3F1NA

Crystal structure of a high affinity heterodimer of hif2 alpha and arnt c-terminal pas domains, with internally bound ethylene glycol.
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
114
structure length
108
Chain Sequence
FKGLDSKTFLSEHSMDMKFTYCDDRITELIGYHPEELLGRSAYEFYHALDSENMTKSHQNLCTKGQVVSGQYRMLAKHGGYVWLETQGTVIYPQCIMCVNYVLSEIEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Artificial ligand binding within the HIF2alpha PAS-B domain of the HIF2 transcription factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Endothelial PAS domain-containing protein 1
total genus 28
structure length 108
sequence length 114
ec nomenclature
pdb deposition date 2008-10-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08447 PAS_3 PAS fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.20 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 3f1nA00
3KX0X 3VE3A 4I39A 1OJ5A 4JGOA 4PKYG 3LIEA 2P7JA 2L1MA 2W0NA 4RQ9A 4JGQA 3UE6A 1Y28A 1BYWA 1UGUA 2JHEA 3E4QA 4R3AA 1LT0A 3VE4A 1LSXA 1OTBA 2R78A 3PHYA 5HDSA 4H6JA 3UB7A 1XJ6A 2PYRA 3BY8A 4B9OA 3NOTC 5A8BA 5EFWA 2M1CA 4XT2B 2CMNA 4EESA 1GSWA 3D72A 1S4SA 3LIFA 4GCZA 4L9GA 1XJ4A 5HDCA 2YKFA 3F1OB 1G28A 2PR5A 4HP4A 3MQQA 3H7WB 2WKRA 1WA9A 2QKPA 5DJUA 2VEAA 1P97A 4NXBA 5IS1A 1P0ZA 4LRYC 4KQDA 2V9AA 4WN5A 4LLOB 1T1AA 2V1AA 4LRXC 3A0VA 3FC7A 1OTAA 3GECA 4HH2A 4WF0A 3T50A 4HJ4A 2L4RA 2V0WA 1OT9A 2PD8A 4I38A 2INWA 4I3JA 3UB9A 2B02A 3CLOA 2J80A 2BASA 3F1PA 2QHKA 2VV7A 2VV6A 1T18A 2PDRA 3H82B 4HP9A 1UWPX 3A0RA 3IS2B 3B33A 4NXFA 1VB6A 1TS6A 5F69A 5TBMB 3MXQA 4DJ2A 4EEPA 1OTIA 4F3LA 1N9LA 1OT6A 3H7WA 5HD5A 1NWZA 2HV1A 2GJ3A 2PYPA 3F1OA 4KUOA 4NXEA 4WL9A 1V9YA 4HNBA 5DJTA 1KOUA 1XFQA 4XT2A 2OWHA 1OTDA 3BY9A 3LIDA 3NOUC 4HJ3A 5F68A 5IU1A 4EETB 3RH8B 5I5LA 3UB6A 4EXOA 1OTEA 1D06A 4GS9A 1S4RA 1S67L 4GHIB 4GHIA 5HDDA 2K7SA 5G4ZA 2QWSA 1T19A 3CAXA 3OLOA 3HJKA 4HY8A 3LI8A 1V9ZA 2A24B 1TS7A 5KIZA 3G6OA 2PR6A 3H9WA 3K3DA 4JGPA 5TBMA 4DJ3A 5AVFA 3GDIA 3IBRA 4L9EA 3ICYA 4L9FA 5J4EA 4KUKA 2YKHA 3LYXA 4NXGA 1EW0A 3ZQ5A 1TS0A 1F98A 3K3CA 3MR0A 1OJGA 5J3WA 4H6JB 2A24A 1ODVA 3UMEA 4EW7A 4R6LA 1LL8A 3P7NA 2W27A 3F1PB 3NHQA 4GS9B 3LIAA 4MN5A 5F5YA 3EWKA 1GSXA 4HHDA 4WUJA 4HOIA 5J7EA 3FG8A 3LICA 1T1BA 5DKKA 4BBTA 2Z6CA 2QJ7A 5G4YA 3LUQA 2H28A 4E04A 1MZUA 2PHYA 2EA9A 1F9IA 2ZOIA 2V0UA 1GSVA 1JNUA 3NJAA 4GW9A 3F1NB 2WKQA 2Z6DA 4LPZA 5HWVA 5HSQA 3MQOA 3UMDA 4LRZE 1DP8A 1DP6A 2ZBBA 4HI4A 4WLAA 5HWWA 1D7EA 1XFNA 2D02A 3VOLA 2I9VA 1XJ2A 4YWZA 3MJQA 4EQ1A 1DP9A 3A0SA 2L0WA 3F1NA 3UB8A 3C8CA 3E4OA 4EERA 1S1YA 3IS2A 4BBUA 5HD3A 4EEUA 3SW1A 1X0OA 2OOLA 3PYPA 4JGRA 4R38A 5HWTA 3LI9A 1LSVA 1S1ZA 2JN7A 2V1BA 3LIBA 1TS8A 4HJ6A 4I3IA 4K08A 4R70A 5AVEA 1T1CA 3RTYA 3E4PA 5HZHA 1N9OA 4I5SA 2D01A 3MFXA 2ZOHA 4HIAA 2PD7A 3C2WA 3HJIA 3ULFA 1DRMA 2KDKA 4M4XA 3CWFA 4F3LB 1UWNX 2QJ5A 4HH3A 4HQAA 3NOPC 3BWLA 1XJ3A 4MN6A 5DKLA 4BBVA 4I3AA 5F6AA 1N9NA 2WKPA 3EEHA 4PKYA 2VV8A 2OWJA 3H82A 1S66L 2KX6A 2VLGA 1LSWA
chains in the Genus database with same CATH superfamily
3CI6A 1KE0A 2P7JA 4RQ9A 1ZG4A 3G34A 5EM1A 2R78A 2ZD8A 5IHVA 4WEKA 5EUAA 3UB7A 4PHTA 3HCYA 4F94A 2W3HA 1P97A 4P87A 5TFQA 1P0ZA 1K55A 1ESUA 4I38A 4MEZA 1K25A 4I3JA 1HD8A 1F5MA 2W1RA 3UNWA 5HFOA 5DVAA 5CGSA 4UA6A 3P09A 1W63Q 1WYCA 1KOUA 1XFQA 3BY9A 3QNBA 4R3JA 2A49A 1K54C 4JXWA 3Q07A 4GLQA 1GHPA 4Z9QA 1OJGA 5GLCA 3V3SA 3ZYTA 3BEBA 3UO9A 3C5AA 4MN5A 3QNCA 1GSXA 5EE8A 2WGWA 2AVXA 2V8FA 4E6WA 3W8KA 5E2EA 1YSPA 2H28A 1KGEA 3ZQ5A 1GSVA 1ZKJA 3F1NB 2V2FF 5FL3A 1IOUA 5L2FA 1OPXA 4KQQA 5AQBA 3LGOA 3ZVWA 3IHBA 1XA7A 3E4OA 3CUEC 3PYPA 3LIBA 2V1BA 1CEGA 2XF3A 2IWDA 3HJIA 3ULFA 3FKVA 5CX7A 3LR3A 2DRWA 3Q81A 3ZG7B 3EEHA 2VV8A 1MWTA 4BD1A 3C7UA 3CITA 1OJ5A 4JGQA 3UE6A 1IKIA 5KSCA 3W4OA 2EX9A 3GMWA 3G4PA 3PR6A 1IFQA 2YKFA 4MDZA 4NG2A 3PBQA 1TEMA 2WKRA 4D60A 3B47A 2QKPA 4NXBA 2JKRM 3OC2A 4KQDA 4IVKA 3CHWP 1HLUP 4LRXC 3NBLA 1W8QA 2ZQDA 5A93A 1UWPX 1TDLA 4NXFA 5TBMB 1CI8A 1OT6A 1PWDA 1N9BA 4WMCD 4X6TA 3VP0A 4HNBA 1YLTA 2O9CA 2G2UA 4QPRA 4GHIA 2Y2PA 2JE5A 3Q82A 4HY8A 3PBNA 3B3XA 1ERQA 3GDIA 4KUKA 3LYXA 4IHQA 3V39A 4O0PA 2LB9A 4JF4A 2PBDP 3KSIA 4OPQA 5FDHA 1YLZA 3T4QA 1PWCA 4BLMA 5FASA 2G7UA 3PBRA 3QP2A 2EA9A 1DJAA 4GW9A 3NJAA 2H0TA 3BFDA 4LRZE 3VOLA 2I9VA 2OLUA 3NI9A 1JVJA 4P0MA 4S2MA 1Q2PA 1H5XA 4JXGA 3Q7ZA 2HP6A 4BJPA 3ZGAB 3H82A 4FSFA 2W3DA 2I72A 4MN7A 4PKYG 5HAIA 5HL6A 4EESA 4L9GA 2EWVA 2VGLS 3F1OB 4R23A 5DFYA 3ZG0A 5CERA 3HBRA 1IYQA 3UB9A 1CF0A 4MCWA 5AQAA 2V1ZA 1E3UA 5CEBA 3G2ZA 1FR1A 4XT2A 3VFFA 2IWCA 3OLOA 1IEMA 4KZ3A 3G6OA 3AGEA 3H9WA 5CHUA 1G6AA 2XSSA 1EW0A 4DXBA 4WELA 4R6LA 3M6HA 5KZHA 3VOYA 4C3QA 1O7EA 3S1YA 1MZUA 2Z6DA 3UMDA 4OOMA 1IYOA 4ZRRA 1YKDA 1VETA 4ZBEA 4YOFA 3KO6A 3NECA 3UB8A 3C8CA 1JTGA 3SW1A 1X0OA 4JGRA 3LI9A 5F83A 2XA7S 5IT5A 3PBSA 4DDSA 4ZJ1A 3BLSA 1SKFA 1O07A 3R4KA 2KDKA 4OONA 3N8SA 3A3JA 2P04A 4UA9A 2KX6A 1ES5A 1K56D 3ZDJA 4X55A 2JHEA 2JKRI 1DJCA 1E4DA 4H6JA 2W3FA 3VSKA 3IF6A 1YSQA 4BL2A 4S2IA 5TR7A 3DTMA 4LLOB 2ZM8A 1MWSA 1OTAA 4PPRA 1OT9A 3BM6A 2JKTI 2P74A 3T4SA 3NULA 3E2LA 3VSLA 1V9YA 1M6KA 4R3BA 