 3TT4A 1QIBA 1DMTA 3L0VA 3LJZA 4AIGA 3EDHA 2OVZA 1XFUA 1HOVA 3LKAA 1CK7A 5CXAA 3I7GA 4JP4A 2OXWA 2O36A 1ASTA 1GKCA 1JIZA 2I47A 3DPFA 3KEKA 2DW1A 1ZP5A 1OM6A 1ZXCA 1BUVM 1BUDA 2AIGP 3P24A 1I73A 4A3WA 2D1NA 1HFSA 3LILA 3KMEA 1MMPA 4PKRA 5D7WA 1I1IP 1JAPA 4L6TA 5I3MA 3GBOA 3VTGA 2O3EA 1G4KA 3B92A 4ILWD 3SHIA 3O2XA 1R55A 3TSKA 1KUGA 1CAQA 4ON1A 3RTSA 3TS4A 1GE5A 2YIGA 1J7NA 4WK7A 2ERPA 4WZVA 1FBLA 5D1UA 3F19A 4FXQA 3KECA 2MLRA 2K9CA 2OY4A 5I12A 4DV8A 830CA 5H8XA 1XUCA 4HMAA 2PJTA 1KAPP 1ZXVA 456CA 3KHIA 1AYKA 3LE9A 3U1RA 4FU4A 4JA1A 1AKLA 1XFYA 1DTHA 1XFWA 1OO9A 3EDIA 4H1QA 3I7IA 3EDGA 3KRYA 1HV5A 2K2GA 5LABA 3LMCA 4XCTA 1PWQA 3OHOA 3Q2HA 2OW9A 4H76A 4IUWA 1JK3A 3K7LA 1R1IA 1G9KA 1S4BP 2J83A 4L19A 1O0QA 4JQGA 3LEAA 1KBCA 3L0TA 3K7NA 2X3BA 3HBUP 1PWWA 4H84A 2SRTA 1EUBA 5I43A 1BKCE 3LK8A 4CTHA 1CGLA 2DDYA 2JT6A 4IJOA 4WKEA 1SLNA 1ZS0A 2WO9A 2Y6DA 1CQRA 3CKIA 3DPEA 3AIGA 4PKVA 1MNCA 1R1JA 1IAEA 1ZTQA 1MMBA 4GR0A 2YB9A 3WV3A 3WV1A 1D7XA 1UTTA 1A86A 1UEAA 4FVLA 1FLSA 4AXQA 1YQYA 1G12A 1BQOA 2WO8A 5I0LA 1BIWA 3UVCA 3B8ZA 4XM8A 1R1HA 1JJ9A 2OVXA 3ZUKA 2OY2A 4G9LA 1A85A 3HBVP 3LUNA 2E3XA 4PKTA 2X7MA 3WV2A 3MA2A 1JAQA 1SRPA 5BOYA 4DD8A 1OS9A 3DSLA 2OI0A 1EAKA 1Y0VA 1KUFA 1OMJA 1IAGA 5CZMA 2HU6A 2J0TA 1OS2A 1ROSA 4L63A 3HY9A 4H30A 4GWMA 1UMTA 3ZVSA 1CGEA 2CLTA 3DNGA 1O0TA 4I35A 2RJPA 3E8RA 2W13A 2FV5A 1SMPA 2W14A 2X3CA 1Y93A 3HY7A 2TCLA 1KUKA 3LJTA 1RM8A 2L0RA 1PWPA 4H49A 1Z3JA 1D8FA 3KWVC 1K7GA 3RTTA 5L7FA 3LIKA 1C7KA 5D1SA 2D1OA 1G05A 1CGFA 1ZVXA 1HTDA 2ERQA 4XM7A 3LQBA
chains in the Genus database with same CATH superfamily
2X3AA 2E2DA 1TVIA 4WF6A 2DW2A 4AUOA 3B2ZA 3VI1A 3LJGA 3F16A 1AF0A 2CKIA 4J4MA 3AYKA 4EFSA 1BM6A 1PWVA 1Y8JA 4AYKA 1XUDA 3EDZA 2WOAA 1YP1A 1JH1A 966CA 1BQQM 1IACA 1QJIA 2W15A 4PKQA 2OXUA 3EHYA 3OHLA 1XFZA 1D5JA 2W12A 2JT5A 3HB2P 1IABA 2RJQA 1BKCA 3LGPA 3DTIA 1GE6A 4HX3A 4JPAA 5CUHA 3LIRA 5JMYA 1L6JA 5B5OA 3BA0A 2OZRA 2JSDA 2XS4A 4PKUA 1MMRA 1ATLA 4L7AA 4DF9A 1XFVA 3DL1A 1K7QA 4IN9A 1GKDA 1UMSA 1BZSA 2JIHA 3KEJA 4XM6A 1B3DA 3N2VA 4Q1LA 1FM1A 3DWBA 3ELMA 3V96B 1I76A 1QIAA 3USNA 4GWNA 3HDAP 4PKSA 1XFXA 3F1AA 5I2ZA 3TVCA 1BSWA 4R3VA 2W0DA 1GO7P 1C3IA 4QKZA 1SLMA 1XURA 3F17A 4ZR5A 2Z2DA 2POJA 2USNA 4I03A 2V4BA 4GUYA 1C8TA 1JKYA 1EB6A 4FXYP 1Q3AA 1IAAA 1MMQA 4H2EA 3G42A 2OW0A 1OM7A 2FV9A 2N8RA 2A8HA 3EHXA 3KMCA 1PWUA 3LQ0A 4GR8A 4H3XA 2Y6CA 1OM8A 1HY7A 3O64A 1H71P 1SU3A 4XBHA 1JIWP 3HDBA 4H82A 5L79A 2MZIA 1USNA 2XS3A 1QUAA 1CIZA 4A7BA 4DPEA 3Q2GA 3F18A 2MZHA 5BPAA 2DDFA 2EROA 1RMZA 1QJJA 3N2UA 