3F1NA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
108
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endothelial PAS domain-containing protein 1
publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 28
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nA00
4JGPA 3F1PB 3T50A 2WKPA 4JGRA 3CAXA 1TS8A 1EW0A 5TBMB 2V0UA 4HP9A 5HWTA 2VV6A 4NXFA 4WLAA 2VLGA 4HHDA 2WKQA 3H82A 1OTDA 1DP6A 3BWLA 3NHQA 1T1CA 3UMDA 1VB6A 5F5YA 2W27A 3A0SA 4EEPA 1S66L 3G6OA 1XJ3A 2K7SA 3K3DA 3VE4A 4B9OA 1S67L 1TS6A 4EXOA 1D06A 4XT2A 4R6LA 3NJAA 3IS2B 3UB6A 3D72A 3BY9A 3MQOA 3E4QA 1OTAA 2GJ3A 1OTEA 2D01A 3LICA 2KDKA 4EQ1A 3LIAA 4GS9A 5HWWA 4HY8A 1DP9A 1P0ZA 1T1AA 1LSVA 4DJ2A 2PHYA 3ULFA 3H9WA 2KX6A 2PDRA 3H7WA 3HJKA 5DKKA 1JNUA 5HDCA 3CWFA 2VV7A 2OOLA 4MN6A 2PD7A 4HI4A 4NXGA 3OLOA 3MQQA 3RTYA 2WKRA 3LIEA 3K3CA 4F3LB 5F68A 4HOIA 2PR5A 5G4ZA 3UB8A 3LI9A 4DJ3A 1V9ZA 2V9AA 5J7EA 2PR6A 4GS9B 3CLOA 4WN5A 1NWZA 4I3IA 1TS0A 2R78A 5EFWA 2QKPA 4I3AA 4KUKA 4LRYC 2Z6CA 3NOPC 2VV8A 1XJ4A 4R38A 2ZOIA 1OT6A 4M4XA 1T19A 2YKHA 4NXBA 4HJ4A 1S1YA 1S1ZA 4GHIB 2ZBBA 4EW7A 3NOTC 5DKLA 4H6JB 3E4PA 4HNBA 3UB7A 4PKYG 2V1BA 3F1NB 2V0WA 1UWPX 3A0VA 3VE3A 4I3JA 5HDSA 1LSXA 3UMEA 1DP8A 2W0NA 3RH8B 5DJTA 2PD8A 3IBRA 4I5SA 2EA9A 2P7JA 3PHYA 4RQ9A 4HH2A 4HH3A 1T18A 3ZQ5A 5I5LA 2VEAA 3HJIA 1N9NA 2BASA 5HSQA 5J4EA 1GSVA 1MZUA 3ICYA 3H82B 5KIZA 4R70A 4PKYA 1OTIA 4L9EA 1N9LA 4HIAA 3SW1A 3MFXA 3MXQA 2QJ7A 3A0RA 1X0OA 4LRZE 1S4RA 4GCZA 2I9VA 4YWZA 3UB9A 1TS7A 1KOUA 2QJ5A 4KUOA 2L0WA 4HP4A 4E04A 4HJ3A 3FG8A 2PYPA 4EESA 2JHEA 1GSWA 3B33A 1UWNX 4WUJA 4XT2B 2A24A 3F1PA 1OJGA 5AVFA 4BBVA 1P97A 5TBMA 1S4SA 1UGUA 1T1BA 5HZHA 2INWA 2V1AA 2JN7A 4MN5A 3C2WA 2D02A 5A8BA 1OT9A 1BYWA 3PYPA 4EETB 2YKFA 3UE6A 5HD3A 3H7WB 3GDIA 4JGQA 1F9IA 4L9GA 5G4YA 4EEUA 4BBTA 3F1OA 3KX0X 2A24B 3IS2A 4LPZA 1LSWA 2ZOHA 3LUQA 4LLOB 3NOUC 1LL8A 4BBUA 3EWKA 2OWJA 3BY8A 3EEHA 1DRMA 5IU1A 3VOLA 3MJQA 4EERA 1Y28A 4JGOA 2QWSA 4L9FA 3GECA 1N9OA 4WF0A 2CMNA 2L1MA 4LRXC 1XFNA 2PYRA 3F1OB 4R3AA 3LYXA 5J3WA 4KQDA 4HJ6A 4F3LA 2OWHA 2J80A 3E4OA 4K08A 1LT0A 3MR0A 5HDDA 4I38A 2H28A 4NXEA 1F98A 4GW9A 1XJ2A 3LIFA 2QHKA 5AVEA 4WL9A 5F69A 2M1CA 2Z6DA 1D7EA 3C8CA 3LIDA 5IS1A 1ODVA 3LIBA 2L4RA 4I39A 4HQAA 2B02A 4GHIA 1XFQA 1OTBA 4H6JA 5HD5A 5HWVA 1G28A 1WA9A 5F6AA 3LI8A 3F1NA 1OJ5A 1V9YA 2HV1A 5DJUA 1XJ6A 1GSXA 3P7NA 3FC7A
chains in the Genus database with same CATH superfamily
2UWXA 4JGPA 3T50A 2ZM8A 3CAXA 3P09A 1GCEA 3D4FA 3QP6A 5AQ9A 2G2WA 4X6TA 3HL9A 4FTXA 3T1XA 4Y15A 1XGIA 4WLAA 4HHDA 4JF6A 4DE1A 1EROA 2WKQA 2ZQAA 1YT4A 1EI5A 2VGKA 2Y79A 4B4ZA 1K54A 3BWLA 3NHQA 4U0XA 4OPYA 3HLBA 1VB6A 4GB7A 1S66L 1BUEA 3G6OA 5U47A 2G7UA 1W7FA 4WZ5A 1NJ4A 1I2SA 4XT2A 1KDSA 3I7JA 4MN7A 4G3KA 4DF6A 1LHYA 3IT9A 3ZGAB 2XDMA 2JKTI 1PWCA 4OQHA 3MQOA 4P87A 3P98A 1OTAA 4OQ0A 1E4DA 1SCWA 1Q2PA 4IUKA 5FEFA 2X71A 2E8JA 4QWOA 4N9KA 3OOVA 3LCEA 3TE8A 2WKEA 2HP6A 2P9VA 3WRTA 4R1GA 3N8SA 1JWZA 2PHYA 3SS4A 3H9WA 4DKIA 2QZ6A 1ES3A 3H7WA 3HJKA 4JXVA 1YMXA 3FWLA 3KO6A 4GJ4A 3E98A 2WK0A 2PD7A 4FUWA 2M7VA 1CI8A 4NXGA 3MQQA 5EE8A 1FOFA 4BMWA 3HUMA 5FI2A 4JKTA 5EM0A 4F3LB 2ZD8A 3BLMA 3NBLA 3N8RA 4S2KA 2XA7M 3UB8A 3LI9A 4C6YA 1CI9A 3QP1A 5J7EA 1GA9A 3M2JA 4Y0UA 3K2NA 4GS9B 1O7EA 3N8LA 3A3EA 5HPFA 3V3SA 4DE2A 2PU4A 3ZCZA 5FQKA 2R78A 5MC7A 3DTEA 4I3AA 2XLNA 3UE0A 3NOPC 1W8QA 4EBLA 4E6XA 2EWWA 3BFEA 1SKOA 2EXBA 5M1AA 3Q81A 4ZAMA 5M18A 1OT6A 5L8MA 4M4XA 5E2EA 2XRNA 1T19A 3G34A 1S1ZA 3C7UA 3IF6A 2WKHA 3NOTC 3VV4A 3IH8A 4OLDA 3OBFA 1F5MA 3CI6A 3E4PA 4Y13A 1MKIA 3MBZA 1L3LA 2V0WA 4H8RA 1NLYA 3MF0A 3MFDA 4X1LA 5HAPA 1DP8A 1NZOA 3CHWP 2FH5A 3DTKA 4JXWA 3FPVA 3IBRA 4I5SA 1FSYA 1DJCA 1T18A 3LR5A 5I5LA 1IYPA 1PWDA 2VEAA 3UNWA 3VP4A 1IEMA 1LLBA 3SH9A 4NEED 4P6ZM 4JXSA 3GVBA 1J9MA 3UPPA 5J4EA 2Y4AA 3WS0A 3S7OA 4PKYA 4KZAA 1OTIA 1O07A 2HDUA 3MXQA 2VKSA 3A0RA 1X0OA 4LRZE 3IF5A 1S4RA 4GCZA 2I9VA 4YWZA 3T1SA 1ZKJA 4ZJ1A 1KOUA 2QJ5A 3BQ8A 4KUOA 4HP4A 2ZMAA 1CEGA 1F2KA 1SDNA 1GSWA 4XT2B 3LO7A 5EVID 3F1PA 3M2KA 4MDZA 2EFXA 4BBVA 1VETA 4ZRRA 2XGNA 3IHBA 2ZQ7A 1WYCA 5DTKA 2Y91A 3C2WA 2D02A 1YLYA 3PYPA 2P9VB 3ZG8B 5F82A 1W8YA 5IT5A 1P9WA 4EETB 3OCLA 2XK1A 1L0FA 3ITAA 5HD3A 3H7WB 4MCWA 1FIKA 4L9GA 4KZ5A 1MPLA 5D3OA 1PNEA 4B4XA 3VP2A 4E3NA 2Z2LB 3F1OA 5KMWA 2Z2MB 1YMSA 2FZ0A 2X01A 4CQHA 3OPRA 2WAFA 1STZA 4LLOB 1YM1A 5TR7A 3UPOA 2ACGA 2A49A 4A5RA 5CEBA 3EGDC 1RCJA 3HBRA 1FR6A 5F83A 2O9AA 1VHMA 2LB5A 1W79A 2ZQDA 3MS6A 5CTNA 3GECA 4WF0A 1D1JA 3LR0A 1W5DA 1SKOB 1M6KA 3G4PA 4Q0IA 2PYRA 3IXGA 3IXDA 4JPMA 3SOIA 3W4QA 3MKFA 4KQDA 1IFQA 2OWHA 2ZQ9A 2HJEA 2KOIA 3NDEA 3SH8A 4Q0JA 4LV1A 1E25A 1PFLA 4ETXA 3UY6A 1F98A 1FR1A 4GW9A 1XJ2A 3S7NA 2Y2KA 2DRWA 2HDQA 1XX2A 3KSIA 2J8YA 1KGEA 3FKWA 3HVFA 3QP5A 2J9OA 1RP5A 2Z6DA 1XPBA 3LR3A 3LIDA 5A93A 4KZ3A 5KSHA 4HBUA 4I39A 1KE3A 1K55C 3RXXA 5G18A 4K0XA 1N9BA 3LFVA 3UN7A 4KG5A 4U0TA 4K0WA 3CG5A 3T1QB 4X53A 3LI8A 4S2PA 2VGJA 1OJ5A 1VEUA 2WKIA 5E43A 4E3IA 3KYEA 2HV1A 4X68A 3S4XA 3P7NA 3R7WA 5FASA 3O5YA 3F1PB 2WKPA 4JGRA 3IX4A 