3F1NA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
108
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nA00
1D7EA 1P0ZA 1S67L 2WKPA 4GCZA 3K3CA 4KUKA 5IS1A 1GSVA 2I9VA 4JGPA 3F1NB 5HD3A 1LSVA 3PYPA 4GHIA 2M1CA 2B02A 4BBUA 4E04A 3C8CA 4HQAA 3FC7A 2QKPA 3D72A 4MN5A 4HY8A 4JGQA 3CAXA 3UMEA 1S66L 1NWZA 4LRXC 5EFWA 4H6JB 4BBTA 3F1NA 3EEHA 3MR0A 4EETB 1T18A 1V9YA 1T1BA 5HWWA 2EA9A 4KUOA 3IS2A 1EW0A 1OTIA 4HHDA 1XJ2A 2D01A 5AVEA 4XT2A 1LT0A 3RTYA 1OTEA 1N9OA 3NHQA 3ICYA 4HJ4A 4R38A 3VE3A 2PDRA 3BY8A 4DJ2A 1OTDA 4HIAA 4LRZE 1D06A 2INWA 3UB9A 2A24A 3H82B 5G4YA 2ZBBA 3GECA 5AVFA 3ZQ5A 3A0RA 1S1YA 4KQDA 4JGOA 3VE4A 3UMDA 5A8BA 1LSWA 2H28A 4I3AA 3K3DA 2OOLA 2L1MA 2PR5A 3MQQA 5J7EA 2ZOHA 2A24B 3H82A 3LI8A 4HH3A 2PR6A 4K08A 2VV7A 2CMNA 3LI9A 1TS7A 1ODVA 2WKRA 4GW9A 4L9EA 4NXEA 4NXFA 5DJUA 4PKYA 4EQ1A 3MFXA 5I5LA 4R6LA 5HWVA 4XT2B 5DKKA 1UWPX 1XFNA 1BYWA 3P7NA 4HI4A 3UE6A 4M4XA 2PYRA 1V9ZA 3CWFA 4HJ3A 3E4PA 2Z6DA 5J4EA 4R3AA 2QWSA 1OT6A 2VEAA 2W27A 5F68A 2D02A 4HNBA 1XJ6A 4R70A 4L9FA 1DRMA 3G6OA 1G28A 3IBRA 1F98A 2VV6A 2PHYA 3F1PA 4WL9A 4WUJA 5HDSA 3E4QA 3NJAA 2QJ5A 5HDCA 1Y28A 4HH2A 4I39A 2ZOIA 5HDDA 3MXQA 4EXOA 3LIAA 4I38A 1WA9A 3VOLA 1MZUA 3E4OA 2OWHA 3F1OA 4EERA 2L4RA 2PD8A 3C2WA 1T1AA 2JN7A 2KDKA 4LRYC 1TS8A 2V9AA 2QHKA 1XFQA 1S1ZA 1T1CA 1GSWA 4GS9B 3ULFA 5G4ZA 3LYXA 5TBMA 1T19A 1KOUA 4EW7A 5HSQA 3FG8A 5KIZA 2PYPA 1S4SA 3A0SA 3A0VA 3UB6A 2V1BA 2BASA 3F1PB 4I3IA 4NXGA 1GSXA 4HP9A 3LICA 1XJ4A 4NXBA 5TBMB 4YWZA 5J3WA 4DJ3A 1DP9A 4LLOB 2V0WA 1LL8A 3F1OB 2HV1A 1UGUA 1OTBA 1TS0A 3PHYA 3HJIA 1OJ5A 2P7JA 3H7WB 5F69A 5F5YA 1UWNX 3LUQA 3UB8A 3CLOA 4JGRA 3EWKA 4GS9A 3OLOA 3H9WA 2KX6A 1TS6A 4PKYG 1OJGA 3NOPC 4LPZA 1P97A 4RQ9A 3B33A 5F6AA 5HD5A 4I3JA 4EESA 3GDIA 4EEPA 4F3LB 3NOUC 3LIFA 3H7WA 4I5SA 3LIEA 1JNUA 4WN5A 3LIDA 2V1AA 2OWJA 2GJ3A 3SW1A 1X0OA 3T50A 2J80A 2WKQA 1S4RA 4WLAA 3KX0X 1F9IA 4HJ6A 3MQOA 1OTAA 3BY9A 4GHIB 4HOIA 4HP4A 1LSXA 5DJTA 1XJ3A 3RH8B 3MJQA 4MN6A 3NOTC 2L0WA 5IU1A 4B9OA 5HWTA 1N9LA 1OT9A 3LIBA 5HZHA 1DP8A 2JHEA 2QJ7A 2V0UA 3UB7A 5DKLA 4H6JA 4F3LA 2Z6CA 2YKFA 2VLGA 4EEUA 1VB6A 3HJKA 1N9NA 2PD7A 2YKHA 3IS2B 1DP6A 4L9GA 2K7SA 4WF0A 2W0NA 4BBVA 2R78A 3BWLA 2VV8A
chains in the Genus database with same CATH superfamily
3U4LP 3VFHA 4UQIM 2V20A 2VGLS 3PYPA 1NWZA 3F1NA 1EW0A 1XP4A 3S7NA 2ZD8A 5HX9A 1K54C 1S1YA 3T12B 3FWLA 4B4ZA 2WKHA 2A24B 4BWIA 4BBVA 1SCWA 3V5MA 3V3SA 3TRCA 3Q81A 3DTIA 4RX2A 3OPHA 1TEMA 4DF6A 4IJGA 4DMZA 1TVFA 2ZLYA 5C5KA 3F1PA 4HEFA 5FDHA 3MXQA 4OPZA 3F1OA 3IBJA 4EERA 2L4RA 3IX3A 2W3EA 4PHTA 4Y5FA 5IT5A 4PM8A 3A0SA 2EFXA 4KZ8A 3LICA 4B93A 3S7OA 2ZMVA 5F5YA 3QNCA 2Y4AA 1PI5A 2HP6A 4RQ9A 5KZHA 2HDSA 5D3OA 1NZOA 4I5SA 3VV4A 3UNWA 1X0OA 2V8CA 5G18A 1ZTUA 2Y55A 3HLFA 4PM7A 5EUAA 1DP6A 3JVUA 2GDNA 3IF6C 4QY6A 3TOIA 1SZVA 5L09A 3RXWA 2LB5A 5TR7A 2AVXA 4OQHA 3IF5A 1V9YA 2DNSA 1W8YA 2P74A 3QP8A 1N9OA 4R3JA 3ICYA 3CZDA 1YLPA 1RCJA 4HIAA 2Y2JA 3PBQA 2EWWA 5L10A 4PPRA 3UPNA 5DTKA 2HDUA 4HH3A 4X6TA 1KVLA 5CERA 4EBLA 4CLCE 4JXGA 1CEFA 3TG9A 3O86A 1OT6A 1ONGA 1F98A 3NJAA 4EQIA 1CJFA 3EQVA 4JF4A 4EXOA 3M6HA 3K2NA 2Y2PA 2V9AA 1D1JA 3QNBA 4KZ4A 3GQZA 3BQ8A 1KE4A 1YSPA 4U0XA 1LL8A 2OAQ1 3IWOA 5F69A 2QMIA 1HLUP 5GHXA 3V50A 3LIFA 5HL6A 4ZJ2A 1MPLA 1L0EA 3TJZC 5DFYA 3SW1A 1YLYA 1S4RA 1LSXA 2ZC5B 3RH8B 4KZ5A 1ES2A 2PRFA 4F94A 1NY0A 4WM9A 1S67L 2XF3A 3K3CA 4KZ3A 4GN2A 2JKRM 4E3NA 2VGLM 4MN5A 5FAQA 4HY8A 3E2LA 2WADA 4JBFA 5DF9A 1YSQA 2ZL1A 4OOLA 1VEUB 5AQ7A 3VE3A 2WKIA 2O9AA 4BL3A 3ZQ5A 3KSHA 3A3DA 2W1RA 1JWZA 2I72A 1K56A 2XROA 4K08A 2VJWA 3MFDA 2WKRA 4R0QA 4ZRRA 2IA2A 3KSFA 4NEED 3T1QB 1V9ZA 2Y2MA 1FCMA 2VEAA 5F68A 1F5MA 1OPXA 5FQIA 4CLCA 4R23A 2QJ5A 2H5SA 3NBLA 2WAEA 4IEDA 4HH2A 3ZHHA 5FEFA 4P87A 3HLBA 4E6XA 1WA9A 1MZUA 4IBRA 2QZ6A 3JYIA 5HSQA 4II7A 3C5AA 3F1PB 1K6SA 3MQ0A 4HP9A 4OP8A 4R4RA 1DP9A 2M7VA 1SDEA 2V0WA 3Q07A 1F2KA 4LV1A 1YMXA 3GV9A 1U60A 3ZG0A 3W4OA 4S2KA 1YMSA 1HD8A 1DY6A 3M2JA 2QYBA 3A3IA 4XUZA 4KQOA 1ES4A 1RP5A 4X55A 1NRFA 5A90A 4N9KA 5HZHA 3S7QA 1VB6A 2K7SA 1AWIA 1K0KA 2Y2LA 1P0ZA 2C6WB 1YLZA 3MZFA 3F1NB 5HD3A 2FFFB 4BBUA 4E04A 1MXOA 1A0KA 4QD4A 4CJNA 4ETZA 3WS1A 4BBTA 1PZOA 4H6JB 3WS0A 4EETB 1CQAA 1T18A 3M6BA 3QP2A 2JC7A 4XT2A 5FL3A 3I7JA 4HJ4A 1XA7A 1D06A 4YNRA 1CF0A 3CUEC 1MWSA 3QP4A 2A3UA 5AQAA 4DE2A 1DJBA 2CMNA 4PM6A 1PZPA 4XT2B 4K0XA 1BZAA 1IEMA 4UQIS 5GL9A 2ZQCA 4S2JA 2O0YA 4M4XA 3VOYA 2R9WA 2RL3A 3MSHA 3G6OA 2J7VA 3B42A 4ID4A 1XPBA 4WZ5A 4R3BA 5FQMA 4WYYA 4Y0UA 4Y15A 3MS6A 1XFQA 4GS9B 4ZJ1A 1SDNA 4GDBA 5EVEA 3T1XA 4KG6A 1FCNA 4LCMA 3SS3A 3HUMA 4DJ3A 3QP1A 5JYOA 3SH9A 1ZHHB 4PM9A 1TS0A 2HF6A 3R4KA 4JF6A 3OLOA 3HCYA 3NOPC 3EGDC 1IELA 2XR0A 5E2EA 1P9RA 2V1AA 2OWJA 2A49A 2J80A 1QMFA 3KX0X 3EOIA 2XSSA 4MN6A 5L8MA 1CI8A 3A3JA 3MBZA 2P9VB 3UDIA 1IOUA 5CXWA 4JKTA 5FI7A 1FOFA 1PW1A 1Q2PA 2XK1A 3CHWP 3D3OA 3FC7A 3LEZA 4OPYA 3GVBA 1FCOA 3HLGA 4JGQA 1S66L 3PBTA 1XA1A 4G3VA 2QPNA 2D01A 5FSRA 5F1FA 4BQMA 1OTEA 3WS2A 3AGDA 3BY8A 3OZHA 5GLCA 5GHYA 3K3DA 5E2GA 3MKFA 