3ZXHA 4GQLA 1UTZA 2KRJA 1BKCI 1D8MA 4G0DA 1SATA 2AYKA 3P1VA 2OW1A 1CXVA 1IADA 3F15A 5D3CA 2QPJA 1JAOA 2OW2A 5D2BA 1K7IA 1R54A 5BOTA 2OXZA 3LUMA 5I4OA 5D1TA 1GXDA 1HFCA 1QICA 2MZEA 5B5PA 1GE7A 3G5CA 1KUIA 4JIJA 4PKWA 1B8YA 3HYGA 1G49A 1YCMA 1ND1A 1GO8P 3AYUA 1WNIA 4WKIA 1KUHA 4GF1A 1YOUA 2DW0A 4GR3A 3EWJA 3NX7A 1JANA 2JNPA 2MLSA 3TT4A 1QIBA 1DMTA 3L0VA 3LJZA 4AIGA 3EDHA 2OVZA 1XFUA 1HOVA 3LKAA 1CK7A 5CXAA 3I7GA 4JP4A 2OXWA 2O36A 1ASTA 1GKCA 1JIZA 2I47A 3DPFA 3KEKA 2DW1A 1ZP5A 1OM6A 1ZXCA 1BUVM 1BUDA 2AIGP 3P24A 1I73A 4A3WA 2D1NA 1HFSA 3LILA 3KMEA 1MMPA 4PKRA 5D7WA 1I1IP 1JAPA 1XM5A 4L6TA 5I3MA 3GBOA 3VTGA 2O3EA 1G4KA 3B92A 4ILWD 3SHIA 3O2XA 1R55A 3TSKA 1KUGA 1CAQA 4ON1A 3RTSA 3TS4A 1OZ9A 1GE5A 2YIGA 1J7NA 4WK7A 2ERPA 4WZVA 1FBLA 5D1UA 3F19A 4FXQA 3KECA 2MLRA 2K9CA 2OY4A 5I12A 4DV8A 830CA 5H8XA 1XUCA 4HMAA 2PJTA 1KAPP 1ZXVA 456CA 3KHIA 1AYKA 3LE9A 3U1RA 4FU4A 4JA1A 1AKLA 1XFYA 1DTHA 1XFWA 1OO9A 3EDIA 4H1QA 3I7IA 3EDGA 3KRYA 1HV5A 2K2GA 5LABA 3LMCA 4XCTA 1PWQA 3OHOA 3Q2HA 2OW9A 4H76A 4IUWA 1JK3A 3K7LA 1R1IA 1G9KA 1S4BP 2J83A 4L19A 1O0QA 4JQGA 3LEAA 1KBCA 3L0TA 3K7NA 2X3BA 4XM7A 3HBUP 1PWWA 4H84A 2SRTA 1EUBA 5I43A 1BKCE 3LK8A 4CTHA 1CGLA 2DDYA 2JT6A 4IJOA 4WKEA 1SLNA 1ZS0A 2WO9A 2Y6DA 1CQRA 3CKIA 3DPEA 3AIGA 4PKVA 1MNCA 1R1JA 1IAEA 1ZTQA 1MMBA 4GR0A 2YB9A 3WV3A 3WV1A 1D7XA 1UTTA 1A86A 1UEAA 4FVLA 1FLSA 4AXQA 1YQYA 1G12A 1BQOA 2WO8A 5I0LA 1BIWA 3UVCA 3B8ZA 4XM8A 1R1HA 1JJ9A 2OVXA 3DTKA 3ZUKA 2OY2A 4G9LA 1A85A 3HBVP 3LUNA 2E3XA 4PKTA 2X7MA 3WV2A 3DTEA 3MA2A 1JAQA 1SRPA 5BOYA 4DD8A 1OS9A 3DSLA 2OI0A 1EAKA 1Y0VA 1KUFA 1OMJA 1IAGA 5CZMA 2HU6A 2J0TA 1OS2A 1ROSA 4L63A 3HY9A 4H30A 4GWMA 1UMTA 3ZVSA 1CGEA 2CLTA 3DNGA 1O0TA 4I35A 2RJPA 2YUFA 3E8RA 2W13A 2FV5A 1SMPA 2W14A 2X3CA 1Y93A 3HY7A 2TCLA 1KUKA 3LJTA 1RM8A 2L0RA 1PWPA 4H49A 1Z3JA 1D8FA 3KWVC 1K7GA 3RTTA 5L7FA 3LIKA 1C7KA 5D1SA 2D1OA 1G05A 1CGFA 1ZVXA 1HTDA 2ERQA 1XAXA 3LQBA
chains in the Genus database with same CATH topology
2X3AA 2E2DA 4WF6A 2DW2A 4AUOA 3B2ZA 3VI1A 3LJGA 3F16A 1AF0A 2CKIA 4J4MA 3AYKA 4EFSA 1BM6A 1PWVA 1Y8JA 4AYKA 1XUDA 3EDZA 2WOAA 1YP1A 1JH1A 966CA 1BQQM 1IACA 1QJIA 2W15A 4PKQA 2OXUA 3EHYA 3OHLA 1XFZA 1D5JA 2W12A 2JT5A 3HB2P 1IABA 2RJQA 1BKCA 3LGPA 3DTIA 1GE6A 4HX3A 4JPAA 5CUHA 3LIRA 5JMYA 1L6JA 5B5OA 3BA0A 2OZRA 2JSDA 2XS4A 4PKUA 1MMRA 1ATLA 4L7AA 4DF9A 1XFVA 3DL1A 1K7QA 4IN9A 1GKDA 1UMSA 1BZSA 2JIHA 3KEJA 4XM6A 1B3DA 3N2VA 4Q1LA 1FM1A 3DWBA 3ELMA 3V96B 1I76A 1QIAA 3USNA 4GWNA 3HDAP 4PKSA 1XFXA 3F1AA 5I2ZA 3TVCA 1BSWA 4R3VA 2W0DA 1GO7P 