4G3VA 2EX2A 4KZ5A 1L2SA 4S2JA 5CEDA 3A3DA 3GQZA 1MXOA 5I94A 3CPTB 2FFYA 5KMWA 1LI9A 3BFCA 3O87A 5J4EA 2ZM0A 3MR0A 4OOYA 5J3WA 2A24A 1ODVA 4KQOA 4O01A 3LIAA 3GR2A 1J3WA 3DWZA 2PBYA 4BBTA 4S2NC 4E3OA 5A92A 2ZBBA 3UY6A 3VFHA 1PWGA 4KG5A 3F1NA 3A3EA 4E3IA 2WAFA 5EECA 1DY6A 4MMNA 3HLEA 1U60A 4Y3IA 2K2NA 1L0DA 1UWNX 3FPWA 3CG5A 1YM1A 1PIOA 3UE3A 3VE3A 1BLHA 5HAQA 1J9MA 3U2AA 4B4XA 1XJ6A 3MXSA 1XJ4A 5HDCA 4X56A 1TD5A 2VGJA 5FQQA 3MQQA 3OZHA 5LBRA 5IS1A 1EROA 1ONHA 4GD6A 4M3KA 1VQQA 3E2KA 2BASA 4DMZA 2EWWA 5EOEA 3B33A 5F82A 4WM9A 1JWPA 3H7WA 1FSWA 4U0TA 1ZC2A 4GKUA 3ZHHA 2OWHA 1LHYA 5IU1A 3IXGA 4BQMA 3NC8A 5FEFA 3MFDA 5DF8A 3MS6A 1BSGA 3LEQA 1PNEA 2PT7A 4Q0HA 5GHZA 2WYXA 3C7VA 3SH9A 3QP6A 4X68A 3F1PB 4R4RA 4HBTA 2WKEA 2OV5A 1T1BA 2QMIA 3HUMA 1KE4A 4P6ZS 4DDYA 3HLCA 4ARZB 3S22A 1I2WA 3VOZA 4FD8A 1D1JA 2ACGA 4KQRA 2BTFP 3IS2A 5HWTA 1Y4OA 5DFXA 4K08A 3JPUA 4JXVA 3ZG9B 3KSGA 5CGXA 3LEZA 1FILA 2CC1A 1NZOA 2VGKA 3NOPC 4HQAA 1OMEA 3HL9A 1LSWA 3VP2A 3WS4A 4DN0A 4CLCB 3CMZA 1S6RA 1W5DA 3QP4A 4GCZA 4MBKA 3IBJA 4QWOA 5CGWA 1FOFA 5JYOA 3AGDA 1L0FA 2Y2LA 4IBRA 5FQKA 2Y59A 1AXBA 5L10A 1LLBA 2X71A 3V3RA 3PXPA 3TE8A 3M2KA 3T4OA 2VA0A 3T1RA 1ONGA 4P6ZM 1TDGA 4EUVA 4C6YA 3MZFA 4CLCC 5E2HA 4CPKA 4FOFA 5FAQA 3OCLA 3G2YA 3UB6A 1W7FA 1MWRA 3DWKA 4GHIB 2LB5A 4EQIA 1TVFA 5EVLA 1YMXA 5FQJA 2EFXA 2O99A 2J3TD 4NETA 3KSHA 3HLDA 3P98A 3EGDC 4Q0JA 4R4SA 5DKKA 2QJ7A 1GHIA 1XXMA 3MQ0A 5DTKA 4HI4A 3DBAA 2ZMFA 3BLMA 1H3QA 2A3UA 1C3BA 3HLWA 2HPBA 3GVBA 4Q8IA 4OP5A 4MLLA 1P9RA 2ZQ9A 2ZOHA 3IWOA 2WKHA 4PAUA 2XA7M 1K4EA 1PFLA 2PU2A 2Q9NA 4I39A 4Y0TA 1MBLA 4IVIA 2L1MA 4R3AA 3RXWA 3IXDA 3BECA 3NDGA 2GNXA 3UPNA 5HARA 2EXBA 3MKEA 3V50A 2M1CA 3ZVTA 3PBOA 1L0GA 1ESIA 4A5RA 2ZLYA 2PR5A 3A3IA 1HZOA 3IX8A 2JKFA 5FI6A 4RX3A 3A3FA 3N8RA 4DE3A 2INWA 2VK3A 1WYBA 1K54A 1G6OA 2ZMAA 1PYYA 2Y2GA 4LFUA 1YT4A 1TS6A 5F69A 3UPOA 1OTIA 2FH5A 3UDFA 4ZDXA 2GJ3A 2HJEA 1NXYA 2HP9A 2PYPA 4KUOA 4Y2FA 2J7VA 2ZL1B 4KZ8A 3IXBA 1NRFA 2QWSA 3CJMA 1VM1A 1I2SA 4NKPA 4FTXA 2RCXA 4KENB 3ICYA 4L9FA 4ETZA 3RFBA 5FI2A 3UMEA 1BLPA 2ZC5B 4MBHA 4GS9B 4XUZA 1CI9A 2H10A 3CUEA 3KYQA 4HOIA 4Y17A 3FG8A 4Y5FA 2EX8A 4WN5A 1XGJA 3GV9A 1DP8A 1NYMA 2MJ6A 5E43A 4ZJ2A 2UV0E 5CRFA 3KYEA 2QPNA 3MZEA 2Q0OA 4HEFA 4IBXA 1LSVA 4EV4A 2WUQA 2Y2QA 3ZG5A 4O8GA 2J8YA 2OWJA 1NZUA 2VLGA 3T4JA 2Y4AA 3SS4A 1RCJA 3HLBA 3PHYA 2FZ0A 2OAQ1 4O7DA 5EFWA 3V67A 2Z2MB 3N7WA 3LR0A 3UE0A 4UEYA 3RXXA 4CJNA 2O9BA 2VEAA 1DJBA 4HH2A 5EVIC 1CQAA 4LV1A 1K38A 1NLYA 3T4LA 2XROA 5GLBA 5CHMA 4KG6A 3T1QB 3IX3A 3WS2A 3ITBA 1ALQA 3OPHA 3RH8B 2RL3A 5I5LA 4S2NA 5HL1A 1EWZA 3D4FA 1SKOA 5CHJA 5FQMA 2Y2MA 3ITAA 3VV4A 4AFIA 4OPZA 3UB5P 2BG1A 2NUPC 3BJNA 2GDNA 3LICA 5DF9A 4EBNA 1F9IA 1STZA 3MQOA 3IF6B 2HZ5A 2D02A 4LCMA 3UN7A 4KZ9A 4OVDA 4KZ6A 4EERA 1S1YA 4QD4A 3Q1FA 5HPIA 4CLCA 1XKZA 3LO7A 1N9OA 3MFXA 4X69A 3LR4A 5FEGA 3IWQA 4F3LB 4WEJA 1SHVA 4GB7A 1ES3A 4S2PA 2WKPA 2ZQ8A 4PM5A 2J9OA 1M40A 3S7PA 1YQSA 3KX0X 3GSGA 2HJ9C 4Y0OA 3C4PA 1Y28A 3G30A 2PYRA 3BY8A 4RVAA 4DRTA 3TOIA 2Y2HA 4WYYA 5HPFA 2ZQCA 1ACFA 1WA9A 2V9AA 3L7HA 3GECA 5K5BA 4OLDA 2ZJ9A 3C38A 2XEPA 2W3GA 1IELA 3ISGA 3T1XA 5HW3A 2ZMVA 5GLAA 4OQIA 4OOLA 4GS9A 1S4RA 1ERMA 2K7SA 3BRMA 3IQAA 4OQ0A 1T19A 3HJKA 2A24B 4CQHA 4JGPA 2PR6A 1K55C 3KYZA 3FKWA 1F98A 2C6WB 4H8RA 2XD1A 5FATA 2WGWB 1LL9A 2Z6CA 3LUQA 4JLFA 4K0XA 2V0UA 3PTEA 3WWXA 4ARZA 5AJGA 4LV2A 4GOGA 5HWWA 1XJ2A 2UWXA 3EEAA 2XFSA 1TS8A 1Y54A 4HIAA 2PD7A 3TG9A 1XJ3A 4I3AA 2JBFA 4D2OA 3MSHA 2Y8HA 3QP8A 1PRQA 4B9OA 5GHYA 4GN2A 3ZNTA 4XT2B 2CMNA 3D72A 4IUHA 2VGLM 3TSGA 3UDIA 5DJUA 3GRJA 3T12B 1FQGA 4WF0A 3MBZA 4K0WA 3OPPA 2B02A 2J3TC 4X1LA 1G68A 1FSYA 4IUKA 3EQUA 5L09A 5DJTA 3T50A 3OOVA 4FH2A 1AWIA 3VP1A 5DTSA 5HDDA 2QZ6A 3LI8A 2DNSA 4S2LA 5KIZA 2ZC4B 2ZL1A 3EGXC 3K3DA 5AVFA 3IBRA 4DE1A 4R0QA 2XD5A 1XX2A 3DTIA 2Y2OA 4DXCA 3VP4A 4XUXA 4S2KA 2E8IA 2O0YA 2HDRA 2PHYA 4LPZA 5HWVA 5E2FA 3TW8A 2JKTM 4JF5A 3IX4A 1RP5A 1DP9A 4BBUA 2M7VA 2B18A 2M7UA 2X01A 2X02A 1GA0A 3RTYA 5AVEA 4UHUA 4BMWA 1BTLA 1FCOA 5HX9A 3BYDA 2EX6A 1FCMA 1YPRA 4JBFA 1L3LA 4JGOA 3SH8A 1YLPA 3R7WB 1NRJA 1BYWA 1UGUA 5A91A 1K6SA 1ES2A 3UPPA 1KDSA 4N1XA 5A8BA 3HVFA 1S4SA 3LIFA 4HP4A 2W3EA 3H7WB 4LRYC 2HF6A 5AQ7A 3TRCA 5EVID 3CLOA 2Z2LB 4UAAA 3H82B 3PAGA 3A0RA 3IS2B 1N4OA 5HD5A 2HDUA 2HV1A 3O3VA 1JWZA 3C4OA 3GTCA 1E25A 2G2WA 4YFMA 5G4ZA 4GNUA 2ZQ7A 1MKIA 4BL3A 4L9EA 4NXGA 3LR5A 4EW7A 1Z6FA 1G5UA 3S7NA 1JWVA 3HUOA 3NHQA 5F5YA 3EWKA 2WAEA 5FAOA 5J7EA 1Q2QA 1CK3A 4Y15A 4E3LA 4R1GA 4PM6A 5HSQA 1LL5A 1D7EA 5F1GA 2XQZA 3DAVA 4EQ1A 4QJGA 1XP4A 1CEFA 5HD3A 1YLWA 3VMAA 5CECA 5M19A 4I3IA 2JN7A 4HJ6A 3BFGA 4PMAA 1BLCA 2QJ5A 5FQ9A 3ZG8B 5EM0A 4JF6A 3LIEA 3M2JA 3IT9A 1XA1A 3MKFA 2XDMA 3E4QA 1FCNA 3VE4A 1LSXA 3QHYA 4X1MA 3SOIA 1FIKA 5M1AA 5HAPA 3DW0A 1HTZA 4OPYA 2VJWA 3NCKA 3SS5A 4HJ4A 2W1TA 4UQIM 3N8LA 4GDBA 4HP9A 1F2KA 4OKPA 1I5QA 1VB6A 4EEPA 1N9LA 2ZM2A 4ZJ3A 1SDNA 3NOUC 3MXRA 2Y91A 2GX5A 3WS5A 1D06A 1PI4A 1S67L 5E2GA 5FQIA 4S2OA 3IH8A 2Y55A 3D9YA 1V9ZA 3IXHA 3WS1A 4LCLA 1H8MA 2ZQAA 2XH9A 4RX2A 5CTNA 1ZHHB 1LL8A 1PW1A 2W27A 1QMFA 2WZXA 3K2NA 1KVLA 5G4YA 4HESA 