3U2AA 4IUHA 3V67A 4Y2FA 4JLFA 2VV7A 3PBSA 4PKYA 1I2SA 4NK3A 4JPMA 1K38A 2Z2MB 3AGEA 4ESPA 1YKDA 2J9OA 3ZVWA 3E4QA 4I39A 4YFMA 1JWPA 1GA0A 3FPWA 4U0TA 3C2WA 3CITA 1LHYA 4BD0A 4N9LA 2G2WA 1S1ZA 4EW7A 4N1XA 1L3LA 1IYQA 1G6OA 5EPHA 1PWCA 1S4SA 1GHPA 3UB6A 3L9KA 2HP9A 3C4PA 4P0MA 3NDEA 3LUQA 4HBTA 3O3VA 4LENA 4BL2A 1P97A 5MC7A 5EOOA 3CI6A 1VHMA 4OLGA 5KSHA 3H7WA 5CEBA 2ZQ7A 2ZC4B 4Y17A 3N7WA 2VX8A 3LIDA 3WRTA 1FSWA 4C75A 4L0LA 3VP1A 1F9IA 5TGFA 3NOTC 3NIAA 1L0FA 1N9LA 3KO6A 3LIBA 5HPFA 1PNEA 4GNUA 2VLGA 4EEUA 1K4EA 3V39A 1Q2QA 5IS1A 1LSVA 5EVIC 3OBFA 4GB7A 4S2LA 3IXHA 5FQJA 1L0DA 2XRNA 1LT0A 3S7PA 3W4QA 4EU0A 4R38A 4CQHA 4LRZE 3GECA 3A0RA 3N8LA 1FILA 5FQKA 1PI4A 3OPPA 3H82A 4EQ1A 3MFXA 4R6LA 4QPRA 3UE6A 3T1RA 3ITAA 1G28A 3VP3A 1NYYA 2JKRI 3E2KA 3C7VA 4KZ9A 1LL5A 1Y28A 3OCLA 1W79A 3R7WB 1C3BA 3CJMA 4OH0A 4U3TA 5CHUA 3EEAA 4MBHA 4EUVA 3ULFA 4LFUA 3ISGA 2BASA 5J3WA 5E2HA 1BULA 3R7WA 4GKUA 3P98A 1NZUA 3H7WB 2V2FF 3IT9A 3GTCA 4GS9A 1TDGA 3B33A 2ZM0A 4F3LB 2J3TD 3T50A 2DMWA 4O7DA 3DW0A 5U47A 3BY9A 4QY5A 3IHBA 3EQUA 1P9WA 3G34A 2C5WB 5DTTA 3IS2B 1ERMA 4JGPA 2H10A 3ZCZA 3BQAA 2QKPA 5I94A 1VM1A 3IF6B 3OPLA 1EI5A 3WS4A 1JTDA 3SH7A 3G31A 1E3UA 4DJ2A 1OTDA 3UB9A 2UWXA 4KQDA 4JXSA 2H28A 3O5YA 1M40A 4ME4A 1L0GA 3Q7VA 4WZ5C 3NY4A 1H3QA 5DJUA 2HJ9C 4Y3IA 5DKKA 1XFNA 3S22A 4QU3A 2PYRA 3C38A 4UA9A 2NUPC 1Y54A 1KVMA 5CTMA 4N92A 2QWSA 3NDGA 1CK3A 2VV6A 5L2FA 1GCEA 5M1AA 3CMZA 3KSIA 3DTKA 2GX5A 2V1ZA 2Y8HA 2VGJA 1G6AA 4LV0A 2EWVA 3G2YA 2ZMAA 5A93A 3LYXA 1MWUA 3SZTA 1WYBA 2NUTC 4KG2A 3LFVA 2V1BA 1GSXA 3HUNA 4FUWA 1DJAA 4WZ4A 4CLCC 4QWOA 2XA7M 1MKMA 4S2NC 3HJIA 3MXSA 4QJGA 4MMNA 1HVBA 1ACFA 1YAXA 2HPBA 3DAVA 4FH2A 3O88A 2WKQA 2JCHA 2O9BA 2WAFA 4KG5A 4HJ6A 3MQOA 4HOIA 4GHIB 1G68A 4B9OA 2L0WA 4DXCA 2P04A 3GMWA 3LY3A 5GLAA 4C6YA 4L9GA 2JKTM 2VV8A 4MBKA 1D7EA 4OKPA 3NI9A 2Y79A 3DTEA 4GHIA 3VP0A 3C8CA 1H8MA 1YPRA 4HQAA 2XA7S 1K6RA 4KUOA 5AVEA 4Y13A 1S0WA 2ZBBA 3CPTA 3LEQA 2B5RA 1FSYA 5GHZA 2K2NA 4KZ7A 2OOLA 2L1MA 2PR5A 5J7EA 2PR6A 3L7HA 1IKIA 1KE0A 4Q0HA 3OOVA 3PBOA 4GZBA 4IHQA 1BLSA 5EVLA 5J4EA 2W27A 4L9FA 4IBXA 4MLLA 4FH4A 3IWQA 5HDSA 4KENB 4RVAA 3ZG9B 5HDDA 3BM6A 4CLCB 1H0MA 4P6BA 3ZGAB 5F82A 4X1LA 3S1YA 1DJCA 3LY4A 5FATA 2OAP1 4I3IA 1XJ4A 4NXBA 5EOEA 5TBMB 2PU4A 1PYYA 3IXBA 5EVID 1FR6A 1XXMA 1CEGA 5J8XA 4WMCD 1AXBA 1UWNX 1RGZA 2OV5A 4PKYG 5FI2A 5HW3A 1K57A 2W3FA 4DE1A 3EGXC 1PWGA 1TF1A 1YLJA 3LGOA 4QHCA 4JXWA 2ZC3B 3LO7A 5FASA 2VGKA 2MJ6A 1O7EA 4IVKA 2E8JA 1JVJA 5FAPA 2JHEA 2V0UA 4OQGA 1PFLA 3HJKA 1MY8A 4OLDA 1WYCA 3BWLA 2M1CA 4G3WA 2X71A 3D72A 4E3OA 4E3MA 2WKEA 1W63Q 3CPTB 4HHDA 1ONHA 3UY6A 4O0PA 5FEGA 4R1GA 2WGWA 1KDSA 3H82B 4FTXA 1IYOA 1PW8A 3ITBA 4MEZA 5FQQA 3T4OA 1KGGA 4GOGA 3OC2A 4EBNA 2Y2HA 4E6WA 3IWIA 4DRTA 5L07A 5CECA 2JKTI 3D9YA 2IWCA 4LRYC 2JN7A 2WZZA 1BLHA 3UE3A 1Y4OA 4A5RA 2Y91A 2Y2NA 3G32A 4WEKA 4DKIA 3F1OB 2BLSA 2EX6A 4UAAA 2FFYA 4LGWA 5F6AA 3NOUC 4E3JA 2IWDA 3LIEA 2XH9A 2PU2A 3HLDA 4HBUA 3M2KA 3HLCA 3PR6A 5HAQA 1GHMA 3UB5P 3UB7A 4H6JA 1VQQA 4DDYA 4NETA 5A91A 4PMAA 4LV2A 4UEYA 3A3FA 1K56D 4RX3A 5HARA 1W63M 5CTNA 2HDQA 4DXBA 4E3IA 3EEHA 4EWFA 1XJ2A 5HAPA 2JKGA 3OPRA 2WGVA 2A24A 4O01A 1LSWA 1VEUA 3IX4A 3G30A 2GNXA 1ESIA 3LI9A 1BLPA 4FOFA 1UWPX 2Y59A 2V8FA 3LR0A 3SOIA 3ZYTA 3IH8A 1YT4A 2PHYA 4ZAMA 2O99A 2ZOIA 5A8BA 3E4OA 3IX8A 3LCEA 3ZNYA 2XLNA 3T4KA 1MC0A 3LR3A 2WUQA 4NXGA 5IHVA 2XFSA 3UPOA 2A2LA 1ESUA 5EM1A 1I5QA 2J8YA 2P7JA 4OQIA 3CLOA 3JPUA 3H9WA 2EFUA 4LPZA 2G2UA 4BENA 4Y0OA 4MNRA 3UN7A 4X56A 3VP4A 4MCWA 1K25A 3ZVTA 3MJQA 4DE3A 5M19A 2JKFA 3MKEA 4UHUA 4N1HA 3KYEA 4LV3A 2XD5A 1GSVA 2I9VA 2HDRA 2JE5A 2B02A 4MDZA 1VETB 5HFOA 4LRXC 2EX8A 1IKGA 3HLWA 1GHIA 1L2SA 1SKFA 4YINA 1YLTA 1SKOB 2H0YA 2BG1A 3BFEA 4L9EA 1TS7A 4NXEA 2XEPA 5K5BA 5I5LA 4XXRA 5HWVA 3TSGA 4Z9QA 2WGWB 1FIKA 4HESA 1HTZA 4GD8A 4KZBA 5F1GA 4R3AA 1SKOA 3B3XA 4AFIA 4WL9A 4GLQA 1PRQA 3SS5A 5E43A 2O9CA 3WRZA 3UDFA 2J9PA 3MF0A 5BOHA 5TBMA 1T19A 1KOUA 2B18A 3DBAA 3MZDA 1E4DA 2W3DA 1BUEA 4E3LA 4LLOB 1UGUA 3BFCA 1LLBA 2EXAA 2VZWA 3ZG7B 4CLCD 1OJ5A 5EECA 3UB8A 4EEPA 5M18A 2ZJ9A 3DWZA 4S2PA 2PAVP 3HUOA 2XQZA 2PT7A 2Y2QA 4WLAA 1NRJA 1MWRA 2Q9NA 4HP4A 1Z6FA 2W3HA 1J9MA 4X25A 3PAGA 1KGEA 1YLWA 3RJUA 3KSGA 2YKHA 3VMAA 3BRMA 3QP6A 1ZC2A 4K91A 2Q9MA 2HZ5A 5EFWA 3BJNA 1NJ4A 5EV0A 3RTYA 2WGIA 1FQGA 5LBRA 4OPQA 1XX2A 3MXRA 3N8RA 1IFQA 5AVFA 4JGOA 2X02A 3E98A 3PBNA 3IQAA 3MQQA 4OPRA 2ZOHA 3LI8A 4GW9A 1H8YA 3G35A 3Q7VB 2XD1A 1G5UA 2EX9A 2FZ0A 2D02A 4HNBA 4OOMA 4BLMA 1NLZA 4WMCA 3QP5A 4I38A 1NYMA 5CRFA 2R9XA 3HVFA 3UE0A 1T1AA 2KDKA 1TS8A 3ZFZA 2OLVA 4LCLA 4OONA 3T4TA 5EE8A 3A0VA 1W7FA 3SS4A 1N9BA 1J3WA 3Q82A 5DFXA 4OVDA 2X01A 3Q1FA 1E25A 2J3TC 1ES5A 2LB9A 2P9VA 4EESA 4RA7A 3VFFA 4OP5A 4X53A 4X68A 2HJEA 4P6ZS 1MKIA 1BLCA 1OTAA 4S2IA 1RGYA 4DDSA 5HAIA 2W3GA 1ZG6A 4BD1A 1EROA 1K4FA 2BTFP 3ZNTA 4Y7PA 2W0NA 1W5DA 4FSFA 2DRWA 4KUKA 1JWVA 3C7UA 1ZKJA 4ZTKA 1H8ZA 3BFFA 4FCFA 5FA7A 4IVIA 3MR0A 3VSLA 2EA9A 2VA0A 5HWWA 4MN7A 1O07A 4FD8A 3RFBA 4O8GA 3GSGA 