2HP5A 2ZM2A 4PHTA 5TJJA 1TS8A 3PXPA 1VETB 4HP9A 4FCFA 5FQ9A 3O3VA 1RGZA 4ZTKA 4CLCA 2IWDA 3HUNA 1DP6A 5GLDA 4MMNA 3UDFA 1YLWA 1ZTUA 3V50A 1SZVA 4FD8A 5FAPA 2NUTC 4WEKA 2OV5A 1H8ZA 3G31A 2EX6A 2Y2QA 3QNBA 3ZYTA 2ZQ8A 1S67L 4Y2FA 1TS6A 3NJAA 3UB6A 3NDGA 3HLFA 2UV0E 5FA7A 3VFHA 2JE5A 3G30A 1KGGA 1OTEA 3PBNA 1OPXA 1ZHHB 3HLWA 4Z1WA 2RL3A 1H3QA 2QPNA 4GS9A 3E0YA 3NULA 3PAEA 1DP9A 2QMIA 2IA2A 3G35A 2IWBA 2HP9A 4EUVA 1K54C 1LSVA 2Y2OA 2ZJ9A 3WS4A 3MSHA 4UA6A 4FH4A 4U3TA 5KSCA 2VK3A 1RGYA 3ISGA 3CWFA 4M3KA 2VV7A 5E2HA 4ZJ3A 3ZNYA 4B88A 3RJUA 3FYZA 4MBHA 4Y7PA 5F68A 2BG1A 4PPRA 5CERA 2V9AA 1MKMA 1TVFA 2CC1A 1Y54A 1IELA 4PMAA 5M19A 2RCXA 2Q9MA 1K6SA 2DMWA 3V5MA 3B42A 1K57A 3U2AA 5EFWA 1K56A 5HL1A 3L9KA 3AGEA 1XKZA 1LL5A 1VQQA 4G3WA 5EM1A 4LCLA 2V8CA 3VFFA 2PAVP 5E2GA 4HJ4A 4FH2A 4OH0A 4X55A 2NUPC 1DY6A 3CMZA 1BULA 5DKLA 3PR6A 3FZCA 3FPWA 4OVDA 2B5RA 4ID4A 5AJGA 3JYIA 1VEUB 3OCNA 4ESPA 3VE3A 2WYXA 4XUXA 3V67A 4P85A 5HDSA 4DDSA 3EQVA 4II7A 5DVAA 3R7WB 2W0NA 1IOUA 2PD8A 2EA9A 2R9XA 4HH2A 4HH3A 1M40A 4WEJA 4RVAA 1N9NA 2B95A 3MZDA 2BASA 3PAGA 4CLCB 1MZUA 4JBFA 1BSGA 2HGVA 5JYOA 5KIZA 3HUOA 1I2WA 1HVBA 3SH7A 4LV0A 4Q8IA 5EV0A 1MXOA 4P0MA 3JVVA 2WGIA 3MFXA 2Q9NA 3IF6C 4GOGA 3DWKA 3UB9A 1KVLA 2XH9A 4UQIM 5CRFA 2DNSA 5FI7A 1ERQA 4IVKA 2PYPA 1I5QA 4WUJA 2J7VA 2HZ5A 3TW8A 2K31A 2VJWA 5L09A 1G5UA 1DJBA 4LCMA 5AVFA 3PBRA 1SHVA 4WMCD 1JVJA 2WAEA 1L0GA 3QHYA 2V1AA 1E3UD 3T1RA 5A8BA 3WRZA 1OT9A 1BYWA 4XUZA 3UE6A 3NECA 4R4RA 3CPTB 4EU0A 1PZOA 4OP5A 3OPHA 1ALQA 3AGDA 2Y59A 3VP1A 4GZBA 4RX2A 4QY6A 3IS2A 3HCYA 4C75A 3HREA 2Y2PA 3CJMA 3CUEA 3TJZC 3VOYA 1KE4A 2W1RA 3LUQA 1ZG4A 3VSKA 5HL6A 1CF0A 3BM6A 5HARA 3IWIA 3T4KA 3NC8A 3BY8A 2X02A 5HPIA 3BECA 4BLMA 1ES5A 3LGOA 4CLCE 1DJAA 4S2IA 5FSRA 2EX8A 2QWSA 4P6ZS 4FSFA 3T4TA 4L9FA 4ZBEA 2M7UA 1W63Q 5FL3A 4E6WA 4HESA 2ZMVA 3A3FA 3PBOA 1H8MA 1IKIA 2Y2NA 5DF8A 4AFIA 2WGWA 1TD5A 5AQAA 3A3JA 3IHAA 2XD1A 2VGLM 3Q82A 3E4OA 4WM9A 2J9PA 2ZC7A 2R9WA 4DDYA 1BLPA 3D9YA 3OC2A 4NK3A 3VOZA 3IWOA 3SZTA 4WL9A 3OPLA 4DMZA 3HLGA 2EFUA 2V20A 1IKGA 2KLIA 2W3HA 4E3JA 1D7EA 1GHMA 4S2NA 3ZDJA 2XEPA 3T12B 3UE1A 3VMAA 4YOFA 3W8KA 4GHIA 5FQMA 1XGJA 1OTBA 4H6JA 5CEDA 4Y3IA 4UEYA 5HWVA 1WA9A 4UHUA 3QP4A 2H10A 3Q7VB 2QYBA 2WADA 2G2UA 3TOIA 2HPBA 3UPNA 4EV4A 1GSXA 2AVXA 3FC7A 4OONA 3NIAA 2W1TA 1G68A 2GNXA 4Y17A 1EW0A 3QP8A 2HJ9C 5HWTA 4OQGA 5FDHA 2VV6A 3C4PA 2VLGA 3DW0A 1W63M 4BD1A 2OAQ1 1JWPA 4WZ4A 5GLAA 2Y2JA 3LEQA 3HLCA 2ZLYA 3UMDA 1YQSA 4KG2A 2C5WB 1MC0A 2W27A 3A0SA 2P08A 3PBQA 5GHXA 3EGXC 2GDNA 3MKEA 3A3IA 1XJ3A 1Q2QA 3T4QA 4DXBA 1D06A 4R6LA 3QNCA 3IS2B 1K4FA 5A91A 3D72A 3C7VA 3BY9A 4GN2A 5FATA 4BJPA 4BENA 4G3VA 4RYEA 4R3JA 5J8XA 3MXRA 3W2ZA 3JPUA 1FCNA 4KQQA 3IX8A 3G2ZA 1YLZA 3A3DA 3EEAA 4WBGA 5HWWA 4HY8A 3G32A 5CXWA 2W3DA 1T1AA 4CLCC 1Z6FA 3MZFA 2Y2IA 2K2NA 4DJ2A 1XA1A 3RXWA 2XFTA 2KX6A 3NY4A 4OOMA 2W3GA 3UB5P 2H5SA 1PI4A 5HDCA 5HFOA 1TEMA 5CHJA 1MWUA 3DBAA 4QD4A 3PBTA 4KZ6A 4P6BA 2ZQCA 2ZM0A 2A3UA 4MN6A 4HI4A 4CPKA 1NZUA 2WGWB 1XXMA 3GR2A 1LL9A 5DFXA 5TFQA 4IJGA 3FKVA 5AQ7A 4HOIA 2PR5A 4ARZA 4YNRA 5G4ZA 3LY3A 4DJ3A 1YPRA 2XD5A 3W4OA 2P74A 1MWSA 2PR6A 5EUAA 3M6HA 1K38A 3WS1A 5FQJA 4I3IA 1TS0A 4KZ8A 3BLSA 4S2JA 3UE3A 2QKPA 3ZNTA 4CJNA 2Z6CA 5HW3A 2VV8A 4O7DA 4MLLA 4DE3A 4MBKA 1QMFA 1J3WA 3HLEA 4KZ9A 2YKHA 1YLPA 1S1YA 4GHIB 2ZBBA 4IUHA 1XP4A 1PIOA 3DTMA 3C5AA 1G6OA 2ZL1A 4GKUA 4H6JB 3G2YA 1HZOA 4KQOA 4HNBA 4DRTA 3BFGA 5CGXA 1S0WA 1IYQA 4WELA 2JBFA 5HAIA 5GHYA 1K57C 2W1TB 4HBTA 5DJTA 2H0YA 2P7JA 3PHYA 4RQ9A 3KSHA 2EXAA 4JF4A 3AGFA 4OKPA 4S2MA 3W4PA 2O9CA 1H0MA 2PBDP 2Q0OA 1N9LA 2O0YA 4HIAA 3SW1A 4OP8A 1YSQA 5FAOA 3CPTA 1TS7A 2OLVA 3ZG5A 2L0WA 3ZVTA 3R4KA 4R3BA 3FG8A 5HAQA 4EESA 1ONHA 1ERMA 1UWNX 4E3KA 4B93A 4IHQA 4OPQA 1P97A 3BEBA 5TBMA 1Y4OA 4C3QA 3MZEA 1S4SA 4BD0A 1T1BA 1K0KA 5HZHA 2OLUA 2INWA 4R23A 2OAP1 2PBYA 2JN7A 1HD8A 5CX7A 2ZC6B 3C38A 3T4OA 3P01A 1IYOA 5EVIA 3B3XA 1ES2A 3L7HA 5G4YA 1F9IA 3E2KA 4E3MA 1NYYA 3ZFZA 4BBTA 1YKDA 3KX0X 2A24B 1K25A 1NXYA 4LPZA 2P04A 3LY4A 3UO9A 1ZG6A 1G6AA 4ARZB 4GD6A 5EOEA 1LL8A 4BBUA 3IQAA 3EWKA 2XFSA 3EOIA 2OWJA 4UA7A 4ETZA 4D2OA 4OQIA 3VOLA 1SDEA 4GDBA 3NI9A 3ZG9B 1SKFA 1N9OA 1BLCA 2CMNA 2HF6A 4WYYA 1YAXA 2H0TA 2L1MA 4UAAA 4LRXC 5FDSA 4PM7A 1PRQA 3BW6A 5FEGA 1XA7A 3M6BA 4E3OA 3VP3A 5KZHA 1K4EA 2O9BA 4UQIS 4HJ6A 3CUEC 4QB8A 4O0PA 1HLUP 2ZL1B 2EX9A 5GL9A 2Y55A 4K08A 1L0EA 3O86A 3Q7VA 4NG2A 4X1MA 3GQZA 4LGWA 4I38A 1LI0A 4NXEA 2XA7S 4N1XA 2QHKA 2Y2MA 3ZG0A 1WYBA 5F69A 3IWQA 3KSGA 4OOYA 2M1CA 3UDIA 4OPZA 3TSGA 3GV9A 1YLTA 4UA9A 2MJ6A 2E8IA 4GNUA 5IS1A 1CK3A 1NRJA 3B47A 4HQAA 4FOFA 3QP2A 1XFQA 5DF9A 4DE0A 1MBLA 4LFUA 3Q1FA 5HD5A 1G28A 3BFFA 4CLCD 3ZG7B 3F1NA 2JC7A 4N92A 4IBXA 1AWIA 2WUQA 5CGSA 3N6IA 1V9YA 4PM8A 2Y2HA 4QU3A 5DJUA 1XJ6A 2V8FA 2HDSA 4O01A 2XQZA 4XXRA 2WZZA 5GHZA 3HLDA 1CQAA 3TRCA 1Z09A 4Z9QA 2JKGA 2V0UA 5TBMB 3GTCA 3LR4A 4NXFA 3SS3A 3MQ0A 1ES4A 5LBRA 1PZPA 3BFDA 4S2NC 4GD8A 1KVMA 3H82A 1OTDA 4S2OA 4PM9A 2V1ZA 3MMHA 5A92A 2PT7A 1BLSA 1T1CA 2FFFB 5EVLA 2Y2GA 