1YAXA 1MC0A 1VEUA 3O88A 1YLYA 3T4KA 3OPLA 2QYBA 4WLAA 1XFNA 3N6IA 1QMEA 3OPRA 5GHXA 4X53A 3MJQA 3OBFA 2XR0A 2EFUA 2Y2IA 1T1CA 4I5SA 4E3MA 4EU0A 1GA9A 4LGWA 1DRMA 3BWLA 4MN6A 4BBVA 4PKYA 2H5SA 1MY8A 3WRTA 3BFEA 4OQGA 3TJZC 3RJUA 2W0NA 2HDQA 1PI5A 5HDSA 2E8JA 2Y2KA 2PU4A 3M6BA 5EOOA 2BLSA 4OLGA 1G28A 2WKIA 1IKGA 4GZBA 2V8CA 2PRFA 4Y7PA 4QY6A 2V1AA 3FC7A 3FYZA 3HLGA 1S0WA 2J80A 3F1PA 3IH9A 1TF1A 3N4IA 3SH7A 1NJ4A 2P9VA 2IA2A 3FPVA 4NXEA 5BOHA 4WL9A 4BENA 2WGIA 3LIDA 1OTEA 1XPBA 1K57C 4X25A 3CAXA 5EVIB 4N92A 5CTMA 4MNRA 1ZTUA 4N9LA 4EBLA 3K3CA 4JKTA 4JPMA 2C5WB 4DE2A 4H6JB 1NY0A 2O9AA 3MZDA 1KVMA 5TGFA 4QB8A 3HLFA 4Y13A 4GJ4A 2JC7A 4E04A 3CPTA 2ZC6B 2OSUA 4FH4A 2Q9MA 4LV3A 4P85A 3U4LP 1CJFA 1YMSA 1K6RA 2WADA 3O5YA 1Z09A 2OOLA 1IYPA 3BQAA 2J9PA 3JYIA 4IEDA 4OP8A 2Y2JA 4PM9A 1PZPA 3ZCZA 1VEUB 3IF6C 3E98A 1MWUA 1YLJA 4N1HA 3T4TA 5J8XA 1K4FA 4KZ4A 5FDSA 2IWBA 1PZOA 1PW8A 4B4ZA 5D3OA 1HVBA 1NLZA 4P6BA 4DKIA 1H8YA 4CLCD 3LCEA 1H8ZA 3AGFA 4OQHA 5F1FA 2OLVA 2V0WA 2QHKA 4FCFA 3JVVA 3T1SA 2XFTA 5DF7A 4DJ2A 3MXQA 3W4QA 5JYPA 2A2LA 3MF0A 3FV7A 3S7QA 1BULA 5F68A 5FSRA 3WS0A 5L07A 4GDNA 4EBPA 2K31A 1TS7A 2GZAA 2J3WA 2XLNA 4DF6A 1ES4A 2YKHA 2DCFA 1TS0A 4UQIS 2OAP1 5EVEA 3P7NA 4IJGA 2WGVA 5AQ9A 1E3UD 4N9KA 4WZ4A 1IYSA 1SKOB 1W79A 4ME4A 1BLSA 1GCEA 1LI0A 3C30A 2EXAA 4EWFA 4B93A 4YWZA 4BWIA 1VHMA 4PM7A 4DE0A 4Z1WA 3E4PA 5HZHA 4NEED 1KDWA 2D01A 4KG2A 2JKGA 5DKLA 5CXWA 4ETXA 3BW6A 3C2WA 2W1TB 1K57A 5GLDA 3IHAA 4WBGA 3QP5A 2KOIA 1L0EA 2HGVA 4ZAMA 3ZNYA 1GSWA 4KZ7A 4WZ5C 1ZG6A 4U0XA 1K0KA 3S4XA 4E3JA 2WZZA 4WMCA 4RYEA 2R9XA 1T1AA 4E3KA 3UDXA 3A0VA 4KZBA 1H0MA 5TJJA 2L4RA 3SS3A 3B42A 4NK3A 1W63M 4BD0A 2R9WA 2VV6A 1SDEA 2PDRA 4G3KA 2KLIA 4OPRA 1K56A 4ID4A 2XRNA 3LY3A 1NWZA 5GL9A 4RA7A 1P9WA 1JTDA 3E0YA 1OTDA 1BUEA 4ZTKA 2NUTC 4E6XA 4EXOA 2VKSA 5FAPA 3V5MA 5EPHA 5DTTA 4G3WA 4ESPA 3PBTA 3SZTA 1BT5A 5C5KA 4QHCA 4JXSA 3HREA 3S7OA 4HBUA 3G32A 4PM8A 4WUJA 4HHDA 4UA7A 3UE1A 3BQ8A 2DMWA 2V20A 2ZOIA 3L9KA 4LENA 1JNUA 1RGYA 5M18A 3DTEA 3WRZA 3MMHA 1DP6A 1VETB 2ZC7A 4C75A 4QU3A 4XXRA 3OCNA 2L0WA 3G31A 3LY4A 1KGFA 4EEUA 2FFFB 4L0LA 4R70A 4E3NA 1KE3A 3O86A 3ZFZA 1W8YA 4M4XA 2B95A 4HH3A 4QY5A 1N9NA 2VZWA 4Q0IA 3VP3A 4YNRA 4KZAA 3I7JA 4U3TA 1NYYA 3QP1A 1LT0A 1OTBA 3NIAA 3NOTC 2P9VB 3IWIA 3P01A 1GHMA 3W2ZA 3PAEA 3LFVA 3KSFA 5L8MA 5G18A 2PAVP 3FWLA 2PD8A 5FI7A 2VV7A 1WE4A 1T18A 3JVUA 1SCWA 3IF5A 2HDSA 4OH0A 4F3LA 1MKMA 1EI5A 3F1OA 2H0YA 4FUWA 3HUNA 4K91A 4EETB 4HJ3A 2HP5A 3Q7VB 1SZVA 4CLCE 2XK1A 3BFFA 4MBFA 5TBMA 4EUZA 4DJ3A 2JCHA 5A90A 1BZAA 1XGIA 5EV0A 3D3OA 5EVIA 3EOIA 1A0KA 1MPLA 3W4PA 1FR6A 3G35A 2P08A 3EQVA 2XGNA 4WZ5A 2WKQA 3NY4A 3Q7VA 2Y2NA 3DTKA 4B88A 5MC7A 3A0SA 4Y0UA 5U47A 2Y79A 1RGZA 2VX8A 3FZCA 2B5RA 2ZC3B 4R38A 4YINA 5KSHA 1S1ZA 3R7WA 3CZDA 1KGGA 3NDEA 4LV0A 2WK0A 3CWFA 4GD8A 5FA7A 5F6AA 4II7A 1S66L
chains in the Genus database with same CATH topology
3UE3A 3KX0X 3CI6A 3VE3A 3TJZC 2HJ9C 2P7JA 2W0NA 4RQ9A 3U2AA 1Y28A 2R78A 5HDSA 4WEKA 1XJ6A 2PYRA 3BY8A 3UB7A 4PHTA 3HCYA 2W3HA 1XJ4A 5HDCA 1G28A 1TD5A 5HPFA 3MQQA 5LBRA 1WA9A 1P97A 5IS1A 1P0ZA 2V9AA 2V1AA 3FC7A 3GECA 5K5BA 4I38A 4I3JA 3C38A 2J80A 2BASA 3F1PA 1F5MA 2W3GA 1TF1A 2W1RA 2EWWA 4DMZA 3B33A 2IA2A 3H7WA 3FPVA 1W63Q 4NXEA 4WL9A 1KOUA 1XFQA 2OWHA 3BY9A 3LIDA 5IU1A 2ZMVA 4OOLA 1OTEA 4GS9A 1S4RA 2K7SA 1T19A 3CAXA 3HJKA 2A24B 4GLQA 4CQHA 4JGPA 2PR6A 2PT7A 1ZTUA 3KYZA 4Q0HA 1F98A 3K3CA 1OJGA 4H6JB 3ZYTA 2O9AA 3F1PB 4MN5A 1GSXA 1T1BA 2Z6CA 4GJ4A 3LUQA 1YSPA 2H28A 4E04A 4P6ZS 3ZQ5A 2V0UA 1GSVA 3F1NB 4ARZB 5FL3A 4ARZA 5AJGA 1IOUA 5HWWA 1OPXA 1XJ2A 3E4OA 3O5YA 3CUEC 3IS2A 3PYPA 2OOLA 3EEAA 5HWTA 3BQAA 5DFXA 3LIBA 2V1BA 4K08A 1TS8A 4HIAA 2PD7A 3KSGA 3HJIA 3ULFA 5CX7A 3LR3A 4HQAA 3NOPC 1XJ3A 4I3AA 3EEHA 3E98A 2VV8A 1LSWA 3CITA 1OJ5A 3T4TA 4DN0A 4JGQA 2Y8HA 3UE6A 4CLCB 4B9OA 1NLZA 4XT2B 2CMNA 4GCZA 3D72A 4IUHA 2VGLM 3IBJA 3PR6A 1IFQA 2YKFA 4MDZA 3PBQA 4CLCD 2WKRA 3B47A 2QKPA 5DJUA 4NXBA 2JKRM 3OC2A 4KQDA 4LRXC 4WF0A 2V0WA 2B02A 2QHKA 3PXPA 3JVVA 3TE8A 2J3TC 1UWPX 4NXFA 5TBMB 3T4OA 4DJ2A 3MXQA 2A2LA 2VA0A 1OT6A 3MF0A 4IUKA 4P6ZM 3S7QA 3EQUA 4EUVA 4CLCC 4HNBA 5DJTA 3T50A 3OOVA 2O9CA 5F68A 4FOFA 3OCLA 3UB6A 4GHIB 4QPRA 2LB5A 4GHIA 5HDDA 2K31A 4HY8A 3LI8A 1TS7A 2GZAA 3PBNA 3EGXC 2J3WA 3K3DA 5KIZA 5AVFA 3GDIA 2O99A 3IBRA 2J3TD 4KUKA 2YKHA 3LYXA 4IHQA 1TS0A 4UQIS 2OAP1 4O0PA 2LB9A 3KSHA 3P7NA 3EGDC 3KSIA 4IJGA 4Q0JA 3T4QA 5DKKA 2G7UA 2QJ7A 2O0YA 3PBRA 2PHYA 2EA9A 4GW9A 4ME4A 4LPZA 3MQ0A 3NJAA 5HWVA 4LRZE 3TW8A 3C30A 2JKTM 4HI4A 3DBAA 3VOLA 2ZMFA 4B93A 2I9VA 4YWZA 4BWIA 1DP9A 1VHMA 1H3QA 4BBUA 2M7VA 2B18A 2M7UA 4Z1WA 3RTYA 5AVEA 4BMWA 1P9RA 3E4PA 5HZHA 4NEED 2D01A 2ZOHA 4PAUA 5DKLA 4BJPA 2XA7M 3H82A 4FSFA 4ETXA 3BW6A 2W3DA 3C2WA 2W1TB 4I39A 4MN7A 2KOIA 4JGOA 4PKYG 2L1MA 3R7WB 1NRJA 1BYWA 1UGUA 4R3AA 2HGVA 2GNXA 5HL6A 5A8BA 2M1CA 4EESA 1GSWA 1S4SA 3LIFA 4L9GA 3PBOA 2EWVA 2VGLS 3F1OB 2PR5A 4HP4A 2W3EA 3H7WB 4LRYC 2HF6A 5DFYA 3TRCA 1T1AA 3A0VA 5TJJA 2L4RA 3UB9A 2INWA 3CLOA 3B42A 1W63M 1G6OA 2VV6A 4MCWA 3H82B 2PDRA 4G3KA 3A0RA 3IS2B 2KLIA 5F69A 1TS6A 1OTIA 2FH5A 