1H5XA 4ZBEA 4IUKA 4I3AA 3JVVA 1YM1A 1ODVA 5DVAA 3VOZA 2M7UA 2OSUA 3P09A 2PBDP 4R70A 1XJ6A 5AQBA 1DRMA 3BFGA 2HGVA 3GR2A 5E2FA 1QMEA 1JTGA 4BMWA 5HPIA 3VP2A 4Q8IA 3HBRA 4KQQA 3N8SA 5CHMA 4Y0TA 1K55A 5KIZA 4EBPA 1ZG4A 1WE4A 3P01A 2XDMA 4P6ZM 5CGWA 5KMWA 3PAEA 4S2NA 4EUZA 5FQ9A 2RCXA 1OTBA 3TE8A 4JGRA 2E8IA 3EWKA 3B47A 2B95A 2J3WA 5DTSA 2ZQ8A 2ZM2A 3KYZA 4JXVA 4PAUA 1Z09A 3BLSA 1BTLA 5HWTA 2QJ7A 4ETXA 2YKFA 2ZC7A 1IYSA 4Z1WA 1HZOA 3IH9A 2ZL1B 2Q0OA 3FKVA 4H8RA 2OLUA 5AJGA 1T1BA 4GJ4A 1OTIA 3MZEA 3MMHA 2Y2GA 2INWA 5G4YA 3SH8A 3VE4A 3OCNA 3S4XA 3CUEA 4M3KA 3NULA 3BECA 4KZ6A 2WZXA 2ZQDA 2VKSA 1BYWA 3P7NA 3CWFA 5GLBA 4QB8A 2Z6DA 3PBRA 3QHYA 3DTMA 3RXXA 5DF8A 2VK3A 4DN0A 2PBYA 2WK0A 3NCKA 1KGFA 3KYQA 4UA7A 1TDLA 3W4PA 3C4OA 4G3KA 3NC8A 4P85A 3FG8A 2PYPA 4XUXA 2HP5A 3HL9A 1SHVA 4D60A 2G7UA 1LI0A 3T4QA 3TW8A 4B4XA 3T4LA 2W1TA 3GDIA 3CG5A 5AQ9A 4RYEA 4WN5A 1K54A 4NKPA 3ZDJA 2ZM8A 5TJJA 5DJTA 2Y2KA 5IU1A 1OT9A 4WEJA 1E3UD 2DCFA 4S2OA 5DKLA 4F3LA 2Z6CA 3BFDA 5FI6A 1N9NA 2PD7A 1KDWA 3FZCA 3E0YA 4GCZA 3UPPA 1MBLA 4ZDXA 1S6RA 1BSGA 1EWZA 2UV0E 2Z2LB 2EX2A 1ALQA 3AGFA 3HREA 3T4JA 2Y2IA 2IWBA 3IS2A 3O87A 4BJPA 1N4OA 3NHQA 2PDRA 4PM5A 2H0TA 4UA6A 3VSKA 3W2ZA 3PXPA 3G2ZA 3UDXA 2K31A 3IHAA 3WS5A 3D4FA 5CHJA 3FV7A 1MWTA 4HJ3A 5DF7A 3E4PA 4MBFA 5EVIA 3NECA 5HDCA 5CX7A 3LIAA 5GLDA 3ZG8B 2XGNA 1T1CA 4OQ0A 5EVIB 4B88A 2W1TB 3UO9A 1KE3A 2P08A 2HV1A 1PWDA 1CI9A 2KLIA 3PHYA 2KX6A 1TS6A 5HD5A 1OJGA 3IXDA 4I3JA 4E3KA 4GDNA 2XFTA 3V3RA 3Q7ZA 2CC1A 2Y2OA 4X69A 3W8KA 4Q0JA 5JYPA 1XGJA 1ES3A 1W8QA 3DWKA 1DP8A 3FYZA 4WF0A 1K55C 1K57C 2ZQAA 2WKPA 4JF5A 3UE1A 3IF6A 1LI9A 3GRJA 3CAXA 3UMEA 1BT5A 4NG2A 2WYXA 3PTEA 4YOFA 5CEDA 3N4IA 1TD5A 2ZQ9A 3BW6A 4D2OA 1ERQA 4X1MA 4S2MA 2ZC6B 4R4SA 3UMDA 2ACGA 3ZG5A 3BEBA 1STZA 4OOYA 1NXYA 3T4SA 3LR5A 4NXFA 5CGSA 1I2WA 3IXGA 4WBGA 5F83A 5TFQA 4CPKA 4HI4A 4Q0IA 3BLMA 5A92A 5FAOA 3IBRA 3WWXA 2EXBA 4WUJA 4ARZA 2JBFA 3FPVA 3VOLA 5KSCA 2OWHA 2PD8A 1IYPA 5HL1A 4C3QA 2QHKA 1GSWA 5G4ZA 4KQRA 3BYDA 1NLYA 1GA9A 3HLEA 4WELA 1LL9A 4ARZB 4YWZA 3G4PA 1PIOA 5EM0A 5CGXA 4DE0A 4EV4A 3N6IA 1XKZA 5FDSA 1JNUA 2GZAA 3T1SA 4KZAA 2GJ3A 1OMEA 1XGIA 1FR1A 1XJ3A 3LR4A 3C30A 1VETA 2FH5A 2KOIA 3FKWA 4GD6A 1YQSA 2ZMFA 4K0WA 3A3EA 2R78A 1M6KA 4ZJ3A
chains in the Genus database with same CATH topology
4FSFA 4UQIM 2VGLS 4KUKA 3D3OA 3PYPA 2M1CA 3FC7A 4G3WA 3D72A 4JGQA 1S66L 1NWZA 3PBTA 3F1NA 3MR0A 4G3VA 1W63Q 2EA9A 2VA0A 1EW0A 5HWWA 4HHDA 4MN7A 2D01A 1OTEA 4O0PA 3BY8A 3S7NA 3RFBA 3H82B 1S1YA 4O8GA 4IUKA 4I3AA 3K3DA 3U2AA 4IUHA 3T4OA 3V67A 4Y2FA 3JVVA 2A24B 4BWIA 4BBVA 2VV7A 1ODVA 3PBSA 3OC2A 4PKYA 3TRCA 2M7UA 4IJGA 4R70A 1XJ6A 4DMZA 1DRMA 1YKDA 5C5KA 3F1PA 3E4QA 2HGVA 4I39A 3MXQA 2JKTI 3F1OA 3FPWA 3IBJA 2L4RA 4BMWA 4EERA 5HPIA 3C2WA 3CITA 2JN7A 4LRYC 1S1ZA 4EW7A 2W3EA 4PHTA 4Y5FA 3UE3A 5IT5A 5KIZA 1G6OA 1S4SA 3A0SA 3UB6A 3P01A 3LICA 4B93A 4P6ZM 4WEKA 3F1OB 3S7OA 2ZMVA 1OTBA 3TE8A 5F5YA 3LUQA 4JGRA 3EWKA 3B47A 1P97A 4RQ9A 5F6AA 5MC7A 3CI6A 1VHMA 3NOUC 5KSHA 3H7WA 4I5SA 3LIEA 3VV4A 2J3WA 2VX8A 3LIDA 3KYZA 1X0OA 4L0LA 1F9IA 4PAUA 1ZTUA 3NOTC 5HWTA 1N9LA 3LIBA 3KO6A 5HPFA 3PR6A 2QJ7A 3UB7A 4H6JA 4ETXA 2YKFA 2VLGA 4EEUA 1DP6A 4Z1WA 4UEYA 3JVUA 5IS1A 1LSVA 1W63M 3OBFA 2LB5A 5AJGA 3EEHA 1V9YA 1T1BA 4GJ4A 1OTIA 1XJ2A 2XRNA 1LT0A 3S7PA 1N9OA 3MMHA 3ICYA 4R38A 4EU0A 4CQHA 4HIAA 4LRZE 2INWA 2A24A 3PBQA 2EWWA 5G4YA 3GECA 3A0RA 4O01A 3VE4A 3OCNA 1LSWA 3CUEA 2GNXA 4HH3A 3H82A 3LI9A 4EQ1A 3MFXA 4FOFA 4R6LA 2VKSA 1UWPX 4CLCE 4QPRA 1BYWA 3P7NA 3UE6A 3CWFA 2Z6DA 3LR0A 1OT6A 3PBRA 1G28A 3ZYTA 1F98A 2JKRI 2PHYA 4DN0A 3NJAA 1Y28A 3OCLA 2O99A 2ZOIA 3EQVA 5A8BA 4EXOA 3E4OA 3KYQA 3R7WB 3K2NA 3EEAA 2V9AA 4G3KA 4EUVA 3ULFA 3T4KA 1MC0A 3LR3A 3FG8A 2PYPA 4NXGA 2BASA 2G7UA 3BQ8A 5J3WA 2A2LA 3T4QA 1YSPA 3TW8A 1LL8A 3R7WA 3T4LA 2OAQ1 2P7JA 3H7WB 5F69A 2W1TA 3CLOA 4GS9A 3H9WA 4LPZA 3B33A 3GDIA 4F3LB 3LIFA 2J3TD 5HL6A 4WN5A 4NKPA 3TJZC 5DFYA 3SW1A 3T50A 5TJJA 2DMWA 1S4RA 4MCWA 3BY9A 5DJTA 1LSXA 3RH8B 3EQUA 3MJQA 5IU1A 1OT9A 4WEJA 1P9WA 5DKLA 4F3LA 2Z6CA 1N9NA 2PD7A 3IS2B 3E0YA 4GCZA 1S67L 3K3CA 1GSVA 2I9VA 4JGPA 2JKRM 2B02A 4MDZA 2VGLM 3BQAA 2QKPA 4MN5A 4HY8A 4LRXC 5DF9A 1YSQA 3T4JA 3IS2A 4BJPA 4OOLA 3NHQA 3VE3A 2PDRA 4DJ2A 1OTDA 2O9AA 3UB9A 3ZQ5A 3W2ZA 3PXPA 4KQDA 3KSHA 2H28A 3O5YA 4ME4A 2W1RA 2K31A 2XROA 4K08A 2VJWA 4L9EA 1H3QA 1TS7A 2WKRA 4NXEA 5DJUA 5K5BA 2HJ9C 5I5LA 5HWVA 4ZRRA 4Y3IA 2IA2A 5DKKA 1XFNA 3KSFA 4NEED 2PYRA 1V9ZA 3C38A 2NUPC 4HJ3A 3E4PA 4R3AA 2QWSA 2VEAA 5F68A 1F5MA 1OPXA 4AFIA 2VV6A 4WL9A 4GLQA 4CLCA 2QJ5A 5HDCA 4HH2A 3KSIA 5CX7A 3LIAA 1WA9A 2O9CA 1MZUA 2GX5A 2Y8HA 3MF0A 2EWVA 1T1CA 5TBMA 3LYXA 1T19A 1KOUA 5HSQA 2B18A 3DBAA 4II7A 2NUTC 3LFVA 2V1BA 3F1PB 1GSXA 3MQ0A 4HP9A 2W3DA 2W1TB 2P08A 1DP9A 2M7VA 4LLOB 2V0WA 4CLCC 2HV1A 1UGUA 2XA7M 2KLIA 1MKMA 2VZWA 3PHYA 4CLCD 3HJIA 1OJ5A 3UB8A 2KX6A 1TS6A 4MMNA 1OJGA 5HD5A 4EEPA 4I3JA 1YAXA 2QYBA 4KQOA 2PT7A 2WKQA 4WLAA 1NRJA 2O9BA 4HJ6A 3MQOA 4HOIA 4GHIB 4HP4A 4Q0JA 4B9OA 2L0WA 