2J3TC 1BLHA 1MWTA 5L07A 2ZC4B 4X56A 5F5YA 5EVIB 1ONGA 4EEPA 4OPRA 4PM5A 3Q07A 4R4SA 4KZ4A 2K7SA 3K3DA 3D3OA 3VE4A 4B9OA 2B18A 3T4JA 1N4OA 2DCFA 5JYPA 2VGLS 4EXOA 2GZAA 5DF7A 4GLQA 5I94A 2XF3A 4Y5FA 5A90A 5DFYA 4IBRA 3E4QA 4KZ7A 2GJ3A 1FILA 2D01A 1U60A 3LICA 2KDKA 4EQ1A 1JTDA 3LIAA 4K91A 3KSFA 1P0ZA 1VM1A 4EBPA 5F1FA 3ZHHA 4HEFA 3S1YA 2ZC5B 4N1HA 1JTGA 4LV2A 5FI6A 3ULFA 4NKPA 2PDRA 3PTEA 1PWGA 4IVIA 5DKKA 3KYZA 1JNUA 1NLZA 4BL2A 4N9LA 1KE0A 4D60A 2OOLA 3E2LA 2W3FA 5CHUA 1K56D 4YFMA 3RFBA 3OLOA 3RTYA 2WKRA 1ZC2A 3LIEA 3K3CA 3KYQA 4R0QA 1FCOA 3Q7ZA 1K6RA 1V9ZA 4RA7A 4DXCA 4NETA 3BQAA 5BOHA 1YSPA 3VSLA 4MEZA 3CLOA 4WN5A 1NWZA 3PBSA 4JF5A 5IHVA 4KUKA 4LRYC 2JKRM 4Y0OA 1XJ4A 1QMEA 1GA0A 1LI9A 3BYDA 4R38A 3BJNA 2ZOIA 2FFYA 1PW8A 4Y0TA 3LEZA 1H8YA 1S6RA 4MNRA 3WWXA 4OOLA 4NXBA 2BLSA 4ME4A 2WGVA 4EW7A 3NCKA 4KQRA 4JXGA 5EPHA 3UB7A 1NRFA 4PKYG 2V1BA 4BQMA 3F1NB 1UWPX 3A0VA 3T4SA 2EWVA 3BFCA 4I3JA 4PM6A 3TG9A 5CHMA 2HDRA 4L0LA 1LSXA 3UMEA 4S2LA 3RH8B 3T4LA 2Y2LA 4LENA 3MXSA 3BRMA 5EOOA 1HTZA 4F94A 3N4IA 3ZQ5A 3UDXA 3N7WA 3HJIA 2C6WB 5HSQA 5HX9A 1BT5A 5L2FA 2A2LA 1GSVA 4QPRA 3ICYA 3H82B 4R70A 1PI5A 1TDLA 3IF6B 4L9EA 2QJ7A 3IBJA 1KGFA 1FQGA 3OZHA 5GLBA 4E04A 4HJ3A 1FSWA 3WS5A 1MY8A 2JHEA 3B33A 1CJFA 4EWFA 2A24A 5FAQA 1OJGA 3DAVA 2VX8A 1L0DA 2W3EA 5CECA 1ESIA 3C30A 1UGUA 3IX3A 3JVUA 1OMEA 4E3LA 4MN5A 1TDGA 1GHIA 3DTIA 5K5BA 5E2FA 3O87A 3IXBA 2YKFA 3GDIA 1L2SA 1ESUA 4KZBA 4JGQA 2LB9A 4WMCA 1YLJA 5EVEA 4EEUA 2OSUA 1KDWA 4OLGA 2XROA 1TF1A 5TGFA 2ZMFA 4QJGA 5CGWA 3V3RA 5L10A 3ITBA 1P9RA 5FQIA 1E3UA 2JCHA 4DN0A 4QY5A 3ZVWA 1LSWA 2ZOHA 5CTMA 3WS2A 2JKRI 3IXHA 2O99A 3NOUC 5FQQA 2PU2A 1BZAA 1CEFA 2I72A 4MBFA 3V39A 3GSGA 3EEHA 1DRMA 4GDNA 2PRFA 2VZWA 1C3BA 3MJQA 5IU1A 4EERA 3SS5A 1Y28A 1IYSA 4JGOA 3GMWA 1JWVA 4ZDXA 2JKTM 5EVIC 3FV7A 5GLCA 3O88A 4EUZA 2IWCA 1BTLA 4EQIA 1XFNA 3S7PA 3F1OB 1FCMA 2BTFP 4X69A 4R3AA 2J3WA 5AQBA 3LYXA 4IEDA 1K55A 5J3WA 1PW1A 4F3LA 3S7QA 5EECA 4RX3A 1EWZA 4KENB 2J80A 4BWIA 4YINA 3IH9A 1LT0A 3MR0A 5HDDA 2J3TD 4X25A 2H28A 2JKFA 2XR0A 2XSSA 3LIFA 5AVEA 1ACFA 1H5XA 1PYYA 4PAUA 4O8GA 4KG6A 4ZJ2A 2ZC3B 2GX5A 1NY0A 2V2FF 4BL3A 3C8CA 2Y8HA 1GHPA 2WZXA 4QHCA 3DWZA 3S22A 1ODVA 4WZ5C 3LIBA 4Q0HA 3CITA 2L4RA 5F1GA 4EBNA 1MWRA 3C4OA 2EX2A 5C5KA 3GRJA 2B02A 2VA0A 3CZDA 3EQUA 3U4LP 1WE4A 5F6AA 4LV3A 5DTTA 1NYMA 3VP0A 3OPPA 1AXBA 4JLFA 5DTSA 1A0KA
chains in the Genus database with same CATH topology
3O5YA 4O01A 4JGPA 3F1PB 3T50A 2WKPA 4JGRA 2W1TA 3CAXA 4PHTA 2GNXA 5TJJA 1TS8A 3TRCA 1EW0A 3PXPA 5TBMB 2V0UA 4HP9A 2HJ9C 5HWTA 3LR4A 2VV6A 4NXFA 4WLAA 2VLGA 3MQ0A 1W63M 5LBRA 4HHDA 2OAQ1 4CLCA 2WKQA 3H82A 1OTDA 1DP6A 2Y79A 3MMHA 3BWLA 3NHQA 4MMNA 2PT7A 1T1CA 1ZTUA 2J3TC 3UMDA 1VB6A 1MC0A 5F5YA 2NUTC 2W27A 4WEKA 3A0SA 2P08A 3PBQA 3EGXC 4EEPA 1S66L 3G6OA 2G7UA 1XJ3A 2K7SA 3K3DA 3D3OA 3VE4A 3ZYTA 4B9OA 2B18A 3T4JA 1S67L 3T4QA 2VGLS 4Y2FA 1TS6A 4EXOA 2GZAA 1D06A 4XT2A 4R6LA 3NJAA 4MN7A 4GLQA 4G3KA 3IS2B 3UB6A 3D72A 2JKTI 3BY9A 4Y5FA 3MQOA 5DFYA 4BJPA 3E4QA 1OTAA 2GJ3A 4G3VA 1OTEA 3PBNA 2D01A 1OPXA 1ZHHB 3LICA 2KDKA 4Z1WA 4EQ1A 3W2ZA 1H3QA 3LIAA 4IUKA 4GS9A 3KSFA 3E0YA 3EEAA 5HWWA 4HY8A 1DP9A 1P0ZA 2W3DA 2IA2A 3OOVA 3TE8A 1T1AA 4CLCC 4EUVA 1LSVA 2K2NA 4DJ2A 2PHYA 3ULFA 3H9WA 4NKPA 2KX6A 2PDRA 4OOMA 3H7WA 3HJKA 2W3GA 5DKKA 3KYZA 1JNUA 5HDCA 1NLZA 3DBAA 3CWFA 3KO6A 3PBTA 4GJ4A 2VV7A 3E98A 2OOLA 4MN6A 2W3FA 2PD7A 3RFBA 4HI4A 2M7VA 3OLOA 4NXGA 3MQQA 3RTYA 4BMWA 2WKRA 3LIEA 3K3CA 3KYQA 5DFXA 4F3LB 4IJGA 5F68A 4HOIA 2PR5A 4ARZA 4YNRA 2XA7M 5G4ZA 3UB8A 3LI9A 4DJ3A 1V9ZA 2V9AA 1MKMA 5J7EA 2PR6A 3K2NA 4GS9B 3BQAA 1YSPA 5HPFA 2DMWA 3CLOA 4WN5A 3B42A 1NWZA 4I3IA 1TS0A 3U2AA 3PBSA 2R78A 5MC7A 5EFWA 3UE3A 2QKPA 4I3AA 4KUKA 4LRYC 2JKRM 2Z6CA 3NOPC 2VV8A 2EWWA 1XJ4A 4R38A 4G3WA 3BJNA 2ZOIA 1OT6A 5L8MA 4M4XA 2XRNA 1T19A 2YKHA 4OOLA 4NXBA 4HJ4A 1S1YA 4ME4A 2NUPC 1S1ZA 4GHIB 2ZBBA 4EW7A 3NOTC 4IUHA 3VV4A 5DKLA 1G6OA 3PR6A 4H6JB 3OBFA 1F5MA 3CI6A 3E4PA 4KQOA 4HNBA 3FPWA 3UB7A 4PKYG 2V1BA 3F1NB 2V0WA 1UWPX 3A0VA 1NLYA 5AJGA 3OCNA 3MF0A 3T4SA 3VE3A 2EWVA 4I3JA 3V67A 5HDSA 4L0LA 1LSXA 3EQVA 4II7A 3R7WB 4WELA 3UMEA 1DP8A 2W0NA 3RH8B 2W1TB 2FH5A 3T4LA 5DJTA 3FPVA 1IOUA 2PD8A 3IBRA 4I5SA 2EA9A 2P7JA 3PHYA 4RQ9A 4HH2A 4HH3A 3KSHA 1T18A 3LR5A 3ZQ5A 5I5LA 2VEAA 4WEJA 3HJIA 1N9NA 2BASA 4NEED 5HSQA 4P6ZM 2A2LA 4CLCB 5J4EA 1GSVA 1MZUA 3ICYA 2O9CA 4QPRA 3H82B 2HGVA 3S7OA 5KIZA 4R70A 4PKYA 1OTIA 3JVVA 4L9EA 1N9LA 2O0YA 4HIAA 3SW1A 3MFXA 3MXQA 2QJ7A 2VKSA 1YSQA 3A0RA 3IBJA 1X0OA 4LRZE 1S4RA 4GCZA 2I9VA 4YWZA 3UB9A 1TS7A 1KOUA 2QJ5A 4UQIM 3BQ8A 4KUOA 2L0WA 4HP4A 4E04A 4HJ3A 3R4KA 3FG8A 2PYPA 4EESA 2JHEA 1GSWA 3B33A 1UWNX 4WUJA 4XT2B 2A24A 3TW8A 2K31A 2VJWA 3F1PA 1OJGA 4MDZA 4B93A 2VX8A 2W3EA 5AVFA 3PBRA 4BBVA 4IHQA 3C30A 1P97A 5TBMA 4ZRRA 1S4SA 1UGUA 1T1BA 5HZHA 2INWA 3JVUA 2OAP1 2V1AA 2JN7A 4MN5A 3C2WA 2D02A 5A8BA 1OT9A 1BYWA 5K5BA 3PYPA 5CX7A 3C38A 3T4OA 3P01A 5IT5A 1P9WA 4EETB 3OCLA 2YKFA 3UE6A 5HD3A 4EU0A 3H7WB 3GDIA 4MCWA 3R7WA 4JGQA 1F9IA 2LB9A 