1C3IA 4QKZA 1SLMA 1XURA 3F17A 4ZR5A 2Z2DA 2POJA 2USNA 4I03A 2V4BA 4GUYA 1C8TA 1JKYA 1EB6A 4FXYP 1Q3AA 1IAAA 1MMQA 4H2EA 3G42A 2OW0A 1OM7A 2FV9A 2N8RA 2A8HA 3EHXA 3KMCA 1PWUA 3LQ0A 4GR8A 4H3XA 2Y6CA 1OM8A 1HY7A 3O64A 1H71P 1SU3A 4XBHA 1JIWP 3HDBA 4H82A 5L79A 2MZIA 1USNA 2XS3A 1QUAA 1CIZA 4A7BA 4DPEA 3Q2GA 3F18A 2MZHA 5BPAA 2DDFA 2EROA 1RMZA 1QJJA 3N2UA 3ZXHA 4GQLA 1UTZA 2KRJA 1BKCI 1D8MA 4G0DA 1SATA 2AYKA 3P1VA 2OW1A 1CXVA 1IADA 3F15A 5D3CA 2QPJA 1JAOA 2OW2A 5D2BA 1K7IA 1R54A 5BOTA 2OXZA 3LUMA 5I4OA 5D1TA 1GXDA 1HFCA 1QICA 2MZEA 5B5PA 1GE7A 3G5CA 1KUIA 4JIJA 4PKWA 1B8YA 3HYGA 1G49A 1YCMA 1ND1A 1GO8P 3AYUA 1WNIA 4WKIA 1KUHA 4GF1A 1YOUA 2DW0A 4GR3A 3EWJA 3NX7A 1JANA 2JNPA 2MLSA 3TT4A 1QIBA 1DMTA 3L0VA 3LJZA 4AIGA 3EDHA 2OVZA 1XFUA 1HOVA 3LKAA 1CK7A 5CXAA 3I7GA 4JP4A 2OXWA 2O36A 1ASTA 1GKCA 1JIZA 2I47A 3DPFA 3KEKA 2DW1A 1ZP5A 1OM6A 1ZXCA 1BUVM 1BUDA 2AIGP 3P24A 1I73A 4A3WA 2D1NA 1HFSA 3LILA 3KMEA 1MMPA 4PKRA 5D7WA 1I1IP 1JAPA 4L6TA 5I3MA 3GBOA 3VTGA 2O3EA 1G4KA 3B92A 4ILWD 3SHIA 3O2XA 1R55A 3TSKA 1KUGA 1CAQA 4ON1A 3RTSA 3TS4A 1GE5A 2YIGA 1J7NA 4WK7A 2ERPA 4WZVA 1FBLA 5D1UA 3F19A 4FXQA 3KECA 2MLRA 2K9CA 2OY4A 5I12A 4DV8A 830CA 5H8XA 1XUCA 4HMAA 2PJTA 1KAPP 1ZXVA 456CA 3KHIA 1AYKA 3LE9A 3U1RA 4FU4A 4JA1A 1AKLA 1XFYA 1DTHA 1XFWA 1OO9A 3EDIA 4H1QA 3I7IA 3EDGA 3KRYA 1HV5A 2K2GA 5LABA 3LMCA 4XCTA 1PWQA 3OHOA 3Q2HA 2OW9A 4H76A 4IUWA 1JK3A 3K7LA 1R1IA 1G9KA 1S4BP 2J83A 4L19A 1O0QA 4JQGA 3LEAA 1KBCA 3L0TA 3K7NA 2X3BA 3HBUP 1PWWA 4H84A 2SRTA 1EUBA 5I43A 1BKCE 3LK8A 4CTHA 1CGLA 2DDYA 2JT6A 4IJOA 4WKEA 1SLNA 1ZS0A 2WO9A 2Y6DA 1CQRA 3CKIA 3DPEA 3AIGA 4PKVA 1MNCA 1R1JA 1IAEA 1ZTQA 1MMBA 4GR0A 2YB9A 3WV3A 3WV1A 1D7XA 1UTTA 1A86A 1UEAA 4FVLA 1FLSA 4AXQA 1YQYA 1G12A 1BQOA 2WO8A 5I0LA 1BIWA 3UVCA 3B8ZA 4XM8A 1R1HA 1JJ9A 2OVXA 3DTKA 3ZUKA 2OY2A 4G9LA 1A85A 3HBVP 3LUNA 2E3XA 4PKTA 2X7MA 3WV2A 3DTEA 3MA2A 1JAQA 1SRPA 5BOYA 4DD8A 1OS9A 3DSLA 2OI0A 1EAKA 1Y0VA 1KUFA 1OMJA 1IAGA 5CZMA 2HU6A 2J0TA 1OS2A 1ROSA 4L63A 3HY9A 4H30A 4GWMA 1UMTA 3ZVSA 1CGEA 2CLTA 3DNGA 1O0TA 4I35A 2RJPA 2YUFA 3E8RA 2W13A 2FV5A 1SMPA 2W14A 2X3CA 1Y93A 3HY7A 2TCLA 1KUKA 3LJTA 1RM8A 2L0RA 1PWPA 4H49A 1Z3JA 1D8FA 3KWVC 1K7GA 3RTTA 5L7FA 3LIKA 1C7KA 5D1SA 2D1OA 1G05A 1CGFA 1ZVXA 1HTDA 2ERQA 4XM7A 3LQBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X3A A;  2E2D A;  4WF6 A;  2DW2 A;  4AUO A;  3B2Z A;  3VI1 A;  3LJG A;  3F16 A;  1AF0 A;  2CKI A;  4J4M A;  3AYK A;  4EFS A;  1BM6 A;  1PWV A;  1Y8J A;  4AYK A;  1XUD A;  3EDZ A;  2WOA A;  1YP1 A;  1JH1 A;  