5HD5A 2XRNA 1NWZA 2HV1A 2GJ3A 2HJEA 2PYPA 4KUOA 1P9WA 4Y2FA 3E0YA 4XT2A 1OTDA 2NUTC 4EXOA 2VKSA 5G4ZA 2QWSA 3OLOA 4G3WA 3G6OA 3H9WA 4NKPA 3PBTA 4L9EA 3ICYA 4L9FA 4ETZA 4NXGA 2XSSA 1EW0A 3RFBA 3LR5A 5C5KA 4EW7A 3UMEA 4WELA 4R6LA 3S7NA 3S7OA 3NHQA 4GS9B 5F5YA 3EWKA 4WUJA 3CUEA 3KYQA 4HHDA 4HOIA 5J7EA 3BQ8A 3FG8A 4Y5FA 2DMWA 1MZUA 2ZOIA 4WN5A 1JNUA 2Z6DA 5HSQA 3UMDA 4OOMA 1DP8A 1YKDA 3MMHA 1DP6A 2MJ6A 4ZRRA 1D7EA 4YOFA 4EQ1A 3OCNA 2L0WA 3KO6A 3UB8A 3C8CA 4EEUA 5HD3A 3SW1A 1X0OA 4JGRA 4L0LA 3LI9A 1LSVA 2JN7A 2XA7S 3PBSA 4HJ6A 4I3IA 4R70A 5IT5A 4O8GA 3R4KA 2KDKA 4M4XA 2QJ5A 4HH3A 2P04A 1N9NA 2VZWA 4Q0IA 4YNRA 2OWJA 2KX6A 2VLGA 3T4JA 3LIEA 3E4QA 2JHEA 2JKRI 3VE4A 1LT0A 1LSXA 1OTBA 3PHYA 4H6JA 2W3FA 3NOTC 2FZ0A 2OAQ1 5EFWA 3V67A 3LR0A 1YSQA 3P01A 4UEYA 2O9BA 3W2ZA 2VEAA 3LFVA 3KSFA 5L8MA 4LLOB 2VJWA 4HH2A 1OTAA 4HJ4A 1OT9A 2PD8A 2JKTI 2W1TA 4UQIM 3T4SA 2VV7A 1NLYA 1T18A 4HP9A 3JVUA 3T4LA 1VB6A 2XROA 4EEPA 4F3LA 1N9LA 1MKMA 3F1OA 1V9YA 4EETB 4G3VA 3NOUC 4HJ3A 3RH8B 2GX5A 5I5LA 4CLCE 1D06A 1S67L 1V9ZA 5TBMA 4DJ3A 5J4EA 3VV4A 1H8MA 3MR0A 4AFIA 5J3WA 2A24A 1ODVA 3D3OA 4KQOA 1ZHHB 3EOIA 1LL8A 4O01A 2W27A 2NUPC 3LIAA 3BJNA 3K2NA 3LICA 4BBTA 2P08A 5G4YA 1YAXA 3EQVA 5DF9A 1MC0A 1F9IA 2WKQA 3T4KA 1STZA 3MQOA 2QYBA 2ZBBA 4WLAA 1XFNA 2D02A 5MC7A 3MJQA 3A0SA 3OBFA 3F1NA 2Y79A 4EERA 1S1YA 4R38A 2VX8A 5HPIA 5KSHA 4CLCA 1S1ZA 3R7WA 1T1CA 1N9OA 4I5SA 3MFXA 3LR4A 4MMNA 4EU0A 4Y3IA 1DRMA 2K2NA 3CWFA 4F3LB 1UWNX 4WEJA 3BWLA 3FPWA 4MN6A 4BBVA 5F6AA 2WKPA 4PKYA 4II7A 1S66L 3S7PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KX0 X;  3VE3 A;  4I39 A;  1OJ5 A;  4JGO A;  4PKY G;  3LIE A;  2P7J A;  2L1M A;  2W0N A;  4RQ9 A;  4JGQ A;  3UE6 A;  1Y28 A;  1BYW A;  1UGU A;  2JHE A;  3E4Q A;  4R3A A;  1LT0 A;  3VE4 A;  1LSX A;  1OTB A;  2R78 A;  3PHY A;  5HDS A;  4H6J A;  3UB7 A;  1XJ6 A;  2PYR A;  3BY8 A;  4B9O A;  3NOT C;  5A8B A;  5EFW A;  2M1C A;  4XT2 B;  2CMN A;  4EES A;  1GSW A;  3D72 A;  1S4S A;  3LIF A;  4GCZ A;  4L9G A;  1XJ4 A;  5HDC A;  2YKF A;  3F1O B;  1G28 A;  2PR5 A;  4HP4 A;  3MQQ A;  3H7W B;  2WKR A;  1WA9 A;  2QKP A;  5DJU A;  2VEA A;  1P97 A;  4NXB A;  5IS1 A;  1P0Z A;  4LRY C;  4KQD A;  2V9A A;  4WN5 A;  4LLO B;  1T1A A;  2V1A A;  4LRX C;  3A0V A;  3FC7 A;  1OTA A;  3GEC A;  4HH2 A;  4WF0 A;  3T50 A;  4HJ4 A;  2L4R A;  2V0W A;  1OT9 A;  2PD8 A;  4I38 A;  2INW A;  4I3J A;  3UB9 A;  2B02 A;  3CLO A;  2J80 A;  2BAS A;  3F1P A;  2QHK A;  2VV7 A;  2VV6 A;  1T18 A;  2PDR A;  3H82 B;  4HP9 A;  1UWP X;  3A0R A;  3IS2 B;  3B33 A;  4NXF A;  1VB6 A;  1TS6 A;  5F69 A;  5TBM B;  3MXQ A;  4DJ2 A;  4EEP A;  1OTI A;  4F3L A;  1N9L A;  1OT6 A;  3H7W A;  5HD5 A;  1NWZ A;  2HV1 A;  2GJ3 A;  2PYP A;  3F1O A;  4KUO A;  4NXE A;  4WL9 A;  1V9Y A;  4HNB A;  5DJT A;  1KOU A;  1XFQ A;  4XT2 A;  2OWH A;  1OTD A;  3BY9 A;  3LID A;  3NOU C;  4HJ3 A;  5F68 A;  5IU1 A;  4EET B;  3RH8 B;  5I5L A;  3UB6 A;  4EXO A;  1OTE A;  1D06 A;  4GS9 A;  1S4R A;  1S67 L;  4GHI B;  4GHI A;  5HDD A;  2K7S A;  5G4Z A;  2QWS A;  1T19 A;  3CAX A;  3OLO A;  3HJK A;  4HY8 A;  3LI8 A;  1V9Z A;  2A24 B;  1TS7 A;  5KIZ A;  3G6O A;  2PR6 A;  3H9W A;  3K3D A;  4JGP A;  5TBM A;  4DJ3 A;  5AVF A;  3GDI A;  3IBR A;  4L9E A;  3ICY A;  4L9F A;  5J4E A;  4KUK A;  2YKH A;  3LYX A;  4NXG A;  1EW0 A;  3ZQ5 A;  1TS0 A;  1F98 A;  3K3C A;  3MR0 A;  1OJG A;  5J3W A;  4H6J B;  2A24 A;  1ODV A;  3UME A;  4EW7 A;  4R6L A;  1LL8 A;  3P7N A;  2W27 A;  3F1P B;  3NHQ A;  4GS9 B;  3LIA A;  4MN5 A;  5F5Y A;  3EWK A;  1GSX A;  4HHD A;  4WUJ A;  4HOI A;  5J7E A;  3FG8 A;  3LIC A;  1T1B A;  5DKK A;  4BBT A;  2Z6C A;  2QJ7 A;  5G4Y A;  3LUQ A;  2H28 A;  4E04 A;  1MZU A;  2PHY A;  2EA9 A;  1F9I A;  2ZOI A;  2V0U A;  1GSV A;  1JNU A;  3NJA A;  4GW9 A;  3F1N B;  2WKQ A;  2Z6D A;  4LPZ A;  5HWV A;  5HSQ A;  3MQO A;  3UMD A;  4LRZ E;  1DP8 A;  1DP6 A;  2ZBB A;  4HI4 A;  4WLA A;  5HWW A;  1D7E A;  1XFN A;  2D02 A;  3VOL A;  2I9V A;  1XJ2 A;  4YWZ A;  3MJQ A;  4EQ1 A;  1DP9 A;  3A0S A;  2L0W A;  3F1N A;  3UB8 A;  3C8C A;  3E4O A;  4EER A;  1S1Y A;  3IS2 A;  4BBU A;  5HD3 A;  4EEU A;  3SW1 A;  1X0O A;  2OOL A;  3PYP A;  4JGR A;  4R38 A;  5HWT A;  3LI9 A;  1LSV A;  1S1Z A;  2JN7 A;  2V1B A;  3LIB A;  1TS8 A;  4HJ6 A;  4I3I A;  4K08 A;  4R70 A;  5AVE A;  1T1C A;  3RTY A;  3E4P A;  5HZH A;  1N9O A;  4I5S A;  2D01 A;  3MFX A;  2ZOH A;  4HIA A;  2PD7 A;  3C2W A;  3HJI A;  3ULF A;  1DRM A;  2KDK A;  4M4X A;  3CWF A;  4F3L B;  1UWN X;  2QJ5 A;  4HH3 A;  4HQA A;  3NOP C;  3BWL A;  1XJ3 A;  4MN6 A;  5DKL A;  4BBV A;  4I3A A;  5F6A A;  1N9N A;  2WKP A;  3EEH A;  4PKY A;  2VV8 A;  2OWJ A;  3H82 A;  1S66 L;  2KX6 A;  2VLG A;  1LSW A; 
#chains in the Genus database with same CATH topology