4L9GA 5G4YA 4EEUA 2XROA 1TF1A 2ZMFA 4BBTA 1P9RA 3F1OA 1YKDA 3KX0X 2A24B 3IS2A 4LPZA 3HCYA 4DN0A 2FZ0A 1LSWA 2ZOHA 3CUEA 4CQHA 3TJZC 2JKRI 1STZA 2O99A 2P04A 2W1RA 3LUQA 4LLOB 3NOUC 4ARZB 5HL6A 1LL8A 3EGDC 3T4KA 4BBUA 3EWKA 3EOIA 2OWJA 3BY8A 3EEHA 1DRMA 5HPIA 4ETZA 2O9AA 1VHMA 2LB5A 2VZWA 3MJQA 5IU1A 3VOLA 4EERA 1Y28A 4CLCE 4JGOA 2QWSA 4P6ZS 4FSFA 3T4TA 4L9FA 3GECA 2JKTM 1N9OA 2M7UA 4WF0A 1W63Q 2CMNA 2HF6A 3LR0A 1YAXA 5FL3A 2L1MA 4LRXC 1XFNA 2ZMVA 3PBOA 2PYRA 3BW6A 3F1OB 4Q0IA 3S7PA 1H8MA 4R3AA 2J3WA 4AFIA 3LYXA 2O9BA 4UQIS 4KQDA 5J3WA 1IFQA 1TD5A 4HJ6A 3CUEC 4F3LA 3S7QA 2OWHA 4O0PA 2VGLM 2J80A 3E4OA 4BWIA 2HJEA 2KOIA 4K08A 1LT0A 3MR0A 5HDDA 2J3TD 4Q0JA 3OC2A 4I38A 2H28A 4NXEA 4ETXA 1F98A 2XA7S 4GW9A 1XJ2A 3S7NA 2XSSA 3LIFA 2QHKA 5AVEA 4WL9A 5F69A 3KSIA 3KSGA 4PAUA 4O8GA 4DMZA 2M1CA 2GX5A 2KLIA 2W3HA 2Z6DA 1D7EA 2Y8HA 3C8CA 3LR3A 2MJ6A 3LIDA 5IS1A 1ODVA 3LIBA 4Q0HA 3CITA 5KSHA 2L4RA 4I39A 1NRJA 4YOFA 3B47A 5C5KA 4HQAA 2B02A 2VA0A 4FOFA 3EQUA 4GHIA 1XFQA 5DF9A 1OTBA 3LFVA 4H6JA 4Y3IA 4UEYA 5HD5A 5HWVA 1G28A 1WA9A 5F6AA 4CLCD 3LI8A 3F1NA 1OJ5A 2QYBA 1V9YA 2HV1A 5DJUA 1XJ6A 1GSXA 3P7NA 3FC7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JGP A;  3F1P B;  3T50 A;  2WKP A;  4JGR A;  3CAX A;  1TS8 A;  1EW0 A;  5TBM B;  2V0U A;  4HP9 A;  5HWT A;  2VV6 A;  4NXF A;  4WLA A;  2VLG A;  4HHD A;  2WKQ A;  3H82 A;  1OTD A;  1DP6 A;  3BWL A;  3NHQ A;  1T1C A;  3UMD A;  1VB6 A;  5F5Y A;  2W27 A;  3A0S A;  4EEP A;  1S66 L;  3G6O A;  1XJ3 A;  2K7S A;  3K3D A;  3VE4 A;  4B9O A;  1S67 L;  1TS6 A;  4EXO A;  1D06 A;  4XT2 A;  4R6L A;  3NJA A;  3IS2 B;  3UB6 A;  3D72 A;  3BY9 A;  3MQO A;  3E4Q A;  1OTA A;  2GJ3 A;  1OTE A;  2D01 A;  3LIC A;  2KDK A;  4EQ1 A;  3LIA A;  4GS9 A;  5HWW A;  4HY8 A;  1DP9 A;  1P0Z A;  1T1A A;  1LSV A;  4DJ2 A;  2PHY A;  3ULF A;  3H9W A;  2KX6 A;  2PDR A;  3H7W A;  3HJK A;  5DKK A;  1JNU A;  5HDC A;  3CWF A;  2VV7 A;  2OOL A;  4MN6 A;  2PD7 A;  4HI4 A;  4NXG A;  3OLO A;  3MQQ A;  3RTY A;  2WKR A;  3LIE A;  3K3C A;  4F3L B;  5F68 A;  4HOI A;  2PR5 A;  5G4Z A;  3UB8 A;  3LI9 A;  4DJ3 A;  1V9Z A;  2V9A A;  5J7E A;  2PR6 A;  4GS9 B;  3CLO A;  4WN5 A;  1NWZ A;  4I3I A;  1TS0 A;  2R78 A;  5EFW A;  2QKP A;  4I3A A;  4KUK A;  4LRY C;  2Z6C A;  3NOP C;  2VV8 A;  1XJ4 A;  4R38 A;  2ZOI A;  1OT6 A;  4M4X A;  1T19 A;  2YKH A;  4NXB A;  4HJ4 A;  1S1Y A;  1S1Z A;  4GHI B;  2ZBB A;  4EW7 A;  3NOT C;  5DKL A;  4H6J B;  3E4P A;  4HNB A;  3UB7 A;  4PKY G;  2V1B A;  3F1N B;  2V0W A;  1UWP X;  3A0V A;  3VE3 A;  4I3J A;  5HDS A;  1LSX A;  3UME A;  1DP8 A;  2W0N A;  3RH8 B;  5DJT A;  2PD8 A;  3IBR A;  4I5S A;  2EA9 A;  2P7J A;  3PHY A;  4RQ9 A;  4HH2 A;  4HH3 A;  1T18 A;  3ZQ5 A;  5I5L A;  2VEA A;  3HJI A;  1N9N A;  2BAS A;  5HSQ A;  5J4E A;  1GSV A;  1MZU A;  3ICY A;  3H82 B;  5KIZ A;  4R70 A;  4PKY A;  1OTI A;  4L9E A;  1N9L A;  4HIA A;  3SW1 A;  3MFX A;  3MXQ A;  2QJ7 A;  3A0R A;  1X0O A;  4LRZ E;  1S4R A;  4GCZ A;  2I9V A;  4YWZ A;  3UB9 A;  1TS7 A;  1KOU A;  2QJ5 A;  4KUO A;  2L0W A;  4HP4 A;  4E04 A;  4HJ3 A;  3FG8 A;  2PYP A;  4EES A;  2JHE A;  1GSW A;  3B33 A;  1UWN X;  4WUJ A;  4XT2 B;  2A24 A;  3F1P A;  1OJG A;  5AVF A;  4BBV A;  1P97 A;  5TBM A;  1S4S A;  1UGU A;  1T1B A;  5HZH A;  2INW A;  2V1A A;  2JN7 A;  4MN5 A;  3C2W A;  2D02 A;  5A8B A;  1OT9 A;  1BYW A;  3PYP A;  4EET B;  2YKF A;  3UE6 A;  5HD3 A;  3H7W B;  3GDI A;  4JGQ A;  1F9I A;  4L9G A;  5G4Y A;  4EEU A;  4BBT A;  3F1O A;  3KX0 X;  2A24 B;  3IS2 A;  4LPZ A;  1LSW A;  2ZOH A;  3LUQ A;  4LLO B;  3NOU C;  1LL8 A;  4BBU A;  3EWK A;  2OWJ A;  3BY8 A;  3EEH A;  1DRM A;  5IU1 A;  3VOL A;  3MJQ A;  4EER A;  1Y28 A;  4JGO A;  2QWS A;  4L9F A;  3GEC A;  1N9O A;  4WF0 A;  2CMN A;  2L1M A;  4LRX C;  1XFN A;  2PYR A;  3F1O B;  4R3A A;  3LYX A;  5J3W A;  4KQD A;  4HJ6 A;  4F3L A;  2OWH A;  2J80 A;  3E4O A;  4K08 A;  1LT0 A;  3MR0 A;  5HDD A;  4I38 A;  2H28 A;  4NXE A;  1F98 A;  4GW9 A;  1XJ2 A;  3LIF A;  2QHK A;  5AVE A;  4WL9 A;  5F69 A;  2M1C A;  2Z6D A;  1D7E A;  3C8C A;  3LID A;  5IS1 A;  1ODV A;  3LIB A;  2L4R A;  4I39 A;  4HQA A;  2B02 A;  4GHI A;  1XFQ A;  1OTB A;  4H6J A;  5HD5 A;  5HWV A;  1G28 A;  1WA9 A;  5F6A A;  3LI8 A;  3F1N A;  1OJ5 A;  1V9Y A;  2HV1 A;  5DJU A;  1XJ6 A;  1GSX A;  3P7N A;  3FC7 A; 
#chains in the Genus database with same CATH topology