966C A;  1BQQ M;  1IAC A;  1QJI A;  2W15 A;  4PKQ A;  2OXU A;  3EHY A;  3OHL A;  1XFZ A;  1D5J A;  2W12 A;  2JT5 A;  3HB2 P;  1IAB A;  2RJQ A;  1BKC A;  3LGP A;  1GE6 A;  4HX3 A;  4JPA A;  5CUH A;  3LIR A;  5JMY A;  1L6J A;  5B5O A;  3BA0 A;  2OZR A;  2JSD A;  2XS4 A;  4PKU A;  1MMR A;  1ATL A;  4DF9 A;  1XFV A;  3DL1 A;  1K7Q A;  4IN9 A;  1GKD A;  1UMS A;  1BZS A;  2JIH A;  3KEJ A;  4XM6 A;  1B3D A;  3N2V A;  4Q1L A;  1FM1 A;  3DWB A;  3ELM A;  3V96 B;  1I76 A;  1QIA A;  3USN A;  4GWN A;  3HDA P;  4PKS A;  1XFX A;  3F1A A;  5I2Z A;  3TVC A;  1BSW A;  4R3V A;  2W0D A;  1GO7 P;  1C3I A;  4QKZ A;  1SLM A;  1XUR A;  3F17 A;  4ZR5 A;  2Z2D A;  2POJ A;  2USN A;  4I03 A;  2V4B A;  4GUY A;  1C8T A;  1JKY A;  1EB6 A;  4FXY P;  1Q3A A;  1IAA A;  1MMQ A;  4H2E A;  3G42 A;  2OW0 A;  1OM7 A;  2FV9 A;  2N8R A;  2A8H A;  3EHX A;  3KMC A;  1PWU A;  3LQ0 A;  4GR8 A;  4H3X A;  2Y6C A;  1OM8 A;  1HY7 A;  3O64 A;  1H71 P;  1SU3 A;  4XBH A;  1JIW P;  3HDB A;  4H82 A;  5L79 A;  2MZI A;  1USN A;  2XS3 A;  1QUA A;  1CIZ A;  4A7B A;  4DPE A;  3Q2G A;  3F18 A;  2MZH A;  5BPA A;  2DDF A;  2ERO A;  1RMZ A;  1QJJ A;  3N2U A;  3ZXH A;  4GQL A;  1UTZ A;  2KRJ A;  1BKC I;  1D8M A;  4G0D A;  1SAT A;  2AYK A;  3P1V A;  2OW1 A;  1CXV A;  1IAD A;  3F15 A;  5D3C A;  2QPJ A;  1JAO A;  2OW2 A;  5D2B A;  1K7I A;  1R54 A;  5BOT A;  2OXZ A;  3LUM A;  5I4O A;  5D1T A;  1GXD A;  1HFC A;  1QIC A;  2MZE A;  5B5P A;  1GE7 A;  3G5C A;  1KUI A;  4JIJ A;  4PKW A;  1B8Y A;  3HYG A;  1G49 A;  1YCM A;  1ND1 A;  1GO8 P;  3AYU A;  1WNI A;  4WKI A;  1KUH A;  4GF1 A;  1YOU A;  2DW0 A;  4GR3 A;  3EWJ A;  3NX7 A;  1JAN A;  2JNP A;  2MLS A;  3TT4 A;  1QIB A;  1DMT A;  3L0V A;  3LJZ A;  4AIG A;  3EDH A;  2OVZ A;  1XFU A;  1HOV A;  3LKA A;  1CK7 A;  5CXA A;  3I7G A;  4JP4 A;  2OXW A;  2O36 A;  1AST A;  1GKC A;  1JIZ A;  2I47 A;  3DPF A;  3KEK A;  2DW1 A;  1ZP5 A;  1OM6 A;  1ZXC A;  1BUV M;  1BUD A;  2AIG P;  3P24 A;  1I73 A;  4A3W A;  2D1N A;  1HFS A;  3LIL A;  3KME A;  1MMP A;  4PKR A;  5D7W A;  1I1I P;  1JAP A;  4L6T A;  5I3M A;  3GBO A;  3VTG A;  2O3E A;  1G4K A;  3B92 A;  4ILW D;  3SHI A;  3O2X A;  1R55 A;  3TSK A;  1KUG A;  1CAQ A;  4ON1 A;  3RTS A;  3TS4 A;  1GE5 A;  2YIG A;  1J7N A;  4WK7 A;  2ERP A;  4WZV A;  1FBL A;  5D1U A;  3F19 A;  4FXQ A;  3KEC A;  2MLR A;  2K9C A;  2OY4 A;  5I12 A;  4DV8 A;  830C A;  5H8X A;  1XUC A;  4HMA A;  2PJT A;  1KAP P;  1ZXV A;  456C A;  3KHI A;  1AYK A;  3LE9 A;  3U1R A;  4FU4 A;  4JA1 A;  1AKL A;  1XFY A;  1DTH A;  