 3CI6 A;  1KE0 A;  2P7J A;  4RQ9 A;  1ZG4 A;  3G34 A;  5EM1 A;  2R78 A;  2ZD8 A;  5IHV A;  4WEK A;  5EUA A;  3UB7 A;  4PHT A;  3HCY A;  4F94 A;  2W3H A;  1P97 A;  4P87 A;  5TFQ A;  1P0Z A;  1K55 A;  1ESU A;  4I38 A;  4MEZ A;  1K25 A;  4I3J A;  1HD8 A;  1F5M A;  2W1R A;  3UNW A;  5HFO A;  5DVA A;  5CGS A;  4UA6 A;  3P09 A;  1W63 Q;  1WYC A;  1KOU A;  1XFQ A;  3BY9 A;  3QNB A;  4R3J A;  2A49 A;  1K54 C;  4JXW A;  3Q07 A;  4GLQ A;  1GHP A;  4Z9Q A;  1OJG A;  5GLC A;  3V3S A;  3ZYT A;  3BEB A;  3UO9 A;  3C5A A;  4MN5 A;  3QNC A;  1GSX A;  5EE8 A;  2WGW A;  2AVX A;  2V8F A;  4E6W A;  3W8K A;  5E2E A;  1YSP A;  2H28 A;  1KGE A;  3ZQ5 A;  1GSV A;  1ZKJ A;  3F1N B;  2V2F F;  5FL3 A;  1IOU A;  5L2F A;  1OPX A;  4KQQ A;  5AQB A;  3LGO A;  3ZVW A;  3IHB A;  1XA7 A;  3E4O A;  3CUE C;  3PYP A;  3LIB A;  2V1B A;  1CEG A;  2XF3 A;  2IWD A;  3HJI A;  3ULF A;  3FKV A;  5CX7 A;  3LR3 A;  2DRW A;  3Q81 A;  3ZG7 B;  3EEH A;  2VV8 A;  1MWT A;  4BD1 A;  3C7U A;  3CIT A;  1OJ5 A;  4JGQ A;  3UE6 A;  1IKI A;  5KSC A;  3W4O A;  2EX9 A;  3GMW A;  3G4P A;  3PR6 A;  1IFQ A;  2YKF A;  4MDZ A;  4NG2 A;  3PBQ A;  1TEM A;  2WKR A;  4D60 A;  3B47 A;  2QKP A;  4NXB A;  2JKR M;  3OC2 A;  4KQD A;  4IVK A;  3CHW P;  1HLU P;  4LRX C;  3NBL A;  1W8Q A;  2ZQD A;  5A93 A;  1UWP X;  1TDL A;  4NXF A;  5TBM B;  1CI8 A;  1OT6 A;  1PWD A;  1N9B A;  4WMC D;  4X6T A;  3VP0 A;  4HNB A;  1YLT A;  2O9C A;  2G2U A;  4QPR A;  4GHI A;  2Y2P A;  2JE5 A;  3Q82 A;  4HY8 A;  3PBN A;  3B3X A;  1ERQ A;  3GDI A;  4KUK A;  3LYX A;  4IHQ A;  3V39 A;  4O0P A;  2LB9 A;  4JF4 A;  2PBD P;  3KSI A;  4OPQ A;  5FDH A;  1YLZ A;  3T4Q A;  1PWC A;  4BLM A;  5FAS A;  2G7U A;  3PBR A;  3QP2 A;  2EA9 A;  1DJA A;  4GW9 A;  3NJA A;  2H0T A;  3BFD A;  4LRZ E;  3VOL A;  2I9V A;  2OLU A;  3NI9 A;  1JVJ A;  4P0M A;  4S2M A;  1Q2P A;  1H5X A;  4JXG A;  3Q7Z A;  2HP6 A;  4BJP A;  3ZGA B;  3H82 A;  4FSF A;  2W3D A;  2I72 A;  4MN7 A;  4PKY G;  5HAI A;  5HL6 A;  4EES A;  4L9G A;  2EWV A;  2VGL S;  3F1O B;  4R23 A;  5DFY A;  3ZG0 A;  5CER A;  3HBR A;  1IYQ A;  3UB9 A;  1CF0 A;  4MCW A;  5AQA A;  2V1Z A;  1E3U A;  5CEB A;  3G2Z A;  1FR1 A;  4XT2 A;  3VFF A;  2IWC A;  3OLO A;  1IEM A;  4KZ3 A;  3G6O A;  3AGE A;  3H9W A;  5CHU A;  1G6A A;  2XSS A;  1EW0 A;  4DXB A;  4WEL A;  4R6L A;  3M6H A;  5KZH A;  3VOY A;  4C3Q A;  1O7E A;  3S1Y A;  1MZU A;  2Z6D A;  3UMD A;  4OOM A;  1IYO A;  4ZRR A;  1YKD A;  1VET A;  4ZBE A;  4YOF A;  3KO6 A;  3NEC A;  3UB8 A;  3C8C A;  1JTG A;  3SW1 A;  1X0O A;  4JGR A;  3LI9 A;  5F83 A;  2XA7 S;  5IT5 A;  3PBS A;  4DDS A;  4ZJ1 A;  3BLS A;  1SKF A;  1O07 A;  3R4K A;  2KDK A;  4OON A;  3N8S A;  3A3J A;  2P04 A;  4UA9 A;  2KX6 A;  1ES5 A;  1K56 D;  3ZDJ A;  4X55 A;  2JHE A;  2JKR I;  1DJC A;  1E4D A;  4H6J A;  2W3F A;  3VSK A;  3IF6 A;  1YSQ A;  4BL2 A;  4S2I A;  5TR7 A;  3DTM A;  4LLO B;  2ZM8 A;  1MWS A;  1OTA A;  4PPR A;  1OT9 A;  3BM6 A;  2JKT I;  2P74 A;  3T4S A;  3NUL A;  3E2L A;  3VSL A;  1V9Y A;  1M6K A;  4R3B A;  4G3V A;  2EX2 A;  4KZ5 A;  1L2S A;  4S2J A;  5CED A;  3A3D A;  3GQZ A;  1MXO A;  5I94 A;  3CPT B;  2FFY A;  5KMW A;  1LI9 A;  3BFC A;  3O87 A;  5J4E A;  2ZM0 A;  3MR0 A;  4OOY A;  5J3W A;  2A24 A;  1ODV A;  4KQO A;  4O01 A;  3LIA A;  3GR2 A;  1J3W A;  3DWZ A;  2PBY A;  4BBT A;  4S2N C;  4E3O A;  5A92 A;  2ZBB A;  3UY6 A;  3VFH A;  1PWG A;  4KG5 A;  3F1N A;  3A3E A;  4E3I A;  2WAF A;  5EEC A;  1DY6 A;  4MMN A;  3HLE A;  1U60 A;  4Y3I A;  2K2N A;  1L0D A;  1UWN X;  3FPW A;  3CG5 A;  1YM1 A;  1PIO A;  3UE3 A;  3VE3 A;  1BLH A;  5HAQ A;  1J9M A;  3U2A A;  4B4X A;  1XJ6 A;  3MXS A;  1XJ4 A;  5HDC A;  4X56 A;  1TD5 A;  2VGJ A;  5FQQ A;  3MQQ A;  3OZH A;  5LBR A;  5IS1 A;  1ERO A;  1ONH A;  4GD6 A;  4M3K A;  1VQQ A;  3E2K A;  2BAS A;  4DMZ A;  2EWW A;  5EOE A;  3B33 A;  5F82 A;  4WM9 A;  1JWP A;  3H7W A;  1FSW A;  4U0T A;  1ZC2 A;  4GKU A;  3ZHH A;  2OWH A;  1LHY A;  5IU1 A;  3IXG A;  4BQM A;  3NC8 A;  5FEF A;  3MFD A;  5DF8 A;  3MS6 A;  1BSG A;  3LEQ A;  1PNE A;  2PT7 A;  4Q0H A;  5GHZ A;  2WYX A;  3C7V A;  3SH9 A;  3QP6 A;  4X68 A;  3F1P B;  4R4R A;  4HBT A;  2WKE A;  2OV5 A;  1T1B A;  2QMI A;  3HUM A;  1KE4 A;  4P6Z S;  4DDY A;  3HLC A;  4ARZ B;  3S22 A;  1I2W A;  3VOZ A;  4FD8 A;  1D1J A;  2ACG A;  4KQR A;  2BTF P;  3IS2 A;  5HWT A;  1Y4O A;  5DFX A;  4K08 A;  3JPU A;  4JXV A;  3ZG9 B;  3KSG A;  5CGX A;  3LEZ A;  1FIL A;  2CC1 A;  1NZO A;  2VGK A;  3NOP C;  4HQA A;  1OME A;  3HL9 A;  1LSW A;  3VP2 A;  3WS4 A;  4DN0 A;  4CLC B;  3CMZ A;  1S6R A;  1W5D A;  3QP4 A;  4GCZ A;  4MBK A;  3IBJ A;  4QWO A;  5CGW A;  1FOF A;  5JYO A;  3AGD A;  1L0F A;  2Y2L A;  4IBR A;  5FQK A;  2Y59 A;  1AXB A;  5L10 A;  1LLB A;  2X71 A;  3V3R A;  3PXP A;  3TE8 A;  3M2K A;  3T4O A;  2VA0 A;  3T1R A;  1ONG A;  4P6Z M;  1TDG A;  4EUV A;  4C6Y A;  3MZF A;  4CLC C;  5E2H A;  4CPK A;  4FOF A;  5FAQ A;  3OCL A;  3G2Y A;  3UB6 A;  1W7F A;  1MWR A;  3DWK A;  4GHI B;  2LB5 A;  4EQI A;  1TVF A;  5EVL A;  1YMX A;  5FQJ A;  2EFX A;  2O99 A;  2J3T D;  4NET A;  3KSH A;  3HLD A;  3P98 A;  3EGD C;  4Q0J A;  4R4S A;  5DKK A;  2QJ7 A;  1GHI A;  1XXM A;  3MQ0 A;  5DTK A;  4HI4 A;  3DBA A;  2ZMF A;  3BLM A;  1H3Q A;  2A3U A;  1C3B A;  3HLW A;  2HPB A;  3GVB A;  4Q8I A;  4OP5 A;  4MLL A;  1P9R A;  2ZQ9 A;  2ZOH A;  3IWO A;  2WKH A;  4PAU A;  2XA7 M;  