2P04A 2W3HA 5HZHA 1DP8A 3S7QA 1VB6A 3KSGA 2YKHA 4L9GA 4WF0A 2K7SA 2JKTM 2VV8A 1D7EA 1P0ZA 2WKPA 2Y79A 3F1NB 5HD3A 4BBUA 4GHIA 4E04A 3C8CA 1H8MA 4HQAA 2XA7S 3CAXA 3UMEA 4ETZA 5EFWA 3BJNA 4H6JB 4BBTA 4EETB 1T18A 4YOFA 4KUOA 3RTYA 5AVEA 4XT2A 5LBRA 5FL3A 4HJ4A 1TD5A 3BW6A 1D06A 4YNRA 2ZBBA 1IFQA 5AVFA 3CUEC 4JGOA 3UMDA 2K2NA 3E98A 2OOLA 2L1MA 2PR5A 3PBNA 3MQQA 5J7EA 2ZOHA 1STZA 3LI8A 2PR6A 2CMNA 3T4SA 4GW9A 3LR5A 4NXFA 4Q0HA 3OOVA 3PBOA 4XT2B 4IHQA 4UQIS 4HI4A 2O0YA 4M4XA 4Q0IA 5J4EA 2FZ0A 2W27A 2D02A 4HNBA 4OOMA 4L9FA 3G6OA 3IBRA 1NLZA 3B42A 4WUJA 5HDSA 4ARZA 5HDDA 4I38A 3FPVA 3VOLA 2OWHA 2PD8A 1T1AA 2KDKA 4CLCB 1TS8A 2QHKA 1XFQA 4GS9B 1GSWA 5G4ZA 1NLYA 3T4TA 3A0VA 2OAP1 4I3IA 4WELA 1XJ4A 4NXBA 4ARZB 5TBMB 4YWZA 4DJ3A 5DFXA 1ZHHB 1TS0A 2HF6A 3R4KA 1UWNX 3OLOA 3HCYA 2J3TC 2LB9A 3NOPC 4PKYG 3EGDC 4EESA 2W3FA 3EGXC 1JNUA 1TF1A 1P9RA 2GZAA 2HJEA 2OWJA 2V1AA 2GJ3A 4P6ZS 2J80A 3KX0X 3EOIA 1OTAA 2XSSA 2MJ6A 1XJ3A 3LR4A 4MN6A 5L8MA 3C30A 2FH5A 2W3GA 2KOIA 2JHEA 2V0UA 1IOUA 2ZMFA 3HJKA 2W0NA 2R78A 3BWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D7E A;  1P0Z A;  1S67 L;  2WKP A;  4GCZ A;  3K3C A;  4KUK A;  5IS1 A;  1GSV A;  2I9V A;  4JGP A;  3F1N B;  5HD3 A;  1LSV A;  3PYP A;  4GHI A;  2M1C A;  2B02 A;  4BBU A;  4E04 A;  3C8C A;  4HQA A;  3FC7 A;  2QKP A;  3D72 A;  4MN5 A;  4HY8 A;  4JGQ A;  3CAX A;  3UME A;  1S66 L;  1NWZ A;  4LRX C;  5EFW A;  4H6J B;  4BBT A;  3F1N A;  3EEH A;  3MR0 A;  4EET B;  1T18 A;  1V9Y A;  1T1B A;  5HWW A;  2EA9 A;  4KUO A;  3IS2 A;  1EW0 A;  1OTI A;  4HHD A;  1XJ2 A;  2D01 A;  5AVE A;  4XT2 A;  1LT0 A;  3RTY A;  1OTE A;  1N9O A;  3NHQ A;  3ICY A;  4HJ4 A;  4R38 A;  3VE3 A;  2PDR A;  3BY8 A;  4DJ2 A;  1OTD A;  4HIA A;  4LRZ E;  1D06 A;  2INW A;  3UB9 A;  2A24 A;  3H82 B;  5G4Y A;  2ZBB A;  3GEC A;  5AVF A;  3ZQ5 A;  3A0R A;  1S1Y A;  4KQD A;  4JGO A;  3VE4 A;  3UMD A;  5A8B A;  1LSW A;  2H28 A;  4I3A A;  3K3D A;  2OOL A;  2L1M A;  2PR5 A;  3MQQ A;  5J7E A;  2ZOH A;  2A24 B;  3H82 A;  3LI8 A;  4HH3 A;  2PR6 A;  4K08 A;  2VV7 A;  2CMN A;  3LI9 A;  1TS7 A;  1ODV A;  2WKR A;  4GW9 A;  4L9E A;  4NXE A;  4NXF A;  5DJU A;  4PKY A;  4EQ1 A;  3MFX A;  5I5L A;  4R6L A;  5HWV A;  4XT2 B;  5DKK A;  1UWP X;  1XFN A;  1BYW A;  3P7N A;  4HI4 A;  3UE6 A;  4M4X A;  2PYR A;  1V9Z A;  3CWF A;  4HJ3 A;  3E4P A;  2Z6D A;  5J4E A;  4R3A A;  2QWS A;  1OT6 A;  2VEA A;  2W27 A;  5F68 A;  2D02 A;  4HNB A;  1XJ6 A;  4R70 A;  4L9F A;  1DRM A;  3G6O A;  1G28 A;  3IBR A;  1F98 A;  2VV6 A;  2PHY A;  3F1P A;  4WL9 A;  4WUJ A;  5HDS A;  3E4Q A;  3NJA A;  2QJ5 A;  5HDC A;  1Y28 A;  4HH2 A;  4I39 A;  2ZOI A;  5HDD A;  3MXQ A;  4EXO A;  3LIA A;  4I38 A;  1WA9 A;  3VOL A;  1MZU A;  3E4O A;  2OWH A;  3F1O A;  4EER A;  2L4R A;  2PD8 A;  3C2W A;  1T1A A;  2JN7 A;  2KDK A;  4LRY C;  1TS8 A;  2V9A A;  2QHK A;  1XFQ A;  1S1Z A;  1T1C A;  1GSW A;  4GS9 B;  3ULF A;  5G4Z A;  3LYX A;  5TBM A;  1T19 A;  1KOU A;  4EW7 A;  5HSQ A;  3FG8 A;  5KIZ A;  2PYP A;  1S4S A;  3A0S A;  3A0V A;  3UB6 A;  2V1B A;  2BAS A;  3F1P B;  4I3I A;  4NXG A;  1GSX A;  4HP9 A;  3LIC A;  1XJ4 A;  4NXB A;  5TBM B;  4YWZ A;  5J3W A;  4DJ3 A;  1DP9 A;  4LLO B;  2V0W A;  1LL8 A;  3F1O B;  2HV1 A;  1UGU A;  1OTB A;  1TS0 A;  3PHY A;  3HJI A;  1OJ5 A;  2P7J A;  3H7W B;  5F69 A;  5F5Y A;  1UWN X;  3LUQ A;  3UB8 A;  3CLO A;  4JGR A;  3EWK A;  4GS9 A;  3OLO A;  3H9W A;  2KX6 A;  1TS6 A;  4PKY G;  1OJG A;  3NOP C;  4LPZ A;  1P97 A;  4RQ9 A;  3B33 A;  5F6A A;  5HD5 A;  4I3J A;  4EES A;  3GDI A;  4EEP A;  4F3L B;  3NOU C;  3LIF A;  3H7W A;  4I5S A;  3LIE A;  1JNU A;  4WN5 A;  3LID A;  2V1A A;  2OWJ A;  2GJ3 A;  3SW1 A;  1X0O A;  3T50 A;  2J80 A;  2WKQ A;  1S4R A;  4WLA A;  3KX0 X;  1F9I A;  4HJ6 A;  3MQO A;  1OTA A;  3BY9 A;  4GHI B;  4HOI A;  4HP4 A;  1LSX A;  5DJT A;  1XJ3 A;  3RH8 B;  3MJQ A;  4MN6 A;  3NOT C;  2L0W A;  5IU1 A;  4B9O A;  5HWT A;  1N9L A;  1OT9 A;  3LIB A;  5HZH A;  1DP8 A;  2JHE A;  2QJ7 A;  2V0U A;  3UB7 A;  5DKL A;  4H6J A;  4F3L A;  2Z6C A;  2YKF A;  2VLG A;  4EEU A;  1VB6 A;  3HJK A;  1N9N A;  2PD7 A;  2YKH A;  3IS2 B;  1DP6 A;  4L9G A;  2K7S A;  4WF0 A;  2W0N A;  4BBV A;  2R78 A;  3BWL A;  2VV8 A; 
#chains in the Genus database with same CATH topology