 2UWX A;  4JGP A;  3T50 A;  2ZM8 A;  3CAX A;  3P09 A;  1GCE A;  3D4F A;  3QP6 A;  5AQ9 A;  2G2W A;  4X6T A;  3HL9 A;  4FTX A;  3T1X A;  4Y15 A;  1XGI A;  4WLA A;  4HHD A;  4JF6 A;  4DE1 A;  1ERO A;  2WKQ A;  2ZQA A;  1YT4 A;  1EI5 A;  2VGK A;  2Y79 A;  4B4Z A;  1K54 A;  3BWL A;  3NHQ A;  4U0X A;  4OPY A;  3HLB A;  1VB6 A;  4GB7 A;  1S66 L;  1BUE A;  3G6O A;  5U47 A;  2G7U A;  1W7F A;  4WZ5 A;  1NJ4 A;  1I2S A;  4XT2 A;  1KDS A;  3I7J A;  4MN7 A;  4G3K A;  4DF6 A;  1LHY A;  3IT9 A;  3ZGA B;  2XDM A;  2JKT I;  1PWC A;  4OQH A;  3MQO A;  4P87 A;  3P98 A;  1OTA A;  4OQ0 A;  1E4D A;  1SCW A;  1Q2P A;  4IUK A;  5FEF A;  2X71 A;  2E8J A;  4QWO A;  4N9K A;  3OOV A;  3LCE A;  3TE8 A;  2WKE A;  2HP6 A;  2P9V A;  3WRT A;  4R1G A;  3N8S A;  1JWZ A;  2PHY A;  3SS4 A;  3H9W A;  4DKI A;  2QZ6 A;  1ES3 A;  3H7W A;  3HJK A;  4JXV A;  1YMX A;  3FWL A;  3KO6 A;  4GJ4 A;  3E98 A;  2WK0 A;  2PD7 A;  4FUW A;  2M7V A;  1CI8 A;  4NXG A;  3MQQ A;  5EE8 A;  1FOF A;  4BMW A;  3HUM A;  5FI2 A;  4JKT A;  5EM0 A;  4F3L B;  2ZD8 A;  3BLM A;  3NBL A;  3N8R A;  4S2K A;  2XA7 M;  3UB8 A;  3LI9 A;  4C6Y A;  1CI9 A;  3QP1 A;  5J7E A;  1GA9 A;  3M2J A;  4Y0U A;  3K2N A;  4GS9 B;  1O7E A;  3N8L A;  3A3E A;  5HPF A;  3V3S A;  4DE2 A;  2PU4 A;  3ZCZ A;  5FQK A;  2R78 A;  5MC7 A;  3DTE A;  4I3A A;  2XLN A;  3UE0 A;  3NOP C;  1W8Q A;  4EBL A;  4E6X A;  2EWW A;  3BFE A;  1SKO A;  2EXB A;  5M1A A;  3Q81 A;  4ZAM A;  5M18 A;  1OT6 A;  5L8M A;  4M4X A;  5E2E A;  2XRN A;  1T19 A;  3G34 A;  1S1Z A;  3C7U A;  3IF6 A;  2WKH A;  3NOT C;  3VV4 A;  3IH8 A;  4OLD A;  3OBF A;  1F5M A;  3CI6 A;  3E4P A;  4Y13 A;  1MKI A;  3MBZ A;  1L3L A;  2V0W A;  4H8R A;  1NLY A;  3MF0 A;  3MFD A;  4X1L A;  5HAP A;  1DP8 A;  1NZO A;  3CHW P;  2FH5 A;  3DTK A;  4JXW A;  3FPV A;  3IBR A;  4I5S A;  1FSY A;  1DJC A;  1T18 A;  3LR5 A;  5I5L A;  1IYP A;  1PWD A;  2VEA A;  3UNW A;  3VP4 A;  1IEM A;  1LLB A;  3SH9 A;  4NEE D;  4P6Z M;  4JXS A;  3GVB A;  1J9M A;  3UPP A;  5J4E A;  2Y4A A;  3WS0 A;  3S7O A;  4PKY A;  4KZA A;  1OTI A;  1O07 A;  2HDU A;  3MXQ A;  2VKS A;  3A0R A;  1X0O A;  4LRZ E;  3IF5 A;  1S4R A;  4GCZ A;  2I9V A;  4YWZ A;  3T1S A;  1ZKJ A;  4ZJ1 A;  1KOU A;  2QJ5 A;  3BQ8 A;  4KUO A;  4HP4 A;  2ZMA A;  1CEG A;  1F2K A;  1SDN A;  1GSW A;  4XT2 B;  3LO7 A;  5EVI D;  3F1P A;  3M2K A;  4MDZ A;  2EFX A;  4BBV A;  1VET A;  4ZRR A;  2XGN A;  3IHB A;  2ZQ7 A;  1WYC A;  5DTK A;  2Y91 A;  3C2W A;  2D02 A;  1YLY A;  3PYP A;  2P9V B;  3ZG8 B;  5F82 A;  1W8Y A;  5IT5 A;  1P9W A;  4EET B;  3OCL A;  2XK1 A;  1L0F A;  3ITA A;  5HD3 A;  3H7W B;  4MCW A;  1FIK A;  4L9G A;  4KZ5 A;  1MPL A;  5D3O A;  1PNE A;  4B4X A;  3VP2 A;  4E3N A;  2Z2L B;  3F1O A;  5KMW A;  2Z2M B;  1YMS A;  2FZ0 A;  2X01 A;  4CQH A;  3OPR A;  2WAF A;  1STZ A;  4LLO B;  1YM1 A;  5TR7 A;  3UPO A;  2ACG A;  2A49 A;  4A5R A;  5CEB A;  3EGD C;  1RCJ A;  3HBR A;  1FR6 A;  5F83 A;  2O9A A;  1VHM A;  2LB5 A;  1W79 A;  2ZQD A;  3MS6 A;  5CTN A;  3GEC A;  4WF0 A;  1D1J A;  3LR0 A;  1W5D A;  1SKO B;  1M6K A;  3G4P A;  4Q0I A;  2PYR A;  3IXG A;  3IXD A;  4JPM A;  3SOI A;  3W4Q A;  3MKF A;  4KQD A;  1IFQ A;  2OWH A;  2ZQ9 A;  2HJE A;  2KOI A;  3NDE A;  3SH8 A;  4Q0J A;  4LV1 A;  1E25 A;  1PFL A;  4ETX A;  3UY6 A;  1F98 A;  1FR1 A;  4GW9 A;  1XJ2 A;  3S7N A;  2Y2K A;  2DRW A;  2HDQ A;  1XX2 A;  3KSI A;  2J8Y A;  1KGE A;  3FKW A;  3HVF A;  3QP5 A;  2J9O A;  1RP5 A;  2Z6D A;  1XPB A;  3LR3 A;  3LID A;  5A93 A;  4KZ3 A;  5KSH A;  4HBU A;  4I39 A;  1KE3 A;  1K55 C;  3RXX A;  5G18 A;  4K0X A;  1N9B A;  3LFV A;  3UN7 A;  4KG5 A;  4U0T A;  4K0W A;  3CG5 A;  3T1Q B;  4X53 A;  3LI8 A;  4S2P A;  2VGJ A;  1OJ5 A;  1VEU A;  2WKI A;  5E43 A;  4E3I A;  3KYE A;  2HV1 A;  4X68 A;  3S4X A;  3P7N A;  3R7W A;  5FAS A;  3O5Y A;  3F1P B;  2WKP A;  4JGR A;  3IX4 A;  2HP5 A;  2ZM2 A;  4PHT A;  5TJJ A;  1TS8 A;  3PXP A;  1VET B;  4HP9 A;  4FCF A;  5FQ9 A;  3O3V A;  1RGZ A;  4ZTK A;  4CLC A;  2IWD A;  3HUN A;  1DP6 A;  5GLD A;  4MMN A;  3UDF A;  1YLW A;  1ZTU A;  3V50 A;  1SZV A;  4FD8 A;  5FAP A;  2NUT C;  4WEK A;  2OV5 A;  1H8Z A;  3G31 A;  2EX6 A;  2Y2Q A;  3QNB A;  3ZYT A;  2ZQ8 A;  1S67 L;  4Y2F A;  1TS6 A;  3NJA A;  3UB6 A;  3NDG A;  3HLF A;  2UV0 E;  5FA7 A;  3VFH A;  2JE5 A;  3G30 A;  1KGG A;  1OTE A;  3PBN A;  1OPX A;  1ZHH B;  3HLW A;  4Z1W A;  2RL3 A;  1H3Q A;  2QPN A;  4GS9 A;  3E0Y A;  3NUL A;  3PAE A;  1DP9 A;  2QMI A;  2IA2 A;  3G35 A;  2IWB A;  2HP9 A;  4EUV A;  1K54 C;  1LSV A;  2Y2O A;  2ZJ9 A;  3WS4 A;  3MSH A;  4UA6 A;  4FH4 A;  4U3T A;  5KSC A;  2VK3 A;  1RGY A;  3ISG A;  3CWF A;  4M3K A;  2VV7 A;  5E2H A;  4ZJ3 A;  3ZNY A;  4B88 A;  3RJU A;  3FYZ A;  4MBH A;  4Y7P A;  5F68 A;  2BG1 A;  4PPR A;  5CER A;  2V9A A;  1MKM A;  1TVF A;  2CC1 A;  1Y54 A;  1IEL A;  4PMA A;  5M19 A;  2RCX A;  2Q9M A;  1K6S A;  2DMW A;  3V5M A;  3B42 A;  1K57 A;  3U2A A;  5EFW A;  1K56 A;  5HL1 A;  3L9K A;  3AGE A;  1XKZ A;  1LL5 A;  1VQQ A;  4G3W A;  5EM1 A;  4LCL A;  2V8C A;  3VFF A;  2PAV P;  5E2G A;  4HJ4 A;  4FH2 A;  4OH0 A;  4X55 A;  2NUP C;  1DY6 A;  3CMZ A;  1BUL A;  5DKL A;  3PR6 A;  3FZC A;  3FPW A;  4OVD A;  2B5R A;  4ID4 A;  5AJG A;  3JYI A;  1VEU B;  3OCN A;  4ESP A;  3VE3 A;  2WYX A;  4XUX A;  3V67 A;  4P85 A;  5HDS A;  4DDS A;  3EQV A;  4II7 A;  5DVA A;  3R7W B;  2W0N A;  1IOU A;  2PD8 A;  2EA9 A;  2R9X A;  4HH2 A;  4HH3 A;  1M40 A;  4WEJ A;  4RVA A;  1N9N A;  2B95 A;  3MZD A;  2BAS A;  3PAG A;  4CLC B;  1MZU A;  4JBF A;  1BSG A;  2HGV A;  5JYO A;  5KIZ A;  3HUO A;  1I2W A;  1HVB A;  3SH7 A;  4LV0 A;  4Q8I