1XFW A;  1OO9 A;  3EDI A;  4H1Q A;  3I7I A;  3EDG A;  3KRY A;  1HV5 A;  2K2G A;  5LAB A;  3LMC A;  4XCT A;  1PWQ A;  3OHO A;  3Q2H A;  2OW9 A;  4H76 A;  4IUW A;  1JK3 A;  3K7L A;  1R1I A;  1G9K A;  1S4B P;  2J83 A;  4L19 A;  1O0Q A;  4JQG A;  3LEA A;  1KBC A;  3L0T A;  3K7N A;  2X3B A;  3HBU P;  1PWW A;  4H84 A;  2SRT A;  1EUB A;  5I43 A;  1BKC E;  3LK8 A;  4CTH A;  1CGL A;  2DDY A;  2JT6 A;  4IJO A;  4WKE A;  1SLN A;  1ZS0 A;  2WO9 A;  2Y6D A;  1CQR A;  3CKI A;  3DPE A;  3AIG A;  4PKV A;  1MNC A;  1R1J A;  1IAE A;  1ZTQ A;  1MMB A;  4GR0 A;  2YB9 A;  3WV3 A;  3WV1 A;  1D7X A;  1UTT A;  1A86 A;  1UEA A;  4FVL A;  1FLS A;  4AXQ A;  1YQY A;  1G12 A;  1BQO A;  2WO8 A;  5I0L A;  1BIW A;  3UVC A;  3B8Z A;  4XM8 A;  1R1H A;  1JJ9 A;  2OVX A;  3ZUK A;  2OY2 A;  4G9L A;  1A85 A;  3HBV P;  3LUN A;  2E3X A;  4PKT A;  2X7M A;  3WV2 A;  3MA2 A;  1JAQ A;  1SRP A;  5BOY A;  4DD8 A;  1OS9 A;  3DSL A;  2OI0 A;  1EAK A;  1Y0V A;  1KUF A;  1OMJ A;  1IAG A;  5CZM A;  2HU6 A;  2J0T A;  1OS2 A;  1ROS A;  4L63 A;  3HY9 A;  4H30 A;  4GWM A;  1UMT A;  3ZVS A;  1CGE A;  2CLT A;  3DNG A;  1O0T A;  4I35 A;  2RJP A;  3E8R A;  2W13 A;  2FV5 A;  1SMP A;  2W14 A;  2X3C A;  1Y93 A;  3HY7 A;  2TCL A;  1KUK A;  3LJT A;  1RM8 A;  2L0R A;  1PWP A;  4H49 A;  1Z3J A;  1D8F A;  3KWV C;  1K7G A;  3RTT A;  5L7F A;  3LIK A;  1C7K A;  5D1S A;  2D1O A;  1G05 A;  1CGF A;  1ZVX A;  1HTD A;  2ERQ A;  4XM7 A;  3LQB A; 
#chains in the Genus database with same CATH topology
 2X3A A;  2E2D A;  1TVI A;  4WF6 A;  2DW2 A;  4AUO A;  3B2Z A;  3VI1 A;  3LJG A;  3F16 A;  1AF0 A;  2CKI A;  4J4M A;  3AYK A;  4EFS A;  1BM6 A;  1PWV A;  1Y8J A;  4AYK A;  1XUD A;  3EDZ A;  2WOA A;  1YP1 A;  1JH1 A;  966C A;  1BQQ M;  1IAC A;  1QJI A;  2W15 A;  4PKQ A;  2OXU A;  3EHY A;  3OHL A;  1XFZ A;  1D5J A;  2W12 A;  2JT5 A;  3HB2 P;  1IAB A;  2RJQ A;  1BKC A;  3LGP A;  3DTI A;  1GE6 A;  4HX3 A;  4JPA A;  5CUH A;  3LIR A;  5JMY A;  1L6J A;  5B5O A;  3BA0 A;  2OZR A;  2JSD A;  2XS4 A;  4PKU A;  1MMR A;  1ATL A;  4L7A A;  4DF9 A;  1XFV A;  3DL1 A;  1K7Q A;  4IN9 A;  1GKD A;  1UMS A;  1BZS A;  2JIH A;  3KEJ A;  4XM6 A;  1B3D A;  3N2V A;  4Q1L A;  1FM1 A;  3DWB A;  3ELM A;  3V96 B;  1I76 A;  1QIA A;  3USN A;  4GWN A;  3HDA P;  4PKS A;  1XFX A;  3F1A A;  5I2Z A;  3TVC A;  1BSW A;  4R3V A;  2W0D A;  1GO7 P;  1C3I A;  4QKZ A;  1SLM A;  1XUR A;  3F17 A;  4ZR5 A;  2Z2D A;  2POJ A;  2USN A;  4I03 A;  2V4B A;  4GUY A;  1C8T A;  1JKY A;  1EB6 A;  4FXY P;  1Q3A A;  1IAA A;  1MMQ A;  