 3U4L P;  3VFH A;  4UQI M;  2V20 A;  2VGL S;  3PYP A;  1NWZ A;  3F1N A;  1EW0 A;  1XP4 A;  3S7N A;  2ZD8 A;  5HX9 A;  1K54 C;  1S1Y A;  3T12 B;  3FWL A;  4B4Z A;  2WKH A;  2A24 B;  4BWI A;  4BBV A;  1SCW A;  3V5M A;  3V3S A;  3TRC A;  3Q81 A;  3DTI A;  4RX2 A;  3OPH A;  1TEM A;  4DF6 A;  4IJG A;  4DMZ A;  1TVF A;  2ZLY A;  5C5K A;  3F1P A;  4HEF A;  5FDH A;  3MXQ A;  4OPZ A;  3F1O A;  3IBJ A;  4EER A;  2L4R A;  3IX3 A;  2W3E A;  4PHT A;  4Y5F A;  5IT5 A;  4PM8 A;  3A0S A;  2EFX A;  4KZ8 A;  3LIC A;  4B93 A;  3S7O A;  2ZMV A;  5F5Y A;  3QNC A;  2Y4A A;  1PI5 A;  2HP6 A;  4RQ9 A;  5KZH A;  2HDS A;  5D3O A;  1NZO A;  4I5S A;  3VV4 A;  3UNW A;  1X0O A;  2V8C A;  5G18 A;  1ZTU A;  2Y55 A;  3HLF A;  4PM7 A;  5EUA A;  1DP6 A;  3JVU A;  2GDN A;  3IF6 C;  4QY6 A;  3TOI A;  1SZV A;  5L09 A;  3RXW A;  2LB5 A;  5TR7 A;  2AVX A;  4OQH A;  3IF5 A;  1V9Y A;  2DNS A;  1W8Y A;  2P74 A;  3QP8 A;  1N9O A;  4R3J A;  3ICY A;  3CZD A;  1YLP A;  1RCJ A;  4HIA A;  2Y2J A;  3PBQ A;  2EWW A;  5L10 A;  4PPR A;  3UPN A;  5DTK A;  2HDU A;  4HH3 A;  4X6T A;  1KVL A;  5CER A;  4EBL A;  4CLC E;  4JXG A;  1CEF A;  3TG9 A;  3O86 A;  1OT6 A;  1ONG A;  1F98 A;  3NJA A;  4EQI A;  1CJF A;  3EQV A;  4JF4 A;  4EXO A;  3M6H A;  3K2N A;  2Y2P A;  2V9A A;  1D1J A;  3QNB A;  4KZ4 A;  3GQZ A;  3BQ8 A;  1KE4 A;  1YSP A;  4U0X A;  1LL8 A;  2OAQ 1;  3IWO A;  5F69 A;  2QMI A;  1HLU P;  5GHX A;  3V50 A;  3LIF A;  5HL6 A;  4ZJ2 A;  1MPL A;  1L0E A;  3TJZ C;  5DFY A;  3SW1 A;  1YLY A;  1S4R A;  1LSX A;  2ZC5 B;  3RH8 B;  4KZ5 A;  1ES2 A;  2PRF A;  4F94 A;  1NY0 A;  4WM9 A;  1S67 L;  2XF3 A;  3K3C A;  4KZ3 A;  4GN2 A;  2JKR M;  4E3N A;  2VGL M;  4MN5 A;  5FAQ A;  4HY8 A;  3E2L A;  2WAD A;  4JBF A;  5DF9 A;  1YSQ A;  2ZL1 A;  4OOL A;  1VEU B;  5AQ7 A;  3VE3 A;  2WKI A;  2O9A A;  4BL3 A;  3ZQ5 A;  3KSH A;  3A3D A;  2W1R A;  1JWZ A;  2I72 A;  1K56 A;  2XRO A;  4K08 A;  2VJW A;  3MFD A;  2WKR A;  4R0Q A;  4ZRR A;  2IA2 A;  3KSF A;  4NEE D;  3T1Q B;  1V9Z A;  2Y2M A;  1FCM A;  2VEA A;  5F68 A;  1F5M A;  1OPX A;  5FQI A;  4CLC A;  4R23 A;  2QJ5 A;  2H5S A;  3NBL A;  2WAE A;  4IED A;  4HH2 A;  3ZHH A;  5FEF A;  4P87 A;  3HLB A;  4E6X A;  1WA9 A;  1MZU A;  4IBR A;  2QZ6 A;  3JYI A;  5HSQ A;  4II7 A;  3C5A A;  3F1P B;  1K6S A;  3MQ0 A;  4HP9 A;  4OP8 A;  4R4R A;  1DP9 A;  2M7V A;  1SDE A;  2V0W A;  3Q07 A;  1F2K A;  4LV1 A;  1YMX A;  3GV9 A;  1U60 A;  3ZG0 A;  3W4O A;  4S2K A;  1YMS A;  1HD8 A;  1DY6 A;  3M2J A;  2QYB A;  3A3I A;  4XUZ A;  4KQO A;  1ES4 A;  1RP5 A;  4X55 A;  1NRF A;  5A90 A;  4N9K A;  5HZH A;  3S7Q A;  1VB6 A;  2K7S A;  1AWI A;  1K0K A;  2Y2L A;  1P0Z A;  2C6W B;  1YLZ A;  3MZF A;  3F1N B;  5HD3 A;  2FFF B;  4BBU A;  4E04 A;  1MXO A;  1A0K A;  4QD4 A;  4CJN A;  4ETZ A;  3WS1 A;  4BBT A;  1PZO A;  4H6J B;  3WS0 A;  4EET B;  1CQA A;  1T18 A;  3M6B A;  3QP2 A;  2JC7 A;  4XT2 A;  5FL3 A;  3I7J A;  4HJ4 A;  1XA7 A;  1D06 A;  4YNR A;  1CF0 A;  3CUE C;  1MWS A;  3QP4 A;  2A3U A;  5AQA A;  4DE2 A;  1DJB A;  2CMN A;  4PM6 A;  1PZP A;  4XT2 B;  4K0X A;  1BZA A;  1IEM A;  4UQI S;  5GL9 A;  2ZQC A;  4S2J A;  2O0Y A;  4M4X A;  3VOY A;  2R9W A;  2RL3 A;  3MSH A;  3G6O A;  2J7V A;  3B42 A;  4ID4 A;  1XPB A;  4WZ5 A;  4R3B A;  5FQM A;  4WYY A;  4Y0U A;  4Y15 A;  3MS6 A;  1XFQ A;  4GS9 B;  4ZJ1 A;  1SDN A;  4GDB A;  5EVE A;  3T1X A;  4KG6 A;  1FCN A;  4LCM A;  3SS3 A;  3HUM A;  4DJ3 A;  3QP1 A;  5JYO A;  3SH9 A;  1ZHH B;  4PM9 A;  1TS0 A;  2HF6 A;  3R4K A;  4JF6 A;  3OLO A;  3HCY A;  3NOP C;  3EGD C;  1IEL A;  2XR0 A;  5E2E A;  1P9R A;  2V1A A;  2OWJ A;  2A49 A;  2J80 A;  1QMF A;  3KX0 X;  3EOI A;  2XSS A;  4MN6 A;  5L8M A;  1CI8 A;  3A3J A;  3MBZ A;  2P9V B;  3UDI A;  1IOU A;  5CXW A;  4JKT A;  5FI7 A;  1FOF A;  1PW1 A;  1Q2P A;  2XK1 A;  3CHW P;  3D3O A;  3FC7 A;  3LEZ A;  4OPY A;  3GVB A;  1FCO A;  3HLG A;  4JGQ A;  1S66 L;  3PBT A;  1XA1 A;  4G3V A;  2QPN A;  2D01 A;  5FSR A;  5F1F A;  4BQM A;  1OTE A;  3WS2 A;  3AGD A;  3BY8 A;  3OZH A;  5GLC A;  5GHY A;  3K3D A;  5E2G A;  3MKF A;  3U2A A;  4IUH A;  3V67 A;  4Y2F A;  4JLF A;  2VV7 A;  3PBS A;  4PKY A;  1I2S A;  4NK3 A;  4JPM A;  1K38 A;  2Z2M B;  3AGE A;  4ESP A;  1YKD A;  2J9O A;  3ZVW A;  3E4Q A;  4I39 A;  4YFM A;  1JWP A;  1GA0 A;  3FPW A;  4U0T A;  3C2W A;  3CIT A;  1LHY A;  4BD0 A;  4N9L A;  2G2W A;  1S1Z A;  4EW7 A;  4N1X A;  1L3L A;  1IYQ A;  1G6O A;  5EPH A;  1PWC A;  1S4S A;  1GHP A;  3UB6 A;  3L9K A;  2HP9 A;  3C4P A;  4P0M A;  3NDE A;  3LUQ A;  4HBT A;  3O3V A;  4LEN A;  4BL2 A;  1P97 A;  5MC7 A;  5EOO A;  3CI6 A;  1VHM A;  4OLG A;  5KSH A;  3H7W A;  5CEB A;  2ZQ7 A;  2ZC4 B;  4Y17 A;  3N7W A;  2VX8 A;  3LID A;  3WRT A;  1FSW A;  4C75 A;  4L0L A;  3VP1 A;  1F9I A;  5TGF A;  3NOT C;  3NIA A;  1L0F A;  1N9L A;  3KO6 A;  3LIB A;  5HPF A;  1PNE A;  4GNU A;  2VLG A;  4EEU A;  1K4E A;  3V39 A;  1Q2Q A;  5IS1 A;  1LSV A;  5EVI C;  3OBF A;  4GB7 A;  4S2L A;  3IXH A;  5FQJ A;  1L0D A;  2XRN A;  1LT0 A;  3S7P A;  3W4Q A;  4EU0 A;  4R38 A;  4CQH A;  4LRZ E;  3GEC A;  3A0R A;  3N8L A;  1FIL A;  5FQK A;  1PI4 A;  3OPP A;  3H82 A;  4EQ1 A;  3MFX A;  4R6L A;  4QPR A;  3UE6 A;  3T1R A;  3ITA A;  1G28 A;  3VP3 A;  1NYY A;  2JKR I;  3E2K A;  3C7V A;  4KZ9 A;  1LL5 A;  1Y28 A;  3OCL A;  1W79 A;  3R7W B;  1C3B A;  3CJM A;  4OH0 A;  4U3T A;  5CHU A;  3EEA A;  4MBH A;  4EUV A;  3ULF A;  4LFU A;  3ISG A;  2BAS A;  5J3W A;  5E2H A;  1BUL A;  3R7W A;  4GKU A;  3P98 A;  1NZU A;  3H7W B;  2V2F F;  3IT9 A;  3GTC A;  4GS9 A;  1TDG A;  3B33 A;  2ZM0 A;  4F3L B;  2J3T D;  3T50 A;  2DMW A;  4O7D A;  3DW0 A;  5U47 A;  3BY9 A;  4QY5 A;  3IHB A;  3EQU A;  