A;  5EV0 A;  1MXO A;  4P0M A;  3JVV A;  2WGI A;  3MFX A;  2Q9N A;  3IF6 C;  4GOG A;  3DWK A;  3UB9 A;  1KVL A;  2XH9 A;  4UQI M;  5CRF A;  2DNS A;  5FI7 A;  1ERQ A;  4IVK A;  2PYP A;  1I5Q A;  4WUJ A;  2J7V A;  2HZ5 A;  3TW8 A;  2K31 A;  2VJW A;  5L09 A;  1G5U A;  1DJB A;  4LCM A;  5AVF A;  3PBR A;  1SHV A;  4WMC D;  1JVJ A;  2WAE A;  1L0G A;  3QHY A;  2V1A A;  1E3U D;  3T1R A;  5A8B A;  3WRZ A;  1OT9 A;  1BYW A;  4XUZ A;  3UE6 A;  3NEC A;  4R4R A;  3CPT B;  4EU0 A;  1PZO A;  4OP5 A;  3OPH A;  1ALQ A;  3AGD A;  2Y59 A;  3VP1 A;  4GZB A;  4RX2 A;  4QY6 A;  3IS2 A;  3HCY A;  4C75 A;  3HRE A;  2Y2P A;  3CJM A;  3CUE A;  3TJZ C;  3VOY A;  1KE4 A;  2W1R A;  3LUQ A;  1ZG4 A;  3VSK A;  5HL6 A;  1CF0 A;  3BM6 A;  5HAR A;  3IWI A;  3T4K A;  3NC8 A;  3BY8 A;  2X02 A;  5HPI A;  3BEC A;  4BLM A;  1ES5 A;  3LGO A;  4CLC E;  1DJA A;  4S2I A;  5FSR A;  2EX8 A;  2QWS A;  4P6Z S;  4FSF A;  3T4T A;  4L9F A;  4ZBE A;  2M7U A;  1W63 Q;  5FL3 A;  4E6W A;  4HES A;  2ZMV A;  3A3F A;  3PBO A;  1H8M A;  1IKI A;  2Y2N A;  5DF8 A;  4AFI A;  2WGW A;  1TD5 A;  5AQA A;  3A3J A;  3IHA A;  2XD1 A;  2VGL M;  3Q82 A;  3E4O A;  4WM9 A;  2J9P A;  2ZC7 A;  2R9W A;  4DDY A;  1BLP A;  3D9Y A;  3OC2 A;  4NK3 A;  3VOZ A;  3IWO A;  3SZT A;  4WL9 A;  3OPL A;  4DMZ A;  3HLG A;  2EFU A;  2V20 A;  1IKG A;  2KLI A;  2W3H A;  4E3J A;  1D7E A;  1GHM A;  4S2N A;  3ZDJ A;  2XEP A;  3T12 B;  3UE1 A;  3VMA A;  4YOF A;  3W8K A;  4GHI A;  5FQM A;  1XGJ A;  1OTB A;  4H6J A;  5CED A;  4Y3I A;  4UEY A;  5HWV A;  1WA9 A;  4UHU A;  3QP4 A;  2H10 A;  3Q7V B;  2QYB A;  2WAD A;  2G2U A;  3TOI A;  2HPB A;  3UPN A;  4EV4 A;  1GSX A;  2AVX A;  3FC7 A;  4OON A;  3NIA A;  2W1T A;  1G68 A;  2GNX A;  4Y17 A;  1EW0 A;  3QP8 A;  2HJ9 C;  5HWT A;  4OQG A;  5FDH A;  2VV6 A;  3C4P A;  2VLG A;  3DW0 A;  1W63 M;  4BD1 A;  2OAQ 1;  1JWP A;  4WZ4 A;  5GLA A;  2Y2J A;  3LEQ A;  3HLC A;  2ZLY A;  3UMD A;  1YQS A;  4KG2 A;  2C5W B;  1MC0 A;  2W27 A;  3A0S A;  2P08 A;  3PBQ A;  5GHX A;  3EGX C;  2GDN A;  3MKE A;  3A3I A;  1XJ3 A;  1Q2Q A;  3T4Q A;  4DXB A;  1D06 A;  4R6L A;  3QNC A;  3IS2 B;  1K4F A;  5A91 A;  3D72 A;  3C7V A;  3BY9 A;  4GN2 A;  5FAT A;  4BJP A;  4BEN A;  4G3V A;  4RYE A;  4R3J A;  5J8X A;  3MXR A;  3W2Z A;  3JPU A;  1FCN A;  4KQQ A;  3IX8 A;  3G2Z A;  1YLZ A;  3A3D A;  3EEA A;  4WBG A;  5HWW A;  4HY8 A;  3G32 A;  5CXW A;  2W3D A;  1T1A A;  4CLC C;  1Z6F A;  3MZF A;  2Y2I A;  2K2N A;  4DJ2 A;  1XA1 A;  3RXW A;  2XFT A;  2KX6 A;  3NY4 A;  4OOM A;  2W3G A;  3UB5 P;  2H5S A;  1PI4 A;  5HDC A;  5HFO A;  1TEM A;  5CHJ A;  1MWU A;  3DBA A;  4QD4 A;  3PBT A;  4KZ6 A;  4P6B A;  2ZQC A;  2ZM0 A;  2A3U A;  4MN6 A;  4HI4 A;  4CPK A;  1NZU A;  2WGW B;  1XXM A;  3GR2 A;  1LL9 A;  5DFX A;  5TFQ A;  4IJG A;  3FKV A;  5AQ7 A;  4HOI A;  2PR5 A;  4ARZ A;  4YNR A;  5G4Z A;  3LY3 A;  4DJ3 A;  1YPR A;  2XD5 A;  3W4O A;  2P74 A;  1MWS A;  2PR6 A;  5EUA A;  3M6H A;  1K38 A;  3WS1 A;  5FQJ A;  4I3I A;  1TS0 A;  4KZ8 A;  3BLS A;  4S2J A;  3UE3 A;  2QKP A;  3ZNT A;  4CJN A;  2Z6C A;  5HW3 A;  2VV8 A;  4O7D A;  4MLL A;  4DE3 A;  4MBK A;  1QMF A;  1J3W A;  3HLE A;  4KZ9 A;  2YKH A;  1YLP A;  1S1Y A;  4GHI B;  2ZBB A;  4IUH A;  1XP4 A;  1PIO A;  3DTM A;  3C5A A;  1G6O A;  2ZL1 A;  4GKU A;  4H6J B;  3G2Y A;  1HZO A;  4KQO A;  4HNB A;  4DRT A;  3BFG A;  5CGX A;  1S0W A;  1IYQ A;  4WEL A;  2JBF A;  5HAI A;  5GHY A;  1K57 C;  2W1T B;  4HBT A;  5DJT A;  2H0Y A;  2P7J A;  3PHY A;  4RQ9 A;  3KSH A;  2EXA A;  4JF4 A;  3AGF A;  4OKP A;  4S2M A;  3W4P A;  2O9C A;  1H0M A;  2PBD P;  2Q0O A;  1N9L A;  2O0Y A;  4HIA A;  3SW1 A;  4OP8 A;  1YSQ A;  5FAO A;  3CPT A;  1TS7 A;  2OLV A;  3ZG5 A;  2L0W A;  3ZVT A;  3R4K A;  4R3B A;  3FG8 A;  5HAQ A;  4EES A;  1ONH A;  1ERM A;  1UWN X;  4E3K A;  4B93 A;  4IHQ A;  4OPQ A;  1P97 A;  3BEB A;  5TBM A;  1Y4O A;  4C3Q A;  3MZE A;  1S4S A;  4BD0 A;  1T1B A;  1K0K A;  5HZH A;  2OLU A;  2INW A;  4R23 A;  2OAP 1;  2PBY A;  2JN7 A;  1HD8 A;  5CX7 A;  2ZC6 B;  3C38 A;  3T4O A;  3P01 A;  1IYO A;  5EVI A;  3B3X A;  1ES2 A;  3L7H A;  5G4Y A;  1F9I A;  3E2K A;  4E3M A;  1NYY A;  3ZFZ A;  4BBT A;  1YKD A;  3KX0 X;  2A24 B;  1K25 A;  1NXY A;  4LPZ A;  2P04 A;  3LY4 A;  3UO9 A;  1ZG6 A;  1G6A A;  4ARZ B;  4GD6 A;  5EOE A;  1LL8 A;  4BBU A;  3IQA A;  3EWK A;  2XFS A;  3EOI A;  2OWJ A;  4UA7 A;  4ETZ A;  4D2O A;  4OQI A;  3VOL A;  1SDE A;  4GDB A;  3NI9 A;  3ZG9 B;  1SKF A;  1N9O A;  1BLC A;  2CMN A;  2HF6 A;  4WYY A;  1YAX A;  2H0T A;  2L1M A;  4UAA A;  4LRX C;  5FDS A;  4PM7 A;  1PRQ A;  3BW6 A;  5FEG A;  1XA7 A;  3M6B A;  4E3O A;  3VP3 A;  5KZH A;  1K4E A;  2O9B A;  4UQI S;  4HJ6 A;  3CUE C;  4QB8 A;  4O0P A;  1HLU P;  2ZL1 B;  2EX9 A;  5GL9 A;  2Y55 A;  4K08 A;  1L0E A;  3O86 A;  3Q7V A;  4NG2 A;  4X1M A;  3GQZ A;  4LGW A;  4I38 A;  1LI0 A;  4NXE A;  2XA7 S;  4N1X A;  2QHK A;  2Y2M A;  3ZG0 A;  1WYB A;  5F69 A;  3IWQ A;  3KSG A;  4OOY A;  2M1C A;  3UDI A;  4OPZ A;  3TSG