4H2E A;  3G42 A;  2OW0 A;  1OM7 A;  2FV9 A;  2N8R A;  2A8H A;  3EHX A;  3KMC A;  1PWU A;  3LQ0 A;  4GR8 A;  4H3X A;  2Y6C A;  1OM8 A;  1HY7 A;  3O64 A;  1H71 P;  1SU3 A;  4XBH A;  1JIW P;  3HDB A;  4H82 A;  5L79 A;  2MZI A;  1USN A;  2XS3 A;  1QUA A;  1CIZ A;  4A7B A;  4DPE A;  3Q2G A;  3F18 A;  2MZH A;  5BPA A;  2DDF A;  2ERO A;  1RMZ A;  1QJJ A;  3N2U A;  3ZXH A;  4GQL A;  1UTZ A;  2KRJ A;  1BKC I;  1D8M A;  4G0D A;  1SAT A;  2AYK A;  3P1V A;  2OW1 A;  1CXV A;  1IAD A;  3F15 A;  5D3C A;  2QPJ A;  1JAO A;  2OW2 A;  5D2B A;  1K7I A;  1R54 A;  5BOT A;  2OXZ A;  3LUM A;  5I4O A;  5D1T A;  1GXD A;  1HFC A;  1QIC A;  2MZE A;  5B5P A;  1GE7 A;  3G5C A;  1KUI A;  4JIJ A;  4PKW A;  1B8Y A;  3HYG A;  1G49 A;  1YCM A;  1ND1 A;  1GO8 P;  3AYU A;  1WNI A;  4WKI A;  1KUH A;  4GF1 A;  1YOU A;  2DW0 A;  4GR3 A;  3EWJ A;  3NX7 A;  1JAN A;  2JNP A;  2MLS A;  3TT4 A;  1QIB A;  1DMT A;  3L0V A;  3LJZ A;  4AIG A;  3EDH A;  2OVZ A;  1XFU A;  1HOV A;  3LKA A;  1CK7 A;  5CXA A;  3I7G A;  4JP4 A;  2OXW A;  2O36 A;  1AST A;  1GKC A;  1JIZ A;  2I47 A;  3DPF A;  3KEK A;  2DW1 A;  1ZP5 A;  1OM6 A;  1ZXC A;  1BUV M;  1BUD A;  2AIG P;  3P24 A;  1I73 A;  4A3W A;  2D1N A;  1HFS A;  3LIL A;  3KME A;  1MMP A;  4PKR A;  5D7W A;  1I1I P;  1JAP A;  1XM5 A;  4L6T A;  5I3M A;  3GBO A;  3VTG A;  2O3E A;  1G4K A;  3B92 A;  4ILW D;  3SHI A;  3O2X A;  1R55 A;  3TSK A;  1KUG A;  1CAQ A;  4ON1 A;  3RTS A;  3TS4 A;  1OZ9 A;  1GE5 A;  2YIG A;  1J7N A;  4WK7 A;  2ERP A;  4WZV A;  1FBL A;  5D1U A;  3F19 A;  4FXQ A;  3KEC A;  2MLR A;  2K9C A;  2OY4 A;  5I12 A;  4DV8 A;  830C A;  5H8X A;  1XUC A;  4HMA A;  2PJT A;  1KAP P;  1ZXV A;  456C A;  3KHI A;  1AYK A;  3LE9 A;  3U1R A;  4FU4 A;  4JA1 A;  1AKL A;  1XFY A;  1DTH A;  1XFW A;  1OO9 A;  3EDI A;  4H1Q A;  3I7I A;  3EDG A;  3KRY A;  1HV5 A;  2K2G A;  5LAB A;  3LMC A;  4XCT A;  1PWQ A;  3OHO A;  3Q2H A;  2OW9 A;  4H76 A;  4IUW A;  1JK3 A;  3K7L A;  1R1I A;  1G9K A;  1S4B P;  2J83 A;  4L19 A;  1O0Q A;  4JQG A;  3LEA A;  1KBC A;  3L0T A;  3K7N A;  2X3B A;  4XM7 A;  3HBU P;  1PWW A;  4H84 A;  2SRT A;  1EUB A;  5I43 A;  1BKC E;  3LK8 A;  4CTH A;  1CGL A;  2DDY A;  2JT6 A;  4IJO A;  4WKE A;  1SLN A;  1ZS0 A;  2WO9 A;  2Y6D A;  1CQR A;  3CKI A;  3DPE A;  3AIG A;  4PKV A;  1MNC A;  1R1J A;  1IAE A;  1ZTQ A;  1MMB A;  4GR0 A;  2YB9 A;  3WV3 A;  3WV1 A;  1D7X A;  1UTT A;  1A86 A;  1UEA A;  4FVL A;  1FLS A;  4AXQ A;  1YQY A;  1G12 A;  1BQO A;  2WO8 A;  5I0L A;  1BIW A;  3UVC A;  3B8Z A;  4XM8 A;  1R1H A;  1JJ9 