1P9W A;  3G34 A;  2C5W B;  5DTT A;  3IS2 B;  1ERM A;  4JGP A;  2H10 A;  3ZCZ A;  3BQA A;  2QKP A;  5I94 A;  1VM1 A;  3IF6 B;  3OPL A;  1EI5 A;  3WS4 A;  1JTD A;  3SH7 A;  3G31 A;  1E3U A;  4DJ2 A;  1OTD A;  3UB9 A;  2UWX A;  4KQD A;  4JXS A;  2H28 A;  3O5Y A;  1M40 A;  4ME4 A;  1L0G A;  3Q7V A;  4WZ5 C;  3NY4 A;  1H3Q A;  5DJU A;  2HJ9 C;  4Y3I A;  5DKK A;  1XFN A;  3S22 A;  4QU3 A;  2PYR A;  3C38 A;  4UA9 A;  2NUP C;  1Y54 A;  1KVM A;  5CTM A;  4N92 A;  2QWS A;  3NDG A;  1CK3 A;  2VV6 A;  5L2F A;  1GCE A;  5M1A A;  3CMZ A;  3KSI A;  3DTK A;  2GX5 A;  2V1Z A;  2Y8H A;  2VGJ A;  1G6A A;  4LV0 A;  2EWV A;  3G2Y A;  2ZMA A;  5A93 A;  3LYX A;  1MWU A;  3SZT A;  1WYB A;  2NUT C;  4KG2 A;  3LFV A;  2V1B A;  1GSX A;  3HUN A;  4FUW A;  1DJA A;  4WZ4 A;  4CLC C;  4QWO A;  2XA7 M;  1MKM A;  4S2N C;  3HJI A;  3MXS A;  4QJG A;  4MMN A;  1HVB A;  1ACF A;  1YAX A;  2HPB A;  3DAV A;  4FH2 A;  3O88 A;  2WKQ A;  2JCH A;  2O9B A;  2WAF A;  4KG5 A;  4HJ6 A;  3MQO A;  4HOI A;  4GHI B;  1G68 A;  4B9O A;  2L0W A;  4DXC A;  2P04 A;  3GMW A;  3LY3 A;  5GLA A;  4C6Y A;  4L9G A;  2JKT M;  2VV8 A;  4MBK A;  1D7E A;  4OKP A;  3NI9 A;  2Y79 A;  3DTE A;  4GHI A;  3VP0 A;  3C8C A;  1H8M A;  1YPR A;  4HQA A;  2XA7 S;  1K6R A;  4KUO A;  5AVE A;  4Y13 A;  1S0W A;  2ZBB A;  3CPT A;  3LEQ A;  2B5R A;  1FSY A;  5GHZ A;  2K2N A;  4KZ7 A;  2OOL A;  2L1M A;  2PR5 A;  5J7E A;  2PR6 A;  3L7H A;  1IKI A;  1KE0 A;  4Q0H A;  3OOV A;  3PBO A;  4GZB A;  4IHQ A;  1BLS A;  5EVL A;  5J4E A;  2W27 A;  4L9F A;  4IBX A;  4MLL A;  4FH4 A;  3IWQ A;  5HDS A;  4KEN B;  4RVA A;  3ZG9 B;  5HDD A;  3BM6 A;  4CLC B;  1H0M A;  4P6B A;  3ZGA B;  5F82 A;  4X1L A;  3S1Y A;  1DJC A;  3LY4 A;  5FAT A;  2OAP 1;  4I3I A;  1XJ4 A;  4NXB A;  5EOE A;  5TBM B;  2PU4 A;  1PYY A;  3IXB A;  5EVI D;  1FR6 A;  1XXM A;  1CEG A;  5J8X A;  4WMC D;  1AXB A;  1UWN X;  1RGZ A;  2OV5 A;  4PKY G;  5FI2 A;  5HW3 A;  1K57 A;  2W3F A;  4DE1 A;  3EGX C;  1PWG A;  1TF1 A;  1YLJ A;  3LGO A;  4QHC A;  4JXW A;  2ZC3 B;  3LO7 A;  5FAS A;  2VGK A;  2MJ6 A;  1O7E A;  4IVK A;  2E8J A;  1JVJ A;  5FAP A;  2JHE A;  2V0U A;  4OQG A;  1PFL A;  3HJK A;  1MY8 A;  4OLD A;  1WYC A;  3BWL A;  2M1C A;  4G3W A;  2X71 A;  3D72 A;  4E3O A;  4E3M A;  2WKE A;  1W63 Q;  3CPT B;  4HHD A;  1ONH A;  3UY6 A;  4O0P A;  5FEG A;  4R1G A;  2WGW A;  1KDS A;  3H82 B;  4FTX A;  1IYO A;  1PW8 A;  3ITB A;  4MEZ A;  5FQQ A;  3T4O A;  1KGG A;  4GOG A;  3OC2 A;  4EBN A;  2Y2H A;  4E6W A;  3IWI A;  4DRT A;  5L07 A;  5CEC A;  2JKT I;  3D9Y A;  2IWC A;  4LRY C;  2JN7 A;  2WZZ A;  1BLH A;  3UE3 A;  1Y4O A;  4A5R A;  2Y91 A;  2Y2N A;  3G32 A;  4WEK A;  4DKI A;  3F1O B;  2BLS A;  2EX6 A;  4UAA A;  2FFY A;  4LGW A;  5F6A A;  3NOU C;  4E3J A;  2IWD A;  3LIE A;  2XH9 A;  2PU2 A;  3HLD A;  4HBU A;  3M2K A;  3HLC A;  3PR6 A;  5HAQ A;  1GHM A;  3UB5 P;  3UB7 A;  4H6J A;  1VQQ A;  4DDY A;  4NET A;  5A91 A;  4PMA A;  4LV2 A;  4UEY A;  3A3F A;  1K56 D;  4RX3 A;  5HAR A;  1W63 M;  5CTN A;  2HDQ A;  4DXB A;  4E3I A;  3EEH A;  4EWF A;  1XJ2 A;  5HAP A;  2JKG A;  3OPR A;  2WGV A;  2A24 A;  4O01 A;  1LSW A;  1VEU A;  3IX4 A;  3G30 A;  2GNX A;  1ESI A;  3LI9 A;  1BLP A;  4FOF A;  1UWP X;  2Y59 A;  2V8F A;  3LR0 A;  3SOI A;  3ZYT A;  3IH8 A;  1YT4 A;  2PHY A;  4ZAM A;  2O99 A;  2ZOI A;  5A8B A;  3E4O A;  3IX8 A;  3LCE A;  3ZNY A;  2XLN A;  3T4K A;  1MC0 A;  3LR3 A;  2WUQ A;  4NXG A;  5IHV A;  2XFS A;  3UPO A;  2A2L A;  1ESU A;  5EM1 A;  1I5Q A;  2J8Y A;  2P7J A;  4OQI A;  3CLO A;  3JPU A;  3H9W A;  2EFU A;  4LPZ A;  2G2U A;  4BEN A;  4Y0O A;  4MNR A;  3UN7 A;  4X56 A;  3VP4 A;  4MCW A;  1K25 A;  3ZVT A;  3MJQ A;  4DE3 A;  5M19 A;  2JKF A;  3MKE A;  4UHU A;  4N1H A;  3KYE A;  4LV3 A;  2XD5 A;  1GSV A;  2I9V A;  2HDR A;  2JE5 A;  2B02 A;  4MDZ A;  1VET B;  5HFO A;  4LRX C;  2EX8 A;  1IKG A;  3HLW A;  1GHI A;  1L2S A;  1SKF A;  4YIN A;  1YLT A;  1SKO B;  2H0Y A;  2BG1 A;  3BFE A;  4L9E A;  1TS7 A;  4NXE A;  2XEP A;  5K5B A;  5I5L A;  4XXR A;  5HWV A;  3TSG A;  4Z9Q A;  2WGW B;  1FIK A;  4HES A;  1HTZ A;  4GD8 A;  4KZB A;  5F1G A;  4R3A A;  1SKO A;  3B3X A;  4AFI A;  4WL9 A;  4GLQ A;  1PRQ A;  3SS5 A;  5E43 A;  2O9C A;  3WRZ A;  3UDF A;  2J9P A;  3MF0 A;  5BOH A;  5TBM A;  1T19 A;  1KOU A;  2B18 A;  3DBA A;  3MZD A;  1E4D A;  2W3D A;  1BUE A;  4E3L A;  4LLO B;  1UGU A;  3BFC A;  1LLB A;  2EXA A;  2VZW A;  3ZG7 B;  4CLC D;  1OJ5 A;  5EEC A;  3UB8 A;  4EEP A;  5M18 A;  2ZJ9 A;  3DWZ A;  4S2P A;  2PAV P;  3HUO A;  2XQZ A;  2PT7 A;  2Y2Q A;  4WLA A;  1NRJ A;  1MWR A;  2Q9N A;  4HP4 A;  1Z6F A;  2W3H A;  1J9M A;  4X25 A;  3PAG A;  1KGE A;  1YLW A;  3RJU A;  3KSG A;  2YKH A;  3VMA A;  3BRM A;  3QP6 A;  1ZC2 A;  4K91 A;  2Q9M A;  2HZ5 A;  5EFW A;  3BJN A;  1NJ4 A;  5EV0 A;  3RTY A;  2WGI A;  1FQG A;  5LBR A;  4OPQ A;  1XX2 A;  3MXR A;  3N8R A;  1IFQ A;  5AVF A;  4JGO A;  2X02 A;  3E98 A;  3PBN A;  3IQA A;  3MQQ A;  4OPR A;  2ZOH A;  