A;  3GV9 A;  1YLT A;  4UA9 A;  2MJ6 A;  2E8I A;  4GNU A;  5IS1 A;  1CK3 A;  1NRJ A;  3B47 A;  4HQA A;  4FOF A;  3QP2 A;  1XFQ A;  5DF9 A;  4DE0 A;  1MBL A;  4LFU A;  3Q1F A;  5HD5 A;  1G28 A;  3BFF A;  4CLC D;  3ZG7 B;  3F1N A;  2JC7 A;  4N92 A;  4IBX A;  1AWI A;  2WUQ A;  5CGS A;  3N6I A;  1V9Y A;  4PM8 A;  2Y2H A;  4QU3 A;  5DJU A;  1XJ6 A;  2V8F A;  2HDS A;  4O01 A;  2XQZ A;  4XXR A;  2WZZ A;  5GHZ A;  3HLD A;  1CQA A;  3TRC A;  1Z09 A;  4Z9Q A;  2JKG A;  2V0U A;  5TBM B;  3GTC A;  3LR4 A;  4NXF A;  3SS3 A;  3MQ0 A;  1ES4 A;  5LBR A;  1PZP A;  3BFD A;  4S2N C;  4GD8 A;  1KVM A;  3H82 A;  1OTD A;  4S2O A;  4PM9 A;  2V1Z A;  3MMH A;  5A92 A;  2PT7 A;  1BLS A;  1T1C A;  2FFF B;  5EVL A;  2Y2G A;  2J3T C;  1BLH A;  1MWT A;  5L07 A;  2ZC4 B;  4X56 A;  5F5Y A;  5EVI B;  1ONG A;  4EEP A;  4OPR A;  4PM5 A;  3Q07 A;  4R4S A;  4KZ4 A;  2K7S A;  3K3D A;  3D3O A;  3VE4 A;  4B9O A;  2B18 A;  3T4J A;  1N4O A;  2DCF A;  5JYP A;  2VGL S;  4EXO A;  2GZA A;  5DF7 A;  4GLQ A;  5I94 A;  2XF3 A;  4Y5F A;  5A90 A;  5DFY A;  4IBR A;  3E4Q A;  4KZ7 A;  2GJ3 A;  1FIL A;  2D01 A;  1U60 A;  3LIC A;  2KDK A;  4EQ1 A;  1JTD A;  3LIA A;  4K91 A;  3KSF A;  1P0Z A;  1VM1 A;  4EBP A;  5F1F A;  3ZHH A;  4HEF A;  3S1Y A;  2ZC5 B;  4N1H A;  1JTG A;  4LV2 A;  5FI6 A;  3ULF A;  4NKP A;  2PDR A;  3PTE A;  1PWG A;  4IVI A;  5DKK A;  3KYZ A;  1JNU A;  1NLZ A;  4BL2 A;  4N9L A;  1KE0 A;  4D60 A;  2OOL A;  3E2L A;  2W3F A;  5CHU A;  1K56 D;  4YFM A;  3RFB A;  3OLO A;  3RTY A;  2WKR A;  1ZC2 A;  3LIE A;  3K3C A;  3KYQ A;  4R0Q A;  1FCO A;  3Q7Z A;  1K6R A;  1V9Z A;  4RA7 A;  4DXC A;  4NET A;  3BQA A;  5BOH A;  1YSP A;  3VSL A;  4MEZ A;  3CLO A;  4WN5 A;  1NWZ A;  3PBS A;  4JF5 A;  5IHV A;  4KUK A;  4LRY C;  2JKR M;  4Y0O A;  1XJ4 A;  1QME A;  1GA0 A;  1LI9 A;  3BYD A;  4R38 A;  3BJN A;  2ZOI A;  2FFY A;  1PW8 A;  4Y0T A;  3LEZ A;  1H8Y A;  1S6R A;  4MNR A;  3WWX A;  4OOL A;  4NXB A;  2BLS A;  4ME4 A;  2WGV A;  4EW7 A;  3NCK A;  4KQR A;  4JXG A;  5EPH A;  3UB7 A;  1NRF A;  4PKY G;  2V1B A;  4BQM A;  3F1N B;  1UWP X;  3A0V A;  3T4S A;  2EWV A;  3BFC A;  4I3J A;  4PM6 A;  3TG9 A;  5CHM A;  2HDR A;  4L0L A;  1LSX A;  3UME A;  4S2L A;  3RH8 B;  3T4L A;  2Y2L A;  4LEN A;  3MXS A;  3BRM A;  5EOO A;  1HTZ A;  4F94 A;  3N4I A;  3ZQ5 A;  3UDX A;  3N7W A;  3HJI A;  2C6W B;  5HSQ A;  5HX9 A;  1BT5 A;  5L2F A;  2A2L A;  1GSV A;  4QPR A;  3ICY A;  3H82 B;  4R70 A;  1PI5 A;  1TDL A;  3IF6 B;  4L9E A;  2QJ7 A;  3IBJ A;  1KGF A;  1FQG A;  3OZH A;  5GLB A;  4E04 A;  4HJ3 A;  1FSW A;  3WS5 A;  1MY8 A;  2JHE A;  3B33 A;  1CJF A;  4EWF A;  2A24 A;  5FAQ A;  1OJG A;  3DAV A;  2VX8 A;  1L0D A;  2W3E A;  5CEC A;  1ESI A;  3C30 A;  1UGU A;  3IX3 A;  3JVU A;  1OME A;  4E3L A;  4MN5 A;  1TDG A;  1GHI A;  3DTI A;  5K5B A;  5E2F A;  3O87 A;  3IXB A;  2YKF A;  3GDI A;  1L2S A;  1ESU A;  4KZB A;  4JGQ A;  2LB9 A;  4WMC A;  1YLJ A;  5EVE A;  4EEU A;  2OSU A;  1KDW A;  4OLG A;  2XRO A;  1TF1 A;  5TGF A;  2ZMF A;  4QJG A;  5CGW A;  3V3R A;  5L10 A;  3ITB A;  1P9R A;  5FQI A;  1E3U A;  2JCH A;  4DN0 A;  4QY5 A;  3ZVW A;  1LSW A;  2ZOH A;  5CTM A;  3WS2 A;  2JKR I;  3IXH A;  2O99 A;  3NOU C;  5FQQ A;  2PU2 A;  1BZA A;  1CEF A;  2I72 A;  4MBF A;  3V39 A;  3GSG A;  3EEH A;  1DRM A;  4GDN A;  2PRF A;  2VZW A;  1C3B A;  3MJQ A;  5IU1 A;  4EER A;  3SS5 A;  1Y28 A;  1IYS A;  4JGO A;  3GMW A;  1JWV A;  4ZDX A;  2JKT M;  5EVI C;  3FV7 A;  5GLC A;  3O88 A;  4EUZ A;  2IWC A;  1BTL A;  4EQI A;  1XFN A;  3S7P A;  3F1O B;  1FCM A;  2BTF P;  4X69 A;  4R3A A;  2J3W A;  5AQB A;  3LYX A;  4IED A;  1K55 A;  5J3W A;  1PW1 A;  4F3L A;  3S7Q A;  5EEC A;  4RX3 A;  1EWZ A;  4KEN B;  2J80 A;  4BWI A;  4YIN A;  3IH9 A;  1LT0 A;  3MR0 A;  5HDD A;  2J3T D;  4X25 A;  2H28 A;  2JKF A;  2XR0 A;  2XSS A;  3LIF A;  5AVE A;  1ACF A;  1H5X A;  1PYY A;  4PAU A;  4O8G A;  4KG6 A;  4ZJ2 A;  2ZC3 B;  2GX5 A;  1NY0 A;  2V2F F;  4BL3 A;  3C8C A;  2Y8H A;  1GHP A;  2WZX A;  4QHC A;  3DWZ A;  3S22 A;  1ODV A;  4WZ5 C;  3LIB A;  4Q0H A;  3CIT A;  2L4R A;  5F1G A;  4EBN A;  1MWR A;  3C4O A;  2EX2 A;  5C5K A;  3GRJ A;  2B02 A;  2VA0 A;  3CZD A;  3EQU A;  3U4L P;  1WE4 A;  5F6A A;  4LV3 A;  5DTT A;  1NYM A;  3VP0 A;  3OPP A;  1AXB A;  4JLF A;  5DTS A;  1A0K A; 
#chains in the Genus database with same CATH homology