A;  2OVX A;  3DTK A;  3ZUK A;  2OY2 A;  4G9L A;  1A85 A;  3HBV P;  3LUN A;  2E3X A;  4PKT A;  2X7M A;  3WV2 A;  3DTE A;  3MA2 A;  1JAQ A;  1SRP A;  5BOY A;  4DD8 A;  1OS9 A;  3DSL A;  2OI0 A;  1EAK A;  1Y0V A;  1KUF A;  1OMJ A;  1IAG A;  5CZM A;  2HU6 A;  2J0T A;  1OS2 A;  1ROS A;  4L63 A;  3HY9 A;  4H30 A;  4GWM A;  1UMT A;  3ZVS A;  1CGE A;  2CLT A;  3DNG A;  1O0T A;  4I35 A;  2RJP A;  2YUF A;  3E8R A;  2W13 A;  2FV5 A;  1SMP A;  2W14 A;  2X3C A;  1Y93 A;  3HY7 A;  2TCL A;  1KUK A;  3LJT A;  1RM8 A;  2L0R A;  1PWP A;  4H49 A;  1Z3J A;  1D8F A;  3KWV C;  1K7G A;  3RTT A;  5L7F A;  3LIK A;  1C7K A;  5D1S A;  2D1O A;  1G05 A;  1CGF A;  1ZVX A;  1HTD A;  2ERQ A;  1XAX A;  3LQB A; 
#chains in the Genus database with same CATH homology
 2X3A A;  2E2D A;  4WF6 A;  2DW2 A;  4AUO A;  3B2Z A;  3VI1 A;  3LJG A;  3F16 A;  1AF0 A;  2CKI A;  4J4M A;  3AYK A;  4EFS A;  1BM6 A;  1PWV A;  1Y8J A;  4AYK A;  1XUD A;  3EDZ A;  2WOA A;  1YP1 A;  1JH1 A;  966C A;  1BQQ M;  1IAC A;  1QJI A;  2W15 A;  4PKQ A;  2OXU A;  3EHY A;  3OHL A;  1XFZ A;  1D5J A;  2W12 A;  2JT5 A;  3HB2 P;  1IAB A;  2RJQ A;  1BKC A;  3LGP A;  3DTI A;  1GE6 A;  4HX3 A;  4JPA A;  5CUH A;  3LIR A;  5JMY A;  1L6J A;  5B5O A;  3BA0 A;  2OZR A;  2JSD A;  2XS4 A;  4PKU A;  1MMR A;  1ATL A;  4L7A A;  4DF9 A;  1XFV A;  3DL1 A;  1K7Q A;  4IN9 A;  1GKD A;  1UMS A;  1BZS A;  2JIH A;  3KEJ A;  4XM6 A;  1B3D A;  3N2V A;  4Q1L A;  1FM1 A;  3DWB A;  3ELM A;  3V96 B;  1I76 A;  1QIA A;  3USN A;  4GWN A;  3HDA P;  4PKS A;  1XFX A;  3F1A A;  5I2Z A;  3TVC A;  1BSW A;  4R3V A;  2W0D A;  1GO7 P;  1C3I A;  4QKZ A;  1SLM A;  1XUR A;  3F17 A;  4ZR5 A;  2Z2D A;  2POJ A;  2USN A;  4I03 A;  2V4B A;  4GUY A;  1C8T A;  1JKY A;  1EB6 A;  4FXY P;  1Q3A A;  1IAA A;  1MMQ A;  4H2E A;  3G42 A;  2OW0 A;  1OM7 A;  2FV9 A;  2N8R A;  2A8H A;  3EHX A;  3KMC A;  1PWU A;  3LQ0 A;  4GR8 A;  4H3X A;  2Y6C A;  1OM8 A;  1HY7 A;  3O64 A;  1H71 P;  1SU3 A;  4XBH A;  1JIW P;  3HDB A;  4H82 A;  5L79 A;  2MZI A;  1USN A;  2XS3 A;  1QUA A;  1CIZ A;  4A7B A;  4DPE A;  3Q2G A;  3F18 A;  2MZH A;  5BPA A;  2DDF A;  2ERO A;  1RMZ A;  1QJJ A;  3N2U A;  3ZXH A;  4GQL A;  1UTZ A;  2KRJ A;  1BKC I;  1D8M A;  4G0D A;  1SAT A;  2AYK A;  3P1V A;  2OW1 A;  1CXV A;  1IAD A;  3F15 A;  5D3C A;  2QPJ A;  1JAO A;  2OW2 A;  5D2B A;  1K7I A;  1R54 A;  5BOT A;  2OXZ A;  3LUM A;  5I4O A;  5D1T A;  1GXD A;  1HFC A;  1QIC A;  2MZE A;  5B5P A;  1GE7 A;  3G5C A;  1KUI A;  4JIJ A;  4PKW A;  1B8Y A;  3HYG A;  1G49 A;  1YCM