3LI8 A;  4GW9 A;  1H8Y A;  3G35 A;  3Q7V B;  2XD1 A;  1G5U A;  2EX9 A;  2FZ0 A;  2D02 A;  4HNB A;  4OOM A;  4BLM A;  1NLZ A;  4WMC A;  3QP5 A;  4I38 A;  1NYM A;  5CRF A;  2R9X A;  3HVF A;  3UE0 A;  1T1A A;  2KDK A;  1TS8 A;  3ZFZ A;  2OLV A;  4LCL A;  4OON A;  3T4T A;  5EE8 A;  3A0V A;  1W7F A;  3SS4 A;  1N9B A;  1J3W A;  3Q82 A;  5DFX A;  4OVD A;  2X01 A;  3Q1F A;  1E25 A;  2J3T C;  1ES5 A;  2LB9 A;  2P9V A;  4EES A;  4RA7 A;  3VFF A;  4OP5 A;  4X53 A;  4X68 A;  2HJE A;  4P6Z S;  1MKI A;  1BLC A;  1OTA A;  4S2I A;  1RGY A;  4DDS A;  5HAI A;  2W3G A;  1ZG6 A;  4BD1 A;  1ERO A;  1K4F A;  2BTF P;  3ZNT A;  4Y7P A;  2W0N A;  1W5D A;  4FSF A;  2DRW A;  4KUK A;  1JWV A;  3C7U A;  1ZKJ A;  4ZTK A;  1H8Z A;  3BFF A;  4FCF A;  5FA7 A;  4IVI A;  3MR0 A;  3VSL A;  2EA9 A;  2VA0 A;  5HWW A;  4MN7 A;  1O07 A;  4FD8 A;  3RFB A;  4O8G A;  3GSG A;  1H5X A;  4ZBE A;  4IUK A;  4I3A A;  3JVV A;  1YM1 A;  1ODV A;  5DVA A;  3VOZ A;  2M7U A;  2OSU A;  3P09 A;  2PBD P;  4R70 A;  1XJ6 A;  5AQB A;  1DRM A;  3BFG A;  2HGV A;  3GR2 A;  5E2F A;  1QME A;  1JTG A;  4BMW A;  5HPI A;  3VP2 A;  4Q8I A;  3HBR A;  4KQQ A;  3N8S A;  5CHM A;  4Y0T A;  1K55 A;  5KIZ A;  4EBP A;  1ZG4 A;  1WE4 A;  3P01 A;  2XDM A;  4P6Z M;  5CGW A;  5KMW A;  3PAE A;  4S2N A;  4EUZ A;  5FQ9 A;  2RCX A;  1OTB A;  3TE8 A;  4JGR A;  2E8I A;  3EWK A;  3B47 A;  2B95 A;  2J3W A;  5DTS A;  2ZQ8 A;  2ZM2 A;  3KYZ A;  4JXV A;  4PAU A;  1Z09 A;  3BLS A;  1BTL A;  5HWT A;  2QJ7 A;  4ETX A;  2YKF A;  2ZC7 A;  1IYS A;  4Z1W A;  1HZO A;  3IH9 A;  2ZL1 B;  2Q0O A;  3FKV A;  4H8R A;  2OLU A;  5AJG A;  1T1B A;  4GJ4 A;  1OTI A;  3MZE A;  3MMH A;  2Y2G A;  2INW A;  5G4Y A;  3SH8 A;  3VE4 A;  3OCN A;  3S4X A;  3CUE A;  4M3K A;  3NUL A;  3BEC A;  4KZ6 A;  2WZX A;  2ZQD A;  2VKS A;  1BYW A;  3P7N A;  3CWF A;  5GLB A;  4QB8 A;  2Z6D A;  3PBR A;  3QHY A;  3DTM A;  3RXX A;  5DF8 A;  2VK3 A;  4DN0 A;  2PBY A;  2WK0 A;  3NCK A;  1KGF A;  3KYQ A;  4UA7 A;  1TDL A;  3W4P A;  3C4O A;  4G3K A;  3NC8 A;  4P85 A;  3FG8 A;  2PYP A;  4XUX A;  2HP5 A;  3HL9 A;  1SHV A;  4D60 A;  2G7U A;  1LI0 A;  3T4Q A;  3TW8 A;  4B4X A;  3T4L A;  2W1T A;  3GDI A;  3CG5 A;  5AQ9 A;  4RYE A;  4WN5 A;  1K54 A;  4NKP A;  3ZDJ A;  2ZM8 A;  5TJJ A;  5DJT A;  2Y2K A;  5IU1 A;  1OT9 A;  4WEJ A;  1E3U D;  2DCF A;  4S2O A;  5DKL A;  4F3L A;  2Z6C A;  3BFD A;  5FI6 A;  1N9N A;  2PD7 A;  1KDW A;  3FZC A;  3E0Y A;  4GCZ A;  3UPP A;  1MBL A;  4ZDX A;  1S6R A;  1BSG A;  1EWZ A;  2UV0 E;  2Z2L B;  2EX2 A;  1ALQ A;  3AGF A;  3HRE A;  3T4J A;  2Y2I A;  2IWB A;  3IS2 A;  3O87 A;  4BJP A;  1N4O A;  3NHQ A;  2PDR A;  4PM5 A;  2H0T A;  4UA6 A;  3VSK A;  3W2Z A;  3PXP A;  3G2Z A;  3UDX A;  2K31 A;  3IHA A;  3WS5 A;  3D4F A;  5CHJ A;  3FV7 A;  1MWT A;  4HJ3 A;  5DF7 A;  3E4P A;  4MBF A;  5EVI A;  3NEC A;  5HDC A;  5CX7 A;  3LIA A;  5GLD A;  3ZG8 B;  2XGN A;  1T1C A;  4OQ0 A;  5EVI B;  4B88 A;  2W1T B;  3UO9 A;  1KE3 A;  2P08 A;  2HV1 A;  1PWD A;  1CI9 A;  2KLI A;  3PHY A;  2KX6 A;  1TS6 A;  5HD5 A;  1OJG A;  3IXD A;  4I3J A;  4E3K A;  4GDN A;  2XFT A;  3V3R A;  3Q7Z A;  2CC1 A;  2Y2O A;  4X69 A;  3W8K A;  4Q0J A;  5JYP A;  1XGJ A;  1ES3 A;  1W8Q A;  3DWK A;  1DP8 A;  3FYZ A;  4WF0 A;  1K55 C;  1K57 C;  2ZQA A;  2WKP A;  4JF5 A;  3UE1 A;  3IF6 A;  1LI9 A;  3GRJ A;  3CAX A;  3UME A;  1BT5 A;  4NG2 A;  2WYX A;  3PTE A;  4YOF A;  5CED A;  3N4I A;  1TD5 A;  2ZQ9 A;  3BW6 A;  4D2O A;  1ERQ A;  4X1M A;  4S2M A;  2ZC6 B;  4R4S A;  3UMD A;  2ACG A;  3ZG5 A;  3BEB A;  1STZ A;  4OOY A;  1NXY A;  3T4S A;  3LR5 A;  4NXF A;  5CGS A;  1I2W A;  3IXG A;  4WBG A;  5F83 A;  5TFQ A;  4CPK A;  4HI4 A;  4Q0I A;  3BLM A;  5A92 A;  5FAO A;  3IBR A;  3WWX A;  2EXB A;  4WUJ A;  4ARZ A;  2JBF A;  3FPV A;  3VOL A;  5KSC A;  2OWH A;  2PD8 A;  1IYP A;  5HL1 A;  4C3Q A;  2QHK A;  1GSW A;  5G4Z A;  4KQR A;  3BYD A;  1NLY A;  1GA9 A;  3HLE A;  4WEL A;  1LL9 A;  4ARZ B;  4YWZ A;  3G4P A;  1PIO A;  5EM0 A;  5CGX A;  4DE0 A;  4EV4 A;  3N6I A;  1XKZ A;  5FDS A;  1JNU A;  2GZA A;  3T1S A;  4KZA A;  2GJ3 A;  1OME A;  1XGI A;  1FR1 A;  1XJ3 A;  3LR4 A;  3C30 A;  1VET A;  2FH5 A;  2KOI A;  3FKW A;  4GD6 A;  1YQS A;  2ZMF A;  4K0W A;  3A3E A;  2R78 A;  1M6K A;  4ZJ3 A; 
#chains in the Genus database with same CATH homology