1K4E A;  1PFL A;  2PU2 A;  2Q9N A;  4I39 A;  4Y0T A;  1MBL A;  4IVI A;  2L1M A;  4R3A A;  3RXW A;  3IXD A;  3BEC A;  3NDG A;  2GNX A;  3UPN A;  5HAR A;  2EXB A;  3MKE A;  3V50 A;  2M1C A;  3ZVT A;  3PBO A;  1L0G A;  1ESI A;  4A5R A;  2ZLY A;  2PR5 A;  3A3I A;  1HZO A;  3IX8 A;  2JKF A;  5FI6 A;  4RX3 A;  3A3F A;  3N8R A;  4DE3 A;  2INW A;  2VK3 A;  1WYB A;  1K54 A;  1G6O A;  2ZMA A;  1PYY A;  2Y2G A;  4LFU A;  1YT4 A;  1TS6 A;  5F69 A;  3UPO A;  1OTI A;  2FH5 A;  3UDF A;  4ZDX A;  2GJ3 A;  2HJE A;  1NXY A;  2HP9 A;  2PYP A;  4KUO A;  4Y2F A;  2J7V A;  2ZL1 B;  4KZ8 A;  3IXB A;  1NRF A;  2QWS A;  3CJM A;  1VM1 A;  1I2S A;  4NKP A;  4FTX A;  2RCX A;  4KEN B;  3ICY A;  4L9F A;  4ETZ A;  3RFB A;  5FI2 A;  3UME A;  1BLP A;  2ZC5 B;  4MBH A;  4GS9 B;  4XUZ A;  1CI9 A;  2H10 A;  3CUE A;  3KYQ A;  4HOI A;  4Y17 A;  3FG8 A;  4Y5F A;  2EX8 A;  4WN5 A;  1XGJ A;  3GV9 A;  1DP8 A;  1NYM A;  2MJ6 A;  5E43 A;  4ZJ2 A;  2UV0 E;  5CRF A;  3KYE A;  2QPN A;  3MZE A;  2Q0O A;  4HEF A;  4IBX A;  1LSV A;  4EV4 A;  2WUQ A;  2Y2Q A;  3ZG5 A;  4O8G A;  2J8Y A;  2OWJ A;  1NZU A;  2VLG A;  3T4J A;  2Y4A A;  3SS4 A;  1RCJ A;  3HLB A;  3PHY A;  2FZ0 A;  2OAQ 1;  4O7D A;  5EFW A;  3V67 A;  2Z2M B;  3N7W A;  3LR0 A;  3UE0 A;  4UEY A;  3RXX A;  4CJN A;  2O9B A;  2VEA A;  1DJB A;  4HH2 A;  5EVI C;  1CQA A;  4LV1 A;  1K38 A;  1NLY A;  3T4L A;  2XRO A;  5GLB A;  5CHM A;  4KG6 A;  3T1Q B;  3IX3 A;  3WS2 A;  3ITB A;  1ALQ A;  3OPH A;  3RH8 B;  2RL3 A;  5I5L A;  4S2N A;  5HL1 A;  1EWZ A;  3D4F A;  1SKO A;  5CHJ A;  5FQM A;  2Y2M A;  3ITA A;  3VV4 A;  4AFI A;  4OPZ A;  3UB5 P;  2BG1 A;  2NUP C;  3BJN A;  2GDN A;  3LIC A;  5DF9 A;  4EBN A;  1F9I A;  1STZ A;  3MQO A;  3IF6 B;  2HZ5 A;  2D02 A;  4LCM A;  3UN7 A;  4KZ9 A;  4OVD A;  4KZ6 A;  4EER A;  1S1Y A;  4QD4 A;  3Q1F A;  5HPI A;  4CLC A;  1XKZ A;  3LO7 A;  1N9O A;  3MFX A;  4X69 A;  3LR4 A;  5FEG A;  3IWQ A;  4F3L B;  4WEJ A;  1SHV A;  4GB7 A;  1ES3 A;  4S2P A;  2WKP A;  2ZQ8 A;  4PM5 A;  2J9O A;  1M40 A;  3S7P A;  1YQS A;  3KX0 X;  3GSG A;  2HJ9 C;  4Y0O A;  3C4P A;  1Y28 A;  3G30 A;  2PYR A;  3BY8 A;  4RVA A;  4DRT A;  3TOI A;  2Y2H A;  4WYY A;  5HPF A;  2ZQC A;  1ACF A;  1WA9 A;  2V9A A;  3L7H A;  3GEC A;  5K5B A;  4OLD A;  2ZJ9 A;  3C38 A;  2XEP A;  2W3G A;  1IEL A;  3ISG A;  3T1X A;  5HW3 A;  2ZMV A;  5GLA A;  4OQI A;  4OOL A;  4GS9 A;  1S4R A;  1ERM A;  2K7S A;  3BRM A;  3IQA A;  4OQ0 A;  1T19 A;  3HJK A;  2A24 B;  4CQH A;  4JGP A;  2PR6 A;  1K55 C;  3KYZ A;  3FKW A;  1F98 A;  2C6W B;  4H8R A;  2XD1 A;  5FAT A;  2WGW B;  1LL9 A;  2Z6C A;  3LUQ A;  4JLF A;  4K0X A;  2V0U A;  3PTE A;  3WWX A;  4ARZ A;  5AJG A;  4LV2 A;  4GOG A;  5HWW A;  1XJ2 A;  2UWX A;  3EEA A;  2XFS A;  1TS8 A;  1Y54 A;  4HIA A;  2PD7 A;  3TG9 A;  1XJ3 A;  4I3A A;  2JBF A;  4D2O A;  3MSH A;  2Y8H A;  3QP8 A;  1PRQ A;  4B9O A;  5GHY A;  4GN2 A;  3ZNT A;  4XT2 B;  2CMN A;  3D72 A;  4IUH A;  2VGL M;  3TSG A;  3UDI A;  5DJU A;  3GRJ A;  3T12 B;  1FQG A;  4WF0 A;  3MBZ A;  4K0W A;  3OPP A;  2B02 A;  2J3T C;  4X1L A;  1G68 A;  1FSY A;  4IUK A;  3EQU A;  5L09 A;  5DJT A;  3T50 A;  3OOV A;  4FH2 A;  1AWI A;  3VP1 A;  5DTS A;  5HDD A;  2QZ6 A;  3LI8 A;  2DNS A;  4S2L A;  5KIZ A;  2ZC4 B;  2ZL1 A;  3EGX C;  3K3D A;  5AVF A;  3IBR A;  4DE1 A;  4R0Q A;  2XD5 A;  1XX2 A;  3DTI A;  2Y2O A;  4DXC A;  3VP4 A;  4XUX A;  4S2K A;  2E8I A;  2O0Y A;  2HDR A;  2PHY A;  4LPZ A;  5HWV A;  5E2F A;  3TW8 A;  2JKT M;  4JF5 A;  3IX4 A;  1RP5 A;  1DP9 A;  4BBU A;  2M7V A;  2B18 A;  2M7U A;  2X01 A;  2X02 A;  1GA0 A;  3RTY A;  5AVE A;  4UHU A;  4BMW A;  1BTL A;  1FCO A;  5HX9 A;  3BYD A;  2EX6 A;  1FCM A;  1YPR A;  4JBF A;  1L3L A;  4JGO A;  3SH8 A;  1YLP A;  3R7W B;  1NRJ A;  1BYW A;  1UGU A;  5A91 A;  1K6S A;  1ES2 A;  3UPP A;  1KDS A;  4N1X A;  5A8B A;  3HVF A;  1S4S A;  3LIF A;  4HP4 A;  2W3E A;  3H7W B;  4LRY C;  2HF6 A;  5AQ7 A;  3TRC A;  5EVI D;  3CLO A;  2Z2L B;  4UAA A;  3H82 B;  3PAG A;  3A0R A;  3IS2 B;  1N4O A;  5HD5 A;  2HDU A;  2HV1 A;  3O3V A;  1JWZ A;  3C4O A;  3GTC A;  1E25 A;  2G2W A;  4YFM A;  5G4Z A;  4GNU A;  2ZQ7 A;  1MKI A;  4BL3 A;  4L9E A;  4NXG A;  3LR5 A;  4EW7 A;  1Z6F A;  1G5U A;  3S7N A;  1JWV A;  3HUO A;  3NHQ A;  5F5Y A;  3EWK A;  2WAE A;  5FAO A;  5J7E A;  1Q2Q A;  1CK3 A;  4Y15 A;  4E3L A;  4R1G A;  4PM6 A;  5HSQ A;  1LL5 A;  1D7E A;  5F1G A;  2XQZ A;  3DAV A;  4EQ1 A;  4QJG A;  1XP4 A;  1CEF A;  5HD3 A;  1YLW A;  3VMA A;  5CEC A;  5M19 A;  4I3I A;  2JN7 A;  4HJ6 A;  3BFG A;  4PMA A;  1BLC A;  2QJ5 A;  5FQ9 A;  3ZG8 B;  5EM0 A;  4JF6 A;  3LIE A;  3M2J A;  3IT9 A;  1XA1 A;  3MKF A;  2XDM A;  3E4Q A;  1FCN A;  3VE4 A;  1LSX A;  3QHY A;  4X1M A;  3SOI A;  1FIK A;  5M1A A;  5HAP A;  3DW0 A;  1HTZ A;  4OPY A;  2VJW A;  3NCK A;  3SS5 A;  4HJ4 A;  2W1T A;  4UQI M;  3N8L A;  4GDB A;  4HP9 A;  1F2K A;  4OKP A;  1I5Q A;  1VB6 A;  4EEP A;  1N9L A;  2ZM2 A;  4ZJ3 A;  1SDN A;  3NOU C;  3MXR A;  2Y91 A;  2GX5 A;  3WS5 A;  1D06 A;  1PI4 A;  1S67 L;  5E2G A;  5FQI A;  4S2O A;  3IH8 A;  