 3O5Y A;  4O01 A;  4JGP A;  3F1P B;  3T50 A;  2WKP A;  4JGR A;  2W1T A;  3CAX A;  4PHT A;  2GNX A;  5TJJ A;  1TS8 A;  3TRC A;  1EW0 A;  3PXP A;  5TBM B;  2V0U A;  4HP9 A;  2HJ9 C;  5HWT A;  3LR4 A;  2VV6 A;  4NXF A;  4WLA A;  2VLG A;  3MQ0 A;  1W63 M;  5LBR A;  4HHD A;  2OAQ 1;  4CLC A;  2WKQ A;  3H82 A;  1OTD A;  1DP6 A;  2Y79 A;  3MMH A;  3BWL A;  3NHQ A;  4MMN A;  2PT7 A;  1T1C A;  1ZTU A;  2J3T C;  3UMD A;  1VB6 A;  1MC0 A;  5F5Y A;  2NUT C;  2W27 A;  4WEK A;  3A0S A;  2P08 A;  3PBQ A;  3EGX C;  4EEP A;  1S66 L;  3G6O A;  2G7U A;  1XJ3 A;  2K7S A;  3K3D A;  3D3O A;  3VE4 A;  3ZYT A;  4B9O A;  2B18 A;  3T4J A;  1S67 L;  3T4Q A;  2VGL S;  4Y2F A;  1TS6 A;  4EXO A;  2GZA A;  1D06 A;  4XT2 A;  4R6L A;  3NJA A;  4MN7 A;  4GLQ A;  4G3K A;  3IS2 B;  3UB6 A;  3D72 A;  2JKT I;  3BY9 A;  4Y5F A;  3MQO A;  5DFY A;  4BJP A;  3E4Q A;  1OTA A;  2GJ3 A;  4G3V A;  1OTE A;  3PBN A;  2D01 A;  1OPX A;  1ZHH B;  3LIC A;  2KDK A;  4Z1W A;  4EQ1 A;  3W2Z A;  1H3Q A;  3LIA A;  4IUK A;  4GS9 A;  3KSF A;  3E0Y A;  3EEA A;  5HWW A;  4HY8 A;  1DP9 A;  1P0Z A;  2W3D A;  2IA2 A;  3OOV A;  3TE8 A;  1T1A A;  4CLC C;  4EUV A;  1LSV A;  2K2N A;  4DJ2 A;  2PHY A;  3ULF A;  3H9W A;  4NKP A;  2KX6 A;  2PDR A;  4OOM A;  3H7W A;  3HJK A;  2W3G A;  5DKK A;  3KYZ A;  1JNU A;  5HDC A;  1NLZ A;  3DBA A;  3CWF A;  3KO6 A;  3PBT A;  4GJ4 A;  2VV7 A;  3E98 A;  2OOL A;  4MN6 A;  2W3F A;  2PD7 A;  3RFB A;  4HI4 A;  2M7V A;  3OLO A;  4NXG A;  3MQQ A;  3RTY A;  4BMW A;  2WKR A;  3LIE A;  3K3C A;  3KYQ A;  5DFX A;  4F3L B;  4IJG A;  5F68 A;  4HOI A;  2PR5 A;  4ARZ A;  4YNR A;  2XA7 M;  5G4Z A;  3UB8 A;  3LI9 A;  4DJ3 A;  1V9Z A;  2V9A A;  1MKM A;  5J7E A;  2PR6 A;  3K2N A;  4GS9 B;  3BQA A;  1YSP A;  5HPF A;  2DMW A;  3CLO A;  4WN5 A;  3B42 A;  1NWZ A;  4I3I A;  1TS0 A;  3U2A A;  3PBS A;  2R78 A;  5MC7 A;  5EFW A;  3UE3 A;  2QKP A;  4I3A A;  4KUK A;  4LRY C;  2JKR M;  2Z6C A;  3NOP C;  2VV8 A;  2EWW A;  1XJ4 A;  4R38 A;  4G3W A;  3BJN A;  2ZOI A;  1OT6 A;  5L8M A;  4M4X A;  2XRN A;  1T19 A;  2YKH A;  4OOL A;  4NXB A;  4HJ4 A;  1S1Y A;  4ME4 A;  2NUP C;  1S1Z A;  4GHI B;  2ZBB A;  4EW7 A;  3NOT C;  4IUH A;  3VV4 A;  5DKL A;  1G6O A;  3PR6 A;  4H6J B;  3OBF A;  1F5M A;  3CI6 A;  3E4P A;  4KQO A;  4HNB A;  3FPW A;  3UB7 A;  4PKY G;  2V1B A;  3F1N B;  2V0W A;  1UWP X;  3A0V A;  1NLY A;  5AJG A;  3OCN A;  3MF0 A;  3T4S A;  3VE3 A;  2EWV A;  4I3J A;  3V67 A;  5HDS A;  4L0L A;  1LSX A;  3EQV A;  4II7 A;  3R7W B;  4WEL A;  3UME A;  1DP8 A;  2W0N A;  3RH8 B;  2W1T B;  2FH5 A;  3T4L A;  5DJT A;  3FPV A;  1IOU A;  2PD8 A;  3IBR A;  4I5S A;  2EA9 A;  2P7J A;  3PHY A;  4RQ9 A;  4HH2 A;  4HH3 A;  3KSH A;  1T18 A;  3LR5 A;  3ZQ5 A;  5I5L A;  2VEA A;  4WEJ A;  3HJI A;  1N9N A;  2BAS A;  4NEE D;  5HSQ A;  4P6Z M;  2A2L A;  4CLC B;  5J4E A;  1GSV A;  1MZU A;  3ICY A;  2O9C A;  4QPR A;  3H82 B;  2HGV A;  3S7O A;  5KIZ A;  4R70 A;  4PKY A;  1OTI A;  3JVV A;  4L9E A;  1N9L A;  2O0Y A;  4HIA A;  3SW1 A;  3MFX A;  3MXQ A;  2QJ7 A;  2VKS A;  1YSQ A;  3A0R A;  3IBJ A;  1X0O A;  4LRZ E;  1S4R A;  4GCZ A;  2I9V A;  4YWZ A;  3UB9 A;  1TS7 A;  1KOU A;  2QJ5 A;  4UQI M;  3BQ8 A;  4KUO A;  2L0W A;  4HP4 A;  4E04 A;  4HJ3 A;  3R4K A;  3FG8 A;  2PYP A;  4EES A;  2JHE A;  1GSW A;  3B33 A;  1UWN X;  4WUJ A;  4XT2 B;  2A24 A;  3TW8 A;  2K31 A;  2VJW A;  3F1P A;  1OJG A;  4MDZ A;  4B93 A;  2VX8 A;  2W3E A;  5AVF A;  3PBR A;  4BBV A;  4IHQ A;  3C30 A;  1P97 A;  5TBM A;  4ZRR A;  1S4S A;  1UGU A;  1T1B A;  5HZH A;  2INW A;  3JVU A;  2OAP 1;  2V1A A;  2JN7 A;  4MN5 A;  3C2W A;  2D02 A;  5A8B A;  1OT9 A;  1BYW A;  5K5B A;  3PYP A;  5CX7 A;  3C38 A;  3T4O A;  3P01 A;  5IT5 A;  1P9W A;  4EET B;  3OCL A;  2YKF A;  3UE6 A;  5HD3 A;  4EU0 A;  3H7W B;  3GDI A;  4MCW A;  3R7W A;  4JGQ A;  1F9I A;  2LB9 A;  4L9G A;  5G4Y A;  4EEU A;  2XRO A;  1TF1 A;  2ZMF A;  4BBT A;  1P9R A;  3F1O A;  1YKD A;  3KX0 X;  2A24 B;  3IS2 A;  4LPZ A;  3HCY A;  4DN0 A;  2FZ0 A;  1LSW A;  2ZOH A;  3CUE A;  4CQH A;  3TJZ C;  2JKR I;  1STZ A;  2O99 A;  2P04 A;  2W1R A;  3LUQ A;  4LLO B;  3NOU C;  4ARZ B;  5HL6 A;  1LL8 A;  3EGD C;  3T4K A;  4BBU A;  3EWK A;  3EOI A;  2OWJ A;  3BY8 A;  3EEH A;  1DRM A;  5HPI A;  4ETZ A;  2O9A A;  1VHM A;  2LB5 A;  2VZW A;  3MJQ A;  5IU1 A;  3VOL A;  4EER A;  1Y28 A;  4CLC E;  4JGO A;  2QWS A;  4P6Z S;  4FSF A;  3T4T A;  4L9F A;  3GEC A;  2JKT M;  1N9O A;  2M7U A;  4WF0 A;  1W63 Q;  2CMN A;  2HF6 A;  3LR0 A;  1YAX A;  5FL3 A;  2L1M A;  4LRX C;  1XFN A;  2ZMV A;  3PBO A;  2PYR A;  3BW6 A;  3F1O B;  4Q0I A;  3S7P A;  1H8M A;  4R3A A;  2J3W A;  4AFI A;  3LYX A;  2O9B A;  4UQI S;  4KQD A;  5J3W A;  1IFQ A;  1TD5 A;  4HJ6 A;  3CUE C;  4F3L A;  3S7Q A;  2OWH A;  4O0P A;  2VGL M;  2J80 A;  3E4O A;  4BWI A;  2HJE A;  2KOI A;  4K08 A;  1LT0 A;  3MR0 A;  5HDD A;  2J3T D;  4Q0J A;  3OC2 A;  4I38 A;  2H28 A;  4NXE A;  4ETX A;  1F98 A;  2XA7 S;  4GW9 A;  1XJ2 A;  3S7N A;  2XSS A;  3LIF A;  2QHK A;  5AVE A;  4WL9 A;  5F69 A;  3KSI A;  3KSG A;  4PAU A;  4O8G A;  4DMZ A;  2M1C A;  2GX5 A;  2KLI A;  2W3H A;  2Z6D A;  1D7E A;  2Y8H A;  3C8C A;  3LR3 A;  2MJ6 A;  3LID A;  5IS1 A;  1ODV A;  3LIB A;  4Q0H A;  3CIT A;  5KSH A;  2L4R A;  4I39 A;  1NRJ A;  4YOF A;  3B47 A;  5C5K A;  4HQA A;  2B02 A;  2VA0 A;  4FOF A;  3EQU A;  4GHI A;  1XFQ A;  5DF9 A;  1OTB A;  3LFV A;  4H6J A;  4Y3I A;  4UEY A;  5HD5 A;  5HWV A;  1G28 A;  1WA9 A;  5F6A A;  4CLC D;  3LI8 A;  3F1N A;  1OJ5 A;  2QYB A;  1V9Y A;  2HV1 A;  5DJU A;  1XJ6 A;  1GSX A;  3P7N A;  3FC7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...