 4FSF A;  4UQI M;  2VGL S;  4KUK A;  3D3O A;  3PYP A;  2M1C A;  3FC7 A;  4G3W A;  3D72 A;  4JGQ A;  1S66 L;  1NWZ A;  3PBT A;  3F1N A;  3MR0 A;  4G3V A;  1W63 Q;  2EA9 A;  2VA0 A;  1EW0 A;  5HWW A;  4HHD A;  4MN7 A;  2D01 A;  1OTE A;  4O0P A;  3BY8 A;  3S7N A;  3RFB A;  3H82 B;  1S1Y A;  4O8G A;  4IUK A;  4I3A A;  3K3D A;  3U2A A;  4IUH A;  3T4O A;  3V67 A;  4Y2F A;  3JVV A;  2A24 B;  4BWI A;  4BBV A;  2VV7 A;  1ODV A;  3PBS A;  3OC2 A;  4PKY A;  3TRC A;  2M7U A;  4IJG A;  4R70 A;  1XJ6 A;  4DMZ A;  1DRM A;  1YKD A;  5C5K A;  3F1P A;  3E4Q A;  2HGV A;  4I39 A;  3MXQ A;  2JKT I;  3F1O A;  3FPW A;  3IBJ A;  2L4R A;  4BMW A;  4EER A;  5HPI A;  3C2W A;  3CIT A;  2JN7 A;  4LRY C;  1S1Z A;  4EW7 A;  2W3E A;  4PHT A;  4Y5F A;  3UE3 A;  5IT5 A;  5KIZ A;  1G6O A;  1S4S A;  3A0S A;  3UB6 A;  3P01 A;  3LIC A;  4B93 A;  4P6Z M;  4WEK A;  3F1O B;  3S7O A;  2ZMV A;  1OTB A;  3TE8 A;  5F5Y A;  3LUQ A;  4JGR A;  3EWK A;  3B47 A;  1P97 A;  4RQ9 A;  5F6A A;  5MC7 A;  3CI6 A;  1VHM A;  3NOU C;  5KSH A;  3H7W A;  4I5S A;  3LIE A;  3VV4 A;  2J3W A;  2VX8 A;  3LID A;  3KYZ A;  1X0O A;  4L0L A;  1F9I A;  4PAU A;  1ZTU A;  3NOT C;  5HWT A;  1N9L A;  3LIB A;  3KO6 A;  5HPF A;  3PR6 A;  2QJ7 A;  3UB7 A;  4H6J A;  4ETX A;  2YKF A;  2VLG A;  4EEU A;  1DP6 A;  4Z1W A;  4UEY A;  3JVU A;  5IS1 A;  1LSV A;  1W63 M;  3OBF A;  2LB5 A;  5AJG A;  3EEH A;  1V9Y A;  1T1B A;  4GJ4 A;  1OTI A;  1XJ2 A;  2XRN A;  1LT0 A;  3S7P A;  1N9O A;  3MMH A;  3ICY A;  4R38 A;  4EU0 A;  4CQH A;  4HIA A;  4LRZ E;  2INW A;  2A24 A;  3PBQ A;  2EWW A;  5G4Y A;  3GEC A;  3A0R A;  4O01 A;  3VE4 A;  3OCN A;  1LSW A;  3CUE A;  2GNX A;  4HH3 A;  3H82 A;  3LI9 A;  4EQ1 A;  3MFX A;  4FOF A;  4R6L A;  2VKS A;  1UWP X;  4CLC E;  4QPR A;  1BYW A;  3P7N A;  3UE6 A;  3CWF A;  2Z6D A;  3LR0 A;  1OT6 A;  3PBR A;  1G28 A;  3ZYT A;  1F98 A;  2JKR I;  2PHY A;  4DN0 A;  3NJA A;  1Y28 A;  3OCL A;  2O99 A;  2ZOI A;  3EQV A;  5A8B A;  4EXO A;  3E4O A;  3KYQ A;  3R7W B;  3K2N A;  3EEA A;  2V9A A;  4G3K A;  4EUV A;  3ULF A;  3T4K A;  1MC0 A;  3LR3 A;  3FG8 A;  2PYP A;  4NXG A;  2BAS A;  2G7U A;  3BQ8 A;  5J3W A;  2A2L A;  3T4Q A;  1YSP A;  3TW8 A;  1LL8 A;  3R7W A;  3T4L A;  2OAQ 1;  2P7J A;  3H7W B;  5F69 A;  2W1T A;  3CLO A;  4GS9 A;  3H9W A;  4LPZ A;  3B33 A;  3GDI A;  4F3L B;  3LIF A;  2J3T D;  5HL6 A;  4WN5 A;  4NKP A;  3TJZ C;  5DFY A;  3SW1 A;  3T50 A;  5TJJ A;  2DMW A;  1S4R A;  4MCW A;  3BY9 A;  5DJT A;  1LSX A;  3RH8 B;  3EQU A;  3MJQ A;  5IU1 A;  1OT9 A;  4WEJ A;  1P9W A;  5DKL A;  4F3L A;  2Z6C A;  1N9N A;  2PD7 A;  3IS2 B;  3E0Y A;  4GCZ A;  1S67 L;  3K3C A;  1GSV A;  2I9V A;  4JGP A;  2JKR M;  2B02 A;  4MDZ A;  2VGL M;  3BQA A;  2QKP A;  4MN5 A;  4HY8 A;  4LRX C;  5DF9 A;  1YSQ A;  3T4J A;  3IS2 A;  4BJP A;  4OOL A;  3NHQ A;  3VE3 A;  2PDR A;  4DJ2 A;  1OTD A;  2O9A A;  3UB9 A;  3ZQ5 A;  3W2Z A;  3PXP A;  4KQD A;  3KSH A;  2H28 A;  3O5Y A;  4ME4 A;  2W1R A;  2K31 A;  2XRO A;  4K08 A;  2VJW A;  4L9E A;  1H3Q A;  1TS7 A;  2WKR A;  4NXE A;  5DJU A;  5K5B A;  2HJ9 C;  5I5L A;  5HWV A;  4ZRR A;  4Y3I A;  2IA2 A;  5DKK A;  1XFN A;  3KSF A;  4NEE D;  2PYR A;  1V9Z A;  3C38 A;  2NUP C;  4HJ3 A;  3E4P A;  4R3A A;  2QWS A;  2VEA A;  5F68 A;  1F5M A;  1OPX A;  4AFI A;  2VV6 A;  4WL9 A;  4GLQ A;  4CLC A;  2QJ5 A;  5HDC A;  4HH2 A;  3KSI A;  5CX7 A;  3LIA A;  1WA9 A;  2O9C A;  1MZU A;  2GX5 A;  2Y8H A;  3MF0 A;  2EWV A;  1T1C A;  5TBM A;  3LYX A;  1T19 A;  1KOU A;  5HSQ A;  2B18 A;  3DBA A;  4II7 A;  2NUT C;  3LFV A;  2V1B A;  3F1P B;  1GSX A;  3MQ0 A;  4HP9 A;  2W3D A;  2W1T B;  2P08 A;  1DP9 A;  2M7V A;  4LLO B;  2V0W A;  4CLC C;  2HV1 A;  1UGU A;  2XA7 M;  2KLI A;  1MKM A;  2VZW A;  3PHY A;  4CLC D;  3HJI A;  1OJ5 A;  3UB8 A;  2KX6 A;  1TS6 A;  4MMN A;  1OJG A;  5HD5 A;  4EEP A;  4I3J A;  1YAX A;  2QYB A;  4KQO A;  2PT7 A;  2WKQ A;  4WLA A;  1NRJ A;  2O9B A;  4HJ6 A;  3MQO A;  4HOI A;  4GHI B;  4HP4 A;  4Q0J A;  4B9O A;  2L0W A;  2P04 A;  2W3H A;  5HZH A;  1DP8 A;  3S7Q A;  1VB6 A;  3KSG A;  2YKH A;  4L9G A;  4WF0 A;  2K7S A;  2JKT M;  2VV8 A;  1D7E A;  1P0Z A;  2WKP A;  2Y79 A;  3F1N B;  5HD3 A;  4BBU A;  4GHI A;  4E04 A;  3C8C A;  1H8M A;  4HQA A;  2XA7 S;  3CAX A;  3UME A;  4ETZ A;  5EFW A;  3BJN A;  4H6J B;  4BBT A;  4EET B;  1T18 A;  4YOF A;  4KUO A;  3RTY A;  5AVE A;  4XT2 A;  5LBR A;  5FL3 A;  4HJ4 A;  1TD5 A;  3BW6 A;  1D06 A;  4YNR A;  2ZBB A;  1IFQ A;  5AVF A;  3CUE C;  4JGO A;  3UMD A;  2K2N A;  3E98 A;  2OOL A;  2L1M A;  2PR5 A;  3PBN A;  3MQQ A;  5J7E A;  2ZOH A;  1STZ A;  3LI8 A;  2PR6 A;  2CMN A;  3T4S A;  4GW9 A;  3LR5 A;  4NXF A;  4Q0H A;  3OOV A;  3PBO A;  4XT2 B;  4IHQ A;  4UQI S;  4HI4 A;  2O0Y A;  4M4X A;  4Q0I A;  5J4E A;  2FZ0 A;  2W27 A;  2D02 A;  4HNB A;  4OOM A;  4L9F A;  3G6O A;  3IBR A;  1NLZ A;  3B42 A;  4WUJ A;  5HDS A;  4ARZ A;  5HDD A;  4I38 A;  3FPV A;  3VOL A;  2OWH A;  2PD8 A;  1T1A A;  2KDK A;  4CLC B;  1TS8 A;  2QHK A;  1XFQ A;  4GS9 B;  1GSW A;  5G4Z A;  1NLY A;  3T4T A;  3A0V A;  2OAP 1;  4I3I A;  4WEL A;  1XJ4 A;  4NXB A;  4ARZ B;  5TBM B;  4YWZ A;  4DJ3 A;  5DFX A;  1ZHH B;  1TS0 A;  2HF6 A;  3R4K A;  1UWN X;  3OLO A;  3HCY A;  2J3T C;  2LB9 A;  3NOP C;  4PKY G;  3EGD C;  4EES A;  2W3F A;  3EGX C;  1JNU A;  1TF1 A;  1P9R A;  2GZA A;  2HJE A;  2OWJ A;  2V1A A;  2GJ3 A;  4P6Z S;  2J80 A;  3KX0 X;  3EOI A;  1OTA A;  2XSS A;  2MJ6 A;  1XJ3 A;  3LR4 A;  4MN6 A;  5L8M A;  3C30 A;  2FH5 A;  2W3G A;  2KOI A;  2JHE A;  2V0U A;  1IOU A;  2ZMF A;  3HJK A;  2W0N A;  2R78 A;  3BWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...