2Y55 A;  3D9Y A;  1V9Z A;  3IXH A;  3WS1 A;  4LCL A;  1H8M A;  2ZQA A;  2XH9 A;  4RX2 A;  5CTN A;  1ZHH B;  1LL8 A;  1PW1 A;  2W27 A;  1QMF A;  2WZX A;  3K2N A;  1KVL A;  5G4Y A;  4HES A;  1YAX A;  1MC0 A;  1VEU A;  3O88 A;  1YLY A;  3T4K A;  3OPL A;  2QYB A;  4WLA A;  1XFN A;  3N6I A;  1QME A;  3OPR A;  5GHX A;  4X53 A;  3MJQ A;  3OBF A;  2XR0 A;  2EFU A;  2Y2I A;  1T1C A;  4I5S A;  4E3M A;  4EU0 A;  1GA9 A;  4LGW A;  1DRM A;  3BWL A;  4MN6 A;  4BBV A;  4PKY A;  2H5S A;  1MY8 A;  3WRT A;  3BFE A;  4OQG A;  3TJZ C;  3RJU A;  2W0N A;  2HDQ A;  1PI5 A;  5HDS A;  2E8J A;  2Y2K A;  2PU4 A;  3M6B A;  5EOO A;  2BLS A;  4OLG A;  1G28 A;  2WKI A;  1IKG A;  4GZB A;  2V8C A;  2PRF A;  4Y7P A;  4QY6 A;  2V1A A;  3FC7 A;  3FYZ A;  3HLG A;  1S0W A;  2J80 A;  3F1P A;  3IH9 A;  1TF1 A;  3N4I A;  3SH7 A;  1NJ4 A;  2P9V A;  2IA2 A;  3FPV A;  4NXE A;  5BOH A;  4WL9 A;  4BEN A;  2WGI A;  3LID A;  1OTE A;  1XPB A;  1K57 C;  4X25 A;  3CAX A;  5EVI B;  4N92 A;  5CTM A;  4MNR A;  1ZTU A;  4N9L A;  4EBL A;  3K3C A;  4JKT A;  4JPM A;  2C5W B;  4DE2 A;  4H6J B;  1NY0 A;  2O9A A;  3MZD A;  1KVM A;  5TGF A;  4QB8 A;  3HLF A;  4Y13 A;  4GJ4 A;  2JC7 A;  4E04 A;  3CPT A;  2ZC6 B;  2OSU A;  4FH4 A;  2Q9M A;  4LV3 A;  4P85 A;  3U4L P;  1CJF A;  1YMS A;  1K6R A;  2WAD A;  3O5Y A;  1Z09 A;  2OOL A;  1IYP A;  3BQA A;  2J9P A;  3JYI A;  4IED A;  4OP8 A;  2Y2J A;  4PM9 A;  1PZP A;  3ZCZ A;  1VEU B;  3IF6 C;  3E98 A;  1MWU A;  1YLJ A;  4N1H A;  3T4T A;  5J8X A;  1K4F A;  4KZ4 A;  5FDS A;  2IWB A;  1PZO A;  1PW8 A;  4B4Z A;  5D3O A;  1HVB A;  1NLZ A;  4P6B A;  4DKI A;  1H8Y A;  4CLC D;  3LCE A;  1H8Z A;  3AGF A;  4OQH A;  5F1F A;  2OLV A;  2V0W A;  2QHK A;  4FCF A;  3JVV A;  3T1S A;  2XFT A;  5DF7 A;  4DJ2 A;  3MXQ A;  3W4Q A;  5JYP A;  2A2L A;  3MF0 A;  3FV7 A;  3S7Q A;  1BUL A;  5F68 A;  5FSR A;  3WS0 A;  5L07 A;  4GDN A;  4EBP A;  2K31 A;  1TS7 A;  2GZA A;  2J3W A;  2XLN A;  4DF6 A;  1ES4 A;  2YKH A;  2DCF A;  1TS0 A;  4UQI S;  2OAP 1;  5EVE A;  3P7N A;  4IJG A;  2WGV A;  5AQ9 A;  1E3U D;  4N9K A;  4WZ4 A;  1IYS A;  1SKO B;  1W79 A;  4ME4 A;  1BLS A;  1GCE A;  1LI0 A;  3C30 A;  2EXA A;  4EWF A;  4B93 A;  4YWZ A;  4BWI A;  1VHM A;  4PM7 A;  4DE0 A;  4Z1W A;  3E4P A;  5HZH A;  4NEE D;  1KDW A;  2D01 A;  4KG2 A;  2JKG A;  5DKL A;  5CXW A;  4ETX A;  3BW6 A;  3C2W A;  2W1T B;  1K57 A;  5GLD A;  3IHA A;  4WBG A;  3QP5 A;  2KOI A;  1L0E A;  2HGV A;  4ZAM A;  3ZNY A;  1GSW A;  4KZ7 A;  4WZ5 C;  1ZG6 A;  4U0X A;  1K0K A;  3S4X A;  4E3J A;  2WZZ A;  4WMC A;  4RYE A;  2R9X A;  1T1A A;  4E3K A;  3UDX A;  3A0V A;  4KZB A;  1H0M A;  5TJJ A;  2L4R A;  3SS3 A;  3B42 A;  4NK3 A;  1W63 M;  4BD0 A;  2R9W A;  2VV6 A;  1SDE A;  2PDR A;  4G3K A;  2KLI A;  4OPR A;  1K56 A;  4ID4 A;  2XRN A;  3LY3 A;  1NWZ A;  5GL9 A;  4RA7 A;  1P9W A;  1JTD A;  3E0Y A;  1OTD A;  1BUE A;  4ZTK A;  2NUT C;  4E6X A;  4EXO A;  2VKS A;  5FAP A;  3V5M A;  5EPH A;  5DTT A;  4G3W A;  4ESP A;  3PBT A;  3SZT A;  1BT5 A;  5C5K A;  4QHC A;  4JXS A;  3HRE A;  3S7O A;  4HBU A;  3G32 A;  4PM8 A;  4WUJ A;  4HHD A;  4UA7 A;  3UE1 A;  3BQ8 A;  2DMW A;  2V20 A;  2ZOI A;  3L9K A;  4LEN A;  1JNU A;  1RGY A;  5M18 A;  3DTE A;  3WRZ A;  3MMH A;  1DP6 A;  1VET B;  2ZC7 A;  4C75 A;  4QU3 A;  4XXR A;  3OCN A;  2L0W A;  3G31 A;  3LY4 A;  1KGF A;  4EEU A;  2FFF B;  4L0L A;  4R70 A;  4E3N A;  1KE3 A;  3O86 A;  3ZFZ A;  1W8Y A;  4M4X A;  2B95 A;  4HH3 A;  4QY5 A;  1N9N A;  2VZW A;  4Q0I A;  3VP3 A;  4YNR A;  4KZA A;  3I7J A;  4U3T A;  1NYY A;  3QP1 A;  1LT0 A;  1OTB A;  3NIA A;  3NOT C;  2P9V B;  3IWI A;  3P01 A;  1GHM A;  3W2Z A;  3PAE A;  3LFV A;  3KSF A;  5L8M A;  5G18 A;  2PAV P;  3FWL A;  2PD8 A;  5FI7 A;  2VV7 A;  1WE4 A;  1T18 A;  3JVU A;  1SCW A;  3IF5 A;  2HDS A;  4OH0 A;  4F3L A;  1MKM A;  1EI5 A;  3F1O A;  2H0Y A;  4FUW A;  3HUN A;  4K91 A;  4EET B;  4HJ3 A;  2HP5 A;  3Q7V B;  1SZV A;  4CLC E;  2XK1 A;  3BFF A;  4MBF A;  5TBM A;  4EUZ A;  4DJ3 A;  2JCH A;  5A90 A;  1BZA A;  1XGI A;  5EV0 A;  3D3O A;  5EVI A;  3EOI A;  1A0K A;  1MPL A;  3W4P A;  1FR6 A;  3G35 A;  2P08 A;  3EQV A;  2XGN A;  4WZ5 A;  2WKQ A;  3NY4 A;  3Q7V A;  2Y2N A;  3DTK A;  4B88 A;  5MC7 A;  3A0S A;  4Y0U A;  5U47 A;  2Y79 A;  1RGZ A;  2VX8 A;  3FZC A;  2B5R A;  2ZC3 B;  4R38 A;  4YIN A;  5KSH A;  1S1Z A;  3R7W A;  3CZD A;  1KGG A;  3NDE A;  4LV0 A;  2WK0 A;  3CWF A;  4GD8 A;  5FA7 A;  5F6A A;  4II7 A;  1S66 L; 
#chains in the Genus database with same CATH homology