A;  1ND1 A;  1GO8 P;  3AYU A;  1WNI A;  4WKI A;  1KUH A;  4GF1 A;  1YOU A;  2DW0 A;  4GR3 A;  3EWJ A;  3NX7 A;  1JAN A;  2JNP A;  2MLS A;  3TT4 A;  1QIB A;  1DMT A;  3L0V A;  3LJZ A;  4AIG A;  3EDH A;  2OVZ A;  1XFU A;  1HOV A;  3LKA A;  1CK7 A;  5CXA A;  3I7G A;  4JP4 A;  2OXW A;  2O36 A;  1AST A;  1GKC A;  1JIZ A;  2I47 A;  3DPF A;  3KEK A;  2DW1 A;  1ZP5 A;  1OM6 A;  1ZXC A;  1BUV M;  1BUD A;  2AIG P;  3P24 A;  1I73 A;  4A3W A;  2D1N A;  1HFS A;  3LIL A;  3KME A;  1MMP A;  4PKR A;  5D7W A;  1I1I P;  1JAP A;  4L6T A;  5I3M A;  3GBO A;  3VTG A;  2O3E A;  1G4K A;  3B92 A;  4ILW D;  3SHI A;  3O2X A;  1R55 A;  3TSK A;  1KUG A;  1CAQ A;  4ON1 A;  3RTS A;  3TS4 A;  1GE5 A;  2YIG A;  1J7N A;  4WK7 A;  2ERP A;  4WZV A;  1FBL A;  5D1U A;  3F19 A;  4FXQ A;  3KEC A;  2MLR A;  2K9C A;  2OY4 A;  5I12 A;  4DV8 A;  830C A;  5H8X A;  1XUC A;  4HMA A;  2PJT A;  1KAP P;  1ZXV A;  456C A;  3KHI A;  1AYK A;  3LE9 A;  3U1R A;  4FU4 A;  4JA1 A;  1AKL A;  1XFY A;  1DTH A;  1XFW A;  1OO9 A;  3EDI A;  4H1Q A;  3I7I A;  3EDG A;  3KRY A;  1HV5 A;  2K2G A;  5LAB A;  3LMC A;  4XCT A;  1PWQ A;  3OHO A;  3Q2H A;  2OW9 A;  4H76 A;  4IUW A;  1JK3 A;  3K7L A;  1R1I A;  1G9K A;  1S4B P;  2J83 A;  4L19 A;  1O0Q A;  4JQG A;  3LEA A;  1KBC A;  3L0T A;  3K7N A;  2X3B A;  3HBU P;  1PWW A;  4H84 A;  2SRT A;  1EUB A;  5I43 A;  1BKC E;  3LK8 A;  4CTH A;  1CGL A;  2DDY A;  2JT6 A;  4IJO A;  4WKE A;  1SLN A;  1ZS0 A;  2WO9 A;  2Y6D A;  1CQR A;  3CKI A;  3DPE A;  3AIG A;  4PKV A;  1MNC A;  1R1J A;  1IAE A;  1ZTQ A;  1MMB A;  4GR0 A;  2YB9 A;  3WV3 A;  3WV1 A;  1D7X A;  1UTT A;  1A86 A;  1UEA A;  4FVL A;  1FLS A;  4AXQ A;  1YQY A;  1G12 A;  1BQO A;  2WO8 A;  5I0L A;  1BIW A;  3UVC A;  3B8Z A;  4XM8 A;  1R1H A;  1JJ9 A;  2OVX A;  3DTK A;  3ZUK A;  2OY2 A;  4G9L A;  1A85 A;  3HBV P;  3LUN A;  2E3X A;  4PKT A;  2X7M A;  3WV2 A;  3DTE A;  3MA2 A;  1JAQ A;  1SRP A;  5BOY A;  4DD8 A;  1OS9 A;  3DSL A;  2OI0 A;  1EAK A;  1Y0V A;  1KUF A;  1OMJ A;  1IAG A;  5CZM A;  2HU6 A;  2J0T A;  1OS2 A;  1ROS A;  4L63 A;  3HY9 A;  4H30 A;  4GWM A;  1UMT A;  3ZVS A;  1CGE A;  2CLT A;  3DNG A;  1O0T A;  4I35 A;  2RJP A;  2YUF A;  3E8R A;  2W13 A;  2FV5 A;  1SMP A;  2W14 A;  2X3C A;  1Y93 A;  3HY7 A;  2TCL A;  1KUK A;  3LJT A;  1RM8 A;  2L0R A;  1PWP A;  4H49 A;  1Z3J A;  1D8F A;  3KWV C;  1K7G A;  3RTT A;  5L7F A;  3LIK A;  1C7K A;  5D1S A;  2D1O A;  1G05 A;  1CGF A;  1ZVX A;  1HTD A;  2ERQ A;  4XM7 A;  3LQB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...