 3UE3 A;  3KX0 X;  3CI6 A;  3VE3 A;  3TJZ C;  2HJ9 C;  2P7J A;  2W0N A;  4RQ9 A;  3U2A A;  1Y28 A;  2R78 A;  5HDS A;  4WEK A;  1XJ6 A;  2PYR A;  3BY8 A;  3UB7 A;  4PHT A;  3HCY A;  2W3H A;  1XJ4 A;  5HDC A;  1G28 A;  1TD5 A;  5HPF A;  3MQQ A;  5LBR A;  1WA9 A;  1P97 A;  5IS1 A;  1P0Z A;  2V9A A;  2V1A A;  3FC7 A;  3GEC A;  5K5B A;  4I38 A;  4I3J A;  3C38 A;  2J80 A;  2BAS A;  3F1P A;  1F5M A;  2W3G A;  1TF1 A;  2W1R A;  2EWW A;  4DMZ A;  3B33 A;  2IA2 A;  3H7W A;  3FPV A;  1W63 Q;  4NXE A;  4WL9 A;  1KOU A;  1XFQ A;  2OWH A;  3BY9 A;  3LID A;  5IU1 A;  2ZMV A;  4OOL A;  1OTE A;  4GS9 A;  1S4R A;  2K7S A;  1T19 A;  3CAX A;  3HJK A;  2A24 B;  4GLQ A;  4CQH A;  4JGP A;  2PR6 A;  2PT7 A;  1ZTU A;  3KYZ A;  4Q0H A;  1F98 A;  3K3C A;  1OJG A;  4H6J B;  3ZYT A;  2O9A A;  3F1P B;  4MN5 A;  1GSX A;  1T1B A;  2Z6C A;  4GJ4 A;  3LUQ A;  1YSP A;  2H28 A;  4E04 A;  4P6Z S;  3ZQ5 A;  2V0U A;  1GSV A;  3F1N B;  4ARZ B;  5FL3 A;  4ARZ A;  5AJG A;  1IOU A;  5HWW A;  1OPX A;  1XJ2 A;  3E4O A;  3O5Y A;  3CUE C;  3IS2 A;  3PYP A;  2OOL A;  3EEA A;  5HWT A;  3BQA A;  5DFX A;  3LIB A;  2V1B A;  4K08 A;  1TS8 A;  4HIA A;  2PD7 A;  3KSG A;  3HJI A;  3ULF A;  5CX7 A;  3LR3 A;  4HQA A;  3NOP C;  1XJ3 A;  4I3A A;  3EEH A;  3E98 A;  2VV8 A;  1LSW A;  3CIT A;  1OJ5 A;  3T4T A;  4DN0 A;  4JGQ A;  2Y8H A;  3UE6 A;  4CLC B;  4B9O A;  1NLZ A;  4XT2 B;  2CMN A;  4GCZ A;  3D72 A;  4IUH A;  2VGL M;  3IBJ A;  3PR6 A;  1IFQ A;  2YKF A;  4MDZ A;  3PBQ A;  4CLC D;  2WKR A;  3B47 A;  2QKP A;  5DJU A;  4NXB A;  2JKR M;  3OC2 A;  4KQD A;  4LRX C;  4WF0 A;  2V0W A;  2B02 A;  2QHK A;  3PXP A;  3JVV A;  3TE8 A;  2J3T C;  1UWP X;  4NXF A;  5TBM B;  3T4O A;  4DJ2 A;  3MXQ A;  2A2L A;  2VA0 A;  1OT6 A;  3MF0 A;  4IUK A;  4P6Z M;  3S7Q A;  3EQU A;  4EUV A;  4CLC C;  4HNB A;  5DJT A;  3T50 A;  3OOV A;  2O9C A;  5F68 A;  4FOF A;  3OCL A;  3UB6 A;  4GHI B;  4QPR A;  2LB5 A;  4GHI A;  5HDD A;  2K31 A;  4HY8 A;  3LI8 A;  1TS7 A;  2GZA A;  3PBN A;  3EGX C;  2J3W A;  3K3D A;  5KIZ A;  5AVF A;  3GDI A;  2O99 A;  3IBR A;  2J3T D;  4KUK A;  2YKH A;  3LYX A;  4IHQ A;  1TS0 A;  4UQI S;  2OAP 1;  4O0P A;  2LB9 A;  3KSH A;  3P7N A;  3EGD C;  3KSI A;  4IJG A;  4Q0J A;  3T4Q A;  5DKK A;  2G7U A;  2QJ7 A;  2O0Y A;  3PBR A;  2PHY A;  2EA9 A;  4GW9 A;  4ME4 A;  4LPZ A;  3MQ0 A;  3NJA A;  5HWV A;  4LRZ E;  3TW8 A;  3C30 A;  2JKT M;  4HI4 A;  3DBA A;  3VOL A;  2ZMF A;  4B93 A;  2I9V A;  4YWZ A;  4BWI A;  1DP9 A;  1VHM A;  1H3Q A;  4BBU A;  2M7V A;  2B18 A;  2M7U A;  4Z1W A;  3RTY A;  5AVE A;  4BMW A;  1P9R A;  3E4P A;  5HZH A;  4NEE D;  2D01 A;  2ZOH A;  4PAU A;  5DKL A;  4BJP A;  2XA7 M;  3H82 A;  4FSF A;  4ETX A;  3BW6 A;  2W3D A;  3C2W A;  2W1T B;  4I39 A;  4MN7 A;  2KOI A;  4JGO A;  4PKY G;  2L1M A;  3R7W B;  1NRJ A;  1BYW A;  1UGU A;  4R3A A;  2HGV A;  2GNX A;  5HL6 A;  5A8B A;  2M1C A;  4EES A;  1GSW A;  1S4S A;  3LIF A;  4L9G A;  3PBO A;  2EWV A;  2VGL S;  3F1O B;  2PR5 A;  4HP4 A;  2W3E A;  3H7W B;  4LRY C;  2HF6 A;  5DFY A;  3TRC A;  1T1A A;  3A0V A;  5TJJ A;  2L4R A;  3UB9 A;  2INW A;  3CLO A;  3B42 A;  1W63 M;  1G6O A;  2VV6 A;  4MCW A;  3H82 B;  2PDR A;  4G3K A;  3A0R A;  3IS2 B;  2KLI A;  5F69 A;  1TS6 A;  1OTI A;  2FH5 A;  5HD5 A;  2XRN A;  1NWZ A;  2HV1 A;  2GJ3 A;  2HJE A;  2PYP A;  4KUO A;  1P9W A;  4Y2F A;  3E0Y A;  4XT2 A;  1OTD A;  2NUT C;  4EXO A;  2VKS A;  5G4Z A;  2QWS A;  3OLO A;  4G3W A;  3G6O A;  3H9W A;  4NKP A;  3PBT A;  4L9E A;  3ICY A;  4L9F A;  4ETZ A;  4NXG A;  2XSS A;  1EW0 A;  3RFB A;  3LR5 A;  5C5K A;  4EW7 A;  3UME A;  4WEL A;  4R6L A;  3S7N A;  3S7O A;  3NHQ A;  4GS9 B;  5F5Y A;  3EWK A;  4WUJ A;  3CUE A;  3KYQ A;  4HHD A;  4HOI A;  5J7E A;  3BQ8 A;  3FG8 A;  4Y5F A;  2DMW A;  1MZU A;  2ZOI A;  4WN5 A;  1JNU A;  2Z6D A;  5HSQ A;  3UMD A;  4OOM A;  1DP8 A;  1YKD A;  3MMH A;  1DP6 A;  2MJ6 A;  4ZRR A;  1D7E A;  4YOF A;  4EQ1 A;  3OCN A;  2L0W A;  3KO6 A;  3UB8 A;  3C8C A;  4EEU A;  5HD3 A;  3SW1 A;  1X0O A;  4JGR A;  4L0L A;  3LI9 A;  1LSV A;  2JN7 A;  2XA7 S;  3PBS A;  4HJ6 A;  4I3I A;  4R70 A;  5IT5 A;  4O8G A;  3R4K A;  2KDK A;  4M4X A;  2QJ5 A;  4HH3 A;  2P04 A;  1N9N A;  2VZW A;  4Q0I A;  4YNR A;  2OWJ A;  2KX6 A;  2VLG A;  3T4J A;  3LIE A;  3E4Q A;  2JHE A;  2JKR I;  3VE4 A;  1LT0 A;  1LSX A;  1OTB A;  3PHY A;  4H6J A;  2W3F A;  3NOT C;  2FZ0 A;  2OAQ 1;  5EFW A;  3V67 A;  3LR0 A;  1YSQ A;  3P01 A;  4UEY A;  2O9B A;  3W2Z A;  2VEA A;  3LFV A;  3KSF A;  5L8M A;  4LLO B;  2VJW A;  4HH2 A;  1OTA A;  4HJ4 A;  1OT9 A;  2PD8 A;  2JKT I;  2W1T A;  4UQI M;  3T4S A;  2VV7 A;  1NLY A;  1T18 A;  4HP9 A;  3JVU A;  3T4L A;  1VB6 A;  2XRO A;  4EEP A;  4F3L A;  1N9L A;  1MKM A;  3F1O A;  1V9Y A;  4EET B;  4G3V A;  3NOU C;  4HJ3 A;  3RH8 B;  2GX5 A;  5I5L A;  4CLC E;  1D06 A;  1S67 L;  1V9Z A;  5TBM A;  4DJ3 A;  5J4E A;  3VV4 A;  1H8M A;  3MR0 A;  4AFI A;  5J3W A;  2A24 A;  1ODV A;  3D3O A;  4KQO A;  1ZHH B;  3EOI A;  1LL8 A;  4O01 A;  2W27 A;  2NUP C;  3LIA A;  3BJN A;  3K2N A;  3LIC A;  4BBT A;  2P08 A;  5G4Y A;  1YAX A;  3EQV A;  5DF9 A;  1MC0 A;  1F9I A;  2WKQ A;  3T4K A;  1STZ A;  3MQO A;  2QYB A;  2ZBB A;  4WLA A;  1XFN A;  2D02 A;  5MC7 A;  3MJQ A;  3A0S A;  3OBF A;  3F1N A;  2Y79 A;  4EER A;  1S1Y A;  4R38 A;  2VX8 A;  5HPI A;  5KSH A;  4CLC A;  1S1Z A;  3R7W A;  1T1C A;  1N9O A;  4I5S A;  3MFX A;  3LR4 A;  4MMN A;  4EU0 A;  4Y3I A;  1DRM A;  2K2N A;  3CWF A;  4F3L B;  1UWN X;  4WEJ A;  3BWL A;  3FPW A;  4MN6 A;  4BBV A;  5F6A A;  2WKP A;  4PKY A;  4II7 A;  1S66 L;  3S7P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...